1RNTA

Restrained least-squares refinement of the crystal structure of the ribonuclease t1(asterisk)2(prime)-guanylic acid complex at 1.9 angstroms resolution
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
b'ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE T1 ISOZYME
publication title Restrained Least-Squares Refinement of the Crystal Structure of the Ribonuclease T1(Asterisk)2(Prime)-Guanylic Acid Complex at 1.9 Angstroms Resolution
pubmed rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase(endoribonuclease)
total genus 25
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1987-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1rntA00
1B21A 1BU4A 3SYUA 1UCKA 1I70A 1RGKA 4BIRA 1IYYA 3DH2A 1X1WA 1BNSA 1TRQA 2F5WA 1B2SA 1I0XA 1BSEA 1RTUA 1UCIA 1B2UA 1BNRA 1RLSA 1BUJA 3GSPA 1RGEA 1DETA 1FUSA 3BIRA 3A5EA 7RNTA 1BOXA 1BRHA 1GMPA 1LRAA 1MGRA 1RN1A 3Q3FA 4GSPA 1FZUA 5BIRA 3URPA 1DE3A 1CH0A 1BANA 2ZA4A 4RNTA 5HOHA 1AQZA 2BU4A 1MGWA 2KF3A 3BU4A 1UCJA 1UCLA 1B20A 1I0VA 1B2XA 1X1XA 1BSAA 1X1UA 4J5GA 3WHOA 1A2PA 2F56A 1FUTA 2KAAA 1C54A 1B2ZA 1TRPA 1BRNL 6RNTA 5BU4A 1BRJA 1I2EA 4BU4A 3D4AA 4GHOA 3DGYA 2KF5A 1FW7A 1Q9EA 1BSDA 4HOHA 2AADA 1GOVA 1FYSA 1BVIA 1GOUA 4J5KA 1RGHA 1I3IA 1RSNA 5GSPA 1RN4A 5RNTA 2C4BA 1TTOA 1RCKA 2KF6A 4HAAA 1I3FA 1BSCA 1BGSA 1RMSA 1PY3A 1PYLA 3AGOA 2GSPA 1B27A 2F5MA 1JBTA 1I8VA 1R4YA 3AHSA 1GMRA 1BSBA 1BRKA 1AY7A 1G02A 1I2GA 1BRGA 1RDSA 1BNFA 2F4YA 1GOYA 1T2HA 1GSPA 1YNVX 1BNEA 9RNTA 1BIRA 2RNTA 1RHLA 1RNBA 1BRIA 1RGCA 1YVSA 1RGAA 1BAOA 1BNIA 3D5IA 1LNIA 1I2FA 1ZGXA 3RNTA 1X1YA 3AHWA 3KCHA 6GSPA 1BNJA 3AGNA 1YGWA 2RBIA 1LOWA 1RNTA 7GSPA 1RGLA 1GMQA 1SARA 3D5GA 2AAEA 1RGGA 1RGFA 1JBRA 1HZ1A 1B3SA 2SARA 3WR2A 1BNGA 3HOHA 8RNTA 1LOVA 2KF4A 1B2MA 1RCLA 1T2IA 1LOYA 2BIRA 1JBSA 1BRSA 1HYFA 2HOHA
chains in the Genus database with same CATH superfamily
2CWUA 3CCL3 1W5ZA 2P0XA 3F7XA 1JB4A 1JNQA 3SYUA 1UCKA 1FUWA 2K54A 1CYVA 2CKFB 3FCSB 3OWYA 4MEIA 2GU1A 3DH2A 5IEPA 1RJOA 3CNMA 3PCSA 3GZBA 3NQYA 1KQS2 2F5WA 2WGOA 1K41A 4GB5A 1T3BA 2F98A 4R1KA 3CME3 1RTUA 1IU7A 1O7PB 4HYZA 1B2UA 4RBNA 1BNRA 4LYLB 5M1AA 2W04A 4QWTA 1S5AA 3BIRA 3A5EA 3NX0A 1GD3A 1A90A 1G0TA 7RNTA 2RSXA 1BOXA 5HGRA 1BRHA 3NV0B 1LRAA 4CJNA 2V1LA 1YIJ3 4HBRA 3CPOA 1W01A 3LT8A 2Z77A 1A2VA 4N6UA 5BVBA 1MNLA 1E3VA 4NREA 1IV7A 1R4CA 2UX0A 1W00A 3BB9A 5I97A 4XBYA 2ZA4A 4RNTA 8CHOA 5HOHA 2A15A 1OHSA 2KF3A 1VQ63 1QMAA 4FMDA 2BMQB 3L0RA 1UCJA 3SVAA 1U8CB 2OOVA 1VQN3 4LMIA 3HI7A 4K1VA 1B2ZA 2WOHA 3G16A 1TP6A 3HIIA 4H3UA 1OHPA 1VQ53 1A2KA 1IT7A 1YIT3 3D9RA 4GHOA 2H0GA 1C7HA 3CU3A 2W0QA 3FLJA 3G6E3 4FMCA 4HOHA 4PEJA 1GOVA 2CH9A 2P38A 4HZBB 3RGAA 1BVIA 3OV4A 3NBBA 3CC43 4DKIA 1QAKA 1Q7Y4 5IF6A 3G0KA 1GY6A 1FGTA 1TFKA 1Q814 5RNTA 1GY5A 2WGQA 4KFFA 3SEDA 2FGTA 3NUVA 1RCKA 1Q824 2K0MA 2YFLB 1O7WB 3FG4A 3WA3A 1OGXA 1ZX2A 1ISKA 1IVVA 3WDGB 1M1XB 3WODG 1EQKA 1PYLA 3OWSA 1B27A 2Z7AA 3DGOA 4BTYA 1O7GB 1SQWA 2HMOB 3QRDA 3PGBA 1I8VA 4TX4A 3UJMA 3AHSA 1PFPA 1BSBA 3EHCA 1AY7A 1G02A 1WMOA 3I563 4O8SA 3S29A 1IK3A 2WO0A 3TDGA 3SOYA 1UGIA 3K0ZA 3MG3A 3S67A 1QJGA 3B4OA 1KC84 2KRTA 1JV2B 1BIRA 3LTAA 1VQK3 4CCVA 2CWTA 3NM2A 2LYXA 4WP5A 1RHLA 2CFWA 2PZVA 1K734 3LOYA 2UUGC 4HM0B 1JN5A 4OK0A 3CCQ3 2CFLA 1BNIA 3GZRA 1Q40A 3CCS3 1N5HA 1DMNA 1LNIA 1I2FA 1IDPA 1ZGXA 3AHWA 1TIJA 2H0IA 1STFI 1CEWI 3S5CA 3NXJA 1IQYA 2INXA 5FW5A 1JRQA 4WWUC 1GMQA 1SARA 2AAEA 1MWUA 1Z1SA 4KFDA 4XDVA 3CD63 1RGFA 2FNQA 4X2OA 2SARA 3N8BA 3LTCA 4HM3B 5ELJA 3SXXA 2L1SA 8RNTA 1LOVA 2KF4A 2W6JH 1RCLA 4OVMA 1LOYA 2BIRA 2STDA 3D79A 1BRSA 4HM2B 1HYFA 1VQP3 1SJWA 1JZOA 1AV4A 3K63A 4HM5B 1BU4A 3MSOA 1GD4A 1I70A 1K9M4 4AKYA 1RGKA 5AEUB 3EC9A 4BIRA 4MMZB 2ZHXB 3X3XA 2BNGA 1BNSA 1TRQA 2BT3A 3LMLA 1ZS7A 3O8YA 4K1UA 3S27A 4EW5A 4Q53A 4FCZA 2CC3A 2QA43 3KIIA 2FXTA 1W4NA 5AYRB 1RGEA 1DETA 3VF1A 2OOVC 3GAXA 3B8LA 1RN1A 2HMJB 2WOFA 3KZTA 5LC7A 3SLUA 1CYUA 4GSPA 4U13A 3GWRA 5BIRA 2JDIH 3DGLA 4RNZA 1DE3A 1CH0A 4HKVB 1OHOA 1O7NB 4KVHA 3EX9A 1AQZA 2ML6A 3EN1B 3X3ZA 5IENA 1MGWA 3IPTA 1V57A 1N5PA 1UCLA 2IUJA 4CPKA 1JN5B 3RGRA 1B20A 2IY2A 1B2XA 2QGUA 3LXUX 4ORLA 1FGOA 2Y73A 1C54A 4KFEA 4BL2A 2KAAA 1D6ZA 1BRNL 3KE7A 6RNTA 2OWPA 2YFIB 1NJI4 4FMAA 1DYUA 3DGYA 3HIGA 5CF2A 3CXC2 1WNHA 2KF5A 3F40A 1BSDA 4HJLB 2CX0A 3JUMA 1FYSA 1N9EA 2R4IA 3CCV3 3KSPA 5IERA 1NO3A 4J5KA 4N6TA 1EG9B 1I3IA 1JKGA 1LNHA 1UI8A 3FG3A 5M19A 1NU3A 5GSPA 1YVBI 4IT7A 2E2UA 4MJDA 1DVDA 6STDA 1W2ZA 4RNYA 3F9SA 5FGOA 2C4BA 1YJ93 4N6V0 5EQLA 5AI1A 3ZG0A 4XB5A 4HZ9B 3FH1A 1SPUA 3JUOA 1QAFA 1ZO2A 2GU3A 1KWIA 3EBTA 2HMKB 4WFOA 1E97A 1RMSA 2W56A 1PY3A 3X3YA 3AGOA 3JUPA 3MKIA 4R80A 3UL5A 3DUKA 5D83A 1M904 4KZ1A 3MPHA 3G8ZA 3MHEA 2IUKA 4G1MB 3FKAA 1OCVA 1GMRA 2CFDA 2B24B 4NPBA 2IA7A 3DMCA 4EXRA 4FR9A 2XSOB 4J8TA 1LQGC 5AYSC 3F8HA 1T2HA 2CWVA 1GSPA 1U5OA 3EF8A 1FGQA 1YNVX 1BNEA 1LOXA 3PYJA 4XBXA 1ROAA 4R9KA 3EE1A 1US1A 3F14A 4X2HA 1BRIA 1T5YA 1W7CA 1YVSA 1RNBA 2GBXB 1MWRA 2Q07A 3J7Yd 1QVF2 5AIGA 1NWWA 2XSHB 3PCRA 4MMYB 4I4KA 4J9AA 1STDA 2MF7A 2RBIA 2XRXB 4WYKA 2CX1A 4L8PA 2LQVA 4BTWA 1DVCA 2CK3H 3D5GA 1ULJB 4O02B 7GSPA 3CC73 2XGLA 1RGGA 3CNXA 1B3SA 4JF8A 3CCR3 3WR2A 2K3DA 3I0YA 2P0MA 3H51A 4MMXB 1UI7A 1RN7A 2E2TA 4RZMA 2KXGA 3F8XA 1LVNA 3Q90A 1T2IA 3RDEA 1JBSA 3GZXB 2H0HA 2XFSA 1VQQA 1B21A 3F7SA 5G1KA 1WMPA 3UL6A 1UUVB 4KT3B 3CPW2 1W6GA 1O7MB 4AKZA 1OF5A 1UUGB 2JQ5A 1UGHI 4N6NB 3VSYA 1IYYA 5CF1A 2MC8A 4I5QA 3FG1A 2W56B 3G713 2BO9B 1VQ43 1I0XA 4O2HA 2P05A 4XM4A 1UCIA 4HM4B 1RLSA 1FGRA 3GSPA 5LC6A 3Q1CA 3SOAA 1FUSA 2KCDA 3A76A 1QALA 2I9WA 4EC6A 3DM8A 3FZWA 2P09A 1W02A 4HVNA 1AR0A 2R41A 2CFKA 3CCJ3 3X42A 3D3LA 2XH9A 4FCJA 1FZUA 1EA2A 2W2CA 2GEXA 5IG0A 3URPA 2HMLB 4LSOA 2BU4A 3JVCA 3BLZA 1W6CA 5AEWB 2M7OA 1I0VA 1X1XA 4J5GA 3WHOA 2CG1A 2BMOB 1A2PA 1M9GA 1FUTA 2F56A 2CG0A 1ASKA 1F8NA 5EEOA 4NHFA 3D4AA 4BU4A 5CXOA 2D42A 4WYKB 3LYGA 1FW7A 1Q9EA 4EV5A 3SX1A 3FGYA 2BMRB 2ML5A 3LH4A 1NB3I 1RGHA 2CIUA 3DZLA 3CMA3 3K5TA 3KFQC 1RSNA 4IIAA 1VQ93 5AIHA 1RN4A 4HM1B 1VQ73 3CCE3 4OUQA 3UNLA 3V98A 4EYCA 3WOFB 1JB2A 3FF0A 2KF6A 1YJW3 1S723 3EN8A 4BL3A 3BNCA 1I3FA 1SIHA 1BSCA 1BGSA 3ALAA 2Z6BA 3BNDA 3FSDA 2XGNA 3JUNA 1OACA 4R9LA 1EEJA 5JPUA 2QIYA 1Q40B 1W6YA 2GSPA 1V74A 1WQLB 2RCDA 2W9QA 1A67A 2F5MA 2GXFA 3CC23 1NDOB 1UW1A 3B7CA 1L5GB 1IT8A 3EBYA 1Q42A 5DREA 5IG3A 1Q864 1BRKA 1JJ22 1I2GA 3BNBA 1BNFA 1IV9A 2F4YA 1GOYA 2HMMB 3DGMA 3AMOA 4EV2A 2J8XB 1GS3A 1TUHA 3DY5A 2W03A 1RRLA 3OW22 3IJEB 3EQQB 3WOEB 4HM8B 1VQO3 4L7KA 1YJN3 3PZWA 2UGIA 2RNTA 4FCMA 1Q7HA 4XDWA 1OPYA 1BUQA 2OCTA 5M18A 1RGCA 2YFJB 3EB8A 1BAOA 2XFTA 3E99A 3I553 3D5IA 3HK4A 5IG4A 3RNTA 2HMNB 1X1YA 4WHAA 3KCHA 6GSPA 1UDII 3AGNA 2CHCA 2OQEA 1LOWA 3DXOA 2F86B 3GZYB 3U97A 4BTXA 1RNTA 1MOLA 1E3RA 1HZ1A 3HX8A 1JBRA 4ILFA 3NHXA 3ER7A 5CLKA 2RFRA 3NQZA 5AIIA 2GEYA 1YHQ3 1RKYA 1YGEA 4ZM8A 2E2VA 1B2MA 2RGQA 1UUWB 2SBLA 3K7CA 1IQXA 4LEHA 4K90B 2XF3A 1TFOA 1D6UA 3CCU3 3KSED 3N54B 5JPPA 4L8OA 1VZZA 1OUNA 1X1WA 4IPBA 3VGNA 3GRDA 5DRVA 2XR8B 1B2SA 5G2GA 1DMMA 3N9HA 5A0OB 1BSEA 4R4KA 1VQL3 2Z76A 4HM6B 5G1LA 3OX9A 3ZG5A 5JBSA 4STDA 1BUJA 5KP1A 1FA3A 3Q2PA 2OTL3 1IVXA 3QK9A 1NB5I 1GMPA 1MGRA 2CFGA 2IMJA 3CCM3 2XEPA 1JZDA 1PU4A 3Q3FA 1Y4KA 3AMOB 4XBTA 4AEQA 2OTJ3 3K9MC 1JKGB 5D81A 3U1WA 3BNEA 3X40A 1BANA 3UB1A 1YI23 5IG5A 3BU4A 3B4PA 4H61A 3ECFA 1OGZA 3LTBA 1K28A 1X1UA 1BSAA 2QEX3 1VQM3 1N8QA 1TRPA 3MYTA 3OWUA 3X41A 1BRJA 1I2EA 4K61A 5BU4A 5BXQA 3MG2A 3PS8A 2PNCA 2O3OA 3V92A 2AADA 2F99A 1ROVA 2B1XB 1J2BA 3HZPA 2IYJA 1D6YA 1TJDA 1WTHA 5ELUA 1GOUA 5AIFA 1QVG2 3IMAB 3T8UA 5STDA 4JRFA 1O7HB 1LXEA 1W2B2 1ULIB 2L4VA 3LZAA 7STDA 1TTOA 3DGNA 5IEOA 4HAAA 3KN4A 3MWZA 4LGQA 5EVHA 4N6OB 3NBRA 1IQ8A 4O3VA 3MG1A 1RRHA 3T8NA 1GYBA 3S28A 3NM7A 3FF2A 1G96A 1KSIA 1JBTA 3EJVA 4HM7B 5CK6A 1K8A4 1SIIA 1R4YA 4FMBA 2Y74A 2ZDJA 5D82A 3NV0A 1BRGA 3WA2X 1RDSA 1M1K4 1DMQA 2BHMA 3V99A 4N6MA 2OQEC 1LQMB 4LZIA 1TU5A 1WMNA 3H3HA 1JB5A 1IVUA 1HKXA 9RNTA 5KP4A 3T0UA 3G4S3 1GY7A 3KKGA 3ZFZA 1CQSA 4N3VA 5KP3A 3M8CA 3WMDA 4EBGA 1AVKA 5TGNA 1NNVA 1RGAA 1MWTA 2C10A 1N9JA 1OF5B 2W9PA 3OXAA 1BNJA 2D1WA 1YGWA 4N6LA 1HU9A 3ROBA 3NBJA 1EUIC 1VQ83 1RGLA 2C11A 1MWSA 1EKMA 1IVWA 2ZL8A 4CDLA 3PXMA 2GBWB 1KD14 2CW9A 3JUQA 4GL6A 3LT9A 1BNGA 1OH0A 3HOHA 1N8R4 1V58A 1FGMA 2YX9A 3STDA 1AVLA 2O9UX 5IW9A 3LTDA 2HOHA
chains in the Genus database with same CATH topology
1B21A 1BU4A 3SYUA 1UCKA 1I70A 1RGKA 4BIRA 1IYYA 3DH2A 1X1WA 1BNSA 1TRQA 2F5WA 1B2SA 1I0XA 1BSEA 1RTUA 1UCIA 1B2UA 1BNRA 1RLSA 1BUJA 3GSPA 1RGEA 1DETA 1FUSA 3BIRA 3A5EA 7RNTA 1BOXA 1BRHA 1GMPA 1LRAA 1MGRA 1RN1A 3Q3FA 4GSPA 1FZUA 5BIRA 3URPA 1DE3A 1CH0A 1BANA 2ZA4A 4RNTA 5HOHA 1AQZA 2BU4A 1MGWA 2KF3A 3BU4A 1UCJA 1UCLA 1B20A 1I0VA 1B2XA 1X1XA 1BSAA 1X1UA 4J5GA 3WHOA 1A2PA 2F56A 1FUTA 2KAAA 1C54A 1B2ZA 1TRPA 1BRNL 6RNTA 5BU4A 1BRJA 1I2EA 4BU4A 3D4AA 4GHOA 3DGYA 2KF5A 1FW7A 1Q9EA 1BSDA 4HOHA 2AADA 1GOVA 1FYSA 1BVIA 1GOUA 4J5KA 1RGHA 1I3IA 1RSNA 5GSPA 1RN4A 5RNTA 2C4BA 1TTOA 1RCKA 2KF6A 4HAAA 1I3FA 1BSCA 1BGSA 1RMSA 1PY3A 1PYLA 3AGOA 2GSPA 1B27A 2F5MA 1JBTA 1I8VA 1R4YA 3AHSA 1GMRA 1BSBA 1BRKA 1AY7A 1G02A 1I2GA 1BRGA 1RDSA 1BNFA 2F4YA 1GOYA 1T2HA 1GSPA 1YNVX 1BNEA 9RNTA 1BIRA 2RNTA 1RHLA 1RNBA 1BRIA 1RGCA 1YVSA 1RGAA 1BAOA 1BNIA 3D5IA 1LNIA 1I2FA 1ZGXA 3RNTA 1X1YA 3AHWA 3KCHA 6GSPA 1BNJA 3AGNA 1YGWA 2RBIA 1LOWA 1RNTA 7GSPA 1RGLA 1GMQA 1SARA 3D5GA 2AAEA 1RGGA 1RGFA 1JBRA 1HZ1A 1B3SA 2SARA 3WR2A 1BNGA 3HOHA 8RNTA 1LOVA 2KF4A 1B2MA 1RCLA 1T2IA 1LOYA 2BIRA 1JBSA 1BRSA 1HYFA 2HOHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B21 A;  1BU4 A;  3SYU A;  1UCK A;  1I70 A;  1RGK A;  4BIR A;  1IYY A;  3DH2 A;  1X1W A;  1BNS A;  1TRQ A;  2F5W A;  1B2S A;  1I0X A;  1BSE A;  1RTU A;  1UCI A;  1B2U A;  1BNR A;  1RLS A;  1BUJ A;  3GSP A;  1RGE A;  1DET A;  1FUS A;  3BIR A;  3A5E A;  7RNT A;  1BOX A;  1BRH A;  1GMP A;  1LRA A;  1MGR A;  1RN1 A;  3Q3F A;  4GSP A;  1FZU A;  5BIR A;  3URP A;  1DE3 A;  1CH0 A;  1BAN A;  2ZA4 A;  4RNT A;  5HOH A;  1AQZ A;  2BU4 A;  1MGW A;  2KF3 A;  3BU4 A;  1UCJ A;  1UCL A;  1B20 A;  1I0V A;  1B2X A;  1X1X A;  1BSA A;  1X1U A;  4J5G A;  3WHO A;  1A2P A;  2F56 A;  1FUT A;  2KAA A;  1C54 A;  1B2Z A;  1TRP A;  1BRN L;  6RNT A;  5BU4 A;  1BRJ A;  1I2E A;  4BU4 A;  3D4A A;  4GHO A;  3DGY A;  2KF5 A;  1FW7 A;  1Q9E A;  1BSD A;  4HOH A;  2AAD A;  1GOV A;  1FYS A;  1BVI A;  1GOU A;  4J5K A;  1RGH A;  1I3I A;  1RSN A;  5GSP A;  1RN4 A;  5RNT A;  2C4B A;  1TTO A;  1RCK A;  2KF6 A;  4HAA A;  1I3F A;  1BSC A;  1BGS A;  1RMS A;  1PY3 A;  1PYL A;  3AGO A;  2GSP A;  1B27 A;  2F5M A;  1JBT A;  1I8V A;  1R4Y A;  3AHS A;  1GMR A;  1BSB A;  1BRK A;  1AY7 A;  1G02 A;  1I2G A;  1BRG A;  1RDS A;  1BNF A;  2F4Y A;  1GOY A;  1T2H A;  1GSP A;  1YNV X;  1BNE A;  9RNT A;  1BIR A;  2RNT A;  1RHL A;  1RNB A;  1BRI A;  1RGC A;  1YVS A;  1RGA A;  1BAO A;  1BNI A;  3D5I A;  1LNI A;  1I2F A;  1ZGX A;  3RNT A;  1X1Y A;  3AHW A;  3KCH A;  6GSP A;  1BNJ A;  3AGN A;  1YGW A;  2RBI A;  1LOW A;  1RNT A;  7GSP A;  1RGL A;  1GMQ A;  1SAR A;  3D5G A;  2AAE A;  1RGG A;  1RGF A;  1JBR A;  1HZ1 A;  1B3S A;  2SAR A;  3WR2 A;  1BNG A;  3HOH A;  8RNT A;  1LOV A;  2KF4 A;  1B2M A;  1RCL A;  1T2I A;  1LOY A;  2BIR A;  1JBS A;  1BRS A;  1HYF A;  2HOH A; 
#chains in the Genus database with same CATH topology
 2CWU A;  3CCL 3;  1W5Z A;  2P0X A;  3F7X A;  1JB4 A;  1JNQ A;  3SYU A;  1UCK A;  1FUW A;  2K54 A;  1CYV A;  2CKF B;  3FCS B;  3OWY A;  4MEI A;  2GU1 A;  3DH2 A;  5IEP A;  1RJO A;  3CNM A;  3PCS A;  3GZB A;  3NQY A;  1KQS 2;  2F5W A;  2WGO A;  1K41 A;  4GB5 A;  1T3B A;  2F98 A;  4R1K A;  3CME 3;  1RTU A;  1IU7 A;  1O7P B;  4HYZ A;  1B2U A;  4RBN A;  1BNR A;  4LYL B;  5M1A A;  2W04 A;  4QWT A;  1S5A A;  3BIR A;  3A5E A;  3NX0 A;  1GD3 A;  1A90 A;  1G0T A;  7RNT A;  2RSX A;  1BOX A;  5HGR A;  1BRH A;  3NV0 B;  1LRA A;  4CJN A;  2V1L A;  1YIJ 3;  4HBR A;  3CPO A;  1W01 A;  3LT8 A;  2Z77 A;  1A2V A;  4N6U A;  5BVB A;  1MNL A;  1E3V A;  4NRE A;  1IV7 A;  1R4C A;  2UX0 A;  1W00 A;  3BB9 A;  5I97 A;  4XBY A;  2ZA4 A;  4RNT A;  8CHO A;  5HOH A;  2A15 A;  1OHS A;  2KF3 A;  1VQ6 3;  1QMA A;  4FMD A;  2BMQ B;  3L0R A;  1UCJ A;  3SVA A;  1U8C B;  2OOV A;  1VQN 3;  4LMI A;  3HI7 A;  4K1V A;  1B2Z A;  2WOH A;  3G16 A;  1TP6 A;  3HII A;  4H3U A;  1OHP A;  1VQ5 3;  1A2K A;  1IT7 A;  1YIT 3;  3D9R A;  4GHO A;  2H0G A;  1C7H A;  3CU3 A;  2W0Q A;  3FLJ A;  3G6E 3;  4FMC A;  4HOH A;  4PEJ A;  1GOV A;  2CH9 A;  2P38 A;  4HZB B;  3RGA A;  1BVI A;  3OV4 A;  3NBB A;  3CC4 3;  4DKI A;  1QAK A;  1Q7Y 4;  5IF6 A;  3G0K A;  1GY6 A;  1FGT A;  1TFK A;  1Q81 4;  5RNT A;  1GY5 A;  2WGQ A;  4KFF A;  3SED A;  2FGT A;  3NUV A;  1RCK A;  1Q82 4;  2K0M A;  2YFL B;  1O7W B;  3FG4 A;  3WA3 A;  1OGX A;  1ZX2 A;  1ISK A;  1IVV A;  3WDG B;  1M1X B;  3WOD G;  1EQK A;  1PYL A;  3OWS A;  1B27 A;  2Z7A A;  3DGO A;  4BTY A;  1O7G B;  1SQW A;  2HMO B;  3QRD A;  3PGB A;  1I8V A;  4TX4 A;  3UJM A;  3AHS A;  1PFP A;  1BSB A;  3EHC A;  1AY7 A;  1G02 A;  1WMO A;  3I56 3;  4O8S A;  3S29 A;  1IK3 A;  2WO0 A;  3TDG A;  3SOY A;  1UGI A;  3K0Z A;  3MG3 A;  3S67 A;  1QJG A;  3B4O A;  1KC8 4;  2KRT A;  1JV2 B;  1BIR A;  3LTA A;  1VQK 3;  4CCV A;  2CWT A;  3NM2 A;  2LYX A;  4WP5 A;  1RHL A;  2CFW A;  2PZV A;  1K73 4;  3LOY A;  2UUG C;  4HM0 B;  1JN5 A;  4OK0 A;  3CCQ 3;  2CFL A;  1BNI A;  3GZR A;  1Q40 A;  3CCS 3;  1N5H A;  1DMN A;  1LNI A;  1I2F A;  1IDP A;  1ZGX A;  3AHW A;  1TIJ A;  2H0I A;  1STF I;  1CEW I;  3S5C A;  3NXJ A;  1IQY A;  2INX A;  5FW5 A;  1JRQ A;  4WWU C;  1GMQ A;  1SAR A;  2AAE A;  1MWU A;  1Z1S A;  4KFD A;  4XDV A;  3CD6 3;  1RGF A;  2FNQ A;  4X2O A;  2SAR A;  3N8B A;  3LTC A;  4HM3 B;  5ELJ A;  3SXX A;  2L1S A;  8RNT A;  1LOV A;  2KF4 A;  2W6J H;  1RCL A;  4OVM A;  1LOY A;  2BIR A;  2STD A;  3D79 A;  1BRS A;  4HM2 B;  1HYF A;  1VQP 3;  1SJW A;  1JZO A;  1AV4 A;  3K63 A;  4HM5 B;  1BU4 A;  3MSO A;  1GD4 A;  1I70 A;  1K9M 4;  4AKY A;  1RGK A;  5AEU B;  3EC9 A;  4BIR A;  4MMZ B;  2ZHX B;  3X3X A;  2BNG A;  1BNS A;  1TRQ A;  2BT3 A;  3LML A;  1ZS7 A;  3O8Y A;  4K1U A;  3S27 A;  4EW5 A;  4Q53 A;  4FCZ A;  2CC3 A;  2QA4 3;  3KII A;  2FXT A;  1W4N A;  5AYR B;  1RGE A;  1DET A;  3VF1 A;  2OOV C;  3GAX A;  3B8L A;  1RN1 A;  2HMJ B;  2WOF A;  3KZT A;  5LC7 A;  3SLU A;  1CYU A;  4GSP A;  4U13 A;  3GWR A;  5BIR A;  2JDI H;  3DGL A;  4RNZ A;  1DE3 A;  1CH0 A;  4HKV B;  1OHO A;  1O7N B;  4KVH A;  3EX9 A;  1AQZ A;  2ML6 A;  3EN1 B;  3X3Z A;  5IEN A;  1MGW A;  3IPT A;  1V57 A;  1N5P A;  1UCL A;  2IUJ A;  4CPK A;  1JN5 B;  3RGR A;  1B20 A;  2IY2 A;  1B2X A;  2QGU A;  3LXU X;  4ORL A;  1FGO A;  2Y73 A;  1C54 A;  4KFE A;  4BL2 A;  2KAA A;  1D6Z A;  1BRN L;  3KE7 A;  6RNT A;  2OWP A;  2YFI B;  1NJI 4;  4FMA A;  1DYU A;  3DGY A;  3HIG A;  5CF2 A;  3CXC 2;  1WNH A;  2KF5 A;  3F40 A;  1BSD A;  4HJL B;  2CX0 A;  3JUM A;  1FYS A;  1N9E A;  2R4I A;  3CCV 3;  3KSP A;  5IER A;  1NO3 A;  4J5K A;  4N6T A;  1EG9 B;  1I3I A;  1JKG A;  1LNH A;  1UI8 A;  3FG3 A;  5M19 A;  1NU3 A;  5GSP A;  1YVB I;  4IT7 A;  2E2U A;  4MJD A;  1DVD A;  6STD A;  1W2Z A;  4RNY A;  3F9S A;  5FGO A;  2C4B A;  1YJ9 3;  4N6V 0;  5EQL A;  5AI1 A;  3ZG0 A;  4XB5 A;  4HZ9 B;  3FH1 A;  1SPU A;  3JUO A;  1QAF A;  1ZO2 A;  2GU3 A;  1KWI A;  3EBT A;  2HMK B;  4WFO A;  1E97 A;  1RMS A;  2W56 A;  1PY3 A;  3X3Y A;  3AGO A;  3JUP A;  3MKI A;  4R80 A;  3UL5 A;  3DUK A;  5D83 A;  1M90 4;  4KZ1 A;  3MPH A;  3G8Z A;  3MHE A;  2IUK A;  4G1M B;  3FKA A;  1OCV A;  1GMR A;  2CFD A;  2B24 B;  4NPB A;  2IA7 A;  3DMC A;  4EXR A;  4FR9 A;  2XSO B;  4J8T A;  1LQG C;  5AYS C;  3F8H A;  1T2H A;  2CWV A;  1GSP A;  1U5O A;  3EF8 A;  1FGQ A;  1YNV X;  1BNE A;  1LOX A;  3PYJ A;  4XBX A;  1ROA A;  4R9K A;  3EE1 A;  1US1 A;  3F14 A;  4X2H A;  1BRI A;  1T5Y A;  1W7C A;  1YVS A;  1RNB A;  2GBX B;  1MWR A;  2Q07 A;  3J7Y d;  1QVF 2;  5AIG A;  1NWW A;  2XSH B;  3PCR A;  4MMY B;  4I4K A;  4J9A A;  1STD A;  2MF7 A;  2RBI A;  2XRX B;  4WYK A;  2CX1 A;  4L8P A;  2LQV A;  4BTW A;  1DVC A;  2CK3 H;  3D5G A;  1ULJ B;  4O02 B;  7GSP A;  3CC7 3;  2XGL A;  1RGG A;  3CNX A;  1B3S A;  4JF8 A;  3CCR 3;  3WR2 A;  2K3D A;  3I0Y A;  2P0M A;  3H51 A;  4MMX B;  1UI7 A;  1RN7 A;  2E2T A;  4RZM A;  2KXG A;  3F8X A;  1LVN A;  3Q90 A;  1T2I A;  3RDE A;  1JBS A;  3GZX B;  2H0H A;  2XFS A;  1VQQ A;  1B21 A;  3F7S A;  5G1K A;  1WMP A;  3UL6 A;  1UUV B;  4KT3 B;  3CPW 2;  1W6G A;  1O7M B;  4AKZ A;  1OF5 A;  1UUG B;  2JQ5 A;  1UGH I;  4N6N B;  3VSY A;  1IYY A;  5CF1 A;  2MC8 A;  4I5Q A;  3FG1 A;  2W56 B;  3G71 3;  2BO9 B;  1VQ4 3;  1I0X A;  4O2H A;  2P05 A;  4XM4 A;  1UCI A;  4HM4 B;  1RLS A;  1FGR A;  3GSP A;  5LC6 A;  3Q1C A;  3SOA A;  1FUS A;  2KCD A;  3A76 A;  1QAL A;  2I9W A;  4EC6 A;  3DM8 A;  3FZW A;  2P09 A;  1W02 A;  4HVN A;  1AR0 A;  2R41 A;  2CFK A;  3CCJ 3;  3X42 A;  3D3L A;  2XH9 A;  4FCJ A;  1FZU A;  1EA2 A;  2W2C A;  2GEX A;  5IG0 A;  3URP A;  2HML B;  4LSO A;  2BU4 A;  3JVC A;  3BLZ A;  1W6C A;  5AEW B;  2M7O A;  1I0V A;  1X1X A;  4J5G A;  3WHO A;  2CG1 A;  2BMO B;  1A2P A;  1M9G A;  1FUT A;  2F56 A;  2CG0 A;  1ASK A;  1F8N A;  5EEO A;  4NHF A;  3D4A A;  4BU4 A;  5CXO A;  2D42 A;  4WYK B;  3LYG A;  1FW7 A;  1Q9E A;  4EV5 A;  3SX1 A;  3FGY A;  2BMR B;  2ML5 A;  3LH4 A;  1NB3 I;  1RGH A;  2CIU A;  3DZL A;  3CMA 3;  3K5T A;  3KFQ C;  1RSN A;  4IIA A;  1VQ9 3;  5AIH A;  1RN4 A;  4HM1 B;  1VQ7 3;  3CCE 3;  4OUQ A;  3UNL A;  3V98 A;  4EYC A;  3WOF B;  1JB2 A;  3FF0 A;  2KF6 A;  1YJW 3;  1S72 3;  3EN8 A;  4BL3 A;  3BNC A;  1I3F A;  1SIH A;  1BSC A;  1BGS A;  3ALA A;  2Z6B A;  3BND A;  3FSD A;  2XGN A;  3JUN A;  1OAC A;  4R9L A;  1EEJ A;  5JPU A;  2QIY A;  1Q40 B;  1W6Y A;  2GSP A;  1V74 A;  1WQL B;  2RCD A;  2W9Q A;  1A67 A;  2F5M A;  2GXF A;  3CC2 3;  1NDO B;  1UW1 A;  3B7C A;  1L5G B;  1IT8 A;  3EBY A;  1Q42 A;  5DRE A;  5IG3 A;  1Q86 4;  1BRK A;  1JJ2 2;  1I2G A;  3BNB A;  1BNF A;  1IV9 A;  2F4Y A;  1GOY A;  2HMM B;  3DGM A;  3AMO A;  4EV2 A;  2J8X B;  1GS3 A;  1TUH A;  3DY5 A;  2W03 A;  1RRL A;  3OW2 2;  3IJE B;  3EQQ B;  3WOE B;  4HM8 B;  1VQO 3;  4L7K A;  1YJN 3;  3PZW A;  2UGI A;  2RNT A;  4FCM A;  1Q7H A;  4XDW A;  1OPY A;  1BUQ A;  2OCT A;  5M18 A;  1RGC A;  2YFJ B;  3EB8 A;  1BAO A;  2XFT A;  3E99 A;  3I55 3;  3D5I A;  3HK4 A;  5IG4 A;  3RNT A;  2HMN B;  1X1Y A;  4WHA A;  3KCH A;  6GSP A;  1UDI I;  3AGN A;  2CHC A;  2OQE A;  1LOW A;  3DXO A;  2F86 B;  3GZY B;  3U97 A;  4BTX A;  1RNT A;  1MOL A;  1E3R A;  1HZ1 A;  3HX8 A;  1JBR A;  4ILF A;  3NHX A;  3ER7 A;  5CLK A;  2RFR A;  3NQZ A;  5AII A;  2GEY A;  1YHQ 3;  1RKY A;  1YGE A;  4ZM8 A;  2E2V A;  1B2M A;  2RGQ A;  1UUW B;  2SBL A;  3K7C A;  1IQX A;  4LEH A;  4K90 B;  2XF3 A;  1TFO A;  1D6U A;  3CCU 3;  3KSE D;  3N54 B;  5JPP A;  4L8O A;  1VZZ A;  1OUN A;  1X1W A;  4IPB A;  3VGN A;  3GRD A;  5DRV A;  2XR8 B;  1B2S A;  5G2G A;  1DMM A;  3N9H A;  5A0O B;  1BSE A;  4R4K A;  1VQL 3;  2Z76 A;  4HM6 B;  5G1L A;  3OX9 A;  3ZG5 A;  5JBS A;  4STD A;  1BUJ A;  5KP1 A;  1FA3 A;  3Q2P A;  2OTL 3;  1IVX A;  3QK9 A;  1NB5 I;  1GMP A;  1MGR A;  2CFG A;  2IMJ A;  3CCM 3;  2XEP A;  1JZD A;  1PU4 A;  3Q3F A;  1Y4K A;  3AMO B;  4XBT A;  4AEQ A;  2OTJ 3;  3K9M C;  1JKG B;  5D81 A;  3U1W A;  3BNE A;  3X40 A;  1BAN A;  3UB1 A;  1YI2 3;  5IG5 A;  3BU4 A;  3B4P A;  4H61 A;  3ECF A;  1OGZ A;  3LTB A;  1K28 A;  1X1U A;  1BSA A;  2QEX 3;  1VQM 3;  1N8Q A;  1TRP A;  3MYT A;  3OWU A;  3X41 A;  1BRJ A;  1I2E A;  4K61 A;  5BU4 A;  5BXQ A;  3MG2 A;  3PS8 A;  2PNC A;  2O3O A;  3V92 A;  2AAD A;  2F99 A;  1ROV A;  2B1X B;  1J2B A;  3HZP A;  2IYJ A;  1D6Y A;  1TJD A;  1WTH A;  5ELU A;  1GOU A;  5AIF A;  1QVG 2;  3IMA B;  3T8U A;  5STD A;  4JRF A;  1O7H B;  1LXE A;  1W2B 2;  1ULI B;  2L4V A;  3LZA A;  7STD A;  1TTO A;  3DGN A;  5IEO A;  4HAA A;  3KN4 A;  3MWZ A;  4LGQ A;  5EVH A;  4N6O B;  3NBR A;  1IQ8 A;  4O3V A;  3MG1 A;  1RRH A;  3T8N A;  1GYB A;  3S28 A;  3NM7 A;  3FF2 A;  1G96 A;  1KSI A;  1JBT A;  3EJV A;  4HM7 B;  5CK6 A;  1K8A 4;  1SII A;  1R4Y A;  4FMB A;  2Y74 A;  2ZDJ A;  5D82 A;  3NV0 A;  1BRG A;  3WA2 X;  1RDS A;  1M1K 4;  1DMQ A;  2BHM A;  3V99 A;  4N6M A;  2OQE C;  1LQM B;  4LZI A;  1TU5 A;  1WMN A;  3H3H A;  1JB5 A;  1IVU A;  1HKX A;  9RNT A;  5KP4 A;  3T0U A;  3G4S 3;  1GY7 A;  3KKG A;  3ZFZ A;  1CQS A;  4N3V A;  5KP3 A;  3M8C A;  3WMD A;  4EBG A;  1AVK A;  5TGN A;  1NNV A;  1RGA A;  1MWT A;  2C10 A;  1N9J A;  1OF5 B;  2W9P A;  3OXA A;  1BNJ A;  2D1W A;  1YGW A;  4N6L A;  1HU9 A;  3ROB A;  3NBJ A;  1EUI C;  1VQ8 3;  1RGL A;  2C11 A;  1MWS A;  1EKM A;  1IVW A;  2ZL8 A;  4CDL A;  3PXM A;  2GBW B;  1KD1 4;  2CW9 A;  3JUQ A;  4GL6 A;  3LT9 A;  1BNG A;  1OH0 A;  3HOH A;  1N8R 4;  1V58 A;  1FGM A;  2YX9 A;  3STD A;  1AVL A;  2O9U X;  5IW9 A;  3LTD A;  2HOH A; 
#chains in the Genus database with same CATH homology
 1B21 A;  1BU4 A;  3SYU A;  1UCK A;  1I70 A;  1RGK A;  4BIR A;  1IYY A;  3DH2 A;  1X1W A;  1BNS A;  1TRQ A;  2F5W A;  1B2S A;  1I0X A;  1BSE A;  1RTU A;  1UCI A;  1B2U A;  1BNR A;  1RLS A;  1BUJ A;  3GSP A;  1RGE A;  1DET A;  1FUS A;  3BIR A;  3A5E A;  7RNT A;  1BOX A;  1BRH A;  1GMP A;  1LRA A;  1MGR A;  1RN1 A;  3Q3F A;  4GSP A;  1FZU A;  5BIR A;  3URP A;  1DE3 A;  1CH0 A;  1BAN A;  2ZA4 A;  4RNT A;  5HOH A;  1AQZ A;  2BU4 A;  1MGW A;  2KF3 A;  3BU4 A;  1UCJ A;  1UCL A;  1B20 A;  1I0V A;  1B2X A;  1X1X A;  1BSA A;  1X1U A;  4J5G A;  3WHO A;  1A2P A;  2F56 A;  1FUT A;  2KAA A;  1C54 A;  1B2Z A;  1TRP A;  1BRN L;  6RNT A;  5BU4 A;  1BRJ A;  1I2E A;  4BU4 A;  3D4A A;  4GHO A;  3DGY A;  2KF5 A;  1FW7 A;  1Q9E A;  1BSD A;  4HOH A;  2AAD A;  1GOV A;  1FYS A;  1BVI A;  1GOU A;  4J5K A;  1RGH A;  1I3I A;  1RSN A;  5GSP A;  1RN4 A;  5RNT A;  2C4B A;  1TTO A;  1RCK A;  2KF6 A;  4HAA A;  1I3F A;  1BSC A;  1BGS A;  1RMS A;  1PY3 A;  1PYL A;  3AGO A;  2GSP A;  1B27 A;  2F5M A;  1JBT A;  1I8V A;  1R4Y A;  3AHS A;  1GMR A;  1BSB A;  1BRK A;  1AY7 A;  1G02 A;  1I2G A;  1BRG A;  1RDS A;  1BNF A;  2F4Y A;  1GOY A;  1T2H A;  1GSP A;  1YNV X;  1BNE A;  9RNT A;  1BIR A;  2RNT A;  1RHL A;  1RNB A;  1BRI A;  1RGC A;  1YVS A;  1RGA A;  1BAO A;  1BNI A;  3D5I A;  1LNI A;  1I2F A;  1ZGX A;  3RNT A;  1X1Y A;  3AHW A;  3KCH A;  6GSP A;  1BNJ A;  3AGN A;  1YGW A;  2RBI A;  1LOW A;  1RNT A;  7GSP A;  1RGL A;  1GMQ A;  1SAR A;  3D5G A;  2AAE A;  1RGG A;  1RGF A;  1JBR A;  1HZ1 A;  1B3S A;  2SAR A;  3WR2 A;  1BNG A;  3HOH A;  8RNT A;  1LOV A;  2KF4 A;  1B2M A;  1RCL A;  1T2I A;  1LOY A;  2BIR A;  1JBS A;  1BRS A;  1HYF A;  2HOH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...