3HOHA

Ribonuclease t1 (thr93gln mutant) complexed with 2'gmp
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
104
structure length
104
Chain Sequence
b'ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHQGASGNNFVECT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (RIBONUCLEASE T1)
publication title Dissection of the structural and functional role of a conserved hydration site in RNase T1.
pubmed rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
total genus 27
structure length 104
sequence length 104
chains with identical sequence B, C, D
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1998-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 3hohA00
1RGHA 1T2HA 1UCLA 1BSCA 2KF3A 3SYUA 1C54A 1B2UA 1RGKA 3GSPA 1GOYA 2AAEA 5HOHA 1RCKA 3Q3FA 1X1WA 1BUJA 1ZGXA 1X1YA 3AGOA 1RCLA 1RLSA 1B21A 1GMPA 1YVSA 8RNTA 5RNTA 1G02A 1LOWA 5GSPA 1B3SA 1BNJA 3BIRA 5BIRA 1MGRA 4HAAA 6RNTA 2KF5A 7GSPA 1MGWA 3DGYA 1LRAA 1I2GA 2RBIA 1X1XA 1I3FA 1GOUA 1FYSA 1RNTA 2F5WA 1RN4A 1JBTA 1GMRA 1T2IA 3DH2A 5BU4A 1RGGA 1PYLA 1I2EA 2F4YA 1LOVA 2KF6A 1B2MA 3HOHA 1I8VA 2KF4A 1DE3A 1RSNA 6GSPA 1RGLA 1I0VA 3URPA 3WR2A 1BRSA 9RNTA 1TRPA 1BVIA 1FUSA 4J5GA 2GSPA 1DETA 3D5GA 4RNTA 1LNIA 2BU4A 1TRQA 3AHSA 1GMQA 1BIRA 1GSPA 1B2ZA 1B2XA 2C4BA 7RNTA 1RTUA 1B27A 1BU4A 2KAAA 1FUTA 2AADA 2F56A 1YNVX 1UCJA 1RMSA 1Q9EA 3A5EA 4J5KA 1BGSA 1BNEA 1BRJA 1RNBA 1FZUA 1UCKA 1FW7A 1RDSA 1RHLA 3D4AA 1HZ1A 1HYFA 3RNTA 1BNGA 1TTOA 1GOVA 4HOHA 1PY3A 1BANA 3AHWA 1B2SA 1BNFA 1IYYA 1JBSA 1BNSA 2F5MA 1BSDA 1B20A 1I0XA 3BU4A 1YGWA 1BNRA 1BSAA 2ZA4A 1RGFA 1AQZA 1BRIA 1RGCA 1BOXA 4GHOA 4BU4A 1BAOA 1I3IA 2RNTA 1BRHA 1I2FA 1SARA 2SARA 1LOYA 3D5IA 1A2PA 1BRNL 1UCIA 1RN1A 1X1UA 1AY7A 3WHOA 2HOHA 3AGNA 1RGAA 1RGEA 1R4YA 1BSBA 1BSEA 4BIRA 1BNIA 2BIRA 3KCHA 1BRGA 1BRKA 1JBRA 4GSPA 1I70A 1CH0A
chains in the Genus database with same CATH superfamily
1T2HA 1ULIB 4NREA 3EN1B 2KF3A 3KSED 3SYUA 5LC6A 4HM1B 5AIGA 3J7Yd 3S5CA 4KVHA 3VF1A 1X1WA 1BUJA 1ZGXA 3PCRA 2B24B 4RBNA 1O7HB 1UUGB 3AGOA 3PGBA 1RCLA 2HMOB 2Q07A 3V98A 8RNTA 2XSHB 3CPW2 3N8BA 1W7CA 3LTCA 4MMXB 1MGRA 5CF1A 3BLZA 1OPYA 1T3BA 2L1SA 2W9PA 3HI7A 3JUOA 4BL3A 3DGYA 1IVVA 4O8SA 1A2KA 1VQM3 3EQQB 3HX8A 2C10A 4G1MB 1L5GB 1WMPA 4EXRA 1MWTA 3LMLA 4J8TA 4H61A 5G1KA 3K5TA 3LXUX 2XGNA 4JRFA 3CC73 1GMRA 3DH2A 4FCZA 3NXJA 3F14A 4I4KA 5BU4A 3I553 2V1LA 1QMAA 1T5YA 1GY7A 1ZO2A 1I2EA 4N6LA 1DVCA 2PNCA 2K3DA 3FCSB 3HOHA 1I8VA 1OHOA 2BT3A 1V58A 1DE3A 1RSNA 1C7HA 5AIFA 2BHMA 3FF2A 1K28A 1JN5A 1TJDA 1E97A 1FUSA 5TGNA 3FGYA 1YJN3 3D79A 3K9MC 1TRQA 1A2VA 4HBRA 3HIIA 1DMMA 4BL2A 4K1VA 1F8NA 2CWVA 2GBXB 1VQN3 2CH9A 3NUVA 4FMAA 1B27A 1BU4A 1NO3A 3SX1A 1FUWA 4WWUC 4HZ9B 3B7CA 4HM7B 1MWUA 3CPOA 1UI8A 4X2HA 4XDWA 5DREA 1W2B2 2GU3A 3EF8A 1Q9EA 3ECFA 4KFEA 4L7KA 1Q824 1BGSA 3WODG 3JUQA 4LZIA 3FKAA 1JZOA 2D42A 2Z77A 1JN5B 2XEPA 1D6YA 2PZVA 2CG1A 1EQKA 1SQWA 3D4AA 1UGHI 3RNTA 1IK3A 1VZZA 2CHCA 4FCMA 2UUGC 4KT3B 2IUKA 1TTOA 1Q40A 3OX9A 1PFPA 3CC23 1UDII 1U8CB 3OWUA 3AHWA 1EUIC 3IPTA 4R9KA 4AEQA 2O3OA 1KSIA 1JBSA 1TUHA 2W2CA 1VQ83 4N6UA 3HK4A 1B20A 2OQEC 4CDLA 5KP4A 1YGWA 1VQ63 1JB2A 4N6NB 4U13A 3BNBA 1SJWA 3ALAA 3CCQ3 1G96A 2CG0A 1K9M4 3CU3A 4BU4A 2RNTA 1I3IA 2SARA 1SARA 2R4IA 1TIJA 1A2PA 4L8PA 3X41A 1LXEA 2MF7A 3NBJA 3WOEB 1ROVA 3VSYA 4K61A 1IV9A 2E2VA 2MC8A 3RDEA 1YIJ3 1CYUA 2HMKB 1RGEA 3DGOA 2Y73A 1YI23 1E3VA 2XH9A 3JUNA 1Q40B 3UJMA 1GYBA 3OV4A 1IQ8A 1BNIA 4IIAA 3STDA 3ROBA 1E3RA 4MMZB 1YGEA 1IT8A 2UX0A 2CX1A 2QIYA 1FGMA 1RGHA 1UCLA 3NM2A 4OK0A 5G2GA 2OTL3 1FGOA 2P0MA 1RGKA 2OCTA 2A15A 1GD3A 4X2OA 5CXOA 1JKGA 3BB9A 3B4OA 4HM2B 1RCKA 3Q3FA 3X42A 2IYJA 1MNLA 3U97A 1RN7A 1X1YA 5HGRA 2CWTA 1C54A 1B21A 1GMPA 2KRTA 3NQYA 1G02A 1LOWA 3HIGA 4HKVB 3N9HA 5GSPA 3T0UA 2WO0A 5I97A 5BIRA 1N8R4 2BMOB 4WHAA 4LGQA 3LTAA 1OACA 4R4KA 3CMA3 6RNTA 2KF5A 2RGQA 3H3HA 4HJLB 4KFFA 3H51A 1NU3A 2L4VA 3KKGA 4MJDA 4XDVA 5EEOA 1I2GA 3G4S3 1AVLA 3S28A 3EJVA 1I3FA 3EBYA 4HM0B 3NBRA 3GZYB 1TU5A 2F5WA 4K90B 1STDA 2J8XB 5AIIA 3F8HA 5D82A 1JKGB 4AKZA 1KD14 2UGIA 4HM6B 3SOAA 1RGGA 2CFWA 2FXTA 2YFIB 2XRXB 4TX4A 1IV7A 4EV2A 1IVUA 2KF4A 5CF2A 3DUKA 2Z6BA 2Z7AA 1LVNA 4Q53A 1TP6A 5BVBA 3WR2A 5AIHA 4FMCA 1W00A 4BTYA 1OH0A 1M904 4RNTA 4IT7A 4XBYA 2D1WA 2INXA 3FLJA 3MG1A 1NB5I 4HM5B 4FMDA 1BIRA 3MKIA 3HZPA 4ORLA 7RNTA 1VQ53 1UUWB 5EQLA 4LYLB 1IDPA 1JZDA 4DKIA 1AV4A 2KAAA 1ZS7A 2F56A 1NB3I 3BNEA 1W6GA 3ZG0A 1NNVA 1UCJA 4EBGA 3EC9A 4HM3B 5FGOA 1RMSA 2GU1A 3A5EA 1QAFA 4WYKA 1SPUA 1W6CA 4J5KA 2OQEA 2QGUA 4N6V0 3JUMA 3CNMA 2Z76A 2IA7A 2P05A 3MYTA 1ASKA 1IVXA 3OWYA 1OCVA 1FW7A 1RDSA 4ZM8A 2YX9A 3GAXA 4AKYA 1RHLA 3PYJA 3GWRA 1RRHA 3I563 5IERA 2CFLA 3D9RA 4FCJA 2ZL8A 3UB1A 3WA2X 3CCM3 1W2ZA 2Y74A 1IQYA 3SOYA 1Q7Y4 1GOVA 2CC3A 3V99A 1O7GB 2CWUA 5IEOA 2HMJB 2F86B 2JQ5A 3G0KA 3NM7A 2F5MA 4EW5A 1SIIA 2KCDA 3CCR3 1UW1A 2CIUA 1I0XA 1OUNA 1US1A 3BU4A 3F7XA 4N6OB 1O7MB 4WYKB 3LZAA 1O7NB 4GHOA 5KP3A 3D5IA 4EC6A 3AMOA 4MMYB 1I2FA 1W01A 1LOYA 3FG4A 1V74A 3DGMA 1KQS2 1BRNL 2W56A 1X1UA 2BO9B 3FSDA 5D81A 2XGLA 5ELUA 3MWZA 3ER7A 3MG3A 3WDGB 1A67A 1ISKA 3F8XA 5AYRB 4NPBA 1BSBA 1UI7A 1BSEA 3X40A 5IF6A 2CX0A 1BRGA 2XR8B 3QK9A 3M8CA 3CCU3 3Q90A 1O7WB 1FA3A 3Q2PA 3CD63 5LC7A 1W6YA 1JNQA 3BNDA 3EX9A 1B2UA 4KZ1A 4WFOA 2BMQB 3JUPA 1FGQA 4IPBA 5BXQA 1NWWA 4EYCA 2RCDA 2WGQA 3AMOB 4L8OA 1AVKA 4N3VA 3KFQC 1YJW3 2W56B 2P09A 2CW9A 3S67A 1RLSA 1YVSA 4J9AA 2P38A 2H0IA 1IVWA 2CK3H 2LYXA 5M19A 5RNTA 1BNJA 3BIRA 1UUVB 1QJGA 3A76A 4HAAA 4ILFA 1JJ22 7GSPA 1VQL3 1MGWA 4RZMA 1VQK3 1QVG2 1RJOA 3KN4A 5DRVA 4I5QA 3CCJ3 3G8ZA 2ZDJA 4GL6A 2CKFB 4XBTA 5AYSC 1OGZA 1RNTA 7STDA 1GD4A 1T2IA 1VQ73 5AI1A 4FMBA 4HM8B 3QRDA 4CJNA 1PYLA 4NHFA 1LOVA 1B2MA 2FNQA 1DMQA 3CNXA 5IENA 1MWSA 3CC43 3VGNA 6GSPA 3JVCA 1Q7HA 1O7PB 1RGLA 1I0VA 3URPA 1BRSA 1OGXA 2HMMB 3LYGA 3V92A 5KP1A 1NJI4 3K0ZA 6STDA 4HZBB 2H0GA 1BVIA 4J5GA 3L0RA 3X3ZA 3EB8A 3MHEA 2RFRA 3SLUA 2QEX3 2FGTA 1Q864 3SVAA 2BU4A 3AHSA 1GMQA 3FH1A 1KC84 3O8YA 2WGOA 2XSOB 4BTWA 3S29A 1GSPA 1B2XA 4R9LA 1HKXA 3G16A 2WOHA 3KE7A 3LT8A 1FUTA 1W5ZA 3NV0A 3NX0A 3PZWA 1N5HA 5CLKA 3T8UA 5M18A 4XB5A 5M1AA 4WP5A 2W9QA 2STDA 2RSXA 1MOLA 2I9WA 3N54B 4MEIA 1RNBA 1FZUA 2LQVA 4PEJA 1UCKA 2F98A 4H3UA 2HMNB 4QWTA 1IT7A 2KXGA 1BNGA 1NDOB 5AEUB 4N6TA 3S27A 2CFDA 3UL5A 3DZLA 3K63A 1M9GA 4RNYA 1TFKA 3NBBA 1N8QA 1EEJA 1BNFA 3UL6A 3ZG5A 1YHQ3 3E99A 2K0MA 4RNZA 1ROAA 2GEYA 2YFJB 1N9JA 1GY6A 3B4PA 4O02B 3NV0B 1UGIA 3CME3 1BSAA 1G0TA 2ZA4A 5JPPA 2GXFA 1AQZA 1BRIA 2JDIH 3OWSA 2R41A 1WTHA 1J2BA 1EA2A 2CFKA 3DMCA 1RN1A 5FW5A 1R4CA 2BMRB 3CXC2 3NHXA 1LQMB 2P0XA 1VQQA 2HOHA 1VQO3 3RGRA 3FG3A 3IJEB 4HM4B 1WMOA 5JBSA 1R4YA 1VQ93 1TFOA 2F99A 2B1XB 3MG2A 5IW9A 1DMNA 5IG4A 4STDA 1U5OA 4EV5A 1I70A 3G713 1M1K4 3PCSA 2ML6A 1CQSA 2OWPA 1BSCA 1GS3A 1RKYA 5IG3A 5JPUA 2E2UA 3GSPA 4OUQA 1GOYA 2AAEA 2YFLB 5HOHA 2K54A 1STFI 3LOYA 1ULJB 3LH4A 4XM4A 3MSOA 3Q1CA 3DXOA 3GRDA 3TDGA 1LOXA 1V57A 1B3SA 3KZTA 4XBXA 5STDA 1M1XB 5IG5A 1FGRA 2W0QA 5IG0A 1CEWI 4LMIA 3B8LA 1EG9B 1LRAA 2RBIA 2SBLA 1BUQA 1X1XA 1K41A 4FR9A 3GZXB 3DM8A 1GOUA 1FYSA 1QAKA 4R1KA 2E2TA 3WOFB 1K8A4 1RN4A 1JBTA 1D6UA 1VQ43 1OF5A 1D6ZA 4LSOA 2QA43 1VQP3 3GZBA 1JB4A 3X3YA 3FZWA 5CK6A 1W4NA 3EE1A 2F4YA 1QVF2 4CPKA 3OXAA 2KF6A 4OVMA 2IY2A 3U1WA 3LTBA 2OOVA 1IQXA 2GBWB 9RNTA 1Y4KA 1TRPA 3FG1A 1OHSA 4HYZA 2GSPA 5EVHA 1DETA 1LQGC 1WQLB 1AR0A 2XFSA 3D5GA 3ZFZA 1LNIA 3EN8A 1PU4A 3WA3A 3G6E3 1Q814 2H0HA 1Q42A 3LTDA 1GY5A 1WNHA 1S5AA 1B2ZA 3PS8A 1LNHA 2C4BA 3KIIA 3CCE3 3EHCA 1RTUA 3NQZA 2XFTA 4BTXA 1WMNA 1OF5B 2BNGA 3WMDA 1Z1SA 1A90A 2AADA 4O2HA 1YNVX 3UNLA 3T8NA 3DY5A 3KSPA 2O9UX 4O3VA 4CCVA 3DGLA 1JV2B 1QALA 2W04A 2ML5A 1BNEA 1FGTA 3F7SA 1BRJA 2HMLB 3D3LA 1DVDA 4N6MA 3SXXA 3IMAB 5D83A 3CCS3 1HZ1A 1HYFA 2WOFA 5A0OB 2CFGA 1KWIA 1OHPA 5G1LA 3X3XA 2ZHXB 1SIHA 4HOHA 5IEPA 1S723 1BANA 1PY3A 5ELJA 1B2SA 1DYUA 3SEDA 4R80A 1N9EA 1IYYA 1BNSA 1HU9A 1BSDA 1W02A 3PXMA 5AEWB 3GZRA 1BNRA 2IMJA 2IUJA 3DGNA 1RGFA 2OOVC 4HVNA 3CCL3 1YIT3 2M7OA 3F9SA 8CHOA 1RGCA 4GB5A 1YJ93 1BOXA 1MWRA 1BAOA 3K7CA 1BRHA 3MPHA 2OTJ3 1CYVA 1UCIA 1EKMA 1RRLA 1YVBI 3EBTA 2W6JH 1AY7A 4JF8A 4K1UA 4KFDA 3WHOA 3FF0A 3LT9A 4LEHA 3AGNA 3F40A 1RGAA 1JRQA 2XF3A 1JB5A 3OW22 2C11A 3I0YA 3RGAA 4BIRA 3BNCA 1K734 2BIRA 3KCHA 1BRKA 1IU7A 1N5PA 1ZX2A 2W03A 4GSPA 1JBRA 3CCV3 2GEXA 1CH0A
chains in the Genus database with same CATH topology
1RGHA 1T2HA 1UCLA 1BSCA 2KF3A 3SYUA 1C54A 1B2UA 1RGKA 3GSPA 1GOYA 2AAEA 5HOHA 1RCKA 3Q3FA 1X1WA 1BUJA 1ZGXA 1X1YA 3AGOA 1RCLA 1RLSA 1B21A 1GMPA 1YVSA 8RNTA 5RNTA 1G02A 1LOWA 5GSPA 1B3SA 1BNJA 3BIRA 5BIRA 1MGRA 4HAAA 6RNTA 2KF5A 7GSPA 1MGWA 3DGYA 1LRAA 1I2GA 2RBIA 1X1XA 1I3FA 1GOUA 1FYSA 1RNTA 2F5WA 1RN4A 1JBTA 1GMRA 1T2IA 3DH2A 5BU4A 1RGGA 1PYLA 1I2EA 2F4YA 1LOVA 2KF6A 1B2MA 3HOHA 1I8VA 2KF4A 1DE3A 1RSNA 6GSPA 1RGLA 1I0VA 3URPA 3WR2A 1BRSA 9RNTA 1TRPA 1BVIA 1FUSA 4J5GA 2GSPA 1DETA 3D5GA 4RNTA 1LNIA 2BU4A 1TRQA 3AHSA 1GMQA 1BIRA 1GSPA 1B2ZA 1B2XA 2C4BA 7RNTA 1RTUA 1B27A 1BU4A 2KAAA 1FUTA 2AADA 2F56A 1YNVX 1UCJA 1RMSA 1Q9EA 3A5EA 4J5KA 1BGSA 1BNEA 1BRJA 1RNBA 1FZUA 1UCKA 1FW7A 1RDSA 1RHLA 3D4AA 1HZ1A 1HYFA 3RNTA 1BNGA 1TTOA 1GOVA 4HOHA 1PY3A 1BANA 3AHWA 1B2SA 1BNFA 1IYYA 1JBSA 1BNSA 2F5MA 1BSDA 1B20A 1I0XA 3BU4A 1YGWA 1BNRA 1BSAA 2ZA4A 1RGFA 1AQZA 1BRIA 1RGCA 1BOXA 4GHOA 4BU4A 1BAOA 1I3IA 2RNTA 1BRHA 1I2FA 1SARA 2SARA 1LOYA 3D5IA 1A2PA 1BRNL 1UCIA 1RN1A 1X1UA 1AY7A 3WHOA 2HOHA 3AGNA 1RGAA 1RGEA 1R4YA 1BSBA 1BSEA 4BIRA 1BNIA 2BIRA 3KCHA 1BRGA 1BRKA 1JBRA 4GSPA 1I70A 1CH0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RGH A;  1T2H A;  1UCL A;  1BSC A;  2KF3 A;  3SYU A;  1C54 A;  1B2U A;  1RGK A;  3GSP A;  1GOY A;  2AAE A;  5HOH A;  1RCK A;  3Q3F A;  1X1W A;  1BUJ A;  1ZGX A;  1X1Y A;  3AGO A;  1RCL A;  1RLS A;  1B21 A;  1GMP A;  1YVS A;  8RNT A;  5RNT A;  1G02 A;  1LOW A;  5GSP A;  1B3S A;  1BNJ A;  3BIR A;  5BIR A;  1MGR A;  4HAA A;  6RNT A;  2KF5 A;  7GSP A;  1MGW A;  3DGY A;  1LRA A;  1I2G A;  2RBI A;  1X1X A;  1I3F A;  1GOU A;  1FYS A;  1RNT A;  2F5W A;  1RN4 A;  1JBT A;  1GMR A;  1T2I A;  3DH2 A;  5BU4 A;  1RGG A;  1PYL A;  1I2E A;  2F4Y A;  1LOV A;  2KF6 A;  1B2M A;  3HOH A;  1I8V A;  2KF4 A;  1DE3 A;  1RSN A;  6GSP A;  1RGL A;  1I0V A;  3URP A;  3WR2 A;  1BRS A;  9RNT A;  1TRP A;  1BVI A;  1FUS A;  4J5G A;  2GSP A;  1DET A;  3D5G A;  4RNT A;  1LNI A;  2BU4 A;  1TRQ A;  3AHS A;  1GMQ A;  1BIR A;  1GSP A;  1B2Z A;  1B2X A;  2C4B A;  7RNT A;  1RTU A;  1B27 A;  1BU4 A;  2KAA A;  1FUT A;  2AAD A;  2F56 A;  1YNV X;  1UCJ A;  1RMS A;  1Q9E A;  3A5E A;  4J5K A;  1BGS A;  1BNE A;  1BRJ A;  1RNB A;  1FZU A;  1UCK A;  1FW7 A;  1RDS A;  1RHL A;  3D4A A;  1HZ1 A;  1HYF A;  3RNT A;  1BNG A;  1TTO A;  1GOV A;  4HOH A;  1PY3 A;  1BAN A;  3AHW A;  1B2S A;  1BNF A;  1IYY A;  1JBS A;  1BNS A;  2F5M A;  1BSD A;  1B20 A;  1I0X A;  3BU4 A;  1YGW A;  1BNR A;  1BSA A;  2ZA4 A;  1RGF A;  1AQZ A;  1BRI A;  1RGC A;  1BOX A;  4GHO A;  4BU4 A;  1BAO A;  1I3I A;  2RNT A;  1BRH A;  1I2F A;  1SAR A;  2SAR A;  1LOY A;  3D5I A;  1A2P A;  1BRN L;  1UCI A;  1RN1 A;  1X1U A;  1AY7 A;  3WHO A;  2HOH A;  3AGN A;  1RGA A;  1RGE A;  1R4Y A;  1BSB A;  1BSE A;  4BIR A;  1BNI A;  2BIR A;  3KCH A;  1BRG A;  1BRK A;  1JBR A;  4GSP A;  1I70 A;  1CH0 A; 
#chains in the Genus database with same CATH topology
 1T2H A;  1ULI B;  4NRE A;  3EN1 B;  2KF3 A;  3KSE D;  3SYU A;  5LC6 A;  4HM1 B;  5AIG A;  3J7Y d;  3S5C A;  4KVH A;  3VF1 A;  1X1W A;  1BUJ A;  1ZGX A;  3PCR A;  2B24 B;  4RBN A;  1O7H B;  1UUG B;  3AGO A;  3PGB A;  1RCL A;  2HMO B;  2Q07 A;  3V98 A;  8RNT A;  2XSH B;  3CPW 2;  3N8B A;  1W7C A;  3LTC A;  4MMX B;  1MGR A;  5CF1 A;  3BLZ A;  1OPY A;  1T3B A;  2L1S A;  2W9P A;  3HI7 A;  3JUO A;  4BL3 A;  3DGY A;  1IVV A;  4O8S A;  1A2K A;  1VQM 3;  3EQQ B;  3HX8 A;  2C10 A;  4G1M B;  1L5G B;  1WMP A;  4EXR A;  1MWT A;  3LML A;  4J8T A;  4H61 A;  5G1K A;  3K5T A;  3LXU X;  2XGN A;  4JRF A;  3CC7 3;  1GMR A;  3DH2 A;  4FCZ A;  3NXJ A;  3F14 A;  4I4K A;  5BU4 A;  3I55 3;  2V1L A;  1QMA A;  1T5Y A;  1GY7 A;  1ZO2 A;  1I2E A;  4N6L A;  1DVC A;  2PNC A;  2K3D A;  3FCS B;  3HOH A;  1I8V A;  1OHO A;  2BT3 A;  1V58 A;  1DE3 A;  1RSN A;  1C7H A;  5AIF A;  2BHM A;  3FF2 A;  1K28 A;  1JN5 A;  1TJD A;  1E97 A;  1FUS A;  5TGN A;  3FGY A;  1YJN 3;  3D79 A;  3K9M C;  1TRQ A;  1A2V A;  4HBR A;  3HII A;  1DMM A;  4BL2 A;  4K1V A;  1F8N A;  2CWV A;  2GBX B;  1VQN 3;  2CH9 A;  3NUV A;  4FMA A;  1B27 A;  1BU4 A;  1NO3 A;  3SX1 A;  1FUW A;  4WWU C;  4HZ9 B;  3B7C A;  4HM7 B;  1MWU A;  3CPO A;  1UI8 A;  4X2H A;  4XDW A;  5DRE A;  1W2B 2;  2GU3 A;  3EF8 A;  1Q9E A;  3ECF A;  4KFE A;  4L7K A;  1Q82 4;  1BGS A;  3WOD G;  3JUQ A;  4LZI A;  3FKA A;  1JZO A;  2D42 A;  2Z77 A;  1JN5 B;  2XEP A;  1D6Y A;  2PZV A;  2CG1 A;  1EQK A;  1SQW A;  3D4A A;  1UGH I;  3RNT A;  1IK3 A;  1VZZ A;  2CHC A;  4FCM A;  2UUG C;  4KT3 B;  2IUK A;  1TTO A;  1Q40 A;  3OX9 A;  1PFP A;  3CC2 3;  1UDI I;  1U8C B;  3OWU A;  3AHW A;  1EUI C;  3IPT A;  4R9K A;  4AEQ A;  2O3O A;  1KSI A;  1JBS A;  1TUH A;  2W2C A;  1VQ8 3;  4N6U A;  3HK4 A;  1B20 A;  2OQE C;  4CDL A;  5KP4 A;  1YGW A;  1VQ6 3;  1JB2 A;  4N6N B;  4U13 A;  3BNB A;  1SJW A;  3ALA A;  3CCQ 3;  1G96 A;  2CG0 A;  1K9M 4;  3CU3 A;  4BU4 A;  2RNT A;  1I3I A;  2SAR A;  1SAR A;  2R4I A;  1TIJ A;  1A2P A;  4L8P A;  3X41 A;  1LXE A;  2MF7 A;  3NBJ A;  3WOE B;  1ROV A;  3VSY A;  4K61 A;  1IV9 A;  2E2V A;  2MC8 A;  3RDE A;  1YIJ 3;  1CYU A;  2HMK B;  1RGE A;  3DGO A;  2Y73 A;  1YI2 3;  1E3V A;  2XH9 A;  3JUN A;  1Q40 B;  3UJM A;  1GYB A;  3OV4 A;  1IQ8 A;  1BNI A;  4IIA A;  3STD A;  3ROB A;  1E3R A;  4MMZ B;  1YGE A;  1IT8 A;  2UX0 A;  2CX1 A;  2QIY A;  1FGM A;  1RGH A;  1UCL A;  3NM2 A;  4OK0 A;  5G2G A;  2OTL 3;  1FGO A;  2P0M A;  1RGK A;  2OCT A;  2A15 A;  1GD3 A;  4X2O A;  5CXO A;  1JKG A;  3BB9 A;  3B4O A;  4HM2 B;  1RCK A;  3Q3F A;  3X42 A;  2IYJ A;  1MNL A;  3U97 A;  1RN7 A;  1X1Y A;  5HGR A;  2CWT A;  1C54 A;  1B21 A;  1GMP A;  2KRT A;  3NQY A;  1G02 A;  1LOW A;  3HIG A;  4HKV B;  3N9H A;  5GSP A;  3T0U A;  2WO0 A;  5I97 A;  5BIR A;  1N8R 4;  2BMO B;  4WHA A;  4LGQ A;  3LTA A;  1OAC A;  4R4K A;  3CMA 3;  6RNT A;  2KF5 A;  2RGQ A;  3H3H A;  4HJL B;  4KFF A;  3H51 A;  1NU3 A;  2L4V A;  3KKG A;  4MJD A;  4XDV A;  5EEO A;  1I2G A;  3G4S 3;  1AVL A;  3S28 A;  3EJV A;  1I3F A;  3EBY A;  4HM0 B;  3NBR A;  3GZY B;  1TU5 A;  2F5W A;  4K90 B;  1STD A;  2J8X B;  5AII A;  3F8H A;  5D82 A;  1JKG B;  4AKZ A;  1KD1 4;  2UGI A;  4HM6 B;  3SOA A;  1RGG A;  2CFW A;  2FXT A;  2YFI B;  2XRX B;  4TX4 A;  1IV7 A;  4EV2 A;  1IVU A;  2KF4 A;  5CF2 A;  3DUK A;  2Z6B A;  2Z7A A;  1LVN A;  4Q53 A;  1TP6 A;  5BVB A;  3WR2 A;  5AIH A;  4FMC A;  1W00 A;  4BTY A;  1OH0 A;  1M90 4;  4RNT A;  4IT7 A;  4XBY A;  2D1W A;  2INX A;  3FLJ A;  3MG1 A;  1NB5 I;  4HM5 B;  4FMD A;  1BIR A;  3MKI A;  3HZP A;  4ORL A;  7RNT A;  1VQ5 3;  1UUW B;  5EQL A;  4LYL B;  1IDP A;  1JZD A;  4DKI A;  1AV4 A;  2KAA A;  1ZS7 A;  2F56 A;  1NB3 I;  3BNE A;  1W6G A;  3ZG0 A;  1NNV A;  1UCJ A;  4EBG A;  3EC9 A;  4HM3 B;  5FGO A;  1RMS A;  2GU1 A;  3A5E A;  1QAF A;  4WYK A;  1SPU A;  1W6C A;  4J5K A;  2OQE A;  2QGU A;  4N6V 0;  3JUM A;  3CNM A;  2Z76 A;  2IA7 A;  2P05 A;  3MYT A;  1ASK A;  1IVX A;  3OWY A;  1OCV A;  1FW7 A;  1RDS A;  4ZM8 A;  2YX9 A;  3GAX A;  4AKY A;  1RHL A;  3PYJ A;  3GWR A;  1RRH A;  3I56 3;  5IER A;  2CFL A;  3D9R A;  4FCJ A;  2ZL8 A;  3UB1 A;  3WA2 X;  3CCM 3;  1W2Z A;  2Y74 A;  1IQY A;  3SOY A;  1Q7Y 4;  1GOV A;  2CC3 A;  3V99 A;  1O7G B;  2CWU A;  5IEO A;  2HMJ B;  2F86 B;  2JQ5 A;  3G0K A;  3NM7 A;  2F5M A;  4EW5 A;  1SII A;  2KCD A;  3CCR 3;  1UW1 A;  2CIU A;  1I0X A;  1OUN A;  1US1 A;  3BU4 A;  3F7X A;  4N6O B;  1O7M B;  4WYK B;  3LZA A;  1O7N B;  4GHO A;  5KP3 A;  3D5I A;  4EC6 A;  3AMO A;  4MMY B;  1I2F A;  1W01 A;  1LOY A;  3FG4 A;  1V74 A;  3DGM A;  1KQS 2;  1BRN L;  2W56 A;  1X1U A;  2BO9 B;  3FSD A;  5D81 A;  2XGL A;  5ELU A;  3MWZ A;  3ER7 A;  3MG3 A;  3WDG B;  1A67 A;  1ISK A;  3F8X A;  5AYR B;  4NPB A;  1BSB A;  1UI7 A;  1BSE A;  3X40 A;  5IF6 A;  2CX0 A;  1BRG A;  2XR8 B;  3QK9 A;  3M8C A;  3CCU 3;  3Q90 A;  1O7W B;  1FA3 A;  3Q2P A;  3CD6 3;  5LC7 A;  1W6Y A;  1JNQ A;  3BND A;  3EX9 A;  1B2U A;  4KZ1 A;  4WFO A;  2BMQ B;  3JUP A;  1FGQ A;  4IPB A;  5BXQ A;  1NWW A;  4EYC A;  2RCD A;  2WGQ A;  3AMO B;  4L8O A;  1AVK A;  4N3V A;  3KFQ C;  1YJW 3;  2W56 B;  2P09 A;  2CW9 A;  3S67 A;  1RLS A;  1YVS A;  4J9A A;  2P38 A;  2H0I A;  1IVW A;  2CK3 H;  2LYX A;  5M19 A;  5RNT A;  1BNJ A;  3BIR A;  1UUV B;  1QJG A;  3A76 A;  4HAA A;  4ILF A;  1JJ2 2;  7GSP A;  1VQL 3;  1MGW A;  4RZM A;  1VQK 3;  1QVG 2;  1RJO A;  3KN4 A;  5DRV A;  4I5Q A;  3CCJ 3;  3G8Z A;  2ZDJ A;  4GL6 A;  2CKF B;  4XBT A;  5AYS C;  1OGZ A;  1RNT A;  7STD A;  1GD4 A;  1T2I A;  1VQ7 3;  5AI1 A;  4FMB A;  4HM8 B;  3QRD A;  4CJN A;  1PYL A;  4NHF A;  1LOV A;  1B2M A;  2FNQ A;  1DMQ A;  3CNX A;  5IEN A;  1MWS A;  3CC4 3;  3VGN A;  6GSP A;  3JVC A;  1Q7H A;  1O7P B;  1RGL A;  1I0V A;  3URP A;  1BRS A;  1OGX A;  2HMM B;  3LYG A;  3V92 A;  5KP1 A;  1NJI 4;  3K0Z A;  6STD A;  4HZB B;  2H0G A;  1BVI A;  4J5G A;  3L0R A;  3X3Z A;  3EB8 A;  3MHE A;  2RFR A;  3SLU A;  2QEX 3;  2FGT A;  1Q86 4;  3SVA A;  2BU4 A;  3AHS A;  1GMQ A;  3FH1 A;  1KC8 4;  3O8Y A;  2WGO A;  2XSO B;  4BTW A;  3S29 A;  1GSP A;  1B2X A;  4R9L A;  1HKX A;  3G16 A;  2WOH A;  3KE7 A;  3LT8 A;  1FUT A;  1W5Z A;  3NV0 A;  3NX0 A;  3PZW A;  1N5H A;  5CLK A;  3T8U A;  5M18 A;  4XB5 A;  5M1A A;  4WP5 A;  2W9Q A;  2STD A;  2RSX A;  1MOL A;  2I9W A;  3N54 B;  4MEI A;  1RNB A;  1FZU A;  2LQV A;  4PEJ A;  1UCK A;  2F98 A;  4H3U A;  2HMN B;  4QWT A;  1IT7 A;  2KXG A;  1BNG A;  1NDO B;  5AEU B;  4N6T A;  3S27 A;  2CFD A;  3UL5 A;  3DZL A;  3K63 A;  1M9G A;  4RNY A;  1TFK A;  3NBB A;  1N8Q A;  1EEJ A;  1BNF A;  3UL6 A;  3ZG5 A;  1YHQ 3;  3E99 A;  2K0M A;  4RNZ A;  1ROA A;  2GEY A;  2YFJ B;  1N9J A;  1GY6 A;  3B4P A;  4O02 B;  3NV0 B;  1UGI A;  3CME 3;  1BSA A;  1G0T A;  2ZA4 A;  5JPP A;  2GXF A;  1AQZ A;  1BRI A;  2JDI H;  3OWS A;  2R41 A;  1WTH A;  1J2B A;  1EA2 A;  2CFK A;  3DMC A;  1RN1 A;  5FW5 A;  1R4C A;  2BMR B;  3CXC 2;  3NHX A;  1LQM B;  2P0X A;  1VQQ A;  2HOH A;  1VQO 3;  3RGR A;  3FG3 A;  3IJE B;  4HM4 B;  1WMO A;  5JBS A;  1R4Y A;  1VQ9 3;  1TFO A;  2F99 A;  2B1X B;  3MG2 A;  5IW9 A;  1DMN A;  5IG4 A;  4STD A;  1U5O A;  4EV5 A;  1I70 A;  3G71 3;  1M1K 4;  3PCS A;  2ML6 A;  1CQS A;  2OWP A;  1BSC A;  1GS3 A;  1RKY A;  5IG3 A;  5JPU A;  2E2U A;  3GSP A;  4OUQ A;  1GOY A;  2AAE A;  2YFL B;  5HOH A;  2K54 A;  1STF I;  3LOY A;  1ULJ B;  3LH4 A;  4XM4 A;  3MSO A;  3Q1C A;  3DXO A;  3GRD A;  3TDG A;  1LOX A;  1V57 A;  1B3S A;  3KZT A;  4XBX A;  5STD A;  1M1X B;  5IG5 A;  1FGR A;  2W0Q A;  5IG0 A;  1CEW I;  4LMI A;  3B8L A;  1EG9 B;  1LRA A;  2RBI A;  2SBL A;  1BUQ A;  1X1X A;  1K41 A;  4FR9 A;  3GZX B;  3DM8 A;  1GOU A;  1FYS A;  1QAK A;  4R1K A;  2E2T A;  3WOF B;  1K8A 4;  1RN4 A;  1JBT A;  1D6U A;  1VQ4 3;  1OF5 A;  1D6Z A;  4LSO A;  2QA4 3;  1VQP 3;  3GZB A;  1JB4 A;  3X3Y A;  3FZW A;  5CK6 A;  1W4N A;  3EE1 A;  2F4Y A;  1QVF 2;  4CPK A;  3OXA A;  2KF6 A;  4OVM A;  2IY2 A;  3U1W A;  3LTB A;  2OOV A;  1IQX A;  2GBW B;  9RNT A;  1Y4K A;  1TRP A;  3FG1 A;  1OHS A;  4HYZ A;  2GSP A;  5EVH A;  1DET A;  1LQG C;  1WQL B;  1AR0 A;  2XFS A;  3D5G A;  3ZFZ A;  1LNI A;  3EN8 A;  1PU4 A;  3WA3 A;  3G6E 3;  1Q81 4;  2H0H A;  1Q42 A;  3LTD A;  1GY5 A;  1WNH A;  1S5A A;  1B2Z A;  3PS8 A;  1LNH A;  2C4B A;  3KII A;  3CCE 3;  3EHC A;  1RTU A;  3NQZ A;  2XFT A;  4BTX A;  1WMN A;  1OF5 B;  2BNG A;  3WMD A;  1Z1S A;  1A90 A;  2AAD A;  4O2H A;  1YNV X;  3UNL A;  3T8N A;  3DY5 A;  3KSP A;  2O9U X;  4O3V A;  4CCV A;  3DGL A;  1JV2 B;  1QAL A;  2W04 A;  2ML5 A;  1BNE A;  1FGT A;  3F7S A;  1BRJ A;  2HML B;  3D3L A;  1DVD A;  4N6M A;  3SXX A;  3IMA B;  5D83 A;  3CCS 3;  1HZ1 A;  1HYF A;  2WOF A;  5A0O B;  2CFG A;  1KWI A;  1OHP A;  5G1L A;  3X3X A;  2ZHX B;  1SIH A;  4HOH A;  5IEP A;  1S72 3;  1BAN A;  1PY3 A;  5ELJ A;  1B2S A;  1DYU A;  3SED A;  4R80 A;  1N9E A;  1IYY A;  1BNS A;  1HU9 A;  1BSD A;  1W02 A;  3PXM A;  5AEW B;  3GZR A;  1BNR A;  2IMJ A;  2IUJ A;  3DGN A;  1RGF A;  2OOV C;  4HVN A;  3CCL 3;  1YIT 3;  2M7O A;  3F9S A;  8CHO A;  1RGC A;  4GB5 A;  1YJ9 3;  1BOX A;  1MWR A;  1BAO A;  3K7C A;  1BRH A;  3MPH A;  2OTJ 3;  1CYV A;  1UCI A;  1EKM A;  1RRL A;  1YVB I;  3EBT A;  2W6J H;  1AY7 A;  4JF8 A;  4K1U A;  4KFD A;  3WHO A;  3FF0 A;  3LT9 A;  4LEH A;  3AGN A;  3F40 A;  1RGA A;  1JRQ A;  2XF3 A;  1JB5 A;  3OW2 2;  2C11 A;  3I0Y A;  3RGA A;  4BIR A;  3BNC A;  1K73 4;  2BIR A;  3KCH A;  1BRK A;  1IU7 A;  1N5P A;  1ZX2 A;  2W03 A;  4GSP A;  1JBR A;  3CCV 3;  2GEX A;  1CH0 A; 
#chains in the Genus database with same CATH homology
 1RGH A;  1T2H A;  1UCL A;  1BSC A;  2KF3 A;  3SYU A;  1C54 A;  1B2U A;  1RGK A;  3GSP A;  1GOY A;  2AAE A;  5HOH A;  1RCK A;  3Q3F A;  1X1W A;  1BUJ A;  1ZGX A;  1X1Y A;  3AGO A;  1RCL A;  1RLS A;  1B21 A;  1GMP A;  1YVS A;  8RNT A;  5RNT A;  1G02 A;  1LOW A;  5GSP A;  1B3S A;  1BNJ A;  3BIR A;  5BIR A;  1MGR A;  4HAA A;  6RNT A;  2KF5 A;  7GSP A;  1MGW A;  3DGY A;  1LRA A;  1I2G A;  2RBI A;  1X1X A;  1I3F A;  1GOU A;  1FYS A;  1RNT A;  2F5W A;  1RN4 A;  1JBT A;  1GMR A;  1T2I A;  3DH2 A;  5BU4 A;  1RGG A;  1PYL A;  1I2E A;  2F4Y A;  1LOV A;  2KF6 A;  1B2M A;  3HOH A;  1I8V A;  2KF4 A;  1DE3 A;  1RSN A;  6GSP A;  1RGL A;  1I0V A;  3URP A;  3WR2 A;  1BRS A;  9RNT A;  1TRP A;  1BVI A;  1FUS A;  4J5G A;  2GSP A;  1DET A;  3D5G A;  4RNT A;  1LNI A;  2BU4 A;  1TRQ A;  3AHS A;  1GMQ A;  1BIR A;  1GSP A;  1B2Z A;  1B2X A;  2C4B A;  7RNT A;  1RTU A;  1B27 A;  1BU4 A;  2KAA A;  1FUT A;  2AAD A;  2F56 A;  1YNV X;  1UCJ A;  1RMS A;  1Q9E A;  3A5E A;  4J5K A;  1BGS A;  1BNE A;  1BRJ A;  1RNB A;  1FZU A;  1UCK A;  1FW7 A;  1RDS A;  1RHL A;  3D4A A;  1HZ1 A;  1HYF A;  3RNT A;  1BNG A;  1TTO A;  1GOV A;  4HOH A;  1PY3 A;  1BAN A;  3AHW A;  1B2S A;  1BNF A;  1IYY A;  1JBS A;  1BNS A;  2F5M A;  1BSD A;  1B20 A;  1I0X A;  3BU4 A;  1YGW A;  1BNR A;  1BSA A;  2ZA4 A;  1RGF A;  1AQZ A;  1BRI A;  1RGC A;  1BOX A;  4GHO A;  4BU4 A;  1BAO A;  1I3I A;  2RNT A;  1BRH A;  1I2F A;  1SAR A;  2SAR A;  1LOY A;  3D5I A;  1A2P A;  1BRN L;  1UCI A;  1RN1 A;  1X1U A;  1AY7 A;  3WHO A;  2HOH A;  3AGN A;  1RGA A;  1RGE A;  1R4Y A;  1BSB A;  1BSE A;  4BIR A;  1BNI A;  2BIR A;  3KCH A;  1BRG A;  1BRK A;  1JBR A;  4GSP A;  1I70 A;  1CH0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...