1RNTA

Restrained least-squares refinement of the crystal structure of the ribonuclease t1(asterisk)2(prime)-guanylic acid complex at 1.9 angstroms resolution
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Restrained Least-Squares Refinement of the Crystal Structure of the Ribonuclease T1(Asterisk)2(Prime)-Guanylic Acid Complex at 1.9 Angstroms Resolution
pubmed rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE T1 ISOZYME
total genus 25
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1987-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1rntA00
3SYUA 3Q3FA 1YVSA 2F4YA 1BRGA 3D4AA 2BU4A 3A5EA 1BUJA 1RDSA 1LOVA 2F56A 1BANA 1B2SA 1B2UA 1PYLA 1AY7A 1DETA 1YNVX 1BNSA 1T2IA 1LRAA 1GMRA 5RNTA 1BRJA 2BIRA 3DGYA 1JBSA 1RGKA 1RLSA 2GSPA 1X1WA 1FUSA 1G02A 1BNEA 1I8VA 1RMSA 1YGWA 1TTOA 7GSPA 3WR2A 1GOVA 1GSPA 5HOHA 9RNTA 1RCKA 1FZUA 3AGOA 2KF4A 3AHWA 1JBTA 1LOYA 3BIRA 4BU4A 1UCKA 1BNFA 1DE3A 1RGGA 2RBIA 2HOHA 1HZ1A 2RNTA 7RNTA 1RHLA 4GSPA 1RNTA 3DH2A 1MGRA 1T2HA 1RCLA 2ZA4A 3RNTA 4HAAA 1I0VA 1JBRA 1I2GA 1FW7A 1BRNL 1BAOA 1BNIA 3AHSA 1SARA 1BSAA 1CH0A 3KCHA 1B2XA 1B20A 1RGLA 1UCJA 1RN1A 1I3IA 1FUTA 1BNRA 1I70A 1B21A 1GMQA 1HYFA 4GHOA 4BIRA 2SARA 1MGWA 1A2PA 2AAEA 1UCIA 1X1XA 1B2MA 1IYYA 1RGCA 1RN4A 1B3SA 1AQZA 1GMPA 1RNBA 6GSPA 2F5MA 1BRIA 1FYSA 2F5WA 4HOHA 3BU4A 1BSCA 1BRHA 1C54A 1BNGA 1LOWA 1RGFA 3URPA 3D5GA 1TRPA 1BOXA 1I2EA 1BSBA 1BU4A 1I0XA 1R4YA 4RNTA 1GOUA 1BRKA 5GSPA 5BU4A 2C4BA 3AGNA 4J5GA 1BRSA 3D5IA 1RGHA 1BNJA 1RGEA 1B27A 1X1YA 2KF6A 1ZGXA 1UCLA 1GOYA 1TRQA 1RGAA 3HOHA 1BVIA 4J5KA 1BGSA 1BIRA 1B2ZA 1X1UA 1RSNA 8RNTA 1Q9EA 1I3FA 6RNTA 1BSDA 2KAAA 1LNIA 1PY3A 2KF5A 1BSEA 5BIRA 1I2FA 3WHOA 2AADA 3GSPA 2KF3A 1RTUA
chains in the Genus database with same CATH superfamily
4HM3B 1ULIB 3SYUA 3Q3FA 1K8A4 3VSYA 3SVAA 3V98A 2WGOA 4R80A 4R1KA 1BUJA 4QWTA 5FW5A 2F56A 5AEWB 4JRFA 3EHCA 3GSPA 1OGXA 5EVHA 1AY7A 3DZLA 1DETA 1W2ZA 1AVKA 1YNVX 3NM2A 1WNHA 2IY2A 4N6TA 1T3BA 5IG0A 1CEWI 4RNZA 1IVVA 4GL6A 3NX0A 1RGKA 1RLSA 2GSPA 1AVLA 4HM0B 3G0KA 4R9LA 4TX4A 5IG5A 1I8VA 1UGIA 1UDII 2FGTA 3JUPA 1VZZA 1YGWA 5CF2A 5HOHA 1GOVA 9RNTA 4EBGA 1VQ83 2KF4A 1Q7HA 2MF7A 5LC6A 1YI23 2BO9B 3GZYB 4N6UA 5IG4A 1JV2B 3ZFZA 1BNFA 3SOYA 2OTL3 1HZ1A 1FUWA 2INXA 2K0MA 5EQLA 1IU7A 1UUGB 1WMOA 2CWTA 2FNQA 3BB9A 4EV2A 2PZVA 3BNCA 4HKVB 1WTHA 3OV4A 4BTWA 2H0GA 4Q53A 1FA3A 3OWSA 3F8XA 5AIFA 5M1AA 1RRHA 1TUHA 1N8R4 1QMAA 2XFSA 1NB3I 3FCSB 3D79A 1TFOA 1CH0A 1IT8A 3KCHA 1B2XA 1RN1A 1L5GB 1LOXA 3I0YA 2GEXA 2ML5A 1MWUA 1BNRA 2I9WA 1I70A 2A15A 3F7XA 3X41A 1JB2A 3NBJA 1BUQA 1HYFA 4BIRA 2SARA 3JUOA 1KC84 1MGWA 1O7HB 2BMQB 2HMOB 3N54B 2QIYA 2W0QA 2O9UX 3AMOB 1B2MA 1IYYA 1RN4A 1OHOA 5CK6A 1RNBA 2IA7A 3K7CA 2F5MA 3H3HA 4MMXB 4HOHA 3EF8A 1IV9A 5G1LA 1OPYA 4EV5A 3LYGA 3G16A 5IEOA 4X2OA 1LOWA 3JUNA 3URPA 3OW22 1VQ53 3JUMA 4K1UA 3PYJA 1D6YA 1BU4A 1UUWB 3X3YA 1R4YA 2C11A 3Q1CA 4HZBB 2OWPA 3FKAA 4XBXA 4XDVA 2C4BA 4J5GA 3CCR3 1QVF2 3OXAA 3SEDA 4N6NB 1BNJA 1V57A 2KF6A 4O02B 5AIGA 3FG3A 3STDA 1LXEA 3ER7A 1QALA 1GOYA 3I563 1DMMA 1OGZA 1BVIA 4DKIA 3IJEB 1E3VA 1UI8A 1QAKA 2H0HA 2KRTA 4RZMA 3BNDA 2XSOB 3CCV3 1DVCA 3MSOA 6RNTA 3ROBA 4LEHA 1W2B2 1UUVB 4HVNA 3ZG5A 3K0ZA 4HBRA 1SIHA 4HAAA 3T8UA 3NQYA 2UUGC 5IEPA 3RGRA 2CIUA 4K90B 4AKYA 2CX1A 2LYXA 3X3XA 4CPKA 3CCJ3 2R4IA 1TP6A 2CFLA 1WQLB 2JDIH 3A5EA 3FGYA 1LOVA 1JKGB 1U8CB 3SX1A 3KFQC 1W02A 1B2UA 1PYLA 2P38A 3O8YA 4AEQA 2OQEA 1OF5A 4N6V0 2CC3A 2HMMB 1VQ73 5JPPA 4NPBA 3DUKA 1NU3A 3EE1A 1G02A 3PGBA 1VQK3 2SBLA 2Q07A 3EBYA 3CC43 2Z77A 2QEX3 1VQ93 3WR2A 1K734 1A90A 4XBYA 1OUNA 3MPHA 1VQO3 3PCSA 1HKXA 3NHXA 1CYVA 4BU4A 1NNVA 1M9GA 3SLUA 2HOHA 4KVHA 2QGUA 2F86B 4OUQA 1RHLA 3MWZA 1RNTA 3DH2A 3CCU3 1T2HA 1U5OA 3DGOA 3N8BA 4BTXA 1IDPA 4N6MA 5JPUA 3CC23 3S29A 4KFDA 1FGQA 1Z1SA 2D1WA 3IPTA 3OX9A 1ROAA 3B4OA 3X3ZA 4K1VA 3WA3A 1EKMA 3HIGA 1S723 1BAOA 4EW5A 5CF1A 1TJDA 1GYBA 1SARA 5KP4A 2F99A 1J2BA 1STDA 1NB5I 1LQGC 1B20A 1GD3A 1RGLA 3HZPA 3U97A 1NO3A 1W01A 2IMJA 3LOYA 1Q7Y4 2IYJA 4NREA 4LMIA 1GMQA 4GHOA 1JJ22 5BXQA 3JVCA 3QK9A 2IUJA 1NDOB 1JZDA 5ELJA 4I4KA 2W56A 1IVWA 4L8PA 3I553 4STDA 3FG4A 1OHSA 1AV4A 3MG3A 4CCVA 3LT9A 5G1KA 1DMNA 3U1WA 4FMBA 2GEYA 4L7KA 2E2UA 4H3UA 4O2HA 1DVDA 1O7PB 1ZO2A 3BU4A 2PNCA 4ZM8A 3G713 1BSCA 1Q864 1RGFA 3JUQA 5KP3A 4OVMA 1MNLA 1BSBA 5IERA 2P0XA 4RNTA 2UGIA 1BRKA 1QAFA 1DYUA 5AIHA 2CW9A 1O7NB 2P05A 3T0UA 4WYKB 1GY5A 1BRSA 1M904 3D5IA 1UW1A 1WMPA 2P0MA 2V1LA 3DM8A 3VF1A 1O7WB 2P09A 1Q824 1QVG2 1W7CA 1B27A 1X1YA 2Z76A 1VQM3 4FMDA 5A0OB 3QRDA 4U13A 1ZGXA 3LTAA 1UCLA 4XM4A 1W5ZA 1NJI4 3UJMA 1W4NA 3CC73 1TRQA 2BHMA 1R4CA 3MG1A 1IQYA 3FSDA 1BGSA 1FGOA 2XGLA 4J5KA 3LH4A 1EQKA 3NQZA 3SXXA 3T8NA 1RSNA 3GWRA 2CX0A 3UB1A 1YVBI 5IF6A 3EN1B 1EEJA 3G4S3 2KCDA 3S67A 1D6ZA 2YFIB 3CPW2 3EN8A 3LTBA 4JF8A 3NV0A 2BMRB 3PXMA 5CLKA 3F14A 1IQXA 1S5AA 1SIIA 1YGEA 3BNEA 3PCRA 4R9KA 1YVSA 2H0IA 3AMOA 2BU4A 4HM1B 4R4KA 4BL2A 3MKIA 4XBTA 5BVBA 4HJLB 5STDA 3LMLA 4ORLA 4WP5A 1BNSA 1N8QA 5I97A 2L1SA 2B24B 1SJWA 3V92A 5JBSA 3B8LA 1GMRA 3SOAA 1W6GA 2BIRA 2HMKB 1G96A 2E2VA 3DGYA 1IQ8A 3GZXB 4HM5B 1JBSA 2C10A 1X1WA 2XRXB 1FUSA 3DY5A 5IG3A 1BNEA 1W6CA 1N5PA 1UI7A 1TTOA 3L0RA 2FXTA 1ULJB 2CG0A 1A2KA 2GU3A 5TGNA 1G0TA 1FZUA 2XSHB 3OWYA 1RN7A 1LVNA 1QJGA 2E2TA 2K54A 3CXC2 1VQ63 1LOYA 4FR9A 2W9PA 4KZ1A 3BIRA 1KSIA 4HM4B 1UGHI 1RGGA 2RBIA 1Q42A 5AI1A 3N9HA 7RNTA 4GSPA 4HZ9B 3NV0B 1JN5A 1MGRA 3DXOA 4HM8B 4K61A 1VQL3 1RCLA 2ZA4A 1WMNA 2OQEC 4N6OB 6STDA 2Y73A 3G6E3 2W03A 3D9RA 1YJN3 2K3DA 3LT8A 1TFKA 1I2GA 1GY7A 5AYSC 1BNIA 3AHSA 2XFTA 1ZX2A 3EC9A 1M1K4 2QA43 2J8XB 1YJW3 1YHQ3 1MWSA 2L4VA 3EJVA 1UCJA 3KIIA 2CK3H 1FUTA 1DMQA 2CG1A 3F40A 4NHFA 2RCDA 1B21A 1VQN3 4RNYA 2R41A 3GRDA 1V74A 3WODG 3S5CA 1JB4A 3EQQB 1UCIA 1F8NA 2HMLB 2ML6A 4GB5A 4HM6B 3RGAA 4FMCA 1PFPA 1MWTA 1K9M4 3NUVA 2Z6BA 1TIJA 5M18A 3KE7A 1B3SA 1FGTA 4WYKA 1GMPA 2M7OA 3F7SA 3FF2A 5IENA 1BRIA 3MHEA 2GBWB 2RSXA 4H61A 4IPBA 4FCZA 1BRHA 1C54A 2D42A 4RBNA 1BOXA 1I2EA 3H51A 4G1MB 4IIAA 1GOUA 1LNHA 3OWUA 1AR0A 3RDEA 3D3LA 1VQP3 3GZBA 3DGNA 5DREA 4MEIA 1YIT3 1GS3A 3MYTA 1RGHA 4X2HA 2Z7AA 1IVUA 5ELUA 1FGRA 2IUKA 2GXFA 4WFOA 2RGQA 3CMA3 3GZRA 3NBRA 2STDA 4L8OA 2WGQA 1VQ43 3S27A 4I5QA 1BIRA 1K41A 1B2ZA 3WOFB 1RKYA 4MJDA 1V58A 4LSOA 2YFLB 2UX0A 1JZOA 1RRLA 3FLJA 3CD63 4CJNA 3EX9A 1LNIA 3KZTA 3DMCA 4BL3A 3LZAA 3F8HA 2HMJB 3FH1A 2GBXB 2KF5A 5BIRA 3CCS3 1I2FA 3GAXA 3WHOA 5AEUB 4FMAA 2CWUA 2KF3A 3LTCA 4EXRA 1RTUA 3WA2X 5CXOA 3HIIA 3ECFA 2F4YA 1BRGA 3D4AA 2CKFB 2W04A 1RDSA 1Q814 1Q40A 3PZWA 1BANA 1B2SA 1ROVA 3MG2A 3ALAA 1E97A 2W9QA 3CNXA 2MC8A 3KSPA 3Q90A 3WOEB 2GU1A 5D82A 1T2IA 1GD4A 1LRAA 5G2GA 3WMDA 4LGQA 1BRJA 5RNTA 1OCVA 3HI7A 1EUIC 1Y4KA 1MOLA 2RFRA 1EG9B 4N6LA 2CHCA 4WWUC 5IW9A 1RMSA 1OF5B 3WDGB 1JKGA 1IK3A 4CDLA 2W2CA 1O7GB 7GSPA 4AKZA 1KWIA 1GSPA 2OTJ3 1RCKA 3AGOA 2XGNA 3AHWA 5LC7A 1JBTA 3X40A 1KQS2 3G8ZA 8CHOA 4KFEA 3CCE3 1IVXA 3S28A 1UCKA 2OOVA 1DE3A 2RNTA 1PU4A 2CFWA 3J7Yd 1RJOA 3HX8A 3EBTA 5M19A 1GY6A 3RNTA 3CPOA 1HU9A 3TDGA 1I0VA 2CFKA 3KSED 1ZS7A 1O7MB 3NBBA 4WHAA 3CCM3 1JBRA 1ASKA 3UL5A 1FW7A 1KD14 1IT7A 1W00A 1BRNL 4HM2B 5KP1A 1BSAA 2HMNB 3M8CA 3FG1A 2ZDJA 1JB5A 1E3RA 3F9SA 1I3IA 4IT7A 1US1A 1K28A 1M1XB 4N3VA 1C7HA 4O8SA 3BLZA 2CFGA 3LXUX 2CH9A 5AYRB 1FGMA 5DRVA 3DGMA 1A2PA 2AAEA 4LZIA 2LQVA 1X1XA 2YX9A 3LTDA 1Q40B 3PS8A 5EEOA 1STFI 2OOVC 2F98A 3CCL3 3DGLA 3X42A 3CME3 1VQQA 1YJ93 1RGCA 1SPUA 4HM7B 4MMZB 2JQ5A 4OK0A 3Q2PA 1ISKA 4FCJA 1JRQA 1AQZA 2BNGA 3EB8A 3BNBA 6GSPA 1FYSA 2F5WA 7STDA 2WOFA 5D83A 4ILFA 4XDWA 4EC6A 1BNGA 5HGRA 1MWRA 1TRPA 3D5GA 3K63A 1JN5B 4J8TA 3V99A 3CU3A 1YIJ3 1I0XA 2W56B 2WO0A 5AIIA 3IMAB 3CCQ3 1EA2A 3E99A 5GSPA 5BU4A 2W6JH 2ZL8A 5D81A 3UL6A 3FF0A 4J9AA 3AGNA 3VGNA 2KXGA 2CFDA 1A2VA 4XB5A 1N9JA 1IV7A 1RGEA 3NM7A 4LYLB 2XEPA 1JNQA 2XR8B 2Y74A 2ZHXB 3K5TA 4EYCA 3ZG0A 3FZWA 3UNLA 1A67A 4FCMA 4HYZA 4O3VA 3B4PA 3NXJA 1RGAA 1OH0A 2XF3A 3HOHA 3K9MC 3KKGA 2CWVA 3B7CA 2WOHA 1SQWA 3CNMA 1T5YA 1OACA 2XH9A 1X1UA 2YFJB 5FGOA 1W6YA 1CYUA 1TU5A 1N9EA 1CQSA 8RNTA 1Q9EA 2BT3A 1I3FA 1N5HA 1BSDA 2KAAA 2B1XB 3A76A 2OCTA 3KN4A 1PY3A 1NWWA 1D6UA 2O3OA 4KT3B 4BTYA 1BSEA 4KFFA 1LQMB 3HK4A 4MMYB 2AADA 2BMOB 1OHPA 4PEJA
chains in the Genus database with same CATH topology
3SYUA 3Q3FA 1YVSA 2F4YA 1BRGA 3D4AA 2BU4A 3A5EA 1BUJA 1RDSA 1LOVA 2F56A 1BANA 1B2SA 1B2UA 1PYLA 1AY7A 1DETA 1YNVX 1BNSA 1T2IA 1LRAA 1GMRA 5RNTA 1BRJA 2BIRA 3DGYA 1JBSA 1RGKA 1RLSA 2GSPA 1X1WA 1FUSA 1G02A 1BNEA 1I8VA 1RMSA 1YGWA 1TTOA 7GSPA 3WR2A 1GOVA 1GSPA 5HOHA 9RNTA 1RCKA 1FZUA 3AGOA 2KF4A 3AHWA 1JBTA 1LOYA 3BIRA 4BU4A 1UCKA 1BNFA 1DE3A 1RGGA 2RBIA 2HOHA 1HZ1A 2RNTA 7RNTA 1RHLA 4GSPA 1RNTA 3DH2A 1MGRA 1T2HA 1RCLA 2ZA4A 3RNTA 4HAAA 1I0VA 1JBRA 1I2GA 1FW7A 1BRNL 1BAOA 1BNIA 3AHSA 1SARA 1BSAA 1CH0A 3KCHA 1B2XA 1B20A 1RGLA 1UCJA 1RN1A 1I3IA 1FUTA 1BNRA 1I70A 1B21A 1GMQA 1HYFA 4GHOA 4BIRA 2SARA 1MGWA 1A2PA 2AAEA 1UCIA 1X1XA 1B2MA 1IYYA 1RGCA 1RN4A 1B3SA 1AQZA 1GMPA 1RNBA 6GSPA 2F5MA 1BRIA 1FYSA 2F5WA 4HOHA 3BU4A 1BSCA 1BRHA 1C54A 1BNGA 1LOWA 1RGFA 3URPA 3D5GA 1TRPA 1BOXA 1I2EA 1BSBA 1BU4A 1I0XA 1R4YA 4RNTA 1GOUA 1BRKA 5GSPA 5BU4A 2C4BA 3AGNA 4J5GA 1BRSA 3D5IA 1RGHA 1BNJA 1RGEA 1B27A 1X1YA 2KF6A 1ZGXA 1UCLA 1GOYA 1TRQA 1RGAA 3HOHA 1BVIA 4J5KA 1BGSA 1BIRA 1B2ZA 1X1UA 1RSNA 8RNTA 1Q9EA 1I3FA 6RNTA 1BSDA 2KAAA 1LNIA 1PY3A 2KF5A 1BSEA 5BIRA 1I2FA 3WHOA 2AADA 3GSPA 2KF3A 1RTUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SYU A;  3Q3F A;  1YVS A;  2F4Y A;  1BRG A;  3D4A A;  2BU4 A;  3A5E A;  1BUJ A;  1RDS A;  1LOV A;  2F56 A;  1BAN A;  1B2S A;  1B2U A;  1PYL A;  1AY7 A;  1DET A;  1YNV X;  1BNS A;  1T2I A;  1LRA A;  1GMR A;  5RNT A;  1BRJ A;  2BIR A;  3DGY A;  1JBS A;  1RGK A;  1RLS A;  2GSP A;  1X1W A;  1FUS A;  1G02 A;  1BNE A;  1I8V A;  1RMS A;  1YGW A;  1TTO A;  7GSP A;  3WR2 A;  1GOV A;  1GSP A;  5HOH A;  9RNT A;  1RCK A;  1FZU A;  3AGO A;  2KF4 A;  3AHW A;  1JBT A;  1LOY A;  3BIR A;  4BU4 A;  1UCK A;  1BNF A;  1DE3 A;  1RGG A;  2RBI A;  2HOH A;  1HZ1 A;  2RNT A;  7RNT A;  1RHL A;  4GSP A;  1RNT A;  3DH2 A;  1MGR A;  1T2H A;  1RCL A;  2ZA4 A;  3RNT A;  4HAA A;  1I0V A;  1JBR A;  1I2G A;  1FW7 A;  1BRN L;  1BAO A;  1BNI A;  3AHS A;  1SAR A;  1BSA A;  1CH0 A;  3KCH A;  1B2X A;  1B20 A;  1RGL A;  1UCJ A;  1RN1 A;  1I3I A;  1FUT A;  1BNR A;  1I70 A;  1B21 A;  1GMQ A;  1HYF A;  4GHO A;  4BIR A;  2SAR A;  1MGW A;  1A2P A;  2AAE A;  1UCI A;  1X1X A;  1B2M A;  1IYY A;  1RGC A;  1RN4 A;  1B3S A;  1AQZ A;  1GMP A;  1RNB A;  6GSP A;  2F5M A;  1BRI A;  1FYS A;  2F5W A;  4HOH A;  3BU4 A;  1BSC A;  1BRH A;  1C54 A;  1BNG A;  1LOW A;  1RGF A;  3URP A;  3D5G A;  1TRP A;  1BOX A;  1I2E A;  1BSB A;  1BU4 A;  1I0X A;  1R4Y A;  4RNT A;  1GOU A;  1BRK A;  5GSP A;  5BU4 A;  2C4B A;  3AGN A;  4J5G A;  1BRS A;  3D5I A;  1RGH A;  1BNJ A;  1RGE A;  1B27 A;  1X1Y A;  2KF6 A;  1ZGX A;  1UCL A;  1GOY A;  1TRQ A;  1RGA A;  3HOH A;  1BVI A;  4J5K A;  1BGS A;  1BIR A;  1B2Z A;  1X1U A;  1RSN A;  8RNT A;  1Q9E A;  1I3F A;  6RNT A;  1BSD A;  2KAA A;  1LNI A;  1PY3 A;  2KF5 A;  1BSE A;  5BIR A;  1I2F A;  3WHO A;  2AAD A;  3GSP A;  2KF3 A;  1RTU A; 
#chains in the Genus database with same CATH topology
 4HM3 B;  1ULI B;  3SYU A;  3Q3F A;  1K8A 4;  3VSY A;  3SVA A;  3V98 A;  2WGO A;  4R80 A;  4R1K A;  1BUJ A;  4QWT A;  5FW5 A;  2F56 A;  5AEW B;  4JRF A;  3EHC A;  3GSP A;  1OGX A;  5EVH A;  1AY7 A;  3DZL A;  1DET A;  1W2Z A;  1AVK A;  1YNV X;  3NM2 A;  1WNH A;  2IY2 A;  4N6T A;  1T3B A;  5IG0 A;  1CEW I;  4RNZ A;  1IVV A;  4GL6 A;  3NX0 A;  1RGK A;  1RLS A;  2GSP A;  1AVL A;  4HM0 B;  3G0K A;  4R9L A;  4TX4 A;  5IG5 A;  1I8V A;  1UGI A;  1UDI I;  2FGT A;  3JUP A;  1VZZ A;  1YGW A;  5CF2 A;  5HOH A;  1GOV A;  9RNT A;  4EBG A;  1VQ8 3;  2KF4 A;  1Q7H A;  2MF7 A;  5LC6 A;  1YI2 3;  2BO9 B;  3GZY B;  4N6U A;  5IG4 A;  1JV2 B;  3ZFZ A;  1BNF A;  3SOY A;  2OTL 3;  1HZ1 A;  1FUW A;  2INX A;  2K0M A;  5EQL A;  1IU7 A;  1UUG B;  1WMO A;  2CWT A;  2FNQ A;  3BB9 A;  4EV2 A;  2PZV A;  3BNC A;  4HKV B;  1WTH A;  3OV4 A;  4BTW A;  2H0G A;  4Q53 A;  1FA3 A;  3OWS A;  3F8X A;  5AIF A;  5M1A A;  1RRH A;  1TUH A;  1N8R 4;  1QMA A;  2XFS A;  1NB3 I;  3FCS B;  3D79 A;  1TFO A;  1CH0 A;  1IT8 A;  3KCH A;  1B2X A;  1RN1 A;  1L5G B;  1LOX A;  3I0Y A;  2GEX A;  2ML5 A;  1MWU A;  1BNR A;  2I9W A;  1I70 A;  2A15 A;  3F7X A;  3X41 A;  1JB2 A;  3NBJ A;  1BUQ A;  1HYF A;  4BIR A;  2SAR A;  3JUO A;  1KC8 4;  1MGW A;  1O7H B;  2BMQ B;  2HMO B;  3N54 B;  2QIY A;  2W0Q A;  2O9U X;  3AMO B;  1B2M A;  1IYY A;  1RN4 A;  1OHO A;  5CK6 A;  1RNB A;  2IA7 A;  3K7C A;  2F5M A;  3H3H A;  4MMX B;  4HOH A;  3EF8 A;  1IV9 A;  5G1L A;  1OPY A;  4EV5 A;  3LYG A;  3G16 A;  5IEO A;  4X2O A;  1LOW A;  3JUN A;  3URP A;  3OW2 2;  1VQ5 3;  3JUM A;  4K1U A;  3PYJ A;  1D6Y A;  1BU4 A;  1UUW B;  3X3Y A;  1R4Y A;  2C11 A;  3Q1C A;  4HZB B;  2OWP A;  3FKA A;  4XBX A;  4XDV A;  2C4B A;  4J5G A;  3CCR 3;  1QVF 2;  3OXA A;  3SED A;  4N6N B;  1BNJ A;  1V57 A;  2KF6 A;  4O02 B;  5AIG A;  3FG3 A;  3STD A;  1LXE A;  3ER7 A;  1QAL A;  1GOY A;  3I56 3;  1DMM A;  1OGZ A;  1BVI A;  4DKI A;  3IJE B;  1E3V A;  1UI8 A;  1QAK A;  2H0H A;  2KRT A;  4RZM A;  3BND A;  2XSO B;  3CCV 3;  1DVC A;  3MSO A;  6RNT A;  3ROB A;  4LEH A;  1W2B 2;  1UUV B;  4HVN A;  3ZG5 A;  3K0Z A;  4HBR A;  1SIH A;  4HAA A;  3T8U A;  3NQY A;  2UUG C;  5IEP A;  3RGR A;  2CIU A;  4K90 B;  4AKY A;  2CX1 A;  2LYX A;  3X3X A;  4CPK A;  3CCJ 3;  2R4I A;  1TP6 A;  2CFL A;  1WQL B;  2JDI H;  3A5E A;  3FGY A;  1LOV A;  1JKG B;  1U8C B;  3SX1 A;  3KFQ C;  1W02 A;  1B2U A;  1PYL A;  2P38 A;  3O8Y A;  4AEQ A;  2OQE A;  1OF5 A;  4N6V 0;  2CC3 A;  2HMM B;  1VQ7 3;  5JPP A;  4NPB A;  3DUK A;  1NU3 A;  3EE1 A;  1G02 A;  3PGB A;  1VQK 3;  2SBL A;  2Q07 A;  3EBY A;  3CC4 3;  2Z77 A;  2QEX 3;  1VQ9 3;  3WR2 A;  1K73 4;  1A90 A;  4XBY A;  1OUN A;  3MPH A;  1VQO 3;  3PCS A;  1HKX A;  3NHX A;  1CYV A;  4BU4 A;  1NNV A;  1M9G A;  3SLU A;  2HOH A;  4KVH A;  2QGU A;  2F86 B;  4OUQ A;  1RHL A;  3MWZ A;  1RNT A;  3DH2 A;  3CCU 3;  1T2H A;  1U5O A;  3DGO A;  3N8B A;  4BTX A;  1IDP A;  4N6M A;  5JPU A;  3CC2 3;  3S29 A;  4KFD A;  1FGQ A;  1Z1S A;  2D1W A;  3IPT A;  3OX9 A;  1ROA A;  3B4O A;  3X3Z A;  4K1V A;  3WA3 A;  1EKM A;  3HIG A;  1S72 3;  1BAO A;  4EW5 A;  5CF1 A;  1TJD A;  1GYB A;  1SAR A;  5KP4 A;  2F99 A;  1J2B A;  1STD A;  1NB5 I;  1LQG C;  1B20 A;  1GD3 A;  1RGL A;  3HZP A;  3U97 A;  1NO3 A;  1W01 A;  2IMJ A;  3LOY A;  1Q7Y 4;  2IYJ A;  4NRE A;  4LMI A;  1GMQ A;  4GHO A;  1JJ2 2;  5BXQ A;  3JVC A;  3QK9 A;  2IUJ A;  1NDO B;  1JZD A;  5ELJ A;  4I4K A;  2W56 A;  1IVW A;  4L8P A;  3I55 3;  4STD A;  3FG4 A;  1OHS A;  1AV4 A;  3MG3 A;  4CCV A;  3LT9 A;  5G1K A;  1DMN A;  3U1W A;  4FMB A;  2GEY A;  4L7K A;  2E2U A;  4H3U A;  4O2H A;  1DVD A;  1O7P B;  1ZO2 A;  3BU4 A;  2PNC A;  4ZM8 A;  3G71 3;  1BSC A;  1Q86 4;  1RGF A;  3JUQ A;  5KP3 A;  4OVM A;  1MNL A;  1BSB A;  5IER A;  2P0X A;  4RNT A;  2UGI A;  1BRK A;  1QAF A;  1DYU A;  5AIH A;  2CW9 A;  1O7N B;  2P05 A;  3T0U A;  4WYK B;  1GY5 A;  1BRS A;  1M90 4;  3D5I A;  1UW1 A;  1WMP A;  2P0M A;  2V1L A;  3DM8 A;  3VF1 A;  1O7W B;  2P09 A;  1Q82 4;  1QVG 2;  1W7C A;  1B27 A;  1X1Y A;  2Z76 A;  1VQM 3;  4FMD A;  5A0O B;  3QRD A;  4U13 A;  1ZGX A;  3LTA A;  1UCL A;  4XM4 A;  1W5Z A;  1NJI 4;  3UJM A;  1W4N A;  3CC7 3;  1TRQ A;  2BHM A;  1R4C A;  3MG1 A;  1IQY A;  3FSD A;  1BGS A;  1FGO A;  2XGL A;  4J5K A;  3LH4 A;  1EQK A;  3NQZ A;  3SXX A;  3T8N A;  1RSN A;  3GWR A;  2CX0 A;  3UB1 A;  1YVB I;  5IF6 A;  3EN1 B;  1EEJ A;  3G4S 3;  2KCD A;  3S67 A;  1D6Z A;  2YFI B;  3CPW 2;  3EN8 A;  3LTB A;  4JF8 A;  3NV0 A;  2BMR B;  3PXM A;  5CLK A;  3F14 A;  1IQX A;  1S5A A;  1SII A;  1YGE A;  3BNE A;  3PCR A;  4R9K A;  1YVS A;  2H0I A;  3AMO A;  2BU4 A;  4HM1 B;  4R4K A;  4BL2 A;  3MKI A;  4XBT A;  5BVB A;  4HJL B;  5STD A;  3LML A;  4ORL A;  4WP5 A;  1BNS A;  1N8Q A;  5I97 A;  2L1S A;  2B24 B;  1SJW A;  3V92 A;  5JBS A;  3B8L A;  1GMR A;  3SOA A;  1W6G A;  2BIR A;  2HMK B;  1G96 A;  2E2V A;  3DGY A;  1IQ8 A;  3GZX B;  4HM5 B;  1JBS A;  2C10 A;  1X1W A;  2XRX B;  1FUS A;  3DY5 A;  5IG3 A;  1BNE A;  1W6C A;  1N5P A;  1UI7 A;  1TTO A;  3L0R A;  2FXT A;  1ULJ B;  2CG0 A;  1A2K A;  2GU3 A;  5TGN A;  1G0T A;  1FZU A;  2XSH B;  3OWY A;  1RN7 A;  1LVN A;  1QJG A;  2E2T A;  2K54 A;  3CXC 2;  1VQ6 3;  1LOY A;  4FR9 A;  2W9P A;  4KZ1 A;  3BIR A;  1KSI A;  4HM4 B;  1UGH I;  1RGG A;  2RBI A;  1Q42 A;  5AI1 A;  3N9H A;  7RNT A;  4GSP A;  4HZ9 B;  3NV0 B;  1JN5 A;  1MGR A;  3DXO A;  4HM8 B;  4K61 A;  1VQL 3;  1RCL A;  2ZA4 A;  1WMN A;  2OQE C;  4N6O B;  6STD A;  2Y73 A;  3G6E 3;  2W03 A;  3D9R A;  1YJN 3;  2K3D A;  3LT8 A;  1TFK A;  1I2G A;  1GY7 A;  5AYS C;  1BNI A;  3AHS A;  2XFT A;  1ZX2 A;  3EC9 A;  1M1K 4;  2QA4 3;  2J8X B;  1YJW 3;  1YHQ 3;  1MWS A;  2L4V A;  3EJV A;  1UCJ A;  3KII A;  2CK3 H;  1FUT A;  1DMQ A;  2CG1 A;  3F40 A;  4NHF A;  2RCD A;  1B21 A;  1VQN 3;  4RNY A;  2R41 A;  3GRD A;  1V74 A;  3WOD G;  3S5C A;  1JB4 A;  3EQQ B;  1UCI A;  1F8N A;  2HML B;  2ML6 A;  4GB5 A;  4HM6 B;  3RGA A;  4FMC A;  1PFP A;  1MWT A;  1K9M 4;  3NUV A;  2Z6B A;  1TIJ A;  5M18 A;  3KE7 A;  1B3S A;  1FGT A;  4WYK A;  1GMP A;  2M7O A;  3F7S A;  3FF2 A;  5IEN A;  1BRI A;  3MHE A;  2GBW B;  2RSX A;  4H61 A;  4IPB A;  4FCZ A;  1BRH A;  1C54 A;  2D42 A;  4RBN A;  1BOX A;  1I2E A;  3H51 A;  4G1M B;  4IIA A;  1GOU A;  1LNH A;  3OWU A;  1AR0 A;  3RDE A;  3D3L A;  1VQP 3;  3GZB A;  3DGN A;  5DRE A;  4MEI A;  1YIT 3;  1GS3 A;  3MYT A;  1RGH A;  4X2H A;  2Z7A A;  1IVU A;  5ELU A;  1FGR A;  2IUK A;  2GXF A;  4WFO A;  2RGQ A;  3CMA 3;  3GZR A;  3NBR A;  2STD A;  4L8O A;  2WGQ A;  1VQ4 3;  3S27 A;  4I5Q A;  1BIR A;  1K41 A;  1B2Z A;  3WOF B;  1RKY A;  4MJD A;  1V58 A;  4LSO A;  2YFL B;  2UX0 A;  1JZO A;  1RRL A;  3FLJ A;  3CD6 3;  4CJN A;  3EX9 A;  1LNI A;  3KZT A;  3DMC A;  4BL3 A;  3LZA A;  3F8H A;  2HMJ B;  3FH1 A;  2GBX B;  2KF5 A;  5BIR A;  3CCS 3;  1I2F A;  3GAX A;  3WHO A;  5AEU B;  4FMA A;  2CWU A;  2KF3 A;  3LTC A;  4EXR A;  1RTU A;  3WA2 X;  5CXO A;  3HII A;  3ECF A;  2F4Y A;  1BRG A;  3D4A A;  2CKF B;  2W04 A;  1RDS A;  1Q81 4;  1Q40 A;  3PZW A;  1BAN A;  1B2S A;  1ROV A;  3MG2 A;  3ALA A;  1E97 A;  2W9Q A;  3CNX A;  2MC8 A;  3KSP A;  3Q90 A;  3WOE B;  2GU1 A;  5D82 A;  1T2I A;  1GD4 A;  1LRA A;  5G2G A;  3WMD A;  4LGQ A;  1BRJ A;  5RNT A;  1OCV A;  3HI7 A;  1EUI C;  1Y4K A;  1MOL A;  2RFR A;  1EG9 B;  4N6L A;  2CHC A;  4WWU C;  5IW9 A;  1RMS A;  1OF5 B;  3WDG B;  1JKG A;  1IK3 A;  4CDL A;  2W2C A;  1O7G B;  7GSP A;  4AKZ A;  1KWI A;  1GSP A;  2OTJ 3;  1RCK A;  3AGO A;  2XGN A;  3AHW A;  5LC7 A;  1JBT A;  3X40 A;  1KQS 2;  3G8Z A;  8CHO A;  4KFE A;  3CCE 3;  1IVX A;  3S28 A;  1UCK A;  2OOV A;  1DE3 A;  2RNT A;  1PU4 A;  2CFW A;  3J7Y d;  1RJO A;  3HX8 A;  3EBT A;  5M19 A;  1GY6 A;  3RNT A;  3CPO A;  1HU9 A;  3TDG A;  1I0V A;  2CFK A;  3KSE D;  1ZS7 A;  1O7M B;  3NBB A;  4WHA A;  3CCM 3;  1JBR A;  1ASK A;  3UL5 A;  1FW7 A;  1KD1 4;  1IT7 A;  1W00 A;  1BRN L;  4HM2 B;  5KP1 A;  1BSA A;  2HMN B;  3M8C A;  3FG1 A;  2ZDJ A;  1JB5 A;  1E3R A;  3F9S A;  1I3I A;  4IT7 A;  1US1 A;  1K28 A;  1M1X B;  4N3V A;  1C7H A;  4O8S A;  3BLZ A;  2CFG A;  3LXU X;  2CH9 A;  5AYR B;  1FGM A;  5DRV A;  3DGM A;  1A2P A;  2AAE A;  4LZI A;  2LQV A;  1X1X A;  2YX9 A;  3LTD A;  1Q40 B;  3PS8 A;  5EEO A;  1STF I;  2OOV C;  2F98 A;  3CCL 3;  3DGL A;  3X42 A;  3CME 3;  1VQQ A;  1YJ9 3;  1RGC A;  1SPU A;  4HM7 B;  4MMZ B;  2JQ5 A;  4OK0 A;  3Q2P A;  1ISK A;  4FCJ A;  1JRQ A;  1AQZ A;  2BNG A;  3EB8 A;  3BNB A;  6GSP A;  1FYS A;  2F5W A;  7STD A;  2WOF A;  5D83 A;  4ILF A;  4XDW A;  4EC6 A;  1BNG A;  5HGR A;  1MWR A;  1TRP A;  3D5G A;  3K63 A;  1JN5 B;  4J8T A;  3V99 A;  3CU3 A;  1YIJ 3;  1I0X A;  2W56 B;  2WO0 A;  5AII A;  3IMA B;  3CCQ 3;  1EA2 A;  3E99 A;  5GSP A;  5BU4 A;  2W6J H;  2ZL8 A;  5D81 A;  3UL6 A;  3FF0 A;  4J9A A;  3AGN A;  3VGN A;  2KXG A;  2CFD A;  1A2V A;  4XB5 A;  1N9J A;  1IV7 A;  1RGE A;  3NM7 A;  4LYL B;  2XEP A;  1JNQ A;  2XR8 B;  2Y74 A;  2ZHX B;  3K5T A;  4EYC A;  3ZG0 A;  3FZW A;  3UNL A;  1A67 A;  4FCM A;  4HYZ A;  4O3V A;  3B4P A;  3NXJ A;  1RGA A;  1OH0 A;  2XF3 A;  3HOH A;  3K9M C;  3KKG A;  2CWV A;  3B7C A;  2WOH A;  1SQW A;  3CNM A;  1T5Y A;  1OAC A;  2XH9 A;  1X1U A;  2YFJ B;  5FGO A;  1W6Y A;  1CYU A;  1TU5 A;  1N9E A;  1CQS A;  8RNT A;  1Q9E A;  2BT3 A;  1I3F A;  1N5H A;  1BSD A;  2KAA A;  2B1X B;  3A76 A;  2OCT A;  3KN4 A;  1PY3 A;  1NWW A;  1D6U A;  2O3O A;  4KT3 B;  4BTY A;  1BSE A;  4KFF A;  1LQM B;  3HK4 A;  4MMY B;  2AAD A;  2BMO B;  1OHP A;  4PEJ A; 
#chains in the Genus database with same CATH homology
 3SYU A;  3Q3F A;  1YVS A;  2F4Y A;  1BRG A;  3D4A A;  2BU4 A;  3A5E A;  1BUJ A;  1RDS A;  1LOV A;  2F56 A;  1BAN A;  1B2S A;  1B2U A;  1PYL A;  1AY7 A;  1DET A;  1YNV X;  1BNS A;  1T2I A;  1LRA A;  1GMR A;  5RNT A;  1BRJ A;  2BIR A;  3DGY A;  1JBS A;  1RGK A;  1RLS A;  2GSP A;  1X1W A;  1FUS A;  1G02 A;  1BNE A;  1I8V A;  1RMS A;  1YGW A;  1TTO A;  7GSP A;  3WR2 A;  1GOV A;  1GSP A;  5HOH A;  9RNT A;  1RCK A;  1FZU A;  3AGO A;  2KF4 A;  3AHW A;  1JBT A;  1LOY A;  3BIR A;  4BU4 A;  1UCK A;  1BNF A;  1DE3 A;  1RGG A;  2RBI A;  2HOH A;  1HZ1 A;  2RNT A;  7RNT A;  1RHL A;  4GSP A;  1RNT A;  3DH2 A;  1MGR A;  1T2H A;  1RCL A;  2ZA4 A;  3RNT A;  4HAA A;  1I0V A;  1JBR A;  1I2G A;  1FW7 A;  1BRN L;  1BAO A;  1BNI A;  3AHS A;  1SAR A;  1BSA A;  1CH0 A;  3KCH A;  1B2X A;  1B20 A;  1RGL A;  1UCJ A;  1RN1 A;  1I3I A;  1FUT A;  1BNR A;  1I70 A;  1B21 A;  1GMQ A;  1HYF A;  4GHO A;  4BIR A;  2SAR A;  1MGW A;  1A2P A;  2AAE A;  1UCI A;  1X1X A;  1B2M A;  1IYY A;  1RGC A;  1RN4 A;  1B3S A;  1AQZ A;  1GMP A;  1RNB A;  6GSP A;  2F5M A;  1BRI A;  1FYS A;  2F5W A;  4HOH A;  3BU4 A;  1BSC A;  1BRH A;  1C54 A;  1BNG A;  1LOW A;  1RGF A;  3URP A;  3D5G A;  1TRP A;  1BOX A;  1I2E A;  1BSB A;  1BU4 A;  1I0X A;  1R4Y A;  4RNT A;  1GOU A;  1BRK A;  5GSP A;  5BU4 A;  2C4B A;  3AGN A;  4J5G A;  1BRS A;  3D5I A;  1RGH A;  1BNJ A;  1RGE A;  1B27 A;  1X1Y A;  2KF6 A;  1ZGX A;  1UCL A;  1GOY A;  1TRQ A;  1RGA A;  3HOH A;  1BVI A;  4J5K A;  1BGS A;  1BIR A;  1B2Z A;  1X1U A;  1RSN A;  8RNT A;  1Q9E A;  1I3F A;  6RNT A;  1BSD A;  2KAA A;  1LNI A;  1PY3 A;  2KF5 A;  1BSE A;  5BIR A;  1I2F A;  3WHO A;  2AAD A;  3GSP A;  2KF3 A;  1RTU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...