3HOHA

Ribonuclease t1 (thr93gln mutant) complexed with 2'gmp
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHQGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissection of the structural and functional role of a conserved hydration site in RNase T1.
pubmed rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
molecule keywords PROTEIN (RIBONUCLEASE T1)
total genus 27
structure length 104
sequence length 104
chains with identical sequence B, C, D
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1998-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 3hohA00
1B20A 1RGLA 2F5WA 1IYYA 1DETA 1X1XA 3AHWA 2F56A 1X1YA 1GMQA 1I8VA 1YGWA 1BAOA 1GOUA 1LOVA 2C4BA 1BNGA 1RTUA 3AGNA 2KF4A 1BSEA 4BU4A 1B2MA 2KAAA 3AHSA 1PY3A 1YNVX 1BNIA 1B21A 3D5GA 1JBTA 3KCHA 1BSDA 1I2GA 1LRAA 9RNTA 1YVSA 1BRKA 7RNTA 1DE3A 1FUTA 1RHLA 1I3IA 1GOYA 1UCJA 1TRQA 3BU4A 1RCLA 1RGKA 3SYUA 1RGCA 7GSPA 3AGOA 2KF3A 1I70A 1RNBA 2F5MA 5RNTA 1A2PA 1RN1A 2F4YA 2KF5A 3WHOA 4BIRA 1BNJA 1BSAA 1AY7A 1B2ZA 1RGEA 2BIRA 1BNRA 1FUSA 1X1UA 3DH2A 3URPA 5HOHA 1I0XA 1MGWA 2RBIA 1BRNL 3D4AA 1RNTA 1X1WA 1ZGXA 3A5EA 1I2EA 1PYLA 1RMSA 1I2FA 1R4YA 1I3FA 2SARA 1BSBA 1GMPA 1Q9EA 2RNTA 1FW7A 1B2SA 1RSNA 5BIRA 1UCLA 1GMRA 1HYFA 2AAEA 1BUJA 1B2XA 4J5GA 8RNTA 1RDSA 1LOYA 2ZA4A 1BU4A 3RNTA 6GSPA 1BNEA 5BU4A 1BRIA 1GOVA 1G02A 1RCKA 4GSPA 3D5IA 1RGAA 3WR2A 1BGSA 3DGYA 1MGRA 2KF6A 1GSPA 1HZ1A 1TRPA 1UCIA 3HOHA 6RNTA 1JBRA 1BRHA 1BVIA 2GSPA 1BIRA 1B3SA 3GSPA 1T2HA 4RNTA 2BU4A 1FZUA 1BNFA 4HOHA 1RN4A 1BANA 3Q3FA 1BRJA 1LNIA 1BRGA 1RGFA 1CH0A 2HOHA 1T2IA 1TTOA 1B27A 4GHOA 4J5KA 3BIRA 1LOWA 5GSPA 1RGHA 2AADA 1RLSA 1SARA 1I0VA 1BNSA 1BRSA 1AQZA 4HAAA 1RGGA 1BSCA 1C54A 1JBSA 1FYSA 1B2UA 1UCKA 1BOXA
chains in the Genus database with same CATH superfamily
1G96A 5KP4A 1B20A 2QIYA 3HK4A 1NDOB 1RGLA 2OOVC 1IYYA 4N6MA 1YJN3 1M9GA 1GMQA 1I8VA 4EXRA 2P0XA 3HI7A 1GOUA 2ZL8A 2BHMA 1GD3A 2IMJA 2OQEA 3CC43 5AI1A 1B2MA 1OUNA 2Z77A 1K28A 1O7PB 1TFKA 2KAAA 3AHSA 3EQQB 1ISKA 1MOLA 2RFRA 2B24B 1SIIA 2YFIB 1DYUA 3Q2PA 1EG9B 2GBXB 3FGYA 3WOEB 4XBXA 5IERA 1LQMB 1NU3A 2CW9A 1W6YA 3ZG5A 1BRKA 7STDA 3CC23 2WGQA 3SOAA 3FH1A 1QVG2 1TRQA 3BU4A 1JB5A 4HM4B 5EVHA 1RCLA 3SYUA 1A67A 1YI23 1F8NA 3BNCA 3N54B 3CCJ3 1VQL3 4XBYA 1A2PA 3KN4A 2F4YA 2KF5A 1LVNA 3FG4A 1TJDA 2P09A 1VQQA 3EBYA 5KP3A 3WHOA 1BNJA 5IW9A 1BSAA 1B2ZA 2BIRA 2R41A 1BNRA 1W6GA 4R4KA 4HZBB 5HOHA 3URPA 4J9AA 5M19A 4HM7B 2W9QA 5FGOA 5BVBA 1BRNL 1MWTA 1UW1A 3DMCA 3KIIA 2E2UA 5CF1A 1PYLA 2CFLA 3FLJA 1EQKA 3Q90A 3LT8A 4FCMA 4GB5A 3RGAA 3HZPA 3LTDA 5M1AA 1GMPA 1Q9EA 2RNTA 1YVBI 1AR0A 2FGTA 2K54A 3RDEA 3WA2X 5BIRA 4PEJA 1MWRA 2O3OA 2AAEA 8CHOA 8RNTA 2CWTA 2YX9A 3EN1B 3U97A 5AEWB 1L5GB 3CPW2 3RNTA 4NPBA 2FXTA 3HIIA 3HIGA 3PGBA 2F99A 2ML6A 5CLKA 3I0YA 3MHEA 4HJLB 2F86B 1N9EA 3UJMA 1GY6A 1MGRA 2KF6A 3IJEB 1JV2B 3M8CA 3MWZA 5D81A 2RSXA 2Y74A 3AMOA 1JN5A 1SJWA 1W2ZA 1CYVA 3F8HA 3CCV3 1ROVA 3HX8A 3BNBA 4L8OA 1BNFA 4MMXB 1RN4A 1GY7A 1RKYA 1VQO3 5I97A 5LC7A 1BRJA 1OF5A 1LNIA 3DXOA 4RZMA 4N6LA 5IEPA 3MSOA 3MPHA 2CFDA 1STDA 3U1WA 3CCS3 1AVKA 4KFDA 4J5KA 1O7HB 4KZ1A 1D6UA 5G1KA 1OGXA 3FKAA 3LZAA 1UUWB 2E2TA 3BIRA 2W9PA 3EHCA 2MC8A 3G6E3 5GSPA 3EN8A 3EJVA 1QALA 4BTYA 1IT8A 1SARA 2W56A 3ALAA 1BNSA 3K7CA 1OHSA 3KSPA 1KC84 4KVHA 3WODG 1Y4KA 4N3VA 1OACA 4CPKA 1WMOA 1RGGA 1O7GB 3J7Yd 3D3LA 4O3VA 3X40A 3D79A 3MG2A 1TIJA 3LT9A 3K5TA 3OWSA 3CCE3 4IIAA 3CU3A 2BO9B 2WOHA 3GWRA 3NV0B 4XDWA 3NQZA 1ULJB 3MKIA 4FCZA 1NJI4 1X1XA 2IA7A 3AHWA 3WMDA 5AYSC 1W7CA 1YGWA 3E99A 1LOVA 1BNGA 1RTUA 1V58A 4FCJA 2CG1A 2LQVA 4KFEA 1LOXA 1EKMA 5TGNA 4BU4A 1RRLA 3JUPA 4OK0A 3ZG0A 1K8A4 1DMQA 2BNGA 5JBSA 3WDGB 3X3ZA 1WTHA 2YFJB 4EV2A 1WQLB 1IVUA 3CCL3 2W2CA 2ZDJA 5AYRB 1JBTA 3KCHA 1I2GA 4WYKB 1IQ8A 1YVSA 1IU7A 2WO0A 3T8NA 3BNDA 3GAXA 1ZX2A 1FUTA 1VQK3 1U5OA 4N6V0 2JQ5A 2ML5A 2W04A 1VQ93 2PZVA 3DGOA 1EA2A 3NBJA 2XRXB 1RGKA 4MJDA 3EX9A 4LMIA 7GSPA 1W00A 3MG3A 1O7NB 1ROAA 2XF3A 1EEJA 3F14A 4J8TA 2XSHB 5EEOA 1CEWI 3I553 4BTXA 5CF2A 3G16A 4NHFA 2KRTA 1BUQA 1Q7HA 4HM3B 1VQ83 1AY7A 5DRVA 1X1UA 1JNQA 1MGWA 2RBIA 2RGQA 3GZRA 1LNHA 5CK6A 1UI8A 2UGIA 3D4AA 2I9WA 1X1WA 1ZGXA 2XR8B 3A5EA 4I5QA 4MMZB 1I2EA 1WMNA 1RMSA 5FW5A 4N6OB 3N8BA 1I3FA 1IK3A 1N9JA 2CX1A 3CXC2 2C10A 3DM8A 1FW7A 4HM0B 3QK9A 2O9UX 3O8YA 3PCSA 2QA43 3S5CA 1IVWA 1A2KA 5D82A 1BUJA 4HM5B 1LOYA 4CJNA 3KFQC 1BU4A 1JZDA 2K0MA 2R4IA 5BU4A 2ZHXB 3DGMA 3SX1A 1OHPA 3CCM3 3CNXA 1K734 3B4PA 1FUWA 1SIHA 2INXA 4GSPA 1IQXA 3D5IA 1A2VA 1RGAA 3G8ZA 4X2OA 5STDA 3DGLA 3DGYA 3JUNA 1JKGA 1OH0A 2XH9A 6RNTA 2GU3A 1TRPA 1QMAA 1JZOA 1JB4A 2HMOB 1W6CA 1GY5A 3HOHA 3NHXA 1BVIA 4GL6A 4JF8A 1O7WB 2W6JH 4LYLB 2XSOB 4N6UA 4K61A 2H0GA 3BLZA 3F9SA 3MG1A 2XEPA 4LSOA 5ELJA 2H0HA 4EW5A 1NNVA 1NB3I 5AIFA 2FNQA 2XFSA 1RGFA 1BRGA 2K3DA 3DZLA 1DVDA 2CC3A 3Q1CA 2LYXA 4HM6B 2HOHA 6STDA 3FF2A 1W02A 1ASKA 1TTOA 1Z1SA 1YJW3 3OW22 5BXQA 1WMPA 2CKFB 2IUKA 2W0QA 2UUGC 3A76A 3FG1A 1LOWA 3FSDA 4HKVB 1VQ63 1RGHA 4HVNA 3UB1A 2Z7AA 2AADA 1DMNA 4O2HA 4R1KA 4FMDA 4LGQA 3KSED 1AQZA 4HAAA 4HM1B 4MMYB 3NX0A 1UUVB 1IQYA 1OPYA 2OWPA 4STDA 4WYKA 1C54A 3LTCA 3B7CA 1JBSA 4H3UA 3OX9A 4R9LA 4RNZA 1B2UA 1STFI 3N9HA 4I4KA 2CG0A 3OWYA 4WFOA 5ELUA 1PU4A 1AVLA 1Q42A 3AMOB 3OWUA 3GZYB 3KKGA 3CNMA 1FGRA 3LOYA 3S67A 1YIJ3 1VQ53 4U13A 3H3HA 1YGEA 2F56A 4HZ9B 2P0MA 1X1YA 3WOFB 4O02B 1EUIC 2L4VA 3AGNA 3NXJA 3VGNA 1OCVA 3ZFZA 5IENA 1BSEA 3V92A 4IT7A 3SLUA 3OV4A 3T0UA 3G713 2OTL3 1PY3A 1VQ73 4ILFA 2OOVA 2C11A 1WNHA 1BSDA 1LRAA 2BT3A 2Q07A 2F98A 3X42A 9RNTA 3G0KA 3K63A 2PNCA 2GEXA 4O8SA 1DE3A 3PYJA 1N5HA 3NBBA 2UX0A 3NUVA 2GU1A 2OCTA 4BL2A 3SXXA 1UGIA 3LTBA 1MWUA 1VZZA 1O7MB 1I70A 1RNBA 1LQGC 5G1LA 1TUHA 4R80A 2JDIH 1FGMA 1MNLA 1SQWA 2XGNA 1RRHA 4BIRA 1RGEA 1QVF2 3PCRA 2J8XB 1Q864 1I0XA 4R9KA 3SOYA 2HMLB 3IMAB 4FMAA 3B8LA 2Y73A 1RNTA 5IG0A 4BTWA 1YIT3 1I2FA 2B1XB 1R4YA 1PFPA 1JB2A 3MYTA 2CH9A 1SPUA 4G1MB 1KWIA 3H51A 5AIIA 3T8UA 3S29A 2P05A 1UCLA 2GEYA 4XB5A 1GMRA 3L0RA 1HYFA 1OHOA 2CHCA 5IF6A 1Q824 4J5GA 1RDSA 1IV7A 2ZA4A 1NB5I 1W01A 1E97A 6GSPA 5A0OB 1QJGA 3SEDA 1G02A 3CCU3 4TX4A 1KQS2 1RCKA 1GS3A 1VQN3 1ZO2A 3WR2A 3BNEA 4XDVA 2HMNB 1HZ1A 5IG5A 1AV4A 1JJ22 1JBRA 1BRHA 1VQP3 2GSPA 2HMKB 5JPPA 3DGNA 4OUQA 1BIRA 1B3SA 4MEIA 3GSPA 2OQEC 3OXAA 2BU4A 1FZUA 4RNTA 1QAKA 3CME3 1W5ZA 1S723 1BANA 4ORLA 3G4S3 3Q3FA 3F7XA 3UL6A 2STDA 1UUGB 3DUKA 3ECFA 3GRDA 2XGLA 2Z6BA 1KD14 1ZS7A 3CCQ3 1T2IA 3GZBA 3KZTA 3BB9A 5AIGA 4WHAA 2A15A 3EB8A 1IVXA 2W56B 1C7HA 3LTAA 5IG3A 2CIUA 2BMQB 4EBGA 1NWWA 5EQLA 1W4NA 4K90B 3F40A 3LH4A 4EV5A 1HKXA 2D1WA 3EBTA 1FYSA 2IUJA 1D6ZA 1JKGB 3NQYA 1RJOA 1OF5B 1FGOA 1UCKA 4FR9A 2CX0A 1TP6A 2F5WA 3JUQA 3NV0A 1DETA 4KFFA 2BMRB 1S5AA 1M1XB 3S28A 2Z76A 3GZXB 1N8QA 1BAOA 2C4BA 2P38A 3TDGA 1US1A 4AEQA 1Q7Y4 1OGZA 2KF4A 2GBWB 1G0TA 4XBTA 4CDLA 3V98A 3S27A 3LXUX 1K41A 2HMJB 1YNVX 4JRFA 1M1K4 1BNIA 2KXGA 1B21A 1FA3A 3D5GA 4N6NB 4EC6A 3FG3A 3NM2A 3F7SA 1E3VA 2QEX3 2RCDA 7RNTA 5HGRA 1RHLA 4FMBA 1I3IA 1GOYA 1UCJA 2WGOA 1DVCA 3D9RA 1Q40A 2IY2A 5G2GA 3I563 1CQSA 3JUMA 2OTJ3 1RGCA 2QGUA 3PS8A 3AGOA 1K9M4 4XM4A 2KF3A 5KP1A 2F5MA 1V74A 5RNTA 3DY5A 1DMMA 1ULIB 1RN1A 3RGRA 3B4OA 4RNYA 4N6TA 3CMA3 2IYJA 2W03A 3PZWA 1FUSA 1N5PA 2KCDA 3NBRA 3DH2A 3NM7A 4IPBA 1TU5A 2V1LA 4K1VA 2CWUA 3UL5A 3X3YA 3FZWA 2YFLB 4HM2B 3WA3A 1FGTA 1IV9A 2SARA 5CXOA 1BSBA 1T3BA 5IEOA 2L1SA 3UNLA 1JRQA 4QWTA 4BL3A 1B2SA 4L7KA 1RSNA 2CFGA 2MF7A 2WOFA 1HU9A 4DKIA 3LMLA 4EYCA 4RBNA 1B2XA 3K0ZA 4HYZA 3LYGA 1R4CA 3PXMA 3STDA 4FMCA 4HBRA 4H61A 1VQ43 1BNEA 1MWSA 1BRIA 2CWVA 2D42A 2E2VA 1GOVA 1QAFA 4LEHA 1IT7A 2BMOB 3X3XA 3JVCA 1BGSA 3CCR3 1JN5B 1GSPA 1D6YA 5IG4A 1GYBA 1UCIA 1YJ93 1V57A 1A90A 4WP5A 5D83A 4KT3B 1E3RA 3EE1A 3CD63 5AEUB 1T2HA 3SVAA 1M904 1IVVA 4HOHA 1T5YA 2M7OA 3CPOA 4X2HA 3EC9A 2CFKA 1TFOA 1CH0A 1IDPA 1GD4A 1RN7A 4NREA 3X41A 1CYUA 4L8PA 2H0IA 4AKYA 1B27A 1UI7A 4HM8B 1LXEA 4CCVA 4GHOA 3FCSB 5M18A 4K1UA 4WWUC 5DREA 3K9MC 1UDII 2GXFA 2HMMB 3CC73 5LC6A 4Q53A 3VF1A 2XFTA 4AKZA 3FF0A 2CK3H 3F8XA 4OVMA 3ROBA 1RLSA 2SBLA 1I0VA 1VQM3 1BRSA 3JUOA 1W2B2 1YHQ3 1Q814 3ER7A 3EF8A 1J2BA 2CFWA 1KSIA 1NO3A 5JPUA 1BSCA 3V99A 4ZM8A 1U8CB 1UGHI 1N8R4 4LZIA 3QRDA 3KE7A 3IPTA 5AIHA 1FGQA 1Q40B 3VSYA 1BOXA
chains in the Genus database with same CATH topology
1B20A 1RGLA 2F5WA 1IYYA 1DETA 1X1XA 3AHWA 2F56A 1X1YA 1GMQA 1I8VA 1YGWA 1BAOA 1GOUA 1LOVA 2C4BA 1BNGA 1RTUA 3AGNA 2KF4A 1BSEA 4BU4A 1B2MA 2KAAA 3AHSA 1PY3A 1YNVX 1BNIA 1B21A 3D5GA 1JBTA 3KCHA 1BSDA 1I2GA 1LRAA 9RNTA 1YVSA 1BRKA 7RNTA 1DE3A 1FUTA 1RHLA 1I3IA 1GOYA 1UCJA 1TRQA 3BU4A 1RCLA 1RGKA 3SYUA 1RGCA 7GSPA 3AGOA 2KF3A 1I70A 1RNBA 2F5MA 5RNTA 1A2PA 1RN1A 2F4YA 2KF5A 3WHOA 4BIRA 1BNJA 1BSAA 1AY7A 1B2ZA 1RGEA 2BIRA 1BNRA 1FUSA 1X1UA 3DH2A 3URPA 5HOHA 1I0XA 1MGWA 2RBIA 1BRNL 3D4AA 1RNTA 1X1WA 1ZGXA 3A5EA 1I2EA 1PYLA 1RMSA 1I2FA 1R4YA 1I3FA 2SARA 1BSBA 1GMPA 1Q9EA 2RNTA 1FW7A 1B2SA 1RSNA 5BIRA 1UCLA 1GMRA 1HYFA 2AAEA 1BUJA 1B2XA 4J5GA 8RNTA 1RDSA 1LOYA 2ZA4A 1BU4A 3RNTA 6GSPA 1BNEA 5BU4A 1BRIA 1GOVA 1G02A 1RCKA 4GSPA 3D5IA 1RGAA 3WR2A 1BGSA 3DGYA 1MGRA 2KF6A 1GSPA 1HZ1A 1TRPA 1UCIA 3HOHA 6RNTA 1JBRA 1BRHA 1BVIA 2GSPA 1BIRA 1B3SA 3GSPA 1T2HA 4RNTA 2BU4A 1FZUA 1BNFA 4HOHA 1RN4A 1BANA 3Q3FA 1BRJA 1LNIA 1BRGA 1RGFA 1CH0A 2HOHA 1T2IA 1TTOA 1B27A 4GHOA 4J5KA 3BIRA 1LOWA 5GSPA 1RGHA 2AADA 1RLSA 1SARA 1I0VA 1BNSA 1BRSA 1AQZA 4HAAA 1RGGA 1BSCA 1C54A 1JBSA 1FYSA 1B2UA 1UCKA 1BOXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B20 A;  1RGL A;  2F5W A;  1IYY A;  1DET A;  1X1X A;  3AHW A;  2F56 A;  1X1Y A;  1GMQ A;  1I8V A;  1YGW A;  1BAO A;  1GOU A;  1LOV A;  2C4B A;  1BNG A;  1RTU A;  3AGN A;  2KF4 A;  1BSE A;  4BU4 A;  1B2M A;  2KAA A;  3AHS A;  1PY3 A;  1YNV X;  1BNI A;  1B21 A;  3D5G A;  1JBT A;  3KCH A;  1BSD A;  1I2G A;  1LRA A;  9RNT A;  1YVS A;  1BRK A;  7RNT A;  1DE3 A;  1FUT A;  1RHL A;  1I3I A;  1GOY A;  1UCJ A;  1TRQ A;  3BU4 A;  1RCL A;  1RGK A;  3SYU A;  1RGC A;  7GSP A;  3AGO A;  2KF3 A;  1I70 A;  1RNB A;  2F5M A;  5RNT A;  1A2P A;  1RN1 A;  2F4Y A;  2KF5 A;  3WHO A;  4BIR A;  1BNJ A;  1BSA A;  1AY7 A;  1B2Z A;  1RGE A;  2BIR A;  1BNR A;  1FUS A;  1X1U A;  3DH2 A;  3URP A;  5HOH A;  1I0X A;  1MGW A;  2RBI A;  1BRN L;  3D4A A;  1RNT A;  1X1W A;  1ZGX A;  3A5E A;  1I2E A;  1PYL A;  1RMS A;  1I2F A;  1R4Y A;  1I3F A;  2SAR A;  1BSB A;  1GMP A;  1Q9E A;  2RNT A;  1FW7 A;  1B2S A;  1RSN A;  5BIR A;  1UCL A;  1GMR A;  1HYF A;  2AAE A;  1BUJ A;  1B2X A;  4J5G A;  8RNT A;  1RDS A;  1LOY A;  2ZA4 A;  1BU4 A;  3RNT A;  6GSP A;  1BNE A;  5BU4 A;  1BRI A;  1GOV A;  1G02 A;  1RCK A;  4GSP A;  3D5I A;  1RGA A;  3WR2 A;  1BGS A;  3DGY A;  1MGR A;  2KF6 A;  1GSP A;  1HZ1 A;  1TRP A;  1UCI A;  3HOH A;  6RNT A;  1JBR A;  1BRH A;  1BVI A;  2GSP A;  1BIR A;  1B3S A;  3GSP A;  1T2H A;  4RNT A;  2BU4 A;  1FZU A;  1BNF A;  4HOH A;  1RN4 A;  1BAN A;  3Q3F A;  1BRJ A;  1LNI A;  1BRG A;  1RGF A;  1CH0 A;  2HOH A;  1T2I A;  1TTO A;  1B27 A;  4GHO A;  4J5K A;  3BIR A;  1LOW A;  5GSP A;  1RGH A;  2AAD A;  1RLS A;  1SAR A;  1I0V A;  1BNS A;  1BRS A;  1AQZ A;  4HAA A;  1RGG A;  1BSC A;  1C54 A;  1JBS A;  1FYS A;  1B2U A;  1UCK A;  1BOX A; 
#chains in the Genus database with same CATH topology
 1G96 A;  5KP4 A;  1B20 A;  2QIY A;  3HK4 A;  1NDO B;  1RGL A;  2OOV C;  1IYY A;  4N6M A;  1YJN 3;  1M9G A;  1GMQ A;  1I8V A;  4EXR A;  2P0X A;  3HI7 A;  1GOU A;  2ZL8 A;  2BHM A;  1GD3 A;  2IMJ A;  2OQE A;  3CC4 3;  5AI1 A;  1B2M A;  1OUN A;  2Z77 A;  1K28 A;  1O7P B;  1TFK A;  2KAA A;  3AHS A;  3EQQ B;  1ISK A;  1MOL A;  2RFR A;  2B24 B;  1SII A;  2YFI B;  1DYU A;  3Q2P A;  1EG9 B;  2GBX B;  3FGY A;  3WOE B;  4XBX A;  5IER A;  1LQM B;  1NU3 A;  2CW9 A;  1W6Y A;  3ZG5 A;  1BRK A;  7STD A;  3CC2 3;  2WGQ A;  3SOA A;  3FH1 A;  1QVG 2;  1TRQ A;  3BU4 A;  1JB5 A;  4HM4 B;  5EVH A;  1RCL A;  3SYU A;  1A67 A;  1YI2 3;  1F8N A;  3BNC A;  3N54 B;  3CCJ 3;  1VQL 3;  4XBY A;  1A2P A;  3KN4 A;  2F4Y A;  2KF5 A;  1LVN A;  3FG4 A;  1TJD A;  2P09 A;  1VQQ A;  3EBY A;  5KP3 A;  3WHO A;  1BNJ A;  5IW9 A;  1BSA A;  1B2Z A;  2BIR A;  2R41 A;  1BNR A;  1W6G A;  4R4K A;  4HZB B;  5HOH A;  3URP A;  4J9A A;  5M19 A;  4HM7 B;  2W9Q A;  5FGO A;  5BVB A;  1BRN L;  1MWT A;  1UW1 A;  3DMC A;  3KII A;  2E2U A;  5CF1 A;  1PYL A;  2CFL A;  3FLJ A;  1EQK A;  3Q90 A;  3LT8 A;  4FCM A;  4GB5 A;  3RGA A;  3HZP A;  3LTD A;  5M1A A;  1GMP A;  1Q9E A;  2RNT A;  1YVB I;  1AR0 A;  2FGT A;  2K54 A;  3RDE A;  3WA2 X;  5BIR A;  4PEJ A;  1MWR A;  2O3O A;  2AAE A;  8CHO A;  8RNT A;  2CWT A;  2YX9 A;  3EN1 B;  3U97 A;  5AEW B;  1L5G B;  3CPW 2;  3RNT A;  4NPB A;  2FXT A;  3HII A;  3HIG A;  3PGB A;  2F99 A;  2ML6 A;  5CLK A;  3I0Y A;  3MHE A;  4HJL B;  2F86 B;  1N9E A;  3UJM A;  1GY6 A;  1MGR A;  2KF6 A;  3IJE B;  1JV2 B;  3M8C A;  3MWZ A;  5D81 A;  2RSX A;  2Y74 A;  3AMO A;  1JN5 A;  1SJW A;  1W2Z A;  1CYV A;  3F8H A;  3CCV 3;  1ROV A;  3HX8 A;  3BNB A;  4L8O A;  1BNF A;  4MMX B;  1RN4 A;  1GY7 A;  1RKY A;  1VQO 3;  5I97 A;  5LC7 A;  1BRJ A;  1OF5 A;  1LNI A;  3DXO A;  4RZM A;  4N6L A;  5IEP A;  3MSO A;  3MPH A;  2CFD A;  1STD A;  3U1W A;  3CCS 3;  1AVK A;  4KFD A;  4J5K A;  1O7H B;  4KZ1 A;  1D6U A;  5G1K A;  1OGX A;  3FKA A;  3LZA A;  1UUW B;  2E2T A;  3BIR A;  2W9P A;  3EHC A;  2MC8 A;  3G6E 3;  5GSP A;  3EN8 A;  3EJV A;  1QAL A;  4BTY A;  1IT8 A;  1SAR A;  2W56 A;  3ALA A;  1BNS A;  3K7C A;  1OHS A;  3KSP A;  1KC8 4;  4KVH A;  3WOD G;  1Y4K A;  4N3V A;  1OAC A;  4CPK A;  1WMO A;  1RGG A;  1O7G B;  3J7Y d;  3D3L A;  4O3V A;  3X40 A;  3D79 A;  3MG2 A;  1TIJ A;  3LT9 A;  3K5T A;  3OWS A;  3CCE 3;  4IIA A;  3CU3 A;  2BO9 B;  2WOH A;  3GWR A;  3NV0 B;  4XDW A;  3NQZ A;  1ULJ B;  3MKI A;  4FCZ A;  1NJI 4;  1X1X A;  2IA7 A;  3AHW A;  3WMD A;  5AYS C;  1W7C A;  1YGW A;  3E99 A;  1LOV A;  1BNG A;  1RTU A;  1V58 A;  4FCJ A;  2CG1 A;  2LQV A;  4KFE A;  1LOX A;  1EKM A;  5TGN A;  4BU4 A;  1RRL A;  3JUP A;  4OK0 A;  3ZG0 A;  1K8A 4;  1DMQ A;  2BNG A;  5JBS A;  3WDG B;  3X3Z A;  1WTH A;  2YFJ B;  4EV2 A;  1WQL B;  1IVU A;  3CCL 3;  2W2C A;  2ZDJ A;  5AYR B;  1JBT A;  3KCH A;  1I2G A;  4WYK B;  1IQ8 A;  1YVS A;  1IU7 A;  2WO0 A;  3T8N A;  3BND A;  3GAX A;  1ZX2 A;  1FUT A;  1VQK 3;  1U5O A;  4N6V 0;  2JQ5 A;  2ML5 A;  2W04 A;  1VQ9 3;  2PZV A;  3DGO A;  1EA2 A;  3NBJ A;  2XRX B;  1RGK A;  4MJD A;  3EX9 A;  4LMI A;  7GSP A;  1W00 A;  3MG3 A;  1O7N B;  1ROA A;  2XF3 A;  1EEJ A;  3F14 A;  4J8T A;  2XSH B;  5EEO A;  1CEW I;  3I55 3;  4BTX A;  5CF2 A;  3G16 A;  4NHF A;  2KRT A;  1BUQ A;  1Q7H A;  4HM3 B;  1VQ8 3;  1AY7 A;  5DRV A;  1X1U A;  1JNQ A;  1MGW A;  2RBI A;  2RGQ A;  3GZR A;  1LNH A;  5CK6 A;  1UI8 A;  2UGI A;  3D4A A;  2I9W A;  1X1W A;  1ZGX A;  2XR8 B;  3A5E A;  4I5Q A;  4MMZ B;  1I2E A;  1WMN A;  1RMS A;  5FW5 A;  4N6O B;  3N8B A;  1I3F A;  1IK3 A;  1N9J A;  2CX1 A;  3CXC 2;  2C10 A;  3DM8 A;  1FW7 A;  4HM0 B;  3QK9 A;  2O9U X;  3O8Y A;  3PCS A;  2QA4 3;  3S5C A;  1IVW A;  1A2K A;  5D82 A;  1BUJ A;  4HM5 B;  1LOY A;  4CJN A;  3KFQ C;  1BU4 A;  1JZD A;  2K0M A;  2R4I A;  5BU4 A;  2ZHX B;  3DGM A;  3SX1 A;  1OHP A;  3CCM 3;  3CNX A;  1K73 4;  3B4P A;  1FUW A;  1SIH A;  2INX A;  4GSP A;  1IQX A;  3D5I A;  1A2V A;  1RGA A;  3G8Z A;  4X2O A;  5STD A;  3DGL A;  3DGY A;  3JUN A;  1JKG A;  1OH0 A;  2XH9 A;  6RNT A;  2GU3 A;  1TRP A;  1QMA A;  1JZO A;  1JB4 A;  2HMO B;  1W6C A;  1GY5 A;  3HOH A;  3NHX A;  1BVI A;  4GL6 A;  4JF8 A;  1O7W B;  2W6J H;  4LYL B;  2XSO B;  4N6U A;  4K61 A;  2H0G A;  3BLZ A;  3F9S A;  3MG1 A;  2XEP A;  4LSO A;  5ELJ A;  2H0H A;  4EW5 A;  1NNV A;  1NB3 I;  5AIF A;  2FNQ A;  2XFS A;  1RGF A;  1BRG A;  2K3D A;  3DZL A;  1DVD A;  2CC3 A;  3Q1C A;  2LYX A;  4HM6 B;  2HOH A;  6STD A;  3FF2 A;  1W02 A;  1ASK A;  1TTO A;  1Z1S A;  1YJW 3;  3OW2 2;  5BXQ A;  1WMP A;  2CKF B;  2IUK A;  2W0Q A;  2UUG C;  3A76 A;  3FG1 A;  1LOW A;  3FSD A;  4HKV B;  1VQ6 3;  1RGH A;  4HVN A;  3UB1 A;  2Z7A A;  2AAD A;  1DMN A;  4O2H A;  4R1K A;  4FMD A;  4LGQ A;  3KSE D;  1AQZ A;  4HAA A;  4HM1 B;  4MMY B;  3NX0 A;  1UUV B;  1IQY A;  1OPY A;  2OWP A;  4STD A;  4WYK A;  1C54 A;  3LTC A;  3B7C A;  1JBS A;  4H3U A;  3OX9 A;  4R9L A;  4RNZ A;  1B2U A;  1STF I;  3N9H A;  4I4K A;  2CG0 A;  3OWY A;  4WFO A;  5ELU A;  1PU4 A;  1AVL A;  1Q42 A;  3AMO B;  3OWU A;  3GZY B;  3KKG A;  3CNM A;  1FGR A;  3LOY A;  3S67 A;  1YIJ 3;  1VQ5 3;  4U13 A;  3H3H A;  1YGE A;  2F56 A;  4HZ9 B;  2P0M A;  1X1Y A;  3WOF B;  4O02 B;  1EUI C;  2L4V A;  3AGN A;  3NXJ A;  3VGN A;  1OCV A;  3ZFZ A;  5IEN A;  1BSE A;  3V92 A;  4IT7 A;  3SLU A;  3OV4 A;  3T0U A;  3G71 3;  2OTL 3;  1PY3 A;  1VQ7 3;  4ILF A;  2OOV A;  2C11 A;  1WNH A;  1BSD A;  1LRA A;  2BT3 A;  2Q07 A;  2F98 A;  3X42 A;  9RNT A;  3G0K A;  3K63 A;  2PNC A;  2GEX A;  4O8S A;  1DE3 A;  3PYJ A;  1N5H A;  3NBB A;  2UX0 A;  3NUV A;  2GU1 A;  2OCT A;  4BL2 A;  3SXX A;  1UGI A;  3LTB A;  1MWU A;  1VZZ A;  1O7M B;  1I70 A;  1RNB A;  1LQG C;  5G1L A;  1TUH A;  4R80 A;  2JDI H;  1FGM A;  1MNL A;  1SQW A;  2XGN A;  1RRH A;  4BIR A;  1RGE A;  1QVF 2;  3PCR A;  2J8X B;  1Q86 4;  1I0X A;  4R9K A;  3SOY A;  2HML B;  3IMA B;  4FMA A;  3B8L A;  2Y73 A;  1RNT A;  5IG0 A;  4BTW A;  1YIT 3;  1I2F A;  2B1X B;  1R4Y A;  1PFP A;  1JB2 A;  3MYT A;  2CH9 A;  1SPU A;  4G1M B;  1KWI A;  3H51 A;  5AII A;  3T8U A;  3S29 A;  2P05 A;  1UCL A;  2GEY A;  4XB5 A;  1GMR A;  3L0R A;  1HYF A;  1OHO A;  2CHC A;  5IF6 A;  1Q82 4;  4J5G A;  1RDS A;  1IV7 A;  2ZA4 A;  1NB5 I;  1W01 A;  1E97 A;  6GSP A;  5A0O B;  1QJG A;  3SED A;  1G02 A;  3CCU 3;  4TX4 A;  1KQS 2;  1RCK A;  1GS3 A;  1VQN 3;  1ZO2 A;  3WR2 A;  3BNE A;  4XDV A;  2HMN B;  1HZ1 A;  5IG5 A;  1AV4 A;  1JJ2 2;  1JBR A;  1BRH A;  1VQP 3;  2GSP A;  2HMK B;  5JPP A;  3DGN A;  4OUQ A;  1BIR A;  1B3S A;  4MEI A;  3GSP A;  2OQE C;  3OXA A;  2BU4 A;  1FZU A;  4RNT A;  1QAK A;  3CME 3;  1W5Z A;  1S72 3;  1BAN A;  4ORL A;  3G4S 3;  3Q3F A;  3F7X A;  3UL6 A;  2STD A;  1UUG B;  3DUK A;  3ECF A;  3GRD A;  2XGL A;  2Z6B A;  1KD1 4;  1ZS7 A;  3CCQ 3;  1T2I A;  3GZB A;  3KZT A;  3BB9 A;  5AIG A;  4WHA A;  2A15 A;  3EB8 A;  1IVX A;  2W56 B;  1C7H A;  3LTA A;  5IG3 A;  2CIU A;  2BMQ B;  4EBG A;  1NWW A;  5EQL A;  1W4N A;  4K90 B;  3F40 A;  3LH4 A;  4EV5 A;  1HKX A;  2D1W A;  3EBT A;  1FYS A;  2IUJ A;  1D6Z A;  1JKG B;  3NQY A;  1RJO A;  1OF5 B;  1FGO A;  1UCK A;  4FR9 A;  2CX0 A;  1TP6 A;  2F5W A;  3JUQ A;  3NV0 A;  1DET A;  4KFF A;  2BMR B;  1S5A A;  1M1X B;  3S28 A;  2Z76 A;  3GZX B;  1N8Q A;  1BAO A;  2C4B A;  2P38 A;  3TDG A;  1US1 A;  4AEQ A;  1Q7Y 4;  1OGZ A;  2KF4 A;  2GBW B;  1G0T A;  4XBT A;  4CDL A;  3V98 A;  3S27 A;  3LXU X;  1K41 A;  2HMJ B;  1YNV X;  4JRF A;  1M1K 4;  1BNI A;  2KXG A;  1B21 A;  1FA3 A;  3D5G A;  4N6N B;  4EC6 A;  3FG3 A;  3NM2 A;  3F7S A;  1E3V A;  2QEX 3;  2RCD A;  7RNT A;  5HGR A;  1RHL A;  4FMB A;  1I3I A;  1GOY A;  1UCJ A;  2WGO A;  1DVC A;  3D9R A;  1Q40 A;  2IY2 A;  5G2G A;  3I56 3;  1CQS A;  3JUM A;  2OTJ 3;  1RGC A;  2QGU A;  3PS8 A;  3AGO A;  1K9M 4;  4XM4 A;  2KF3 A;  5KP1 A;  2F5M A;  1V74 A;  5RNT A;  3DY5 A;  1DMM A;  1ULI B;  1RN1 A;  3RGR A;  3B4O A;  4RNY A;  4N6T A;  3CMA 3;  2IYJ A;  2W03 A;  3PZW A;  1FUS A;  1N5P A;  2KCD A;  3NBR A;  3DH2 A;  3NM7 A;  4IPB A;  1TU5 A;  2V1L A;  4K1V A;  2CWU A;  3UL5 A;  3X3Y A;  3FZW A;  2YFL B;  4HM2 B;  3WA3 A;  1FGT A;  1IV9 A;  2SAR A;  5CXO A;  1BSB A;  1T3B A;  5IEO A;  2L1S A;  3UNL A;  1JRQ A;  4QWT A;  4BL3 A;  1B2S A;  4L7K A;  1RSN A;  2CFG A;  2MF7 A;  2WOF A;  1HU9 A;  4DKI A;  3LML A;  4EYC A;  4RBN A;  1B2X A;  3K0Z A;  4HYZ A;  3LYG A;  1R4C A;  3PXM A;  3STD A;  4FMC A;  4HBR A;  4H61 A;  1VQ4 3;  1BNE A;  1MWS A;  1BRI A;  2CWV A;  2D42 A;  2E2V A;  1GOV A;  1QAF A;  4LEH A;  1IT7 A;  2BMO B;  3X3X A;  3JVC A;  1BGS A;  3CCR 3;  1JN5 B;  1GSP A;  1D6Y A;  5IG4 A;  1GYB A;  1UCI A;  1YJ9 3;  1V57 A;  1A90 A;  4WP5 A;  5D83 A;  4KT3 B;  1E3R A;  3EE1 A;  3CD6 3;  5AEU B;  1T2H A;  3SVA A;  1M90 4;  1IVV A;  4HOH A;  1T5Y A;  2M7O A;  3CPO A;  4X2H A;  3EC9 A;  2CFK A;  1TFO A;  1CH0 A;  1IDP A;  1GD4 A;  1RN7 A;  4NRE A;  3X41 A;  1CYU A;  4L8P A;  2H0I A;  4AKY A;  1B27 A;  1UI7 A;  4HM8 B;  1LXE A;  4CCV A;  4GHO A;  3FCS B;  5M18 A;  4K1U A;  4WWU C;  5DRE A;  3K9M C;  1UDI I;  2GXF A;  2HMM B;  3CC7 3;  5LC6 A;  4Q53 A;  3VF1 A;  2XFT A;  4AKZ A;  3FF0 A;  2CK3 H;  3F8X A;  4OVM A;  3ROB A;  1RLS A;  2SBL A;  1I0V A;  1VQM 3;  1BRS A;  3JUO A;  1W2B 2;  1YHQ 3;  1Q81 4;  3ER7 A;  3EF8 A;  1J2B A;  2CFW A;  1KSI A;  1NO3 A;  5JPU A;  1BSC A;  3V99 A;  4ZM8 A;  1U8C B;  1UGH I;  1N8R 4;  4LZI A;  3QRD A;  3KE7 A;  3IPT A;  5AIH A;  1FGQ A;  1Q40 B;  3VSY A;  1BOX A; 
#chains in the Genus database with same CATH homology
 1B20 A;  1RGL A;  2F5W A;  1IYY A;  1DET A;  1X1X A;  3AHW A;  2F56 A;  1X1Y A;  1GMQ A;  1I8V A;  1YGW A;  1BAO A;  1GOU A;  1LOV A;  2C4B A;  1BNG A;  1RTU A;  3AGN A;  2KF4 A;  1BSE A;  4BU4 A;  1B2M A;  2KAA A;  3AHS A;  1PY3 A;  1YNV X;  1BNI A;  1B21 A;  3D5G A;  1JBT A;  3KCH A;  1BSD A;  1I2G A;  1LRA A;  9RNT A;  1YVS A;  1BRK A;  7RNT A;  1DE3 A;  1FUT A;  1RHL A;  1I3I A;  1GOY A;  1UCJ A;  1TRQ A;  3BU4 A;  1RCL A;  1RGK A;  3SYU A;  1RGC A;  7GSP A;  3AGO A;  2KF3 A;  1I70 A;  1RNB A;  2F5M A;  5RNT A;  1A2P A;  1RN1 A;  2F4Y A;  2KF5 A;  3WHO A;  4BIR A;  1BNJ A;  1BSA A;  1AY7 A;  1B2Z A;  1RGE A;  2BIR A;  1BNR A;  1FUS A;  1X1U A;  3DH2 A;  3URP A;  5HOH A;  1I0X A;  1MGW A;  2RBI A;  1BRN L;  3D4A A;  1RNT A;  1X1W A;  1ZGX A;  3A5E A;  1I2E A;  1PYL A;  1RMS A;  1I2F A;  1R4Y A;  1I3F A;  2SAR A;  1BSB A;  1GMP A;  1Q9E A;  2RNT A;  1FW7 A;  1B2S A;  1RSN A;  5BIR A;  1UCL A;  1GMR A;  1HYF A;  2AAE A;  1BUJ A;  1B2X A;  4J5G A;  8RNT A;  1RDS A;  1LOY A;  2ZA4 A;  1BU4 A;  3RNT A;  6GSP A;  1BNE A;  5BU4 A;  1BRI A;  1GOV A;  1G02 A;  1RCK A;  4GSP A;  3D5I A;  1RGA A;  3WR2 A;  1BGS A;  3DGY A;  1MGR A;  2KF6 A;  1GSP A;  1HZ1 A;  1TRP A;  1UCI A;  3HOH A;  6RNT A;  1JBR A;  1BRH A;  1BVI A;  2GSP A;  1BIR A;  1B3S A;  3GSP A;  1T2H A;  4RNT A;  2BU4 A;  1FZU A;  1BNF A;  4HOH A;  1RN4 A;  1BAN A;  3Q3F A;  1BRJ A;  1LNI A;  1BRG A;  1RGF A;  1CH0 A;  2HOH A;  1T2I A;  1TTO A;  1B27 A;  4GHO A;  4J5K A;  3BIR A;  1LOW A;  5GSP A;  1RGH A;  2AAD A;  1RLS A;  1SAR A;  1I0V A;  1BNS A;  1BRS A;  1AQZ A;  4HAA A;  1RGG A;  1BSC A;  1C54 A;  1JBS A;  1FYS A;  1B2U A;  1UCK A;  1BOX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...