1RNTA

Restrained least-squares refinement of the crystal structure of the ribonuclease t1(asterisk)2(prime)-guanylic acid complex at 1.9 angstroms resolution
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE T1 ISOZYME
publication title Restrained Least-Squares Refinement of the Crystal Structure of the Ribonuclease T1(Asterisk)2(Prime)-Guanylic Acid Complex at 1.9 Angstroms Resolution
pubmed rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase(endoribonuclease)
total genus 25
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1987-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1rntA00
1AY7A 1I70A 1BSCA 1T2IA 1PYLA 1RMSA 1BNSA 1BRJA 1DE3A 2HOHA 3BIRA 1TRPA 1UCKA 1R4YA 1I0XA 1UCLA 1BRKA 4GSPA 4GHOA 5RNTA 5BU4A 1BNGA 1FUTA 3D5GA 1DETA 1RTUA 1TTOA 1BRNL 1FZUA 1GOYA 1RGEA 1LOWA 1JBRA 2BIRA 1RSNA 1X1XA 4BU4A 4J5GA 2AAEA 1B21A 1MGRA 1BOXA 3AHWA 6GSPA 1LRAA 3Q3FA 1Q9EA 1RN4A 2C4BA 1BSEA 1X1UA 3KCHA 1BANA 1FYSA 1I8VA 6RNTA 1I2GA 1BNRA 1G02A 1RN1A 4HAAA 8RNTA 1UCIA 1RGLA 1RGGA 3DGYA 2RNTA 1YVSA 3BU4A 1RGCA 1B2SA 1GOVA 7GSPA 1I3IA 1I3FA 5GSPA 2RBIA 1RGHA 4HOHA 9RNTA 1X1WA 1GMPA 1IYYA 1SARA 1BNJA 3RNTA 2KF3A 1BSAA 1B2XA 1B2ZA 2GSPA 1RGAA 2F56A 1BNFA 1RGKA 1C54A 1RLSA 1BVIA 1HZ1A 1BIRA 1BRSA 3SYUA 1FW7A 1LOVA 1UCJA 1RGFA 3A5EA 4RNTA 1JBTA 2KF5A 3AGNA 2KAAA 1MGWA 1B20A 2KF6A 2F4YA 1HYFA 1AQZA 1LOYA 1RCKA 2SARA 4J5KA 1BRIA 1RCLA 1I0VA 1GMRA 1BNIA 2KF4A 2ZA4A 1B3SA 5BIRA 2BU4A 1ZGXA 7RNTA 5HOHA 1I2EA 2F5MA 1I2FA 4BIRA 3AGOA 1RHLA 2F5WA 3DH2A 1TRQA 1LNIA 1BRHA 3D4AA 1JBSA 1GMQA 1BUJA 1BNEA 1X1YA 3HOHA 3AHSA 1B2MA 1BGSA 1GSPA 1T2HA 1B27A 3WHOA 1RNTA 1YGWA 1BSDA 1BU4A 1YNVX 3WR2A 1A2PA 1CH0A 2AADA 1RNBA 3D5IA 1FUSA 1BRGA 3GSPA 1BAOA 1BSBA 1PY3A 1RDSA 1B2UA 3URPA 1GOUA
chains in the Genus database with same CATH superfamily
4H3UA 4HM1B 1BSCA 3K0ZA 5EEOA 1PYLA 1HKXA 3G0KA 3PS8A 5IG4A 3DMCA 3WA2X 3ALAA 1IVUA 2HOHA 2XSOB 4HBRA 2OQEA 4KFDA 4AKYA 3NX0A 1W2B2 5DREA 1VQ83 1I0XA 4LGQA 1EA2A 4WWUC 5TGNA 4GHOA 3KFQC 1FUTA 1DETA 1JB5A 2B1XB 2Z7AA 1IQXA 3FKAA 2BIRA 1RSNA 4RBNA 2GEYA 5A0OB 3HX8A 1X1XA 4XM4A 2SBLA 2C11A 3B4OA 4HM4B 5CF2A 2P0MA 4J5GA 5STDA 1U5OA 2D42A 1C7HA 5LC7A 3MSOA 3BNCA 1LVNA 3Q3FA 1GS3A 1RN4A 1JZOA 3NHXA 1W6CA 2P05A 1AR0A 1AV4A 1MWSA 2QIYA 3RGRA 1MWRA 5HGRA 1SQWA 4R9LA 4HM2B 2HMLB 8RNTA 1D6ZA 3F14A 4O02B 4NREA 4EC6A 3DGYA 2A15A 4DKIA 1ULJB 5IERA 3JUOA 3LT8A 3HI7A 3FGYA 2HMMB 1GOVA 4NHFA 1RJOA 1VQ53 1AVKA 3ROBA 4HM7B 3V92A 4J9AA 1OHSA 3FCSB 3F40A 1X1WA 2F99A 1OF5B 5AIIA 4MMZB 2BO9B 2M7OA 5IEPA 4GL6A 4I5QA 4Q53A 1BNJA 3B7CA 2CFWA 1MWTA 2CW9A 3OXAA 2CWUA 2WGOA 3F8XA 5LC6A 2GSPA 4NPBA 1RGAA 3JUQA 3VF1A 2BNGA 3CU3A 4HJLB 2CFLA 1BNFA 3GRDA 4R4KA 1OUNA 1RGKA 2K0MA 5D83A 5I97A 1RLSA 3F8HA 4FCMA 1BVIA 1HZ1A 3NBRA 1KQS2 5M18A 1BIRA 1Q864 4EBGA 3SVAA 2H0IA 1N5PA 3SEDA 5FGOA 1VQO3 1RRLA 4RNTA 3KE7A 2OOVC 2KAAA 2QA43 1ASKA 3KKGA 1US1A 4H61A 5D81A 3BB9A 2F4YA 3CNXA 1AQZA 1LOYA 3CPOA 1PU4A 1OH0A 1Q824 2Q07A 2CWVA 3FZWA 1UUVB 1I0VA 1O7HB 2GU1A 4OVMA 2BU4A 1GY7A 1KC84 2CFDA 4L7KA 3WOFB 1VQ63 3KSPA 1TP6A 1O7PB 1I2FA 1RHLA 2F5WA 4EV2A 1FA3A 4WYKB 4CJNA 4EV5A 3CC43 3AHSA 4LMIA 1A2VA 1BGSA 5AIGA 5EQLA 1TU5A 2OTL3 3CNMA 1Q7Y4 4O2HA 1BSDA 3LTCA 3G6E3 1IV7A 3CCU3 1Q40B 4X2OA 1CQSA 3D3LA 3D9RA 1LQGC 2BMRB 4CCVA 4R9KA 4HZBB 4WFOA 7STDA 1ZO2A 4HM8B 2STDA 3UL5A 1V74A 1T5YA 3URPA 5AIHA 4WHAA 1DVDA 1KSIA 1GOUA 2CHCA 1JNQA 3AMOB 4G1MB 3FLJA 3JVCA 3RGAA 4IPBA 5IENA 1FUWA 3F9SA 1O7NB 4GB5A 3S67A 5BXQA 2CIUA 2YX9A 1J2BA 2O9UX 2W04A 4RZMA 3T8NA 4BTXA 3BIRA 1TRPA 2XGNA 1Q7HA 3G4S3 3FH1A 1R4YA 2RGQA 4CDLA 1YJN3 2WOHA 5JPPA 1UGIA 3D5GA 3FG4A 3GZBA 1ROVA 1FZUA 4FMBA 3V99A 3NQZA 2RSXA 3N9HA 4N3VA 2R4IA 2XGLA 3X3YA 2B24B 1IVWA 2Z76A 3L0RA 2GEXA 2AAEA 1O7WB 4MMXB 3B4PA 3JUNA 1V57A 2KRTA 4OUQA 5AEUB 4EW5A 6GSPA 1YJ93 2UGIA 5G1LA 1TJDA 2HMNB 2K3DA 3OWUA 5BVBA 1IT7A 4MEIA 5IF6A 3VSYA 2WGQA 1BSEA 3KCHA 1G96A 4FMAA 1I8VA 6RNTA 3TDGA 1BNRA 4N6TA 2ML6A 1QAKA 1RGLA 3EF8A 1GY6A 2RNTA 1YVSA 4AEQA 3LOYA 1UI7A 1EKMA 1WTHA 2QGUA 1JB4A 2UX0A 3BU4A 1JB2A 1FGTA 4X2HA 1I3IA 1TFKA 3LH4A 2OTJ3 3KN4A 5GSPA 3GZYB 1NB3I 4N6LA 1YI23 2JDIH 1ROAA 4HOHA 1IU7A 9RNTA 2W56A 4KT3B 3U1WA 1GMPA 1VQ73 3PCRA 1YJW3 1SARA 4N6UA 3CCL3 1JN5A 2W6JH 5IG3A 3LTAA 3RNTA 2IA7A 4BL2A 1CYVA 3WODG 3NBBA 2W03A 4STDA 1M1XB 1M9GA 1R4CA 1RKYA 2KCDA 4HM3B 1WNHA 3CD63 1FGOA 3DM8A 3ECFA 3BNBA 1K9M4 1O7MB 1BRSA 3S27A 5KP3A 3SYUA 2BT3A 1A2KA 4XBYA 1SIIA 3EHCA 1RGFA 2D1WA 3A5EA 3X3XA 1LOXA 2UUGC 3AGNA 5EVHA 1KD14 1MGWA 3GAXA 2OOVA 1IV9A 2KF6A 1HYFA 3NBJA 6STDA 1STFI 1N5HA 1E3RA 1QMAA 2Y74A 3EBTA 3PYJA 3CCM3 2HMKB 2ZA4A 4R80A 3EX9A 5BIRA 1ZGXA 3EBYA 3FG1A 1K8A4 3ER7A 1DMQA 1DYUA 3DXOA 1W5ZA 3DH2A 1N9JA 2GXFA 3Q1CA 3HIGA 4FR9A 4LYLB 1BUQA 1GMQA 1VQQA 3Q2PA 1BUJA 1BNEA 1X1YA 2E2UA 3EB8A 3HOHA 1GSPA 3EN8A 3K9MC 2BHMA 1B27A 2W9PA 3N8BA 1RN7A 1YGWA 3LXUX 1BU4A 3WR2A 1CYUA 2AADA 4ZM8A 1QVG2 1RNBA 1NDOB 2WOFA 1F8NA 3DGNA 3UB1A 1Q42A 2INXA 1TUHA 3GSPA 2BMOB 3N54B 1SPUA 3PCSA 1BSBA 1PY3A 3IPTA 1W01A 1NO3A 3JUMA 4HVNA 3ZG5A 4K61A 3OV4A 2OWPA 5M1AA 1I70A 1M1K4 5AEWB 3HK4A 3BNDA 1QJGA 1K734 1NU3A 3HIIA 3SOAA 5IG5A 2J8XB 1RMSA 2F98A 5M19A 1QALA 1BNSA 4I4KA 3K7CA 4BL3A 1UCKA 4L8PA 5CXOA 3MKIA 3X3ZA 3IMAB 3MG1A 3DY5A 1WMPA 2XF3A 3ZFZA 5BU4A 5RNTA 4QWTA 1JV2B 3CPW2 1RTUA 2GBXB 1TTOA 2O3OA 1E3VA 1GOYA 1RGEA 1BRNL 1LOWA 1JKGA 1E97A 1MOLA 1U8CB 1MNLA 2R41A 1DMNA 1W2ZA 4RNYA 4BU4A 1UGHI 1OPYA 5JBSA 1B21A 5JPUA 1BOXA 3AHWA 4LSOA 1LRAA 2XFTA 2K54A 1Q9EA 4HYZA 2C4BA 1GD4A 1JRQA 4XBTA 4N6NB 2FNQA 2FGTA 1IQ8A 4K90B 1X1UA 1BANA 1I2GA 1OHOA 4HM0B 5IG0A 1UCIA 3GZXB 1RGGA 1UI8A 3IJEB 2IYJA 2Z77A 3UNLA 2RFRA 1RGCA 1VQN3 3CCJ3 2IUKA 3D79A 3PXMA 3X42A 4HKVB 3CC73 1I3FA 2CFKA 2RBIA 3I0YA 1ULIB 1SJWA 4N6V0 1RGHA 1WMNA 1K41A 3O8YA 1QVF2 1M904 1GYBA 1CEWI 3S29A 3MHEA 1IYYA 2XFSA 3M8CA 1OGXA 5AIFA 3WMDA 2ZHXB 4BTYA 1IQYA 3X41A 3CCE3 1N9EA 2OCTA 1L5GB 3LT9A 1RRHA 2F86B 1KWIA 3QK9A 3SX1A 1D6YA 3STDA 2F56A 1N8QA 1YIT3 3EQQB 3SLUA 1YIJ3 5DRVA 1ISKA 3G16A 1OACA 3I553 3RDEA 2YFIB 4AKZA 2XSHB 2PNCA 2V1LA 3LZAA 2YFJB 2P38A 1G0TA 1STDA 2E2TA 2CX0A 1O7GB 1HU9A 2KF5A 3G713 2JQ5A 2CX1A 2ZDJA 5G1KA 3QRDA 2SARA 1RCKA 4FMDA 1ZX2A 1AVLA 1GMRA 2RCDA 4JRFA 2XR8B 1B3SA 1LXEA 3MG3A 7RNTA 5HOHA 1Q814 1UDII 2MF7A 5AI1A 2Z6BA 1W6GA 1SIHA 3A76A 2F5MA 2P09A 3NV0A 1EUIC 4IT7A 3S28A 4KZ1A 1JBSA 2IMJA 4BTWA 2W56B 4XBXA 2E2VA 2IY2A 3LYGA 1T2HA 3S5CA 1JN5B 1RNTA 4XB5A 2C10A 1NB5I 5KP4A 1V58A 1UUWB 3MPHA 3EC9A 2CG1A 1T3BA 3SXXA 2H0HA 3CMA3 1UW1A 3FF0A 3NV0B 3LTBA 3D5IA 3CCQ3 1Y4KA 1YHQ3 1FUSA 1BRGA 2XRXB 1GD3A 3DGMA 3DGOA 4HM5B 5CLKA 1MWUA 1RDSA 1B2UA 1AY7A 4RNZA 5FW5A 4K1UA 3X40A 1IK3A 2GU3A 1T2IA 3DZLA 3KZTA 1JZDA 1W4NA 2OQEC 1BRJA 1DE3A 1EEJA 3MWZA 1OF5A 3DGLA 4EXRA 2CK3H 1UCLA 3T8UA 1Z1SA 1BRKA 4EYCA 1GY5A 4GSPA 3CCR3 1IVVA 3NQYA 3NXJA 1BNGA 3UJMA 1VQ43 4HZ9B 5IW9A 4HM6B 1A90A 3KSED 2W2CA 1JBRA 3U97A 1VQK3 4O8SA 5AYSC 1LQMB 1W6YA 3OWYA 1VQP3 4MJDA 1VQL3 1MGRA 3FF2A 2PZVA 1PFPA 4N6OB 1IDPA 4LEHA 3EE1A 3MG2A 1DVCA 4KFFA 2BMQB 3CCS3 2YFLB 4KVHA 4FCZA 4K1VA 3CC23 1A67A 1FYSA 2P0XA 4L8OA 1NNVA 3NM2A 1G02A 1RN1A 1W00A 3F7SA 4HAAA 2CG0A 2CWTA 3MYTA 4MMYB 1TFOA 3FSDA 3HZPA 3OX9A 2QEX3 8CHOA 1EQKA 3FG3A 2WO0A 3KIIA 1B2SA 2L4VA 7GSPA 3H3HA 4N6MA 3OWSA 1IVXA 3LMLA 4IIAA 3BNEA 1DMMA 3OW22 5IEOA 1IT8A 4WYKA 3K63A 2I9WA 2CC3A 4XDVA 2W9QA 3PGBA 4U13A 1UUGB 4R1KA 1NWWA 2KF3A 3E99A 1Q40A 1TIJA 1YGEA 1BSAA 3F7XA 1B2XA 2ZL8A 3GZRA 4XDWA 3G8ZA 1B2ZA 1JKGB 3T0UA 3CME3 3WOEB 4FMCA 4OK0A 5ELUA 1C54A 3WDGB 3WA3A 3H51A 4ORLA 2L1SA 3GWRA 1EG9B 1YVBI 4CPKA 3AMOA 1LNHA 3SOYA 1LOVA 1UCJA 2FXTA 3B8LA 3PZWA 3V98A 1FW7A 1JBTA 2Y73A 1ZS7A 1N8R4 2H0GA 3Q90A 3J7Yd 2CH9A 1B20A 4O3VA 5CF1A 2XH9A 1WQLB 1W02A 4FCJA 1K28A 2CFGA 4J5KA 1QAFA 1BRIA 1NJI4 1RCLA 2KF4A 1BNIA 2IUJA 2GBWB 4WP5A 1VQM3 3CXC2 2W0QA 5G2GA 1I2EA 3EJVA 4KFEA 1FGMA 1D6UA 2LYXA 2ML5A 1OHPA 5CK6A 3AGOA 4BIRA 3I563 1TRQA 1LNIA 1BRHA 3D4AA 2CKFB 4J8TA 3JUPA 4PEJA 1VZZA 2HMJB 3CCV3 1JJ22 1B2MA 3K5TA 1S723 3LTDA 3NM7A 3WHOA 3DUKA 5D82A 1YNVX 5ELJA 4LZIA 1A2PA 1CH0A 3NUVA 1FGRA 4JF8A 4ILFA 5AYRB 1OCVA 3BLZA 2LQVA 3VGNA 5KP1A 1VQ93 1S5AA 4TX4A 1BAOA 2KXGA 1OGZA 2MC8A 3UL6A 1FGQA 1WMOA 3EN1B 3ZG0A 1W7CA 2HMOB 2XEPA
chains in the Genus database with same CATH topology
1AY7A 1I70A 1BSCA 1T2IA 1PYLA 1RMSA 1BNSA 1BRJA 1DE3A 2HOHA 3BIRA 1TRPA 1UCKA 1R4YA 1I0XA 1UCLA 1BRKA 4GSPA 4GHOA 5RNTA 5BU4A 1BNGA 1FUTA 3D5GA 1DETA 1RTUA 1TTOA 1BRNL 1FZUA 1GOYA 1RGEA 1LOWA 1JBRA 2BIRA 1RSNA 1X1XA 4BU4A 4J5GA 2AAEA 1B21A 1MGRA 1BOXA 3AHWA 6GSPA 1LRAA 3Q3FA 1Q9EA 1RN4A 2C4BA 1BSEA 1X1UA 3KCHA 1BANA 1FYSA 1I8VA 6RNTA 1I2GA 1BNRA 1G02A 1RN1A 4HAAA 8RNTA 1UCIA 1RGLA 1RGGA 3DGYA 2RNTA 1YVSA 3BU4A 1RGCA 1B2SA 1GOVA 7GSPA 1I3IA 1I3FA 5GSPA 2RBIA 1RGHA 4HOHA 9RNTA 1X1WA 1GMPA 1IYYA 1SARA 1BNJA 3RNTA 2KF3A 1BSAA 1B2XA 1B2ZA 2GSPA 1RGAA 2F56A 1BNFA 1RGKA 1C54A 1RLSA 1BVIA 1HZ1A 1BIRA 1BRSA 3SYUA 1FW7A 1LOVA 1UCJA 1RGFA 3A5EA 4RNTA 1JBTA 2KF5A 3AGNA 2KAAA 1MGWA 1B20A 2KF6A 2F4YA 1HYFA 1AQZA 1LOYA 1RCKA 2SARA 4J5KA 1BRIA 1RCLA 1I0VA 1GMRA 1BNIA 2KF4A 2ZA4A 1B3SA 5BIRA 2BU4A 1ZGXA 7RNTA 5HOHA 1I2EA 2F5MA 1I2FA 4BIRA 3AGOA 1RHLA 2F5WA 3DH2A 1TRQA 1LNIA 1BRHA 3D4AA 1JBSA 1GMQA 1BUJA 1BNEA 1X1YA 3HOHA 3AHSA 1B2MA 1BGSA 1GSPA 1T2HA 1B27A 3WHOA 1RNTA 1YGWA 1BSDA 1BU4A 1YNVX 3WR2A 1A2PA 1CH0A 2AADA 1RNBA 3D5IA 1FUSA 1BRGA 3GSPA 1BAOA 1BSBA 1PY3A 1RDSA 1B2UA 3URPA 1GOUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AY7 A;  1I70 A;  1BSC A;  1T2I A;  1PYL A;  1RMS A;  1BNS A;  1BRJ A;  1DE3 A;  2HOH A;  3BIR A;  1TRP A;  1UCK A;  1R4Y A;  1I0X A;  1UCL A;  1BRK A;  4GSP A;  4GHO A;  5RNT A;  5BU4 A;  1BNG A;  1FUT A;  3D5G A;  1DET A;  1RTU A;  1TTO A;  1BRN L;  1FZU A;  1GOY A;  1RGE A;  1LOW A;  1JBR A;  2BIR A;  1RSN A;  1X1X A;  4BU4 A;  4J5G A;  2AAE A;  1B21 A;  1MGR A;  1BOX A;  3AHW A;  6GSP A;  1LRA A;  3Q3F A;  1Q9E A;  1RN4 A;  2C4B A;  1BSE A;  1X1U A;  3KCH A;  1BAN A;  1FYS A;  1I8V A;  6RNT A;  1I2G A;  1BNR A;  1G02 A;  1RN1 A;  4HAA A;  8RNT A;  1UCI A;  1RGL A;  1RGG A;  3DGY A;  2RNT A;  1YVS A;  3BU4 A;  1RGC A;  1B2S A;  1GOV A;  7GSP A;  1I3I A;  1I3F A;  5GSP A;  2RBI A;  1RGH A;  4HOH A;  9RNT A;  1X1W A;  1GMP A;  1IYY A;  1SAR A;  1BNJ A;  3RNT A;  2KF3 A;  1BSA A;  1B2X A;  1B2Z A;  2GSP A;  1RGA A;  2F56 A;  1BNF A;  1RGK A;  1C54 A;  1RLS A;  1BVI A;  1HZ1 A;  1BIR A;  1BRS A;  3SYU A;  1FW7 A;  1LOV A;  1UCJ A;  1RGF A;  3A5E A;  4RNT A;  1JBT A;  2KF5 A;  3AGN A;  2KAA A;  1MGW A;  1B20 A;  2KF6 A;  2F4Y A;  1HYF A;  1AQZ A;  1LOY A;  1RCK A;  2SAR A;  4J5K A;  1BRI A;  1RCL A;  1I0V A;  1GMR A;  1BNI A;  2KF4 A;  2ZA4 A;  1B3S A;  5BIR A;  2BU4 A;  1ZGX A;  7RNT A;  5HOH A;  1I2E A;  2F5M A;  1I2F A;  4BIR A;  3AGO A;  1RHL A;  2F5W A;  3DH2 A;  1TRQ A;  1LNI A;  1BRH A;  3D4A A;  1JBS A;  1GMQ A;  1BUJ A;  1BNE A;  1X1Y A;  3HOH A;  3AHS A;  1B2M A;  1BGS A;  1GSP A;  1T2H A;  1B27 A;  3WHO A;  1RNT A;  1YGW A;  1BSD A;  1BU4 A;  1YNV X;  3WR2 A;  1A2P A;  1CH0 A;  2AAD A;  1RNB A;  3D5I A;  1FUS A;  1BRG A;  3GSP A;  1BAO A;  1BSB A;  1PY3 A;  1RDS A;  1B2U A;  3URP A;  1GOU A; 
#chains in the Genus database with same CATH topology
 4H3U A;  4HM1 B;  1BSC A;  3K0Z A;  5EEO A;  1PYL A;  1HKX A;  3G0K A;  3PS8 A;  5IG4 A;  3DMC A;  3WA2 X;  3ALA A;  1IVU A;  2HOH A;  2XSO B;  4HBR A;  2OQE A;  4KFD A;  4AKY A;  3NX0 A;  1W2B 2;  5DRE A;  1VQ8 3;  1I0X A;  4LGQ A;  1EA2 A;  4WWU C;  5TGN A;  4GHO A;  3KFQ C;  1FUT A;  1DET A;  1JB5 A;  2B1X B;  2Z7A A;  1IQX A;  3FKA A;  2BIR A;  1RSN A;  4RBN A;  2GEY A;  5A0O B;  3HX8 A;  1X1X A;  4XM4 A;  2SBL A;  2C11 A;  3B4O A;  4HM4 B;  5CF2 A;  2P0M A;  4J5G A;  5STD A;  1U5O A;  2D42 A;  1C7H A;  5LC7 A;  3MSO A;  3BNC A;  1LVN A;  3Q3F A;  1GS3 A;  1RN4 A;  1JZO A;  3NHX A;  1W6C A;  2P05 A;  1AR0 A;  1AV4 A;  1MWS A;  2QIY A;  3RGR A;  1MWR A;  5HGR A;  1SQW A;  4R9L A;  4HM2 B;  2HML B;  8RNT A;  1D6Z A;  3F14 A;  4O02 B;  4NRE A;  4EC6 A;  3DGY A;  2A15 A;  4DKI A;  1ULJ B;  5IER A;  3JUO A;  3LT8 A;  3HI7 A;  3FGY A;  2HMM B;  1GOV A;  4NHF A;  1RJO A;  1VQ5 3;  1AVK A;  3ROB A;  4HM7 B;  3V92 A;  4J9A A;  1OHS A;  3FCS B;  3F40 A;  1X1W A;  2F99 A;  1OF5 B;  5AII A;  4MMZ B;  2BO9 B;  2M7O A;  5IEP A;  4GL6 A;  4I5Q A;  4Q53 A;  1BNJ A;  3B7C A;  2CFW A;  1MWT A;  2CW9 A;  3OXA A;  2CWU A;  2WGO A;  3F8X A;  5LC6 A;  2GSP A;  4NPB A;  1RGA A;  3JUQ A;  3VF1 A;  2BNG A;  3CU3 A;  4HJL B;  2CFL A;  1BNF A;  3GRD A;  4R4K A;  1OUN A;  1RGK A;  2K0M A;  5D83 A;  5I97 A;  1RLS A;  3F8H A;  4FCM A;  1BVI A;  1HZ1 A;  3NBR A;  1KQS 2;  5M18 A;  1BIR A;  1Q86 4;  4EBG A;  3SVA A;  2H0I A;  1N5P A;  3SED A;  5FGO A;  1VQO 3;  1RRL A;  4RNT A;  3KE7 A;  2OOV C;  2KAA A;  2QA4 3;  1ASK A;  3KKG A;  1US1 A;  4H61 A;  5D81 A;  3BB9 A;  2F4Y A;  3CNX A;  1AQZ A;  1LOY A;  3CPO A;  1PU4 A;  1OH0 A;  1Q82 4;  2Q07 A;  2CWV A;  3FZW A;  1UUV B;  1I0V A;  1O7H B;  2GU1 A;  4OVM A;  2BU4 A;  1GY7 A;  1KC8 4;  2CFD A;  4L7K A;  3WOF B;  1VQ6 3;  3KSP A;  1TP6 A;  1O7P B;  1I2F A;  1RHL A;  2F5W A;  4EV2 A;  1FA3 A;  4WYK B;  4CJN A;  4EV5 A;  3CC4 3;  3AHS A;  4LMI A;  1A2V A;  1BGS A;  5AIG A;  5EQL A;  1TU5 A;  2OTL 3;  3CNM A;  1Q7Y 4;  4O2H A;  1BSD A;  3LTC A;  3G6E 3;  1IV7 A;  3CCU 3;  1Q40 B;  4X2O A;  1CQS A;  3D3L A;  3D9R A;  1LQG C;  2BMR B;  4CCV A;  4R9K A;  4HZB B;  4WFO A;  7STD A;  1ZO2 A;  4HM8 B;  2STD A;  3UL5 A;  1V74 A;  1T5Y A;  3URP A;  5AIH A;  4WHA A;  1DVD A;  1KSI A;  1GOU A;  2CHC A;  1JNQ A;  3AMO B;  4G1M B;  3FLJ A;  3JVC A;  3RGA A;  4IPB A;  5IEN A;  1FUW A;  3F9S A;  1O7N B;  4GB5 A;  3S67 A;  5BXQ A;  2CIU A;  2YX9 A;  1J2B A;  2O9U X;  2W04 A;  4RZM A;  3T8N A;  4BTX A;  3BIR A;  1TRP A;  2XGN A;  1Q7H A;  3G4S 3;  3FH1 A;  1R4Y A;  2RGQ A;  4CDL A;  1YJN 3;  2WOH A;  5JPP A;  1UGI A;  3D5G A;  3FG4 A;  3GZB A;  1ROV A;  1FZU A;  4FMB A;  3V99 A;  3NQZ A;  2RSX A;  3N9H A;  4N3V A;  2R4I A;  2XGL A;  3X3Y A;  2B24 B;  1IVW A;  2Z76 A;  3L0R A;  2GEX A;  2AAE A;  1O7W B;  4MMX B;  3B4P A;  3JUN A;  1V57 A;  2KRT A;  4OUQ A;  5AEU B;  4EW5 A;  6GSP A;  1YJ9 3;  2UGI A;  5G1L A;  1TJD A;  2HMN B;  2K3D A;  3OWU A;  5BVB A;  1IT7 A;  4MEI A;  5IF6 A;  3VSY A;  2WGQ A;  1BSE A;  3KCH A;  1G96 A;  4FMA A;  1I8V A;  6RNT A;  3TDG A;  1BNR A;  4N6T A;  2ML6 A;  1QAK A;  1RGL A;  3EF8 A;  1GY6 A;  2RNT A;  1YVS A;  4AEQ A;  3LOY A;  1UI7 A;  1EKM A;  1WTH A;  2QGU A;  1JB4 A;  2UX0 A;  3BU4 A;  1JB2 A;  1FGT A;  4X2H A;  1I3I A;  1TFK A;  3LH4 A;  2OTJ 3;  3KN4 A;  5GSP A;  3GZY B;  1NB3 I;  4N6L A;  1YI2 3;  2JDI H;  1ROA A;  4HOH A;  1IU7 A;  9RNT A;  2W56 A;  4KT3 B;  3U1W A;  1GMP A;  1VQ7 3;  3PCR A;  1YJW 3;  1SAR A;  4N6U A;  3CCL 3;  1JN5 A;  2W6J H;  5IG3 A;  3LTA A;  3RNT A;  2IA7 A;  4BL2 A;  1CYV A;  3WOD G;  3NBB A;  2W03 A;  4STD A;  1M1X B;  1M9G A;  1R4C A;  1RKY A;  2KCD A;  4HM3 B;  1WNH A;  3CD6 3;  1FGO A;  3DM8 A;  3ECF A;  3BNB A;  1K9M 4;  1O7M B;  1BRS A;  3S27 A;  5KP3 A;  3SYU A;  2BT3 A;  1A2K A;  4XBY A;  1SII A;  3EHC A;  1RGF A;  2D1W A;  3A5E A;  3X3X A;  1LOX A;  2UUG C;  3AGN A;  5EVH A;  1KD1 4;  1MGW A;  3GAX A;  2OOV A;  1IV9 A;  2KF6 A;  1HYF A;  3NBJ A;  6STD A;  1STF I;  1N5H A;  1E3R A;  1QMA A;  2Y74 A;  3EBT A;  3PYJ A;  3CCM 3;  2HMK B;  2ZA4 A;  4R80 A;  3EX9 A;  5BIR A;  1ZGX A;  3EBY A;  3FG1 A;  1K8A 4;  3ER7 A;  1DMQ A;  1DYU A;  3DXO A;  1W5Z A;  3DH2 A;  1N9J A;  2GXF A;  3Q1C A;  3HIG A;  4FR9 A;  4LYL B;  1BUQ A;  1GMQ A;  1VQQ A;  3Q2P A;  1BUJ A;  1BNE A;  1X1Y A;  2E2U A;  3EB8 A;  3HOH A;  1GSP A;  3EN8 A;  3K9M C;  2BHM A;  1B27 A;  2W9P A;  3N8B A;  1RN7 A;  1YGW A;  3LXU X;  1BU4 A;  3WR2 A;  1CYU A;  2AAD A;  4ZM8 A;  1QVG 2;  1RNB A;  1NDO B;  2WOF A;  1F8N A;  3DGN A;  3UB1 A;  1Q42 A;  2INX A;  1TUH A;  3GSP A;  2BMO B;  3N54 B;  1SPU A;  3PCS A;  1BSB A;  1PY3 A;  3IPT A;  1W01 A;  1NO3 A;  3JUM A;  4HVN A;  3ZG5 A;  4K61 A;  3OV4 A;  2OWP A;  5M1A A;  1I70 A;  1M1K 4;  5AEW B;  3HK4 A;  3BND A;  1QJG A;  1K73 4;  1NU3 A;  3HII A;  3SOA A;  5IG5 A;  2J8X B;  1RMS A;  2F98 A;  5M19 A;  1QAL A;  1BNS A;  4I4K A;  3K7C A;  4BL3 A;  1UCK A;  4L8P A;  5CXO A;  3MKI A;  3X3Z A;  3IMA B;  3MG1 A;  3DY5 A;  1WMP A;  2XF3 A;  3ZFZ A;  5BU4 A;  5RNT A;  4QWT A;  1JV2 B;  3CPW 2;  1RTU A;  2GBX B;  1TTO A;  2O3O A;  1E3V A;  1GOY A;  1RGE A;  1BRN L;  1LOW A;  1JKG A;  1E97 A;  1MOL A;  1U8C B;  1MNL A;  2R41 A;  1DMN A;  1W2Z A;  4RNY A;  4BU4 A;  1UGH I;  1OPY A;  5JBS A;  1B21 A;  5JPU A;  1BOX A;  3AHW A;  4LSO A;  1LRA A;  2XFT A;  2K54 A;  1Q9E A;  4HYZ A;  2C4B A;  1GD4 A;  1JRQ A;  4XBT A;  4N6N B;  2FNQ A;  2FGT A;  1IQ8 A;  4K90 B;  1X1U A;  1BAN A;  1I2G A;  1OHO A;  4HM0 B;  5IG0 A;  1UCI A;  3GZX B;  1RGG A;  1UI8 A;  3IJE B;  2IYJ A;  2Z77 A;  3UNL A;  2RFR A;  1RGC A;  1VQN 3;  3CCJ 3;  2IUK A;  3D79 A;  3PXM A;  3X42 A;  4HKV B;  3CC7 3;  1I3F A;  2CFK A;  2RBI A;  3I0Y A;  1ULI B;  1SJW A;  4N6V 0;  1RGH A;  1WMN A;  1K41 A;  3O8Y A;  1QVF 2;  1M90 4;  1GYB A;  1CEW I;  3S29 A;  3MHE A;  1IYY A;  2XFS A;  3M8C A;  1OGX A;  5AIF A;  3WMD A;  2ZHX B;  4BTY A;  1IQY A;  3X41 A;  3CCE 3;  1N9E A;  2OCT A;  1L5G B;  3LT9 A;  1RRH A;  2F86 B;  1KWI A;  3QK9 A;  3SX1 A;  1D6Y A;  3STD A;  2F56 A;  1N8Q A;  1YIT 3;  3EQQ B;  3SLU A;  1YIJ 3;  5DRV A;  1ISK A;  3G16 A;  1OAC A;  3I55 3;  3RDE A;  2YFI B;  4AKZ A;  2XSH B;  2PNC A;  2V1L A;  3LZA A;  2YFJ B;  2P38 A;  1G0T A;  1STD A;  2E2T A;  2CX0 A;  1O7G B;  1HU9 A;  2KF5 A;  3G71 3;  2JQ5 A;  2CX1 A;  2ZDJ A;  5G1K A;  3QRD A;  2SAR A;  1RCK A;  4FMD A;  1ZX2 A;  1AVL A;  1GMR A;  2RCD A;  4JRF A;  2XR8 B;  1B3S A;  1LXE A;  3MG3 A;  7RNT A;  5HOH A;  1Q81 4;  1UDI I;  2MF7 A;  5AI1 A;  2Z6B A;  1W6G A;  1SIH A;  3A76 A;  2F5M A;  2P09 A;  3NV0 A;  1EUI C;  4IT7 A;  3S28 A;  4KZ1 A;  1JBS A;  2IMJ A;  4BTW A;  2W56 B;  4XBX A;  2E2V A;  2IY2 A;  3LYG A;  1T2H A;  3S5C A;  1JN5 B;  1RNT A;  4XB5 A;  2C10 A;  1NB5 I;  5KP4 A;  1V58 A;  1UUW B;  3MPH A;  3EC9 A;  2CG1 A;  1T3B A;  3SXX A;  2H0H A;  3CMA 3;  1UW1 A;  3FF0 A;  3NV0 B;  3LTB A;  3D5I A;  3CCQ 3;  1Y4K A;  1YHQ 3;  1FUS A;  1BRG A;  2XRX B;  1GD3 A;  3DGM A;  3DGO A;  4HM5 B;  5CLK A;  1MWU A;  1RDS A;  1B2U A;  1AY7 A;  4RNZ A;  5FW5 A;  4K1U A;  3X40 A;  1IK3 A;  2GU3 A;  1T2I A;  3DZL A;  3KZT A;  1JZD A;  1W4N A;  2OQE C;  1BRJ A;  1DE3 A;  1EEJ A;  3MWZ A;  1OF5 A;  3DGL A;  4EXR A;  2CK3 H;  1UCL A;  3T8U A;  1Z1S A;  1BRK A;  4EYC A;  1GY5 A;  4GSP A;  3CCR 3;  1IVV A;  3NQY A;  3NXJ A;  1BNG A;  3UJM A;  1VQ4 3;  4HZ9 B;  5IW9 A;  4HM6 B;  1A90 A;  3KSE D;  2W2C A;  1JBR A;  3U97 A;  1VQK 3;  4O8S A;  5AYS C;  1LQM B;  1W6Y A;  3OWY A;  1VQP 3;  4MJD A;  1VQL 3;  1MGR A;  3FF2 A;  2PZV A;  1PFP A;  4N6O B;  1IDP A;  4LEH A;  3EE1 A;  3MG2 A;  1DVC A;  4KFF A;  2BMQ B;  3CCS 3;  2YFL B;  4KVH A;  4FCZ A;  4K1V A;  3CC2 3;  1A67 A;  1FYS A;  2P0X A;  4L8O A;  1NNV A;  3NM2 A;  1G02 A;  1RN1 A;  1W00 A;  3F7S A;  4HAA A;  2CG0 A;  2CWT A;  3MYT A;  4MMY B;  1TFO A;  3FSD A;  3HZP A;  3OX9 A;  2QEX 3;  8CHO A;  1EQK A;  3FG3 A;  2WO0 A;  3KII A;  1B2S A;  2L4V A;  7GSP A;  3H3H A;  4N6M A;  3OWS A;  1IVX A;  3LML A;  4IIA A;  3BNE A;  1DMM A;  3OW2 2;  5IEO A;  1IT8 A;  4WYK A;  3K63 A;  2I9W A;  2CC3 A;  4XDV A;  2W9Q A;  3PGB A;  4U13 A;  1UUG B;  4R1K A;  1NWW A;  2KF3 A;  3E99 A;  1Q40 A;  1TIJ A;  1YGE A;  1BSA A;  3F7X A;  1B2X A;  2ZL8 A;  3GZR A;  4XDW A;  3G8Z A;  1B2Z A;  1JKG B;  3T0U A;  3CME 3;  3WOE B;  4FMC A;  4OK0 A;  5ELU A;  1C54 A;  3WDG B;  3WA3 A;  3H51 A;  4ORL A;  2L1S A;  3GWR A;  1EG9 B;  1YVB I;  4CPK A;  3AMO A;  1LNH A;  3SOY A;  1LOV A;  1UCJ A;  2FXT A;  3B8L A;  3PZW A;  3V98 A;  1FW7 A;  1JBT A;  2Y73 A;  1ZS7 A;  1N8R 4;  2H0G A;  3Q90 A;  3J7Y d;  2CH9 A;  1B20 A;  4O3V A;  5CF1 A;  2XH9 A;  1WQL B;  1W02 A;  4FCJ A;  1K28 A;  2CFG A;  4J5K A;  1QAF A;  1BRI A;  1NJI 4;  1RCL A;  2KF4 A;  1BNI A;  2IUJ A;  2GBW B;  4WP5 A;  1VQM 3;  3CXC 2;  2W0Q A;  5G2G A;  1I2E A;  3EJV A;  4KFE A;  1FGM A;  1D6U A;  2LYX A;  2ML5 A;  1OHP A;  5CK6 A;  3AGO A;  4BIR A;  3I56 3;  1TRQ A;  1LNI A;  1BRH A;  3D4A A;  2CKF B;  4J8T A;  3JUP A;  4PEJ A;  1VZZ A;  2HMJ B;  3CCV 3;  1JJ2 2;  1B2M A;  3K5T A;  1S72 3;  3LTD A;  3NM7 A;  3WHO A;  3DUK A;  5D82 A;  1YNV X;  5ELJ A;  4LZI A;  1A2P A;  1CH0 A;  3NUV A;  1FGR A;  4JF8 A;  4ILF A;  5AYR B;  1OCV A;  3BLZ A;  2LQV A;  3VGN A;  5KP1 A;  1VQ9 3;  1S5A A;  4TX4 A;  1BAO A;  2KXG A;  1OGZ A;  2MC8 A;  3UL6 A;  1FGQ A;  1WMO A;  3EN1 B;  3ZG0 A;  1W7C A;  2HMO B;  2XEP A; 
#chains in the Genus database with same CATH homology
 1AY7 A;  1I70 A;  1BSC A;  1T2I A;  1PYL A;  1RMS A;  1BNS A;  1BRJ A;  1DE3 A;  2HOH A;  3BIR A;  1TRP A;  1UCK A;  1R4Y A;  1I0X A;  1UCL A;  1BRK A;  4GSP A;  4GHO A;  5RNT A;  5BU4 A;  1BNG A;  1FUT A;  3D5G A;  1DET A;  1RTU A;  1TTO A;  1BRN L;  1FZU A;  1GOY A;  1RGE A;  1LOW A;  1JBR A;  2BIR A;  1RSN A;  1X1X A;  4BU4 A;  4J5G A;  2AAE A;  1B21 A;  1MGR A;  1BOX A;  3AHW A;  6GSP A;  1LRA A;  3Q3F A;  1Q9E A;  1RN4 A;  2C4B A;  1BSE A;  1X1U A;  3KCH A;  1BAN A;  1FYS A;  1I8V A;  6RNT A;  1I2G A;  1BNR A;  1G02 A;  1RN1 A;  4HAA A;  8RNT A;  1UCI A;  1RGL A;  1RGG A;  3DGY A;  2RNT A;  1YVS A;  3BU4 A;  1RGC A;  1B2S A;  1GOV A;  7GSP A;  1I3I A;  1I3F A;  5GSP A;  2RBI A;  1RGH A;  4HOH A;  9RNT A;  1X1W A;  1GMP A;  1IYY A;  1SAR A;  1BNJ A;  3RNT A;  2KF3 A;  1BSA A;  1B2X A;  1B2Z A;  2GSP A;  1RGA A;  2F56 A;  1BNF A;  1RGK A;  1C54 A;  1RLS A;  1BVI A;  1HZ1 A;  1BIR A;  1BRS A;  3SYU A;  1FW7 A;  1LOV A;  1UCJ A;  1RGF A;  3A5E A;  4RNT A;  1JBT A;  2KF5 A;  3AGN A;  2KAA A;  1MGW A;  1B20 A;  2KF6 A;  2F4Y A;  1HYF A;  1AQZ A;  1LOY A;  1RCK A;  2SAR A;  4J5K A;  1BRI A;  1RCL A;  1I0V A;  1GMR A;  1BNI A;  2KF4 A;  2ZA4 A;  1B3S A;  5BIR A;  2BU4 A;  1ZGX A;  7RNT A;  5HOH A;  1I2E A;  2F5M A;  1I2F A;  4BIR A;  3AGO A;  1RHL A;  2F5W A;  3DH2 A;  1TRQ A;  1LNI A;  1BRH A;  3D4A A;  1JBS A;  1GMQ A;  1BUJ A;  1BNE A;  1X1Y A;  3HOH A;  3AHS A;  1B2M A;  1BGS A;  1GSP A;  1T2H A;  1B27 A;  3WHO A;  1RNT A;  1YGW A;  1BSD A;  1BU4 A;  1YNV X;  3WR2 A;  1A2P A;  1CH0 A;  2AAD A;  1RNB A;  3D5I A;  1FUS A;  1BRG A;  3GSP A;  1BAO A;  1BSB A;  1PY3 A;  1RDS A;  1B2U A;  3URP A;  1GOU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...