1RNTA

Restrained least-squares refinement of the crystal structure of the ribonuclease t1(asterisk)2(prime)-guanylic acid complex at 1.9 angstroms resolution
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE T1 ISOZYME
publication title Restrained Least-Squares Refinement of the Crystal Structure of the Ribonuclease T1(Asterisk)2(Prime)-Guanylic Acid Complex at 1.9 Angstroms Resolution
pubmed rcsb
source organism Aspergillus oryzae
total genus 25
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1987-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1rntA00
1BAOA 1BRGA 2HOHA 1BSDA 1BRSA 4BU4A 1DE3A 3SYUA 2KAAA 5RNTA 1AY7A 2AADA 1JBTA 1B2ZA 1ZGXA 1I0XA 1RCKA 3HOHA 1Q9EA 1HZ1A 1X1YA 3Q3FA 5BU4A 1RCLA 1BSEA 1I2FA 1R4YA 1YNVX 3D5IA 1BRHA 2KF5A 1AQZA 1FYSA 1GOYA 1I3FA 1RGGA 1CH0A 7RNTA 1X1WA 1RGLA 1YVSA 2F56A 1SARA 4HAAA 3RNTA 1BU4A 3KCHA 1BRNL 1BNRA 4GHOA 1BRIA 1BNGA 3DH2A 1RGKA 1HYFA 3AHSA 1DETA 2KF6A 5HOHA 1B20A 1A2PA 1I8VA 1RTUA 2KF4A 1T2IA 1RGHA 1MGRA 1BSAA 1UCJA 7GSPA 2SARA 2C4BA 5GSPA 1BGSA 3GSPA 1PY3A 1BOXA 2AAEA 3AGOA 1RLSA 3D5GA 1BNFA 1JBRA 1I0VA 1B2XA 1TRQA 1RGAA 1I70A 2RBIA 1TRPA 2F5WA 1FUSA 1GMQA 3AGNA 3A5EA 1BVIA 1I2EA 1T2HA 1BIRA 4GSPA 3D4AA 1RGFA 1MGWA 3AHWA 1RDSA 1X1UA 1X1XA 4BIRA 1RN4A 1RNBA 8RNTA 1LOYA 1BNJA 2F5MA 1BSBA 1RMSA 3BIRA 2RNTA 4J5KA 1B2SA 6GSPA 4HOHA 1FZUA 1B2UA 1GMPA 3URPA 2KF3A 3WHOA 1LOVA 2ZA4A 1UCKA 1GOVA 1BRKA 1IYYA 4RNTA 1RHLA 1B2MA 2F4YA 1BUJA 5BIRA 2BU4A 1B27A 1RNTA 1LRAA 3DGYA 1BNIA 1B3SA 1UCLA 1YGWA 1B21A 1PYLA 3WR2A 1C54A 1BNSA 1BRJA 1BANA 1GMRA 1BNEA 9RNTA 1GOUA 1UCIA 1RN1A 1GSPA 6RNTA 2BIRA 1I2GA 1BSCA 3BU4A 1RGCA 1RGEA 1RSNA 4J5GA 1G02A 1FW7A 1I3IA 1JBSA 1TTOA 1FUTA 1LOWA 1LNIA 2GSPA
chains in the Genus database with same CATH superfamily
3UL5A 2ZHXB 2A15A 4CDLA 1BSDA 2GU1A 4L8PA 2Y74A 3SYUA 2Z76A 1V74A 2AADA 1GS3A 1IT7A 4HM3B 4PEJA 2KRTA 4EV5A 1MWTA 2QGUA 1NO3A 2BMQB 3HOHA 4HVNA 3CCQ3 1HZ1A 1YGEA 4XB5A 1S5AA 1D6UA 2CFLA 1BUQA 1VQK3 1I2FA 4H3UA 1WNHA 3D5IA 2BT3A 3EN1B 4FMCA 3DM8A 5KP4A 1RGGA 1K8A4 1CH0A 5AIHA 5DRVA 3WODG 3CC73 1X1WA 1IT8A 1RGLA 2B1XB 2F56A 4HAAA 3B4OA 1BNRA 2OOVC 3J7Yd 1MWRA 4XM4A 4EW5A 1FGQA 1BRIA 3DH2A 5JPPA 3WOFB 4R9KA 1DETA 2KF6A 1STFI 2HMJB 1B20A 2KF4A 2W9PA 1RTUA 3QK9A 1T2IA 4N3VA 1BSAA 3WOEB 1TFOA 2GBXB 5M18A 1NB5I 5GSPA 3GSPA 4HYZA 1JB2A 3KZTA 1V58A 3ECFA 2FXTA 1R4CA 3FCSB 1BNFA 3K5TA 1I0VA 4KFEA 3KIIA 3MHEA 1VZZA 3UNLA 3VF1A 3JUQA 1ZS7A 4FMDA 1TRPA 4AKZA 3V98A 1QMAA 2CWUA 4MJDA 3T0UA 3T8NA 3FSDA 3G16A 1FUSA 1GD3A 4FR9A 1GMQA 1QVG2 1DMMA 2QEX3 3FF2A 4KFDA 4BL3A 3MG2A 4HM4B 2XFSA 1UUWB 1Q814 2P38A 3VSYA 3EHCA 1Q42A 2IY2A 2W04A 2OQEC 3GZYB 3Q1CA 1MGWA 4H61A 3HZPA 4CJNA 3DGNA 3U97A 2Y73A 3EQQB 4N6MA 3CCE3 3BIRA 3HI7A 4IIAA 2D1WA 1W4NA 1QVF2 4DKIA 1JB5A 1DMQA 1YHQ3 2CKFB 3SOAA 3PZWA 1B2UA 1SIIA 2R41A 1N9JA 1OGZA 1K9M4 4HM7B 1HU9A 3KE7A 3OX9A 1D6YA 1T3BA 2GU3A 3KFQC 1E3RA 3ER7A 3PGBA 1IYYA 4AKYA 1NJI4 1B2MA 1JV2B 2F4YA 4AEQA 5IG4A 1VQ93 4KVHA 1BUJA 3GWRA 1FGRA 2GXFA 5BIRA 1DYUA 2IMJA 3EBTA 4HKVB 1ULIB 3E99A 1B27A 3MG3A 4WP5A 4FCMA 3PCRA 1IVUA 2HMMB 2KCDA 2BHMA 1KC84 1B21A 2LYXA 1CYVA 3DGOA 1STDA 1M9GA 1BNSA 3CCU3 3MWZA 2B24B 3SVAA 1RN1A 3Q90A 1T5YA 1MWUA 6RNTA 1KQS2 2C10A 2QA43 1IVVA 3CC43 2XGNA 3M8CA 3G4S3 3NBBA 2W03A 2HMNB 3OWYA 5IG5A 2RCDA 3ALAA 2CWTA 1OCVA 1K734 3EC9A 3NBJA 1TP6A 3KSPA 4HJLB 3CPOA 3LTBA 1LNIA 3EB8A 2GSPA 1VQN3 4HM8B 2Z6BA 1JNQA 1HKXA 1QAKA 2CHCA 4GL6A 2CIUA 1SIHA 3CCR3 2KAAA 2W56B 1ROVA 1TJDA 4WYKA 5RNTA 4EYCA 1JBTA 1ZGXA 2XSHB 1EEJA 3A76A 2GBWB 3LTDA 3FH1A 1OHSA 1I0XA 1Q7HA 1RCKA 2CFKA 1Q9EA 4HZ9B 3LT9A 4KT3B 1TU5A 4MEIA 1UUVB 3Q3FA 1N9EA 1RCLA 1W2ZA 2CC3A 2K54A 2WGOA 3NV0B 3F8HA 5TGNA 3LH4A 3EJVA 1GOYA 4HM2B 3VGNA 3NHXA 3SLUA 2CFDA 3OXAA 2PZVA 1W6CA 1YVSA 4I4KA 1SARA 4O02B 3RNTA 1JZDA 1JKGA 3KCHA 6STDA 3CCS3 2STDA 4R1KA 2IUKA 4GHOA 2F86B 3FG4A 1TUHA 3F8XA 4LZIA 1BNGA 3NUVA 3UB1A 3JUNA 1HYFA 3AHSA 4X2OA 5HOHA 2ML6A 4JRFA 1J2BA 4WWUC 1RGHA 1VQO3 7GSPA 1A90A 2OTL3 1MOLA 3D3LA 1UW1A 5CF1A 2XSOB 3OWUA 5M19A 1OACA 2AAEA 3AGOA 5ELJA 1TRQA 1W6YA 2RBIA 2W6JH 1JN5A 2ZL8A 3BLZA 2KXGA 3N8BA 3MKIA 4LYLB 2OOVA 3PXMA 3CME3 4WFOA 1UI7A 2UGIA 1Q824 3A5EA 1BVIA 3EBYA 3HX8A 3N9HA 4ZM8A 1EG9B 1QALA 1VQQA 2BMOB 4EV2A 3BNEA 1NU3A 4G1MB 1US1A 2FGTA 4KFFA 2OCTA 1X1UA 1X1XA 3BB9A 2D42A 1OF5B 1RNBA 3GRDA 4TX4A 3CPW2 2BMRB 1GY5A 3KSED 3DY5A 6GSPA 1EA2A 1U5OA 3PYJA 4BTXA 1NB3I 4HZBB 4XDVA 1FZUA 2JQ5A 3URPA 2O9UX 1Q40A 1N5PA 1VQM3 2PNCA 3JUPA 3CCM3 1CEWI 2ZA4A 1OH0A 5D83A 2GEYA 3NM7A 1AV4A 3FF0A 5DREA 1VQP3 1YJ93 1GOVA 2OTJ3 2OQEA 3G713 1Q7Y4 1RHLA 4XBTA 3B8LA 4N6V0 1LQMB 2YFJB 1RRLA 4R80A 4K1VA 4RNYA 1LNHA 4HM6B 1WMOA 3LZAA 2W0QA 1RJOA 2CG1A 4CPKA 3SEDA 3IPTA 3O8YA 4LGQA 1LXEA 1RNTA 4CCVA 1LRAA 3OW22 2XRXB 1N8R4 1OGXA 1W02A 3SXXA 1NNVA 2O3OA 1C54A 3T8UA 1MNLA 3I563 3HK4A 1O7HB 1GOUA 1VQ63 1KSIA 1NDOB 3RGRA 1CYUA 3LXUX 3BNBA 3MPHA 2E2TA 1M1XB 5JBSA 3X41A 3G0KA 1MWSA 3DMCA 1EQKA 1G96A 3SX1A 4XDWA 3B7CA 4HM5B 1LOXA 3DGLA 3FLJA 1I3IA 1JBSA 2E2VA 2CG0A 3LT8A 4JF8A 1FA3A 2WOHA 4HM1B 3GZXB 1BAOA 1BRGA 2HOHA 3CNMA 1IV7A 1BRSA 1G0TA 2XGLA 1DE3A 1AY7A 2RSXA 2ZDJA 1B2ZA 5AIGA 1JRQA 3S27A 1AR0A 4KZ1A 1CQSA 5EEOA 3S29A 1AVLA 3OWSA 3SOYA 2IYJA 1GYBA 1BSEA 3TDGA 1R4YA 1BRHA 2BNGA 3DGMA 1W2B2 3U1WA 3JUOA 1KWIA 3F9SA 2SBLA 2CK3H 3X3ZA 5AYRB 1YVBI 2MF7A 2LQVA 1C7HA 3K7CA 5IERA 1BU4A 3N54B 3V99A 3X42A 4MMZB 4BTYA 2K0MA 2YFLB 3FGYA 4MMYB 5D81A 1JJ22 2Z7AA 1UGHI 3IMAB 4BTWA 5AI1A 3MG1A 5FGOA 2WGQA 2J8XB 3LTAA 1O7GB 1I8VA 5STDA 3X3XA 5M1AA 1QJGA 2Z77A 2H0GA 3ZFZA 3STDA 1UCJA 5IW9A 2C4BA 1PY3A 3I0YA 2QIYA 1RLSA 3D5GA 3QRDA 2JDIH 1JBRA 5AIFA 1B2XA 1I70A 2CWVA 3DZLA 4LMIA 1FGMA 1DVDA 1TIJA 2UUGC 5IEOA 2F5WA 3FG3A 2CFGA 3UJMA 1O7MB 2IA7A 1RRHA 4RZMA 1I2EA 1BIRA 1FGTA 1W6GA 2RGQA 2MC8A 1OUNA 4GSPA 1VQ73 2M7OA 3NXJA 4N6NB 5AYSC 1RDSA 2UX0A 1GY6A 1PU4A 2F99A 1IQYA 3EX9A 1RN4A 3CCV3 1BNJA 4J5KA 4N6TA 1UUGB 1B2SA 4LSOA 3EE1A 3CNXA 1S723 3X40A 1IVWA 2YX9A 2KF3A 1UI8A 3NM2A 4R4KA 1E97A 5G1KA 5IG3A 3CCJ3 1Q40B 3D79A 4I5QA 1WMNA 2IUJA 1ROAA 1N8QA 1UDII 4RNTA 1GY7A 1RN7A 4EC6A 2Q07A 4J9AA 1IK3A 2E2UA 3MYTA 2W56A 4HM0B 4L8OA 1IVXA 1EUIC 4N6UA 5EVHA 3Q2PA 3GZRA 3WA2X 4EBGA 1U8CB 1A2KA 1SPUA 2L4VA 4XBXA 1LVNA 2V1LA 3G8ZA 1A67A 1VQ53 1K41A 3DXOA 1YGWA 1PYLA 5G2GA 3BNDA 1BRJA 5FW5A 1BANA 3HIGA 3NV0A 4RNZA 3AMOA 3K63A 3K0ZA 8CHOA 1WTHA 5IENA 1IQXA 1K28A 2BIRA 3H3HA 4NPBA 1M904 2W9QA 1L5GB 4STDA 1WMPA 2CW9A 2P09A 1YIT3 1RGCA 1RGEA 2XFTA 2WOFA 4J5GA 4BL2A 2FNQA 1G02A 3ROBA 2XEPA 3HIIA 3ZG0A 1FW7A 4HBRA 1JZOA 1VQ83 1SQWA 2HMLB 1LOWA 5CK6A 4K1UA 4N6LA 5CF2A 4O8SA 3DUKA 1KD14 1VQ43 4OK0A 4BU4A 1ULJB 3WMDA 4N6OB 4GB5A 5AEUB 1ZX2A 1ISKA 3LYGA 4FMAA 1IU7A 1IQ8A 1QAFA 4U13A 5AIIA 5LC6A 3B4PA 1X1YA 4OVMA 5EQLA 5BU4A 3LMLA 4FCJA 1YJW3 1YNVX 5G1LA 2WO0A 2KF5A 4ORLA 1AQZA 1FYSA 3PCSA 1I3FA 3KKGA 4R9LA 7RNTA 1SJWA 4K90B 1E3VA 3L0RA 1BRNL 3S5CA 3CCL3 3IJEB 1OF5A 5BVBA 3LTCA 1IV9A 4ILFA 1W5ZA 1RGKA 5ELUA 3JUMA 5IEPA 1RKYA 3CC23 1Y4KA 5CXOA 1A2PA 3ZG5A 1MGRA 3LOYA 5JPUA 1O7NB 2OWPA 2SARA 3F7SA 3EN8A 3F7XA 1DMNA 4WYKB 1BGSA 3K9MC 4FMBA 5HGRA 1W01A 2C11A 1BOXA 2P0XA 3NQZA 2HMOB 2F98A 1RGAA 3MSOA 5CLKA 5KP1A 3D9RA 2I9WA 3H51A 3S67A 1UGIA 2CH9A 3I553 3AGNA 1A2VA 1VQL3 1FGOA 1T2HA 4OUQA 1O7PB 2CX0A 4FCZA 1W00A 4O2HA 3CD63 2CFWA 5D82A 1JKGB 3D4AA 1RGFA 3AHWA 4J8TA 2GEXA 3S28A 4BIRA 1LQGC 1PFPA 2HMKB 4IPBA 8RNTA 1LOYA 2F5MA 1BSBA 1DVCA 1RMSA 2RNTA 3GZBA 3NX0A 2CX1A 2R4IA 4X2HA 1TFKA 2H0IA 1O7WB 4LEHA 4HOHA 3CMA3 1OPYA 5IF6A 1GMPA 3EF8A 3WA3A 3V92A 1GD4A 3WHOA 3GAXA 1LOVA 2H0HA 4EXRA 1UCKA 1Q864 4L7KA 2XR8B 5IG0A 3PS8A 2XF3A 4WHAA 2XH9A 3WDGB 1AVKA 1BRKA 1JN5B 3UL6A 5BXQA 1Z1SA 1YJN3 1V57A 2ML5A 1D6ZA 4K61A 4XBYA 5LC7A 3KN4A 1YIJ3 3NBRA 5KP3A 1W7CA 5AEWB 2L1SA 4MMXB 3RGAA 1WQLB 2BU4A 2RFRA 3NQYA 7STDA 3CXC2 3DGYA 1M1K4 1BNIA 1B3SA 1UCLA 2K3DA 2INXA 3WR2A 1ASKA 2P05A 1GMRA 1BNEA 2YFIB 3BNCA 3F14A 1ZO2A 3CU3A 2P0MA 3FZWA 4QWTA 9RNTA 1UCIA 1YI23 1GSPA 3AMOB 1F8NA 1EKMA 1FUWA 4RBNA 4NREA 3RDEA 5I97A 1I2GA 2W2CA 1BSCA 3FG1A 3BU4A 3JVCA 1JB4A 3G6E3 1RSNA 1NWWA 4NHFA 4IT7A 3OV4A 4O3VA 4Q53A 3F40A 1OHPA 1IDPA 1TTOA 1FUTA 5A0OB 3X3YA 1N5HA 3FKAA 1OHOA 2BO9B
chains in the Genus database with same CATH topology
1BAOA 1BRGA 2HOHA 1BSDA 1BRSA 4BU4A 1DE3A 3SYUA 2KAAA 5RNTA 1AY7A 2AADA 1JBTA 1B2ZA 1ZGXA 1I0XA 1RCKA 3HOHA 1Q9EA 1HZ1A 1X1YA 3Q3FA 5BU4A 1RCLA 1BSEA 1I2FA 1R4YA 1YNVX 3D5IA 1BRHA 2KF5A 1AQZA 1FYSA 1GOYA 1I3FA 1RGGA 1CH0A 7RNTA 1X1WA 1RGLA 1YVSA 2F56A 1SARA 4HAAA 3RNTA 1BU4A 3KCHA 1BRNL 1BNRA 4GHOA 1BRIA 1BNGA 3DH2A 1RGKA 1HYFA 3AHSA 1DETA 2KF6A 5HOHA 1B20A 1A2PA 1I8VA 1RTUA 2KF4A 1T2IA 1RGHA 1MGRA 1BSAA 1UCJA 7GSPA 2SARA 2C4BA 5GSPA 1BGSA 3GSPA 1PY3A 1BOXA 2AAEA 3AGOA 1RLSA 3D5GA 1BNFA 1JBRA 1I0VA 1B2XA 1TRQA 1RGAA 1I70A 2RBIA 1TRPA 2F5WA 1FUSA 1GMQA 3AGNA 3A5EA 1BVIA 1I2EA 1T2HA 1BIRA 4GSPA 3D4AA 1RGFA 1MGWA 3AHWA 1RDSA 1X1UA 1X1XA 4BIRA 1RN4A 1RNBA 8RNTA 1LOYA 1BNJA 2F5MA 1BSBA 1RMSA 3BIRA 2RNTA 4J5KA 1B2SA 6GSPA 4HOHA 1FZUA 1B2UA 1GMPA 3URPA 2KF3A 3WHOA 1LOVA 2ZA4A 1UCKA 1GOVA 1BRKA 1IYYA 4RNTA 1RHLA 1B2MA 2F4YA 1BUJA 5BIRA 2BU4A 1B27A 1RNTA 1LRAA 3DGYA 1BNIA 1B3SA 1UCLA 1YGWA 1B21A 1PYLA 3WR2A 1C54A 1BNSA 1BRJA 1BANA 1GMRA 1BNEA 9RNTA 1GOUA 1UCIA 1RN1A 1GSPA 6RNTA 2BIRA 1I2GA 1BSCA 3BU4A 1RGCA 1RGEA 1RSNA 4J5GA 1G02A 1FW7A 1I3IA 1JBSA 1TTOA 1FUTA 1LOWA 1LNIA 2GSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BAO A;  1BRG A;  2HOH A;  1BSD A;  1BRS A;  4BU4 A;  1DE3 A;  3SYU A;  2KAA A;  5RNT A;  1AY7 A;  2AAD A;  1JBT A;  1B2Z A;  1ZGX A;  1I0X A;  1RCK A;  3HOH A;  1Q9E A;  1HZ1 A;  1X1Y A;  3Q3F A;  5BU4 A;  1RCL A;  1BSE A;  1I2F A;  1R4Y A;  1YNV X;  3D5I A;  1BRH A;  2KF5 A;  1AQZ A;  1FYS A;  1GOY A;  1I3F A;  1RGG A;  1CH0 A;  7RNT A;  1X1W A;  1RGL A;  1YVS A;  2F56 A;  1SAR A;  4HAA A;  3RNT A;  1BU4 A;  3KCH A;  1BRN L;  1BNR A;  4GHO A;  1BRI A;  1BNG A;  3DH2 A;  1RGK A;  1HYF A;  3AHS A;  1DET A;  2KF6 A;  5HOH A;  1B20 A;  1A2P A;  1I8V A;  1RTU A;  2KF4 A;  1T2I A;  1RGH A;  1MGR A;  1BSA A;  1UCJ A;  7GSP A;  2SAR A;  2C4B A;  5GSP A;  1BGS A;  3GSP A;  1PY3 A;  1BOX A;  2AAE A;  3AGO A;  1RLS A;  3D5G A;  1BNF A;  1JBR A;  1I0V A;  1B2X A;  1TRQ A;  1RGA A;  1I70 A;  2RBI A;  1TRP A;  2F5W A;  1FUS A;  1GMQ A;  3AGN A;  3A5E A;  1BVI A;  1I2E A;  1T2H A;  1BIR A;  4GSP A;  3D4A A;  1RGF A;  1MGW A;  3AHW A;  1RDS A;  1X1U A;  1X1X A;  4BIR A;  1RN4 A;  1RNB A;  8RNT A;  1LOY A;  1BNJ A;  2F5M A;  1BSB A;  1RMS A;  3BIR A;  2RNT A;  4J5K A;  1B2S A;  6GSP A;  4HOH A;  1FZU A;  1B2U A;  1GMP A;  3URP A;  2KF3 A;  3WHO A;  1LOV A;  2ZA4 A;  1UCK A;  1GOV A;  1BRK A;  1IYY A;  4RNT A;  1RHL A;  1B2M A;  2F4Y A;  1BUJ A;  5BIR A;  2BU4 A;  1B27 A;  1RNT A;  1LRA A;  3DGY A;  1BNI A;  1B3S A;  1UCL A;  1YGW A;  1B21 A;  1PYL A;  3WR2 A;  1C54 A;  1BNS A;  1BRJ A;  1BAN A;  1GMR A;  1BNE A;  9RNT A;  1GOU A;  1UCI A;  1RN1 A;  1GSP A;  6RNT A;  2BIR A;  1I2G A;  1BSC A;  3BU4 A;  1RGC A;  1RGE A;  1RSN A;  4J5G A;  1G02 A;  1FW7 A;  1I3I A;  1JBS A;  1TTO A;  1FUT A;  1LOW A;  1LNI A;  2GSP A; 
#chains in the Genus database with same CATH topology
 3UL5 A;  2ZHX B;  2A15 A;  4CDL A;  1BSD A;  2GU1 A;  4L8P A;  2Y74 A;  3SYU A;  2Z76 A;  1V74 A;  2AAD A;  1GS3 A;  1IT7 A;  4HM3 B;  4PEJ A;  2KRT A;  4EV5 A;  1MWT A;  2QGU A;  1NO3 A;  2BMQ B;  3HOH A;  4HVN A;  3CCQ 3;  1HZ1 A;  1YGE A;  4XB5 A;  1S5A A;  1D6U A;  2CFL A;  1BUQ A;  1VQK 3;  1I2F A;  4H3U A;  1WNH A;  3D5I A;  2BT3 A;  3EN1 B;  4FMC A;  3DM8 A;  5KP4 A;  1RGG A;  1K8A 4;  1CH0 A;  5AIH A;  5DRV A;  3WOD G;  3CC7 3;  1X1W A;  1IT8 A;  1RGL A;  2B1X B;  2F56 A;  4HAA A;  3B4O A;  1BNR A;  2OOV C;  3J7Y d;  1MWR A;  4XM4 A;  4EW5 A;  1FGQ A;  1BRI A;  3DH2 A;  5JPP A;  3WOF B;  4R9K A;  1DET A;  2KF6 A;  1STF I;  2HMJ B;  1B20 A;  2KF4 A;  2W9P A;  1RTU A;  3QK9 A;  1T2I A;  4N3V A;  1BSA A;  3WOE B;  1TFO A;  2GBX B;  5M18 A;  1NB5 I;  5GSP A;  3GSP A;  4HYZ A;  1JB2 A;  3KZT A;  1V58 A;  3ECF A;  2FXT A;  1R4C A;  3FCS B;  1BNF A;  3K5T A;  1I0V A;  4KFE A;  3KII A;  3MHE A;  1VZZ A;  3UNL A;  3VF1 A;  3JUQ A;  1ZS7 A;  4FMD A;  1TRP A;  4AKZ A;  3V98 A;  1QMA A;  2CWU A;  4MJD A;  3T0U A;  3T8N A;  3FSD A;  3G16 A;  1FUS A;  1GD3 A;  4FR9 A;  1GMQ A;  1QVG 2;  1DMM A;  2QEX 3;  3FF2 A;  4KFD A;  4BL3 A;  3MG2 A;  4HM4 B;  2XFS A;  1UUW B;  1Q81 4;  2P38 A;  3VSY A;  3EHC A;  1Q42 A;  2IY2 A;  2W04 A;  2OQE C;  3GZY B;  3Q1C A;  1MGW A;  4H61 A;  3HZP A;  4CJN A;  3DGN A;  3U97 A;  2Y73 A;  3EQQ B;  4N6M A;  3CCE 3;  3BIR A;  3HI7 A;  4IIA A;  2D1W A;  1W4N A;  1QVF 2;  4DKI A;  1JB5 A;  1DMQ A;  1YHQ 3;  2CKF B;  3SOA A;  3PZW A;  1B2U A;  1SII A;  2R41 A;  1N9J A;  1OGZ A;  1K9M 4;  4HM7 B;  1HU9 A;  3KE7 A;  3OX9 A;  1D6Y A;  1T3B A;  2GU3 A;  3KFQ C;  1E3R A;  3ER7 A;  3PGB A;  1IYY A;  4AKY A;  1NJI 4;  1B2M A;  1JV2 B;  2F4Y A;  4AEQ A;  5IG4 A;  1VQ9 3;  4KVH A;  1BUJ A;  3GWR A;  1FGR A;  2GXF A;  5BIR A;  1DYU A;  2IMJ A;  3EBT A;  4HKV B;  1ULI B;  3E99 A;  1B27 A;  3MG3 A;  4WP5 A;  4FCM A;  3PCR A;  1IVU A;  2HMM B;  2KCD A;  2BHM A;  1KC8 4;  1B21 A;  2LYX A;  1CYV A;  3DGO A;  1STD A;  1M9G A;  1BNS A;  3CCU 3;  3MWZ A;  2B24 B;  3SVA A;  1RN1 A;  3Q90 A;  1T5Y A;  1MWU A;  6RNT A;  1KQS 2;  2C10 A;  2QA4 3;  1IVV A;  3CC4 3;  2XGN A;  3M8C A;  3G4S 3;  3NBB A;  2W03 A;  2HMN B;  3OWY A;  5IG5 A;  2RCD A;  3ALA A;  2CWT A;  1OCV A;  1K73 4;  3EC9 A;  3NBJ A;  1TP6 A;  3KSP A;  4HJL B;  3CPO A;  3LTB A;  1LNI A;  3EB8 A;  2GSP A;  1VQN 3;  4HM8 B;  2Z6B A;  1JNQ A;  1HKX A;  1QAK A;  2CHC A;  4GL6 A;  2CIU A;  1SIH A;  3CCR 3;  2KAA A;  2W56 B;  1ROV A;  1TJD A;  4WYK A;  5RNT A;  4EYC A;  1JBT A;  1ZGX A;  2XSH B;  1EEJ A;  3A76 A;  2GBW B;  3LTD A;  3FH1 A;  1OHS A;  1I0X A;  1Q7H A;  1RCK A;  2CFK A;  1Q9E A;  4HZ9 B;  3LT9 A;  4KT3 B;  1TU5 A;  4MEI A;  1UUV B;  3Q3F A;  1N9E A;  1RCL A;  1W2Z A;  2CC3 A;  2K54 A;  2WGO A;  3NV0 B;  3F8H A;  5TGN A;  3LH4 A;  3EJV A;  1GOY A;  4HM2 B;  3VGN A;  3NHX A;  3SLU A;  2CFD A;  3OXA A;  2PZV A;  1W6C A;  1YVS A;  4I4K A;  1SAR A;  4O02 B;  3RNT A;  1JZD A;  1JKG A;  3KCH A;  6STD A;  3CCS 3;  2STD A;  4R1K A;  2IUK A;  4GHO A;  2F86 B;  3FG4 A;  1TUH A;  3F8X A;  4LZI A;  1BNG A;  3NUV A;  3UB1 A;  3JUN A;  1HYF A;  3AHS A;  4X2O A;  5HOH A;  2ML6 A;  4JRF A;  1J2B A;  4WWU C;  1RGH A;  1VQO 3;  7GSP A;  1A90 A;  2OTL 3;  1MOL A;  3D3L A;  1UW1 A;  5CF1 A;  2XSO B;  3OWU A;  5M19 A;  1OAC A;  2AAE A;  3AGO A;  5ELJ A;  1TRQ A;  1W6Y A;  2RBI A;  2W6J H;  1JN5 A;  2ZL8 A;  3BLZ A;  2KXG A;  3N8B A;  3MKI A;  4LYL B;  2OOV A;  3PXM A;  3CME 3;  4WFO A;  1UI7 A;  2UGI A;  1Q82 4;  3A5E A;  1BVI A;  3EBY A;  3HX8 A;  3N9H A;  4ZM8 A;  1EG9 B;  1QAL A;  1VQQ A;  2BMO B;  4EV2 A;  3BNE A;  1NU3 A;  4G1M B;  1US1 A;  2FGT A;  4KFF A;  2OCT A;  1X1U A;  1X1X A;  3BB9 A;  2D42 A;  1OF5 B;  1RNB A;  3GRD A;  4TX4 A;  3CPW 2;  2BMR B;  1GY5 A;  3KSE D;  3DY5 A;  6GSP A;  1EA2 A;  1U5O A;  3PYJ A;  4BTX A;  1NB3 I;  4HZB B;  4XDV A;  1FZU A;  2JQ5 A;  3URP A;  2O9U X;  1Q40 A;  1N5P A;  1VQM 3;  2PNC A;  3JUP A;  3CCM 3;  1CEW I;  2ZA4 A;  1OH0 A;  5D83 A;  2GEY A;  3NM7 A;  1AV4 A;  3FF0 A;  5DRE A;  1VQP 3;  1YJ9 3;  1GOV A;  2OTJ 3;  2OQE A;  3G71 3;  1Q7Y 4;  1RHL A;  4XBT A;  3B8L A;  4N6V 0;  1LQM B;  2YFJ B;  1RRL A;  4R80 A;  4K1V A;  4RNY A;  1LNH A;  4HM6 B;  1WMO A;  3LZA A;  2W0Q A;  1RJO A;  2CG1 A;  4CPK A;  3SED A;  3IPT A;  3O8Y A;  4LGQ A;  1LXE A;  1RNT A;  4CCV A;  1LRA A;  3OW2 2;  2XRX B;  1N8R 4;  1OGX A;  1W02 A;  3SXX A;  1NNV A;  2O3O A;  1C54 A;  3T8U A;  1MNL A;  3I56 3;  3HK4 A;  1O7H B;  1GOU A;  1VQ6 3;  1KSI A;  1NDO B;  3RGR A;  1CYU A;  3LXU X;  3BNB A;  3MPH A;  2E2T A;  1M1X B;  5JBS A;  3X41 A;  3G0K A;  1MWS A;  3DMC A;  1EQK A;  1G96 A;  3SX1 A;  4XDW A;  3B7C A;  4HM5 B;  1LOX A;  3DGL A;  3FLJ A;  1I3I A;  1JBS A;  2E2V A;  2CG0 A;  3LT8 A;  4JF8 A;  1FA3 A;  2WOH A;  4HM1 B;  3GZX B;  1BAO A;  1BRG A;  2HOH A;  3CNM A;  1IV7 A;  1BRS A;  1G0T A;  2XGL A;  1DE3 A;  1AY7 A;  2RSX A;  2ZDJ A;  1B2Z A;  5AIG A;  1JRQ A;  3S27 A;  1AR0 A;  4KZ1 A;  1CQS A;  5EEO A;  3S29 A;  1AVL A;  3OWS A;  3SOY A;  2IYJ A;  1GYB A;  1BSE A;  3TDG A;  1R4Y A;  1BRH A;  2BNG A;  3DGM A;  1W2B 2;  3U1W A;  3JUO A;  1KWI A;  3F9S A;  2SBL A;  2CK3 H;  3X3Z A;  5AYR B;  1YVB I;  2MF7 A;  2LQV A;  1C7H A;  3K7C A;  5IER A;  1BU4 A;  3N54 B;  3V99 A;  3X42 A;  4MMZ B;  4BTY A;  2K0M A;  2YFL B;  3FGY A;  4MMY B;  5D81 A;  1JJ2 2;  2Z7A A;  1UGH I;  3IMA B;  4BTW A;  5AI1 A;  3MG1 A;  5FGO A;  2WGQ A;  2J8X B;  3LTA A;  1O7G B;  1I8V A;  5STD A;  3X3X A;  5M1A A;  1QJG A;  2Z77 A;  2H0G A;  3ZFZ A;  3STD A;  1UCJ A;  5IW9 A;  2C4B A;  1PY3 A;  3I0Y A;  2QIY A;  1RLS A;  3D5G A;  3QRD A;  2JDI H;  1JBR A;  5AIF A;  1B2X A;  1I70 A;  2CWV A;  3DZL A;  4LMI A;  1FGM A;  1DVD A;  1TIJ A;  2UUG C;  5IEO A;  2F5W A;  3FG3 A;  2CFG A;  3UJM A;  1O7M B;  2IA7 A;  1RRH A;  4RZM A;  1I2E A;  1BIR A;  1FGT A;  1W6G A;  2RGQ A;  2MC8 A;  1OUN A;  4GSP A;  1VQ7 3;  2M7O A;  3NXJ A;  4N6N B;  5AYS C;  1RDS A;  2UX0 A;  1GY6 A;  1PU4 A;  2F99 A;  1IQY A;  3EX9 A;  1RN4 A;  3CCV 3;  1BNJ A;  4J5K A;  4N6T A;  1UUG B;  1B2S A;  4LSO A;  3EE1 A;  3CNX A;  1S72 3;  3X40 A;  1IVW A;  2YX9 A;  2KF3 A;  1UI8 A;  3NM2 A;  4R4K A;  1E97 A;  5G1K A;  5IG3 A;  3CCJ 3;  1Q40 B;  3D79 A;  4I5Q A;  1WMN A;  2IUJ A;  1ROA A;  1N8Q A;  1UDI I;  4RNT A;  1GY7 A;  1RN7 A;  4EC6 A;  2Q07 A;  4J9A A;  1IK3 A;  2E2U A;  3MYT A;  2W56 A;  4HM0 B;  4L8O A;  1IVX A;  1EUI C;  4N6U A;  5EVH A;  3Q2P A;  3GZR A;  3WA2 X;  4EBG A;  1U8C B;  1A2K A;  1SPU A;  2L4V A;  4XBX A;  1LVN A;  2V1L A;  3G8Z A;  1A67 A;  1VQ5 3;  1K41 A;  3DXO A;  1YGW A;  1PYL A;  5G2G A;  3BND A;  1BRJ A;  5FW5 A;  1BAN A;  3HIG A;  3NV0 A;  4RNZ A;  3AMO A;  3K63 A;  3K0Z A;  8CHO A;  1WTH A;  5IEN A;  1IQX A;  1K28 A;  2BIR A;  3H3H A;  4NPB A;  1M90 4;  2W9Q A;  1L5G B;  4STD A;  1WMP A;  2CW9 A;  2P09 A;  1YIT 3;  1RGC A;  1RGE A;  2XFT A;  2WOF A;  4J5G A;  4BL2 A;  2FNQ A;  1G02 A;  3ROB A;  2XEP A;  3HII A;  3ZG0 A;  1FW7 A;  4HBR A;  1JZO A;  1VQ8 3;  1SQW A;  2HML B;  1LOW A;  5CK6 A;  4K1U A;  4N6L A;  5CF2 A;  4O8S A;  3DUK A;  1KD1 4;  1VQ4 3;  4OK0 A;  4BU4 A;  1ULJ B;  3WMD A;  4N6O B;  4GB5 A;  5AEU B;  1ZX2 A;  1ISK A;  3LYG A;  4FMA A;  1IU7 A;  1IQ8 A;  1QAF A;  4U13 A;  5AII A;  5LC6 A;  3B4P A;  1X1Y A;  4OVM A;  5EQL A;  5BU4 A;  3LML A;  4FCJ A;  1YJW 3;  1YNV X;  5G1L A;  2WO0 A;  2KF5 A;  4ORL A;  1AQZ A;  1FYS A;  3PCS A;  1I3F A;  3KKG A;  4R9L A;  7RNT A;  1SJW A;  4K90 B;  1E3V A;  3L0R A;  1BRN L;  3S5C A;  3CCL 3;  3IJE B;  1OF5 A;  5BVB A;  3LTC A;  1IV9 A;  4ILF A;  1W5Z A;  1RGK A;  5ELU A;  3JUM A;  5IEP A;  1RKY A;  3CC2 3;  1Y4K A;  5CXO A;  1A2P A;  3ZG5 A;  1MGR A;  3LOY A;  5JPU A;  1O7N B;  2OWP A;  2SAR A;  3F7S A;  3EN8 A;  3F7X A;  1DMN A;  4WYK B;  1BGS A;  3K9M C;  4FMB A;  5HGR A;  1W01 A;  2C11 A;  1BOX A;  2P0X A;  3NQZ A;  2HMO B;  2F98 A;  1RGA A;  3MSO A;  5CLK A;  5KP1 A;  3D9R A;  2I9W A;  3H51 A;  3S67 A;  1UGI A;  2CH9 A;  3I55 3;  3AGN A;  1A2V A;  1VQL 3;  1FGO A;  1T2H A;  4OUQ A;  1O7P B;  2CX0 A;  4FCZ A;  1W00 A;  4O2H A;  3CD6 3;  2CFW A;  5D82 A;  1JKG B;  3D4A A;  1RGF A;  3AHW A;  4J8T A;  2GEX A;  3S28 A;  4BIR A;  1LQG C;  1PFP A;  2HMK B;  4IPB A;  8RNT A;  1LOY A;  2F5M A;  1BSB A;  1DVC A;  1RMS A;  2RNT A;  3GZB A;  3NX0 A;  2CX1 A;  2R4I A;  4X2H A;  1TFK A;  2H0I A;  1O7W B;  4LEH A;  4HOH A;  3CMA 3;  1OPY A;  5IF6 A;  1GMP A;  3EF8 A;  3WA3 A;  3V92 A;  1GD4 A;  3WHO A;  3GAX A;  1LOV A;  2H0H A;  4EXR A;  1UCK A;  1Q86 4;  4L7K A;  2XR8 B;  5IG0 A;  3PS8 A;  2XF3 A;  4WHA A;  2XH9 A;  3WDG B;  1AVK A;  1BRK A;  1JN5 B;  3UL6 A;  5BXQ A;  1Z1S A;  1YJN 3;  1V57 A;  2ML5 A;  1D6Z A;  4K61 A;  4XBY A;  5LC7 A;  3KN4 A;  1YIJ 3;  3NBR A;  5KP3 A;  1W7C A;  5AEW B;  2L1S A;  4MMX B;  3RGA A;  1WQL B;  2BU4 A;  2RFR A;  3NQY A;  7STD A;  3CXC 2;  3DGY A;  1M1K 4;  1BNI A;  1B3S A;  1UCL A;  2K3D A;  2INX A;  3WR2 A;  1ASK A;  2P05 A;  1GMR A;  1BNE A;  2YFI B;  3BNC A;  3F14 A;  1ZO2 A;  3CU3 A;  2P0M A;  3FZW A;  4QWT A;  9RNT A;  1UCI A;  1YI2 3;  1GSP A;  3AMO B;  1F8N A;  1EKM A;  1FUW A;  4RBN A;  4NRE A;  3RDE A;  5I97 A;  1I2G A;  2W2C A;  1BSC A;  3FG1 A;  3BU4 A;  3JVC A;  1JB4 A;  3G6E 3;  1RSN A;  1NWW A;  4NHF A;  4IT7 A;  3OV4 A;  4O3V A;  4Q53 A;  3F40 A;  1OHP A;  1IDP A;  1TTO A;  1FUT A;  5A0O B;  3X3Y A;  1N5H A;  3FKA A;  1OHO A;  2BO9 B; 
#chains in the Genus database with same CATH homology
 1BAO A;  1BRG A;  2HOH A;  1BSD A;  1BRS A;  4BU4 A;  1DE3 A;  3SYU A;  2KAA A;  5RNT A;  1AY7 A;  2AAD A;  1JBT A;  1B2Z A;  1ZGX A;  1I0X A;  1RCK A;  3HOH A;  1Q9E A;  1HZ1 A;  1X1Y A;  3Q3F A;  5BU4 A;  1RCL A;  1BSE A;  1I2F A;  1R4Y A;  1YNV X;  3D5I A;  1BRH A;  2KF5 A;  1AQZ A;  1FYS A;  1GOY A;  1I3F A;  1RGG A;  1CH0 A;  7RNT A;  1X1W A;  1RGL A;  1YVS A;  2F56 A;  1SAR A;  4HAA A;  3RNT A;  1BU4 A;  3KCH A;  1BRN L;  1BNR A;  4GHO A;  1BRI A;  1BNG A;  3DH2 A;  1RGK A;  1HYF A;  3AHS A;  1DET A;  2KF6 A;  5HOH A;  1B20 A;  1A2P A;  1I8V A;  1RTU A;  2KF4 A;  1T2I A;  1RGH A;  1MGR A;  1BSA A;  1UCJ A;  7GSP A;  2SAR A;  2C4B A;  5GSP A;  1BGS A;  3GSP A;  1PY3 A;  1BOX A;  2AAE A;  3AGO A;  1RLS A;  3D5G A;  1BNF A;  1JBR A;  1I0V A;  1B2X A;  1TRQ A;  1RGA A;  1I70 A;  2RBI A;  1TRP A;  2F5W A;  1FUS A;  1GMQ A;  3AGN A;  3A5E A;  1BVI A;  1I2E A;  1T2H A;  1BIR A;  4GSP A;  3D4A A;  1RGF A;  1MGW A;  3AHW A;  1RDS A;  1X1U A;  1X1X A;  4BIR A;  1RN4 A;  1RNB A;  8RNT A;  1LOY A;  1BNJ A;  2F5M A;  1BSB A;  1RMS A;  3BIR A;  2RNT A;  4J5K A;  1B2S A;  6GSP A;  4HOH A;  1FZU A;  1B2U A;  1GMP A;  3URP A;  2KF3 A;  3WHO A;  1LOV A;  2ZA4 A;  1UCK A;  1GOV A;  1BRK A;  1IYY A;  4RNT A;  1RHL A;  1B2M A;  2F4Y A;  1BUJ A;  5BIR A;  2BU4 A;  1B27 A;  1RNT A;  1LRA A;  3DGY A;  1BNI A;  1B3S A;  1UCL A;  1YGW A;  1B21 A;  1PYL A;  3WR2 A;  1C54 A;  1BNS A;  1BRJ A;  1BAN A;  1GMR A;  1BNE A;  9RNT A;  1GOU A;  1UCI A;  1RN1 A;  1GSP A;  6RNT A;  2BIR A;  1I2G A;  1BSC A;  3BU4 A;  1RGC A;  1RGE A;  1RSN A;  4J5G A;  1G02 A;  1FW7 A;  1I3I A;  1JBS A;  1TTO A;  1FUT A;  1LOW A;  1LNI A;  2GSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...