4WP5A

Chaetomium thermophilum mex67 ntf2-like domain complexed with mtr2
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
201
structure length
199
Chain Sequence
MPTPLPQLPSNVRDGENNVASTFLQAFFQLWDHDRLTLIPQFYDSETTFSVVFATDSPQDPASSSCSKFSRNLNILSPPSTLQRLFVGSNLIADLWKVLPATRHPSLDQTSQWLIDCHTFPHLADPTGMAPYAMGLMINVNGQCEEADISQNLYGTRTFSRCFILGPSKPGAPHPYRVLSDQLTLHTWKPQPAPQVGTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords mRNA export protein
publication title Structural characterization of the principal mRNA-export factor Mex67-Mtr2 from Chaetomium thermophilum.
pubmed doi rcsb
source organism Chaetomium thermophilum
molecule tags Transport protein
total genus 37
structure length 199
sequence length 201
ec nomenclature
pdb deposition date 2014-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4wp5A00
3JUPA 5D81A 1OHPA 1UUWB 1WQLB 3GZYB 7STDA 5KP3A 2HMOB 3H3HA 1OF5A 4ORLA 2YFLB 1JKGA 3OWUA 4GB5A 3OV4A 5IERA 1JB4A 1OGXA 3KE7A 4XBXA 2OWPA 4STDA 2QGUA 3H51A 3FH1A 3JUQA 4I4KA 3MHEA 3BLZA 1O7WB 2Z77A 3GZXB 2XSHB 1U5OA 3EBYA 4PEJA 1DMNA 5DREA 3Q90A 5D83A 1O7PB 4KVHA 1W6YA 4XM4A 1JB2A 2HMKB 3FLJA 4XBYA 4J9AA 1GS3A 1Q40B 5CF1A 1A2KA 5JPPA 3MG3A 1DMMA 5AI1A 3EHCA 2B24B 2HMMB 3G0KA 4HM1B 2QIYA 3GZBA 2F86B 1ULJB 1OCVA 3EBTA 2RGQA 4L8OA 3DMCA 5KP4A 2RCDA 1AR0A 5JPUA 4MJDA 1O7NB 5EVHA 4R1KA 3F7SA 2GEXA 1OHSA 3T8UA 3T8NA 1Q40A 4WWUC 4HM3B 1C7HA 5DRVA 3EN8A 2XSOB 1QMAA 2F99A 2GBXB 3SOAA 3FKAA 5AEWB 3CNMA 1EA2A 2HMJB 3HX8A 3EX9A 5AIFA 1S5AA 1O7HB 4IIAA 1W02A 2GXFA 3BB9A 2HMLB 5IENA 3F9SA 4HVNA 1TP6A 3EC9A 3B4PA 5IEOA 1Z1SA 5CK6A 3NHXA 2K54A 4HM2B 1STDA 4LGQA 2Z76A 1OPYA 4FCMA 3DUKA 5STDA 4XB5A 4RZMA 3FSDA 2CHCA 2W2CA 1ISKA 5CF2A 3NM2A 1GY7A 3CPOA 1JN5B 1SJWA 3GZRA 1GY6A 3B7CA 1UUVB 6STDA 1NDOB 4FCJA 4K1VA 3ROBA 1W01A 2GBWB 3G16A 3OXAA 5IF6A 3HK4A 3A76A 3FGYA 2STDA 3FF0A 4HM7B 4OUQA 1E97A 2PZVA 3JUOA 3G8ZA 2INXA 2YFIB 3VSYA 5G2GA 4XDWA 3HZPA 2HMNB 3OWYA 2UX0A 1DMQA 4LMIA 1O7MB 3NUVA 4H3UA 1BUQA 3F8HA 4K1UA 1JN5A 4J8TA 3I0YA 3MSOA 1HKXA 3FF2A 1NU3A 1ZX2A 5D82A 3RGAA 4HM4B 2B1XB 5BXQA 1EG9B 4R9LA 2JQ5A 2XRXB 4HZBB 3F8XA 3OX9A 1GYBA 3VGNA 5TGNA 3NXJA 1K41A 2IMJA 4HKVB 3DZLA 3SOYA 3JUNA 5BVBA 5FW5A 4CDLA 4X2OA 3UNLA 5IG3A 4WP5A 5CLKA 3EN1B 5CXOA 1TUHA 1Q42A 1E3RA 1OHOA 1NWWA 2Z7AA 3F40A 3NBRA 3E99A 3B8LA 5IG0A 3RGRA 4U13A 3EJVA 3WMDA 8CHOA 4L7KA 3EF8A 4HJLB 1IDPA 4HM8B 3GWRA 3UJMA 2YFJB 3B4OA 3GRDA 4Q53A 5HGRA 4HM6B 1ULIB 5AEUB 5IG5A 3LZAA 2A15A 4XBTA 4HM0B 3IPTA 3KKGA 3FZWA 4HZ9B 1OUNA 3MG2A 3LYGA 4R9KA 1GY5A 2XR8B 5AIIA 2GEYA 3DXOA 3M8CA 2BNGA 1CQSA 3MG1A 4WYKB 1VZZA 3NV0B 5IG4A 4OVMA 2BMRB 1ASKA 3KZTA 4X2HA 1JB5A 3JUMA 3ECFA 3KSPA 2BMQB 4N3VA 2R4IA 3ER7A 1OGZA 3CU3A 3EQQB 3STDA 1OF5B 3F14A 2BMOB 4XDVA 1JKGB 1O7GB 1OH0A 1W00A 5KP1A 3K7CA 3S5CA 1E3VA 2I9WA 5IEPA 4WYKA 3K0ZA 2CKFB 3SEDA 1QJGA 3NV0A 3F7XA 3MYTA 3MKIA 4HM5B 4LEHA 4L8PA 3CNXA 3DM8A 3D9RA 3OWSA 5AIHA 5AIGA 2F98A 1ZO2A 2RFRA
chains in the Genus database with same CATH superfamily
1BSAA 1UUGB 4O02B 3JUPA 1I2EA 1RNTA 4EW5A 5D81A 1B2XA 1W6GA 4GL6A 1OHPA 1YVBI 1W5ZA 1UUWB 1BOXA 1JZDA 1YIT3 1EQKA 3TDGA 1WQLB 3GZYB 2GU3A 7STDA 5KP3A 1TRPA 2HMOB 3FCSB 3H3HA 1OF5A 4MMXB 1LNIA 2YFLB 4ORLA 5BIRA 4HOHA 8RNTA 1JKGA 4N6OB 2CIUA 1DETA 1KSIA 5JBSA 3OWUA 4EV2A 4GB5A 3FG4A 2W9QA 3OV4A 3S28A 3UL6A 1A67A 1CYVA 1JRQA 5IERA 1JB4A 4KZ1A 2UUGC 1US1A 1STFI 1A2VA 1OGXA 1BNIA 3CME3 3KE7A 1TFKA 4XBXA 1UCIA 2OWPA 1YJN3 5FGOA 4STDA 2QGUA 3V99A 3H51A 3FH1A 1Q814 3JUQA 1OACA 1SQWA 2OOVC 2Q07A 3U97A 3WR2A 7RNTA 4I4KA 3MHEA 5M18A 1VQL3 3BLZA 2AADA 1K734 4K90B 1A90A 1RHLA 1O7WB 2Z77A 1MOLA 4KT3B 3GZXB 1K28A 2XSHB 3NQZA 1U5OA 3EBYA 4PEJA 4EXRA 1DMNA 5DREA 1FZUA 1RSNA 2F4YA 2BIRA 3Q90A 1FGMA 2F56A 5D83A 1DE3A 1O7PB 2XGNA 4KVHA 3N54B 1W6YA 4XM4A 4BIRA 1JB2A 1UCJA 2HMKB 3FLJA 1SIIA 2P38A 4XBYA 1BSBA 3LTBA 1QVG2 4J9AA 1GS3A 1GMRA 3DY5A 4FMDA 3CCJ3 1Q40B 3PXMA 1VQ53 2BHMA 5BU4A 1GOVA 1VQO3 2C11A 1BSEA 5CF1A 2IY2A 1A2KA 1LQGC 1VQQA 5JPPA 3MG3A 1MWTA 1Q7Y4 2XFTA 1BANA 1DMMA 5AI1A 3EHCA 2B24B 2HMMB 3BNDA 4EYCA 1RMSA 3G0KA 1ROVA 3K5TA 2QIYA 1IVUA 1FUSA 2RBIA 4HM1B 1VQP3 3LH4A 3CD63 1LOYA 2W56B 3GZBA 2JDIH 1R4YA 1TRQA 3NM7A 1UW1A 4LZIA 2F86B 5G1LA 3ZG5A 2CFGA 4JRFA 2WOFA 4O3VA 1ULJB 1VQ63 3L0RA 1OCVA 3EBTA 1NO3A 2RGQA 3ZFZA 3X3XA 4L8OA 5GSPA 3Q1CA 3CC43 3DMCA 1IVXA 1UDII 2RCDA 5KP4A 1AR0A 1RN4A 3AGOA 1RDSA 5JPUA 4MJDA 2WO0A 1FUTA 2YX9A 1B27A 1O7NB 5EVHA 1BRIA 4R1KA 3F7SA 5ELJA 4K61A 1GD3A 1BGSA 1EUIC 1YGEA 2GEXA 4FMCA 1KD14 1OHSA 3T0UA 3PS8A 1VQ43 1YHQ3 3T8UA 1B3SA 3HIGA 1BRNL 1J2BA 1IVWA 2FNQA 3T8NA 3J7Yd 1JZOA 1TTOA 2OQEC 1QVF2 1VQ83 1Q40A 4WWUC 1UI7A 1MWUA 1N8QA 3PYJA 4HM3B 1WMOA 1UI8A 1C7HA 1Q864 5DRVA 1FW7A 1ZGXA 3EN8A 2XSOB 1B20A 1LVNA 1D6UA 2K3DA 2P0XA 1FUWA 2CX0A 1Q824 1QMAA 2F99A 2GBXB 3SOAA 3FKAA 5AEWB 1YNVX 4DKIA 2KF6A 3CNMA 1EA2A 4ZM8A 1JBTA 6GSPA 2HMJB 2XF3A 3HX8A 3U1WA 4O8SA 3EX9A 3FG3A 4FCZA 1M904 4LSOA 1SIHA 5AIFA 1GMQA 2L4VA 1RN7A 1S5AA 2XH9A 4HYZA 1O7HB 4IIAA 1MGRA 2WOHA 3LTCA 2SBLA 1W02A 1JBSA 2GXFA 1X1XA 3KSED 1KQS2 3BB9A 2HMLB 2XEPA 5IENA 3F9SA 4HVNA 1HYFA 1TP6A 1W2ZA 3EC9A 3B4PA 2Y74A 3Q2PA 5IEOA 1Z1SA 5CK6A 3NHXA 1PFPA 2K54A 3CXC2 4HM2B 4RNZA 4N6V0 1STDA 3URPA 3I563 4LGQA 1V74A 3PZWA 1B21A 5RNTA 2Z76A 2CH9A 1OPYA 3D3LA 4FCMA 1B2MA 3DUKA 1ROAA 5STDA 2QA43 1C54A 3PCSA 1I0XA 4G1MB 1RCLA 1K9M4 3ALAA 4IPBA 4KFDA 4XB5A 1TU5A 1RNBA 3NQYA 1EKMA 2ML6A 4RZMA 1AVLA 1PYLA 2C4BA 2CHCA 1I3IA 2W2CA 3FSDA 4LYLB 4BTWA 1RKYA 1GOUA 1TIJA 2IUKA 3NX0A 1RRLA 5CF2A 2CFDA 1GOYA 3NM2A 1GY7A 1ISKA 3CPOA 1JN5B 2WGQA 2MF7A 1SJWA 4CPKA 1BNSA 1QAFA 2RNTA 2Y73A 3WODG 3CCQ3 3GZRA 3X42A 4J5GA 1GY6A 2KAAA 3B7CA 1RN1A 1UUVB 1M1K4 1VQ73 1BRSA 3BIRA 6STDA 1NB5I 1NDOB 1IQYA 4FCJA 4K1VA 3ROBA 1W01A 1X1UA 3G6E3 2H0HA 1WMPA 3BU4A 4BL2A 1V57A 2HOHA 2ZHXB 2GBWB 3G16A 3OXAA 1YVSA 1BRHA 3HK4A 4J5KA 5IF6A 1IU7A 3A76A 3FGYA 1IT8A 1GSPA 2STDA 3FF0A 1BSDA 4HM7B 4OUQA 1IV7A 1E97A 2PZVA 2RSXA 1IQ8A 3JUOA 3LT9A 3CCE3 4CJNA 3G8ZA 3RNTA 1RGLA 2INXA 1BRJA 2YFIB 5G2GA 3QRDA 3HZPA 3MWZA 4XDWA 3VSYA 2QEX3 5ELUA 2HMNB 3OWYA 3LTDA 4MMYB 1CYUA 1L5GB 2CG0A 1TFOA 2UX0A 4AKZA 1DMQA 4R4KA 3I553 1IQXA 3KN4A 1BRKA 2P05A 4IT7A 4BTYA 3CCR3 1WMNA 1GMPA 1X1YA 1NNVA 4LMIA 2IUJA 2BO9B 3N8BA 1O7MB 2ZA4A 3X3YA 3EE1A 3NUVA 4H3UA 4GSPA 3K9MC 1K8A4 1BUQA 3F8HA 1BNRA 2GU1A 4K1UA 1JN5A 2KCDA 4J8TA 3I0YA 7GSPA 3MSOA 4RNYA 1N5PA 3KFQC 4KFFA 3CC73 1HKXA 1LOWA 3FF2A 1NU3A 2LYXA 1RRHA 2W9PA 2P0MA 1D6YA 2W0QA 1ZX2A 4JF8A 5D82A 1RGGA 3BNCA 3RGAA 4N6LA 5I97A 3WA3A 3Q3FA 4BL3A 4HM4B 2B1XB 3LOYA 5BXQA 1RGFA 2O9UX 2R41A 3V98A 3CCM3 5EEOA 1EG9B 3X3ZA 3CCV3 1NB3I 2V1LA 1BNFA 1JBRA 4R9LA 1YI23 2AAEA 3BNEA 1N9JA 2JQ5A 2XRXB 3DGOA 4HZBB 4I5QA 1T2HA 4BU4A 3F8XA 3OX9A 3JVCA 1GYBA 1RGEA 1UGIA 4H61A 3VGNA 1SPUA 1W7CA 3AHWA 1VQM3 2M7OA 2KF3A 3SXXA 1MGWA 1BNGA 5TGNA 1BNEA 1Q9EA 2CWTA 3NXJA 1K41A 2PNCA 3WDGB 3WHOA 5IW9A 2CG1A 1IYYA 1MWSA 1Y4KA 2IMJA 4HKVB 2FGTA 1AV4A 4WFOA 1UCLA 3DZLA 2KXGA 2CFLA 3SOYA 3ZG0A 4NPBA 1FGRA 1RGHA 1BRGA 4OK0A 1AQZA 3JUNA 1RCKA 5BVBA 1YGWA 3OW22 1NJI4 2W03A 5FW5A 1RGCA 1M9GA 2OOVA 4CDLA 2F5WA 1T3BA 4X2OA 3UNLA 5IG3A 6RNTA 2CFWA 1VQ93 1JV2B 2CFKA 2CW9A 4WP5A 5CLKA 3UL5A 3EN1B 5CXOA 1V58A 1RJOA 1TUHA 3WA2X 1Q42A 3KCHA 1E3RA 2H0GA 2BU4A 1JNQA 1WNHA 1OHOA 1IV9A 1NWWA 2Z7AA 3F40A 3NBRA 3AMOB 2BT3A 3GSPA 3G4S3 1BAOA 3E99A 5EQLA 4O2HA 3B8LA 4N6NB 4RNTA 1B2ZA 5IG0A 5AYSC 3DGYA 3HI7A 1M1XB 4GHOA 2OTJ3 4HAAA 1B2UA 3RGRA 2D42A 4U13A 3EJVA 2J8XB 3D5IA 3WMDA 8CHOA 4L7KA 3EF8A 2L1SA 4RBNA 4HJLB 1PU4A 1N9EA 3A5EA 3PGBA 1T2IA 1IDPA 1RTUA 1I2FA 2W6JH 1AVKA 1BVIA 1BNJA 4HM8B 5LC6A 1HU9A 3CPW2 3MPHA 3GWRA 1I8VA 2E2VA 3UJMA 2GSPA 1UCKA 1G02A 2FXTA 1BUJA 3X41A 1S723 1N8R4 2SARA 3K63A 2YFJB 3X40A 3FG1A 2D1WA 3B4OA 2E2TA 5M19A 1FA3A 3GRDA 4Q53A 5HGRA 3IJEB 3GAXA 1CH0A 4HM6B 4AEQA 1ULIB 5AEUB 5IG5A 1RGAA 4HBRA 3LZAA 1RLSA 1MNLA 2CWVA 3SX1A 3WOFB 2UGIA 2A15A 3HOHA 4NHFA 5A0OB 2O3OA 3CC23 3BNBA 4XBTA 2H0IA 1LRAA 1R4CA 1YJW3 1BIRA 4KFEA 4N6MA 4MMZB 4HM0B 3G713 3IPTA 1B2SA 3CCS3 3SVAA 3KKGA 1VQN3 3AMOA 3N9HA 1Q7HA 2F5MA 4MEIA 2OCTA 3QK9A 2OQEA 2CK3H 3FZWA 1DVCA 4HZ9B 1OUNA 3MG2A 3HIIA 3V92A 3CCL3 1YJ93 3DGNA 1I3FA 4FMAA 3LYGA 4R9KA 2Z6BA 4WHAA 4AKYA 1IK3A 1GY5A 2XR8B 2IA7A 3D79A 2KRTA 3S27A 5LC7A 4BTXA 3CCU3 5AIIA 1KC84 4EV5A 1I2GA 2GEYA 3DXOA 3M8CA 2BNGA 3WOEB 1SARA 3D5GA 1CQSA 1W4NA 3MG1A 1IT7A 2ZL8A 4WYKB 1EEJA 1LNHA 1VZZA 3NV0B 2IYJA 5IG4A 4N6UA 4OVMA 1QALA 4ILFA 1KWIA 2BMRB 1QAKA 2LQVA 2XFSA 4NREA 1ASKA 2CWUA 3LXUX 3S29A 3AHSA 4FR9A 1N5HA 1G0TA 1A2PA 3KZTA 2CX1A 1JB5A 1I0VA 3JUMA 4X2HA 3ECFA 1VQK3 3KSPA 5G1KA 2BMQB 9RNTA 1FGQA 4N3VA 1LXEA 3DGLA 1HZ1A 2R4IA 1YIJ3 3ER7A 1U8CB 1OGZA 3CU3A 3CMA3 3UB1A 5AYRB 1T5YA 3EQQB 3STDA 3SLUA 2XGLA 2CC3A 2C10A 3LT8A 1WTHA 3S67A 1OF5B 1MWRA 1GD4A 3IMAB 3O8YA 1W6CA 3F14A 2BMOB 1O7GB 1JKGB 1G96A 1OH0A 2W04A 4XDVA 5HOHA 2K0MA 3RDEA 3NBJA 2ML5A 1W00A 1ZS7A 3LTAA 5KP1A 3K7CA 1LOVA 2ZDJA 4N6TA 3KIIA 1BU4A 1DVDA 1FGTA 3S5CA 1E3VA 1LQMB 2I9WA 3VF1A 4CCVA 1UGHI 5IEPA 4WYKA 3K0ZA 2MC8A 2CKFB 3SEDA 3D4AA 1QJGA 4R80A 4QWTA 1RGKA 3DGMA 3NV0A 4FMBA 1FGOA 3F7XA 3MYTA 3MKIA 1TJDA 1DYUA 2OTL3 3SYUA 3PCRA 1JJ22 4HM5B 4LEHA 1LOXA 3LMLA 1AY7A 1X1WA 2KF5A 2P09A 2W56A 3CNXA 4L8PA 3DM8A 3D9RA 4TX4A 5M1AA 4EBGA 4EC6A 1FYSA 2KF4A 3EB8A 2E2UA 1IVVA 3DH2A 3OWSA 5AIHA 1F8NA 1CEWI 5AIGA 3AGNA 2F98A 3NBBA 2WGOA 1PY3A 1BSCA 1ZO2A 1D6ZA 1I70A 2RFRA 1W2B2
chains in the Genus database with same CATH topology
4O02B 3JUPA 5D81A 1W6GA 4GL6A 1OHPA 1YVBI 1W5ZA 1UUWB 1YIT3 1EQKA 3TDGA 1WQLB 3GZYB 2GU3A 7STDA 5KP3A 2HMOB 3FCSB 3H3HA 1OF5A 4MMXB 2YFLB 4ORLA 1JKGA 4N6OB 2CIUA 5JBSA 1KSIA 3OWUA 4EV2A 4GB5A 3FG4A 2W9QA 3OV4A 3S28A 3UL6A 1A67A 1CYVA 1JRQA 5IERA 1JB4A 4KZ1A 1US1A 1STFI 1A2VA 1OGXA 3CME3 3KE7A 1TFKA 4XBXA 2OWPA 1YJN3 5FGOA 4STDA 2QGUA 3V99A 3H51A 3FH1A 1Q814 3JUQA 1OACA 1SQWA 2OOVC 2Q07A 3U97A 4I4KA 3MHEA 1VQL3 3BLZA 1K734 1A90A 4K90B 1O7WB 2Z77A 1MOLA 3GZXB 1K28A 2XSHB 3NQZA 1U5OA 3EBYA 4PEJA 4EXRA 1DMNA 5DREA 3Q90A 1FGMA 5D83A 1O7PB 2XGNA 4KVHA 3N54B 1W6YA 4XM4A 1JB2A 2HMKB 3FLJA 1SIIA 2P38A 4XBYA 3LTBA 1QVG2 4J9AA 1GS3A 3DY5A 4FMDA 3CCJ3 1Q40B 3PXMA 1VQ53 2BHMA 1VQO3 2C11A 5CF1A 1A2KA 5JPPA 3MG3A 1Q7Y4 2XFTA 1DMMA 5AI1A 3EHCA 2B24B 2HMMB 3BNDA 4EYCA 3G0KA 1ROVA 3K5TA 2QIYA 1IVUA 4HM1B 1VQP3 3LH4A 3CD63 2W56B 3GZBA 2JDIH 3NM7A 4LZIA 1UW1A 2F86B 2CFGA 4JRFA 2WOFA 4O3VA 1ULJB 1VQ63 3L0RA 1OCVA 3EBTA 1NO3A 2RGQA 3X3XA 4L8OA 3Q1CA 3CC43 3DMCA 1IVXA 5KP4A 2RCDA 1AR0A 5JPUA 4MJDA 2WO0A 2YX9A 1O7NB 5EVHA 4R1KA 3F7SA 5ELJA 4K61A 1GD3A 4FMCA 1YGEA 2GEXA 1KD14 1OHSA 3T0UA 3PS8A 1VQ43 1YHQ3 3T8UA 3HIGA 1J2BA 1IVWA 2FNQA 3T8NA 3J7Yd 2OQEC 1QVF2 1VQ83 1Q40A 4WWUC 1UI7A 1N8QA 3PYJA 4HM3B 1WMOA 1UI8A 1C7HA 1Q864 5DRVA 3EN8A 2XSOB 1LVNA 1D6UA 2P0XA 1FUWA 1Q824 1QMAA 2F99A 2GBXB 3SOAA 3FKAA 5AEWB 4ZM8A 3CNMA 1EA2A 2HMJB 2XF3A 3HX8A 3U1WA 4O8SA 3EX9A 3FG3A 4FCZA 1M904 4LSOA 1SIHA 5AIFA 2L4VA 1RN7A 1S5AA 2XH9A 4HYZA 1O7HB 4IIAA 2WOHA 3LTCA 2SBLA 1W02A 2GXFA 3KSED 1KQS2 3BB9A 2HMLB 2XEPA 5IENA 3F9SA 4HVNA 1TP6A 1W2ZA 3EC9A 3B4PA 2Y74A 3Q2PA 5IEOA 1Z1SA 5CK6A 3NHXA 1PFPA 2K54A 3CXC2 4HM2B 4RNZA 4N6V0 1STDA 3I563 4LGQA 1V74A 3PZWA 2Z76A 2CH9A 1OPYA 3D3LA 4FCMA 3DUKA 1ROAA 5STDA 2QA43 3PCSA 4G1MB 1K9M4 3ALAA 4IPBA 4KFDA 4XB5A 1TU5A 3NQYA 1EKMA 2ML6A 4RZMA 1AVLA 3FSDA 4BTWA 2CHCA 2W2CA 1RKYA 1TIJA 2IUKA 3NX0A 1RRLA 5CF2A 2CFDA 1ISKA 3NM2A 1GY7A 3CPOA 1JN5B 2WGQA 2MF7A 1SJWA 3CCM3 1QAFA 3CCQ3 2Y73A 3GZRA 3X42A 1GY6A 3B7CA 1UUVB 1M1K4 1VQ73 6STDA 1NB5I 1NDOB 1IQYA 4FCJA 4K1VA 3ROBA 1W01A 3G6E3 1WMPA 2GBWB 3G16A 3OXAA 5IF6A 3HK4A 1IU7A 3A76A 3FGYA 1IT8A 2STDA 3FF0A 4HM7B 4OUQA 1IV7A 1E97A 2PZVA 2RSXA 1IQ8A 3JUOA 3LT9A 3CCE3 3G8ZA 3WODG 2INXA 2YFIB 3VSYA 5G2GA 3QRDA 3HZPA 3MWZA 4XDWA 2QEX3 5ELUA 2HMNB 3OWYA 3LTDA 4MMYB 1CYUA 1L5GB 2CG0A 1TFOA 2UX0A 4AKZA 1DMQA 4R4KA 3I553 1IQXA 3KN4A 2P05A 4IT7A 4BTYA 3CCR3 1WMNA 2IUJA 4LMIA 2BO9B 3N8BA 1O7MB 3X3YA 3EE1A 3NUVA 4H3UA 3K9MC 1K8A4 1BUQA 3F8HA 2GU1A 4K1UA 1JN5A 2KCDA 4J8TA 3I0YA 3MSOA 4RNYA 1N5PA 3KFQC 4KFFA 3CC73 1HKXA 3FF2A 1NU3A 2LYXA 1RRHA 2W9PA 2P0MA 1D6YA 2W0QA 1ZX2A 4JF8A 5D82A 3BNCA 3RGAA 3WA3A 4N6LA 5I97A 4HM4B 2B1XB 3LOYA 5BXQA 2O9UX 3V98A 5EEOA 1EG9B 3X3ZA 3CCV3 1NB3I 2V1LA 4R9LA 1YI23 3BNEA 1N9JA 2JQ5A 2XRXB 3DGOA 4HZBB 3F8XA 3OX9A 3JVCA 1GYBA 4H61A 3VGNA 1SPUA 1W7CA 1VQM3 2M7OA 3SXXA 5TGNA 2CWTA 3NXJA 3WDGB 1K41A 2PNCA 5IW9A 2CG1A 1Y4KA 2IMJA 4HKVB 2FGTA 1AV4A 4WFOA 3DZLA 2KXGA 2CFLA 3SOYA 1FGRA 4OK0A 3JUNA 3OW22 5BVBA 1NJI4 2W03A 5FW5A 2OOVA 1M9GA 4CDLA 4X2OA 3UNLA 5IG3A 2CFWA 1VQ93 1JV2B 2CFKA 2CW9A 4WP5A 5CLKA 3UL5A 3EN1B 5CXOA 1RJOA 1TUHA 3WA2X 1Q42A 1E3RA 1JNQA 1WNHA 1OHOA 1IV9A 1NWWA 2Z7AA 3F40A 3NBRA 3AMOB 2BT3A 3G4S3 3E99A 5EQLA 4O2HA 3B8LA 4N6NB 5IG0A 5AYSC 3HI7A 1M1XB 2OTJ3 3RGRA 2D42A 4U13A 3EJVA 3WMDA 8CHOA 4L7KA 3EF8A 4RBNA 1PU4A 4HJLB 1N9EA 3PGBA 2W6JH 1IDPA 1AVKA 4HM8B 5LC6A 3CPW2 1HU9A 3MPHA 3GWRA 2E2VA 3UJMA 2FXTA 3X41A 1S723 1N8R4 3K63A 2YFJB 3X40A 3FG1A 3B4OA 2D1WA 2E2TA 1FA3A 3GRDA 4Q53A 5HGRA 3IJEB 3GAXA 4AEQA 4HM6B 1ULIB 5AEUB 5IG5A 4HBRA 3LZAA 1MNLA 2CWVA 3SX1A 3WOFB 2A15A 4NHFA 5A0OB 2O3OA 3CC23 3BNBA 4XBTA 1R4CA 1YJW3 4KFEA 4N6MA 4MMZB 4HM0B 3G713 3IPTA 3CCS3 3SVAA 3KKGA 1VQN3 3AMOA 3N9HA 4MEIA 2OCTA 3QK9A 2OQEA 2CK3H 3FZWA 1DVCA 4HZ9B 1OUNA 3MG2A 3HIIA 3V92A 3CCL3 1YJ93 3DGNA 4FMAA 3LYGA 4R9KA 2Z6BA 4WHAA 4AKYA 1IK3A 1GY5A 2XR8B 2IA7A 2KRTA 3S27A 5LC7A 4BTXA 3CCU3 5AIIA 1KC84 4EV5A 2GEYA 3DXOA 3M8CA 3WOEB 2BNGA 1CQSA 1W4NA 3MG1A 1IT7A 2ZL8A 4WYKB 1LNHA 1VZZA 3NV0B 5IG4A 4N6UA 4OVMA 1QALA 1KWIA 2BMRB 1QAKA 2LQVA 2XFSA 4NREA 1ASKA 2CWUA 3LXUX 3S29A 4FR9A 1N5HA 3KZTA 4X2HA 1JB5A 3JUMA 3ECFA 1VQK3 3KSPA 2BMQB 1FGQA 4N3VA 1LXEA 3DGLA 2R4IA 1YIJ3 3ER7A 1U8CB 1OGZA 3CU3A 3CMA3 3UB1A 5AYRB 1T5YA 3EQQB 3STDA 3SLUA 2XGLA 2CC3A 2C10A 3LT8A 1WTHA 3S67A 1OF5B 3IMAB 1GD4A 3O8YA 1W6CA 3F14A 2BMOB 1O7GB 1JKGB 1G96A 1OH0A 2W04A 4XDVA 2K0MA 3RDEA 3NBJA 2ML5A 1W00A 3LTAA 5KP1A 3K7CA 2ZDJA 4N6TA 3KIIA 1DVDA 1FGTA 3S5CA 1E3VA 2I9WA 3VF1A 4CCVA 5IEPA 4WYKA 3K0ZA 2MC8A 2CKFB 3SEDA 1QJGA 4R80A 4QWTA 3DGMA 3NV0A 4FMBA 1FGOA 3F7XA 3MYTA 3MKIA 1DYUA 2OTL3 3PCRA 1JJ22 4HM5B 4LEHA 1LOXA 3LMLA 2P09A 2W56A 3CNXA 4L8PA 4EBGA 4EC6A 4TX4A 3DM8A 3D9RA 3EB8A 2E2UA 1IVVA 3OWSA 5AIHA 1F8NA 1CEWI 5AIGA 2F98A 3NBBA 2WGOA 1ZO2A 1D6ZA 2RFRA 1W2B2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JUP A;  5D81 A;  1OHP A;  1UUW B;  1WQL B;  3GZY B;  7STD A;  5KP3 A;  2HMO B;  3H3H A;  1OF5 A;  4ORL A;  2YFL B;  1JKG A;  3OWU A;  4GB5 A;  3OV4 A;  5IER A;  1JB4 A;  1OGX A;  3KE7 A;  4XBX A;  2OWP A;  4STD A;  2QGU A;  3H51 A;  3FH1 A;  3JUQ A;  4I4K A;  3MHE A;  3BLZ A;  1O7W B;  2Z77 A;  3GZX B;  2XSH B;  1U5O A;  3EBY A;  4PEJ A;  1DMN A;  5DRE A;  3Q90 A;  5D83 A;  1O7P B;  4KVH A;  1W6Y A;  4XM4 A;  1JB2 A;  2HMK B;  3FLJ A;  4XBY A;  4J9A A;  1GS3 A;  1Q40 B;  5CF1 A;  1A2K A;  5JPP A;  3MG3 A;  1DMM A;  5AI1 A;  3EHC A;  2B24 B;  2HMM B;  3G0K A;  4HM1 B;  2QIY A;  3GZB A;  2F86 B;  1ULJ B;  1OCV A;  3EBT A;  2RGQ A;  4L8O A;  3DMC A;  5KP4 A;  2RCD A;  1AR0 A;  5JPU A;  4MJD A;  1O7N B;  5EVH A;  4R1K A;  3F7S A;  2GEX A;  1OHS A;  3T8U A;  3T8N A;  1Q40 A;  4WWU C;  4HM3 B;  1C7H A;  5DRV A;  3EN8 A;  2XSO B;  1QMA A;  2F99 A;  2GBX B;  3SOA A;  3FKA A;  5AEW B;  3CNM A;  1EA2 A;  2HMJ B;  3HX8 A;  3EX9 A;  5AIF A;  1S5A A;  1O7H B;  4IIA A;  1W02 A;  2GXF A;  3BB9 A;  2HML B;  5IEN A;  3F9S A;  4HVN A;  1TP6 A;  3EC9 A;  3B4P A;  5IEO A;  1Z1S A;  5CK6 A;  3NHX A;  2K54 A;  4HM2 B;  1STD A;  4LGQ A;  2Z76 A;  1OPY A;  4FCM A;  3DUK A;  5STD A;  4XB5 A;  4RZM A;  3FSD A;  2CHC A;  2W2C A;  1ISK A;  5CF2 A;  3NM2 A;  1GY7 A;  3CPO A;  1JN5 B;  1SJW A;  3GZR A;  1GY6 A;  3B7C A;  1UUV B;  6STD A;  1NDO B;  4FCJ A;  4K1V A;  3ROB A;  1W01 A;  2GBW B;  3G16 A;  3OXA A;  5IF6 A;  3HK4 A;  3A76 A;  3FGY A;  2STD A;  3FF0 A;  4HM7 B;  4OUQ A;  1E97 A;  2PZV A;  3JUO A;  3G8Z A;  2INX A;  2YFI B;  3VSY A;  5G2G A;  4XDW A;  3HZP A;  2HMN B;  3OWY A;  2UX0 A;  1DMQ A;  4LMI A;  1O7M B;  3NUV A;  4H3U A;  1BUQ A;  3F8H A;  4K1U A;  1JN5 A;  4J8T A;  3I0Y A;  3MSO A;  1HKX A;  3FF2 A;  1NU3 A;  1ZX2 A;  5D82 A;  3RGA A;  4HM4 B;  2B1X B;  5BXQ A;  1EG9 B;  4R9L A;  2JQ5 A;  2XRX B;  4HZB B;  3F8X A;  3OX9 A;  1GYB A;  3VGN A;  5TGN A;  3NXJ A;  1K41 A;  2IMJ A;  4HKV B;  3DZL A;  3SOY A;  3JUN A;  5BVB A;  5FW5 A;  4CDL A;  4X2O A;  3UNL A;  5IG3 A;  4WP5 A;  5CLK A;  3EN1 B;  5CXO A;  1TUH A;  1Q42 A;  1E3R A;  1OHO A;  1NWW A;  2Z7A A;  3F40 A;  3NBR A;  3E99 A;  3B8L A;  5IG0 A;  3RGR A;  4U13 A;  3EJV A;  3WMD A;  8CHO A;  4L7K A;  3EF8 A;  4HJL B;  1IDP A;  4HM8 B;  3GWR A;  3UJM A;  2YFJ B;  3B4O A;  3GRD A;  4Q53 A;  5HGR A;  4HM6 B;  1ULI B;  5AEU B;  5IG5 A;  3LZA A;  2A15 A;  4XBT A;  4HM0 B;  3IPT A;  3KKG A;  3FZW A;  4HZ9 B;  1OUN A;  3MG2 A;  3LYG A;  4R9K A;  1GY5 A;  2XR8 B;  5AII A;  2GEY A;  3DXO A;  3M8C A;  2BNG A;  1CQS A;  3MG1 A;  4WYK B;  1VZZ A;  3NV0 B;  5IG4 A;  4OVM A;  2BMR B;  1ASK A;  3KZT A;  4X2H A;  1JB5 A;  3JUM A;  3ECF A;  3KSP A;  2BMQ B;  4N3V A;  2R4I A;  3ER7 A;  1OGZ A;  3CU3 A;  3EQQ B;  3STD A;  1OF5 B;  3F14 A;  2BMO B;  4XDV A;  1JKG B;  1O7G B;  1OH0 A;  1W00 A;  5KP1 A;  3K7C A;  3S5C A;  1E3V A;  2I9W A;  5IEP A;  4WYK A;  3K0Z A;  2CKF B;  3SED A;  1QJG A;  3NV0 A;  3F7X A;  3MYT A;  3MKI A;  4HM5 B;  4LEH A;  4L8P A;  3CNX A;  3DM8 A;  3D9R A;  3OWS A;  5AIH A;  5AIG A;  2F98 A;  1ZO2 A;  2RFR A; 
#chains in the Genus database with same CATH topology
 1BSA A;  1UUG B;  4O02 B;  3JUP A;  1I2E A;  1RNT A;  4EW5 A;  5D81 A;  1B2X A;  1W6G A;  4GL6 A;  1OHP A;  1YVB I;  1W5Z A;  1UUW B;  1BOX A;  1JZD A;  1YIT 3;  1EQK A;  3TDG A;  1WQL B;  3GZY B;  2GU3 A;  7STD A;  5KP3 A;  1TRP A;  2HMO B;  3FCS B;  3H3H A;  1OF5 A;  4MMX B;  1LNI A;  2YFL B;  4ORL A;  5BIR A;  4HOH A;  8RNT A;  1JKG A;  4N6O B;  2CIU A;  1DET A;  1KSI A;  5JBS A;  3OWU A;  4EV2 A;  4GB5 A;  3FG4 A;  2W9Q A;  3OV4 A;  3S28 A;  3UL6 A;  1A67 A;  1CYV A;  1JRQ A;  5IER A;  1JB4 A;  4KZ1 A;  2UUG C;  1US1 A;  1STF I;  1A2V A;  1OGX A;  1BNI A;  3CME 3;  3KE7 A;  1TFK A;  4XBX A;  1UCI A;  2OWP A;  1YJN 3;  5FGO A;  4STD A;  2QGU A;  3V99 A;  3H51 A;  3FH1 A;  1Q81 4;  3JUQ A;  1OAC A;  1SQW A;  2OOV C;  2Q07 A;  3U97 A;  3WR2 A;  7RNT A;  4I4K A;  3MHE A;  5M18 A;  1VQL 3;  3BLZ A;  2AAD A;  1K73 4;  4K90 B;  1A90 A;  1RHL A;  1O7W B;  2Z77 A;  1MOL A;  4KT3 B;  3GZX B;  1K28 A;  2XSH B;  3NQZ A;  1U5O A;  3EBY A;  4PEJ A;  4EXR A;  1DMN A;  5DRE A;  1FZU A;  1RSN A;  2F4Y A;  2BIR A;  3Q90 A;  1FGM A;  2F56 A;  5D83 A;  1DE3 A;  1O7P B;  2XGN A;  4KVH A;  3N54 B;  1W6Y A;  4XM4 A;  4BIR A;  1JB2 A;  1UCJ A;  2HMK B;  3FLJ A;  1SII A;  2P38 A;  4XBY A;  1BSB A;  3LTB A;  1QVG 2;  4J9A A;  1GS3 A;  1GMR A;  3DY5 A;  4FMD A;  3CCJ 3;  1Q40 B;  3PXM A;  1VQ5 3;  2BHM A;  5BU4 A;  1GOV A;  1VQO 3;  2C11 A;  1BSE A;  5CF1 A;  2IY2 A;  1A2K A;  1LQG C;  1VQQ A;  5JPP A;  3MG3 A;  1MWT A;  1Q7Y 4;  2XFT A;  1BAN A;  1DMM A;  5AI1 A;  3EHC A;  2B24 B;  2HMM B;  3BND A;  4EYC A;  1RMS A;  3G0K A;  1ROV A;  3K5T A;  2QIY A;  1IVU A;  1FUS A;  2RBI A;  4HM1 B;  1VQP 3;  3LH4 A;  3CD6 3;  1LOY A;  2W56 B;  3GZB A;  2JDI H;  1R4Y A;  1TRQ A;  3NM7 A;  1UW1 A;  4LZI A;  2F86 B;  5G1L A;  3ZG5 A;  2CFG A;  4JRF A;  2WOF A;  4O3V A;  1ULJ B;  1VQ6 3;  3L0R A;  1OCV A;  3EBT A;  1NO3 A;  2RGQ A;  3ZFZ A;  3X3X A;  4L8O A;  5GSP A;  3Q1C A;  3CC4 3;  3DMC A;  1IVX A;  1UDI I;  2RCD A;  5KP4 A;  1AR0 A;  1RN4 A;  3AGO A;  1RDS A;  5JPU A;  4MJD A;  2WO0 A;  1FUT A;  2YX9 A;  1B27 A;  1O7N B;  5EVH A;  1BRI A;  4R1K A;  3F7S A;  5ELJ A;  4K61 A;  1GD3 A;  1BGS A;  1EUI C;  1YGE A;  2GEX A;  4FMC A;  1KD1 4;  1OHS A;  3T0U A;  3PS8 A;  1VQ4 3;  1YHQ 3;  3T8U A;  1B3S A;  3HIG A;  1BRN L;  1J2B A;  1IVW A;  2FNQ A;  3T8N A;  3J7Y d;  1JZO A;  1TTO A;  2OQE C;  1QVF 2;  1VQ8 3;  1Q40 A;  4WWU C;  1UI7 A;  1MWU A;  1N8Q A;  3PYJ A;  4HM3 B;  1WMO A;  1UI8 A;  1C7H A;  1Q86 4;  5DRV A;  1FW7 A;  1ZGX A;  3EN8 A;  2XSO B;  1B20 A;  1LVN A;  1D6U A;  2K3D A;  2P0X A;  1FUW A;  2CX0 A;  1Q82 4;  1QMA A;  2F99 A;  2GBX B;  3SOA A;  3FKA A;  5AEW B;  1YNV X;  4DKI A;  2KF6 A;  3CNM A;  1EA2 A;  4ZM8 A;  1JBT A;  6GSP A;  2HMJ B;  2XF3 A;  3HX8 A;  3U1W A;  4O8S A;  3EX9 A;  3FG3 A;  4FCZ A;  1M90 4;  4LSO A;  1SIH A;  5AIF A;  1GMQ A;  2L4V A;  1RN7 A;  1S5A A;  2XH9 A;  4HYZ A;  1O7H B;  4IIA A;  1MGR A;  2WOH A;  3LTC A;  2SBL A;  1W02 A;  1JBS A;  2GXF A;  1X1X A;  3KSE D;  1KQS 2;  3BB9 A;  2HML B;  2XEP A;  5IEN A;  3F9S A;  4HVN A;  1HYF A;  1TP6 A;  1W2Z A;  3EC9 A;  3B4P A;  2Y74 A;  3Q2P A;  5IEO A;  1Z1S A;  5CK6 A;  3NHX A;  1PFP A;  2K54 A;  3CXC 2;  4HM2 B;  4RNZ A;  4N6V 0;  1STD A;  3URP A;  3I56 3;  4LGQ A;  1V74 A;  3PZW A;  1B21 A;  5RNT A;  2Z76 A;  2CH9 A;  1OPY A;  3D3L A;  4FCM A;  1B2M A;  3DUK A;  1ROA A;  5STD A;  2QA4 3;  1C54 A;  3PCS A;  1I0X A;  4G1M B;  1RCL A;  1K9M 4;  3ALA A;  4IPB A;  4KFD A;  4XB5 A;  1TU5 A;  1RNB A;  3NQY A;  1EKM A;  2ML6 A;  4RZM A;  1AVL A;  1PYL A;  2C4B A;  2CHC A;  1I3I A;  2W2C A;  3FSD A;  4LYL B;  4BTW A;  1RKY A;  1GOU A;  1TIJ A;  2IUK A;  3NX0 A;  1RRL A;  5CF2 A;  2CFD A;  1GOY A;  3NM2 A;  1GY7 A;  1ISK A;  3CPO A;  1JN5 B;  2WGQ A;  2MF7 A;  1SJW A;  4CPK A;  1BNS A;  1QAF A;  2RNT A;  2Y73 A;  3WOD G;  3CCQ 3;  3GZR A;  3X42 A;  4J5G A;  1GY6 A;  2KAA A;  3B7C A;  1RN1 A;  1UUV B;  1M1K 4;  1VQ7 3;  1BRS A;  3BIR A;  6STD A;  1NB5 I;  1NDO B;  1IQY A;  4FCJ A;  4K1V A;  3ROB A;  1W01 A;  1X1U A;  3G6E 3;  2H0H A;  1WMP A;  3BU4 A;  4BL2 A;  1V57 A;  2HOH A;  2ZHX B;  2GBW B;  3G16 A;  3OXA A;  1YVS A;  1BRH A;  3HK4 A;  4J5K A;  5IF6 A;  1IU7 A;  3A76 A;  3FGY A;  1IT8 A;  1GSP A;  2STD A;  3FF0 A;  1BSD A;  4HM7 B;  4OUQ A;  1IV7 A;  1E97 A;  2PZV A;  2RSX A;  1IQ8 A;  3JUO A;  3LT9 A;  3CCE 3;  4CJN A;  3G8Z A;  3RNT A;  1RGL A;  2INX A;  1BRJ A;  2YFI B;  5G2G A;  3QRD A;  3HZP A;  3MWZ A;  4XDW A;  3VSY A;  2QEX 3;  5ELU A;  2HMN B;  3OWY A;  3LTD A;  4MMY B;  1CYU A;  1L5G B;  2CG0 A;  1TFO A;  2UX0 A;  4AKZ A;  1DMQ A;  4R4K A;  3I55 3;  1IQX A;  3KN4 A;  1BRK A;  2P05 A;  4IT7 A;  4BTY A;  3CCR 3;  1WMN A;  1GMP A;  1X1Y A;  1NNV A;  4LMI A;  2IUJ A;  2BO9 B;  3N8B A;  1O7M B;  2ZA4 A;  3X3Y A;  3EE1 A;  3NUV A;  4H3U A;  4GSP A;  3K9M C;  1K8A 4;  1BUQ A;  3F8H A;  1BNR A;  2GU1 A;  4K1U A;  1JN5 A;  2KCD A;  4J8T A;  3I0Y A;  7GSP A;  3MSO A;  4RNY A;  1N5P A;  3KFQ C;  4KFF A;  3CC7 3;  1HKX A;  1LOW A;  3FF2 A;  1NU3 A;  2LYX A;  1RRH A;  2W9P A;  2P0M A;  1D6Y A;  2W0Q A;  1ZX2 A;  4JF8 A;  5D82 A;  1RGG A;  3BNC A;  3RGA A;  4N6L A;  5I97 A;  3WA3 A;  3Q3F A;  4BL3 A;  4HM4 B;  2B1X B;  3LOY A;  5BXQ A;  1RGF A;  2O9U X;  2R41 A;  3V98 A;  3CCM 3;  5EEO A;  1EG9 B;  3X3Z A;  3CCV 3;  1NB3 I;  2V1L A;  1BNF A;  1JBR A;  4R9L A;  1YI2 3;  2AAE A;  3BNE A;  1N9J A;  2JQ5 A;  2XRX B;  3DGO A;  4HZB B;  4I5Q A;  1T2H A;  4BU4 A;  3F8X A;  3OX9 A;  3JVC A;  1GYB A;  1RGE A;  1UGI A;  4H61 A;  3VGN A;  1SPU A;  1W7C A;  3AHW A;  1VQM 3;  2M7O A;  2KF3 A;  3SXX A;  1MGW A;  1BNG A;  5TGN A;  1BNE A;  1Q9E A;  2CWT A;  3NXJ A;  1K41 A;  2PNC A;  3WDG B;  3WHO A;  5IW9 A;  2CG1 A;  1IYY A;  1MWS A;  1Y4K A;  2IMJ A;  4HKV B;  2FGT A;  1AV4 A;  4WFO A;  1UCL A;  3DZL A;  2KXG A;  2CFL A;  3SOY A;  3ZG0 A;  4NPB A;  1FGR A;  1RGH A;  1BRG A;  4OK0 A;  1AQZ A;  3JUN A;  1RCK A;  5BVB A;  1YGW A;  3OW2 2;  1NJI 4;  2W03 A;  5FW5 A;  1RGC A;  1M9G A;  2OOV A;  4CDL A;  2F5W A;  1T3B A;  4X2O A;  3UNL A;  5IG3 A;  6RNT A;  2CFW A;  1VQ9 3;  1JV2 B;  2CFK A;  2CW9 A;  4WP5 A;  5CLK A;  3UL5 A;  3EN1 B;  5CXO A;  1V58 A;  1RJO A;  1TUH A;  3WA2 X;  1Q42 A;  3KCH A;  1E3R A;  2H0G A;  2BU4 A;  1JNQ A;  1WNH A;  1OHO A;  1IV9 A;  1NWW A;  2Z7A A;  3F40 A;  3NBR A;  3AMO B;  2BT3 A;  3GSP A;  3G4S 3;  1BAO A;  3E99 A;  5EQL A;  4O2H A;  3B8L A;  4N6N B;  4RNT A;  1B2Z A;  5IG0 A;  5AYS C;  3DGY A;  3HI7 A;  1M1X B;  4GHO A;  2OTJ 3;  4HAA A;  1B2U A;  3RGR A;  2D42 A;  4U13 A;  3EJV A;  2J8X B;  3D5I A;  3WMD A;  8CHO A;  4L7K A;  3EF8 A;  2L1S A;  4RBN A;  4HJL B;  1PU4 A;  1N9E A;  3A5E A;  3PGB A;  1T2I A;  1IDP A;  1RTU A;  1I2F A;  2W6J H;  1AVK A;  1BVI A;  1BNJ A;  4HM8 B;  5LC6 A;  1HU9 A;  3CPW 2;  3MPH A;  3GWR A;  1I8V A;  2E2V A;  3UJM A;  2GSP A;  1UCK A;  1G02 A;  2FXT A;  1BUJ A;  3X41 A;  1S72 3;  1N8R 4;  2SAR A;  3K63 A;  2YFJ B;  3X40 A;  3FG1 A;  2D1W A;  3B4O A;  2E2T A;  5M19 A;  1FA3 A;  3GRD A;  4Q53 A;  5HGR A;  3IJE B;  3GAX A;  1CH0 A;  4HM6 B;  4AEQ A;  1ULI B;  5AEU B;  5IG5 A;  1RGA A;  4HBR A;  3LZA A;  1RLS A;  1MNL A;  2CWV A;  3SX1 A;  3WOF B;  2UGI A;  2A15 A;  3HOH A;  4NHF A;  5A0O B;  2O3O A;  3CC2 3;  3BNB A;  4XBT A;  2H0I A;  1LRA A;  1R4C A;  1YJW 3;  1BIR A;  4KFE A;  4N6M A;  4MMZ B;  4HM0 B;  3G71 3;  3IPT A;  1B2S A;  3CCS 3;  3SVA A;  3KKG A;  1VQN 3;  3AMO A;  3N9H A;  1Q7H A;  2F5M A;  4MEI A;  2OCT A;  3QK9 A;  2OQE A;  2CK3 H;  3FZW A;  1DVC A;  4HZ9 B;  1OUN A;  3MG2 A;  3HII A;  3V92 A;  3CCL 3;  1YJ9 3;  3DGN A;  1I3F A;  4FMA A;  3LYG A;  4R9K A;  2Z6B A;  4WHA A;  4AKY A;  1IK3 A;  1GY5 A;  2XR8 B;  2IA7 A;  3D79 A;  2KRT A;  3S27 A;  5LC7 A;  4BTX A;  3CCU 3;  5AII A;  1KC8 4;  4EV5 A;  1I2G A;  2GEY A;  3DXO A;  3M8C A;  2BNG A;  3WOE B;  1SAR A;  3D5G A;  1CQS A;  1W4N A;  3MG1 A;  1IT7 A;  2ZL8 A;  4WYK B;  1EEJ A;  1LNH A;  1VZZ A;  3NV0 B;  2IYJ A;  5IG4 A;  4N6U A;  4OVM A;  1QAL A;  4ILF A;  1KWI A;  2BMR B;  1QAK A;  2LQV A;  2XFS A;  4NRE A;  1ASK A;  2CWU A;  3LXU X;  3S29 A;  3AHS A;  4FR9 A;  1N5H A;  1G0T A;  1A2P A;  3KZT A;  2CX1 A;  1JB5 A;  1I0V A;  3JUM A;  4X2H A;  3ECF A;  1VQK 3;  3KSP A;  5G1K A;  2BMQ B;  9RNT A;  1FGQ A;  4N3V A;  1LXE A;  3DGL A;  1HZ1 A;  2R4I A;  1YIJ 3;  3ER7 A;  1U8C B;  1OGZ A;  3CU3 A;  3CMA 3;  3UB1 A;  5AYR B;  1T5Y A;  3EQQ B;  3STD A;  3SLU A;  2XGL A;  2CC3 A;  2C10 A;  3LT8 A;  1WTH A;  3S67 A;  1OF5 B;  1MWR A;  1GD4 A;  3IMA B;  3O8Y A;  1W6C A;  3F14 A;  2BMO B;  1O7G B;  1JKG B;  1G96 A;  1OH0 A;  2W04 A;  4XDV A;  5HOH A;  2K0M A;  3RDE A;  3NBJ A;  2ML5 A;  1W00 A;  1ZS7 A;  3LTA A;  5KP1 A;  3K7C A;  1LOV A;  2ZDJ A;  4N6T A;  3KII A;  1BU4 A;  1DVD A;  1FGT A;  3S5C A;  1E3V A;  1LQM B;  2I9W A;  3VF1 A;  4CCV A;  1UGH I;  5IEP A;  4WYK A;  3K0Z A;  2MC8 A;  2CKF B;  3SED A;  3D4A A;  1QJG A;  4R80 A;  4QWT A;  1RGK A;  3DGM A;  3NV0 A;  4FMB A;  1FGO A;  3F7X A;  3MYT A;  3MKI A;  1TJD A;  1DYU A;  2OTL 3;  3SYU A;  3PCR A;  1JJ2 2;  4HM5 B;  4LEH A;  1LOX A;  3LML A;  1AY7 A;  1X1W A;  2KF5 A;  2P09 A;  2W56 A;  3CNX A;  4L8P A;  3DM8 A;  3D9R A;  4TX4 A;  5M1A A;  4EBG A;  4EC6 A;  1FYS A;  2KF4 A;  3EB8 A;  2E2U A;  1IVV A;  3DH2 A;  3OWS A;  5AIH A;  1F8N A;  1CEW I;  5AIG A;  3AGN A;  2F98 A;  3NBB A;  2WGO A;  1PY3 A;  1BSC A;  1ZO2 A;  1D6Z A;  1I70 A;  2RFR A;  1W2B 2; 
#chains in the Genus database with same CATH homology
 4O02 B;  3JUP A;  5D81 A;  1W6G A;  4GL6 A;  1OHP A;  1YVB I;  1W5Z A;  1UUW B;  1YIT 3;  1EQK A;  3TDG A;  1WQL B;  3GZY B;  2GU3 A;  7STD A;  5KP3 A;  2HMO B;  3FCS B;  3H3H A;  1OF5 A;  4MMX B;  2YFL B;  4ORL A;  1JKG A;  4N6O B;  2CIU A;  5JBS A;  1KSI A;  3OWU A;  4EV2 A;  4GB5 A;  3FG4 A;  2W9Q A;  3OV4 A;  3S28 A;  3UL6 A;  1A67 A;  1CYV A;  1JRQ A;  5IER A;  1JB4 A;  4KZ1 A;  1US1 A;  1STF I;  1A2V A;  1OGX A;  3CME 3;  3KE7 A;  1TFK A;  4XBX A;  2OWP A;  1YJN 3;  5FGO A;  4STD A;  2QGU A;  3V99 A;  3H51 A;  3FH1 A;  1Q81 4;  3JUQ A;  1OAC A;  1SQW A;  2OOV C;  2Q07 A;  3U97 A;  4I4K A;  3MHE A;  1VQL 3;  3BLZ A;  1K73 4;  1A90 A;  4K90 B;  1O7W B;  2Z77 A;  1MOL A;  3GZX B;  1K28 A;  2XSH B;  3NQZ A;  1U5O A;  3EBY A;  4PEJ A;  4EXR A;  1DMN A;  5DRE A;  3Q90 A;  1FGM A;  5D83 A;  1O7P B;  2XGN A;  4KVH A;  3N54 B;  1W6Y A;  4XM4 A;  1JB2 A;  2HMK B;  3FLJ A;  1SII A;  2P38 A;  4XBY A;  3LTB A;  1QVG 2;  4J9A A;  1GS3 A;  3DY5 A;  4FMD A;  3CCJ 3;  1Q40 B;  3PXM A;  1VQ5 3;  2BHM A;  1VQO 3;  2C11 A;  5CF1 A;  1A2K A;  5JPP A;  3MG3 A;  1Q7Y 4;  2XFT A;  1DMM A;  5AI1 A;  3EHC A;  2B24 B;  2HMM B;  3BND A;  4EYC A;  3G0K A;  1ROV A;  3K5T A;  2QIY A;  1IVU A;  4HM1 B;  1VQP 3;  3LH4 A;  3CD6 3;  2W56 B;  3GZB A;  2JDI H;  3NM7 A;  4LZI A;  1UW1 A;  2F86 B;  2CFG A;  4JRF A;  2WOF A;  4O3V A;  1ULJ B;  1VQ6 3;  3L0R A;  1OCV A;  3EBT A;  1NO3 A;  2RGQ A;  3X3X A;  4L8O A;  3Q1C A;  3CC4 3;  3DMC A;  1IVX A;  5KP4 A;  2RCD A;  1AR0 A;  5JPU A;  4MJD A;  2WO0 A;  2YX9 A;  1O7N B;  5EVH A;  4R1K A;  3F7S A;  5ELJ A;  4K61 A;  1GD3 A;  4FMC A;  1YGE A;  2GEX A;  1KD1 4;  1OHS A;  3T0U A;  3PS8 A;  1VQ4 3;  1YHQ 3;  3T8U A;  3HIG A;  1J2B A;  1IVW A;  2FNQ A;  3T8N A;  3J7Y d;  2OQE C;  1QVF 2;  1VQ8 3;  1Q40 A;  4WWU C;  1UI7 A;  1N8Q A;  3PYJ A;  4HM3 B;  1WMO A;  1UI8 A;  1C7H A;  1Q86 4;  5DRV A;  3EN8 A;  2XSO B;  1LVN A;  1D6U A;  2P0X A;  1FUW A;  1Q82 4;  1QMA A;  2F99 A;  2GBX B;  3SOA A;  3FKA A;  5AEW B;  4ZM8 A;  3CNM A;  1EA2 A;  2HMJ B;  2XF3 A;  3HX8 A;  3U1W A;  4O8S A;  3EX9 A;  3FG3 A;  4FCZ A;  1M90 4;  4LSO A;  1SIH A;  5AIF A;  2L4V A;  1RN7 A;  1S5A A;  2XH9 A;  4HYZ A;  1O7H B;  4IIA A;  2WOH A;  3LTC A;  2SBL A;  1W02 A;  2GXF A;  3KSE D;  1KQS 2;  3BB9 A;  2HML B;  2XEP A;  5IEN A;  3F9S A;  4HVN A;  1TP6 A;  1W2Z A;  3EC9 A;  3B4P A;  2Y74 A;  3Q2P A;  5IEO A;  1Z1S A;  5CK6 A;  3NHX A;  1PFP A;  2K54 A;  3CXC 2;  4HM2 B;  4RNZ A;  4N6V 0;  1STD A;  3I56 3;  4LGQ A;  1V74 A;  3PZW A;  2Z76 A;  2CH9 A;  1OPY A;  3D3L A;  4FCM A;  3DUK A;  1ROA A;  5STD A;  2QA4 3;  3PCS A;  4G1M B;  1K9M 4;  3ALA A;  4IPB A;  4KFD A;  4XB5 A;  1TU5 A;  3NQY A;  1EKM A;  2ML6 A;  4RZM A;  1AVL A;  3FSD A;  4BTW A;  2CHC A;  2W2C A;  1RKY A;  1TIJ A;  2IUK A;  3NX0 A;  1RRL A;  5CF2 A;  2CFD A;  1ISK A;  3NM2 A;  1GY7 A;  3CPO A;  1JN5 B;  2WGQ A;  2MF7 A;  1SJW A;  3CCM 3;  1QAF A;  3CCQ 3;  2Y73 A;  3GZR A;  3X42 A;  1GY6 A;  3B7C A;  1UUV B;  1M1K 4;  1VQ7 3;  6STD A;  1NB5 I;  1NDO B;  1IQY A;  4FCJ A;  4K1V A;  3ROB A;  1W01 A;  3G6E 3;  1WMP A;  2GBW B;  3G16 A;  3OXA A;  5IF6 A;  3HK4 A;  1IU7 A;  3A76 A;  3FGY A;  1IT8 A;  2STD A;  3FF0 A;  4HM7 B;  4OUQ A;  1IV7 A;  1E97 A;  2PZV A;  2RSX A;  1IQ8 A;  3JUO A;  3LT9 A;  3CCE 3;  3G8Z A;  3WOD G;  2INX A;  2YFI B;  3VSY A;  5G2G A;  3QRD A;  3HZP A;  3MWZ A;  4XDW A;  2QEX 3;  5ELU A;  2HMN B;  3OWY A;  3LTD A;  4MMY B;  1CYU A;  1L5G B;  2CG0 A;  1TFO A;  2UX0 A;  4AKZ A;  1DMQ A;  4R4K A;  3I55 3;  1IQX A;  3KN4 A;  2P05 A;  4IT7 A;  4BTY A;  3CCR 3;  1WMN A;  2IUJ A;  4LMI A;  2BO9 B;  3N8B A;  1O7M B;  3X3Y A;  3EE1 A;  3NUV A;  4H3U A;  3K9M C;  1K8A 4;  1BUQ A;  3F8H A;  2GU1 A;  4K1U A;  1JN5 A;  2KCD A;  4J8T A;  3I0Y A;  3MSO A;  4RNY A;  1N5P A;  3KFQ C;  4KFF A;  3CC7 3;  1HKX A;  3FF2 A;  1NU3 A;  2LYX A;  1RRH A;  2W9P A;  2P0M A;  1D6Y A;  2W0Q A;  1ZX2 A;  4JF8 A;  5D82 A;  3BNC A;  3RGA A;  3WA3 A;  4N6L A;  5I97 A;  4HM4 B;  2B1X B;  3LOY A;  5BXQ A;  2O9U X;  3V98 A;  5EEO A;  1EG9 B;  3X3Z A;  3CCV 3;  1NB3 I;  2V1L A;  4R9L A;  1YI2 3;  3BNE A;  1N9J A;  2JQ5 A;  2XRX B;  3DGO A;  4HZB B;  3F8X A;  3OX9 A;  3JVC A;  1GYB A;  4H61 A;  3VGN A;  1SPU A;  1W7C A;  1VQM 3;  2M7O A;  3SXX A;  5TGN A;  2CWT A;  3NXJ A;  3WDG B;  1K41 A;  2PNC A;  5IW9 A;  2CG1 A;  1Y4K A;  2IMJ A;  4HKV B;  2FGT A;  1AV4 A;  4WFO A;  3DZL A;  2KXG A;  2CFL A;  3SOY A;  1FGR A;  4OK0 A;  3JUN A;  3OW2 2;  5BVB A;  1NJI 4;  2W03 A;  5FW5 A;  2OOV A;  1M9G A;  4CDL A;  4X2O A;  3UNL A;  5IG3 A;  2CFW A;  1VQ9 3;  1JV2 B;  2CFK A;  2CW9 A;  4WP5 A;  5CLK A;  3UL5 A;  3EN1 B;  5CXO A;  1RJO A;  1TUH A;  3WA2 X;  1Q42 A;  1E3R A;  1JNQ A;  1WNH A;  1OHO A;  1IV9 A;  1NWW A;  2Z7A A;  3F40 A;  3NBR A;  3AMO B;  2BT3 A;  3G4S 3;  3E99 A;  5EQL A;  4O2H A;  3B8L A;  4N6N B;  5IG0 A;  5AYS C;  3HI7 A;  1M1X B;  2OTJ 3;  3RGR A;  2D42 A;  4U13 A;  3EJV A;  3WMD A;  8CHO A;  4L7K A;  3EF8 A;  4RBN A;  1PU4 A;  4HJL B;  1N9E A;  3PGB A;  2W6J H;  1IDP A;  1AVK A;  4HM8 B;  5LC6 A;  3CPW 2;  1HU9 A;  3MPH A;  3GWR A;  2E2V A;  3UJM A;  2FXT A;  3X41 A;  1S72 3;  1N8R 4;  3K63 A;  2YFJ B;  3X40 A;  3FG1 A;  3B4O A;  2D1W A;  2E2T A;  1FA3 A;  3GRD A;  4Q53 A;  5HGR A;  3IJE B;  3GAX A;  4AEQ A;  4HM6 B;  1ULI B;  5AEU B;  5IG5 A;  4HBR A;  3LZA A;  1MNL A;  2CWV A;  3SX1 A;  3WOF B;  2A15 A;  4NHF A;  5A0O B;  2O3O A;  3CC2 3;  3BNB A;  4XBT A;  1R4C A;  1YJW 3;  4KFE A;  4N6M A;  4MMZ B;  4HM0 B;  3G71 3;  3IPT A;  3CCS 3;  3SVA A;  3KKG A;  1VQN 3;  3AMO A;  3N9H A;  4MEI A;  2OCT A;  3QK9 A;  2OQE A;  2CK3 H;  3FZW A;  1DVC A;  4HZ9 B;  1OUN A;  3MG2 A;  3HII A;  3V92 A;  3CCL 3;  1YJ9 3;  3DGN A;  4FMA A;  3LYG A;  4R9K A;  2Z6B A;  4WHA A;  4AKY A;  1IK3 A;  1GY5 A;  2XR8 B;  2IA7 A;  2KRT A;  3S27 A;  5LC7 A;  4BTX A;  3CCU 3;  5AII A;  1KC8 4;  4EV5 A;  2GEY A;  3DXO A;  3M8C A;  3WOE B;  2BNG A;  1CQS A;  1W4N A;  3MG1 A;  1IT7 A;  2ZL8 A;  4WYK B;  1LNH A;  1VZZ A;  3NV0 B;  5IG4 A;  4N6U A;  4OVM A;  1QAL A;  1KWI A;  2BMR B;  1QAK A;  2LQV A;  2XFS A;  4NRE A;  1ASK A;  2CWU A;  3LXU X;  3S29 A;  4FR9 A;  1N5H A;  3KZT A;  4X2H A;  1JB5 A;  3JUM A;  3ECF A;  1VQK 3;  3KSP A;  2BMQ B;  1FGQ A;  4N3V A;  1LXE A;  3DGL A;  2R4I A;  1YIJ 3;  3ER7 A;  1U8C B;  1OGZ A;  3CU3 A;  3CMA 3;  3UB1 A;  5AYR B;  1T5Y A;  3EQQ B;  3STD A;  3SLU A;  2XGL A;  2CC3 A;  2C10 A;  3LT8 A;  1WTH A;  3S67 A;  1OF5 B;  3IMA B;  1GD4 A;  3O8Y A;  1W6C A;  3F14 A;  2BMO B;  1O7G B;  1JKG B;  1G96 A;  1OH0 A;  2W04 A;  4XDV A;  2K0M A;  3RDE A;  3NBJ A;  2ML5 A;  1W00 A;  3LTA A;  5KP1 A;  3K7C A;  2ZDJ A;  4N6T A;  3KII A;  1DVD A;  1FGT A;  3S5C A;  1E3V A;  2I9W A;  3VF1 A;  4CCV A;  5IEP A;  4WYK A;  3K0Z A;  2MC8 A;  2CKF B;  3SED A;  1QJG A;  4R80 A;  4QWT A;  3DGM A;  3NV0 A;  4FMB A;  1FGO A;  3F7X A;  3MYT A;  3MKI A;  1DYU A;  2OTL 3;  3PCR A;  1JJ2 2;  4HM5 B;  4LEH A;  1LOX A;  3LML A;  2P09 A;  2W56 A;  3CNX A;  4L8P A;  4EBG A;  4EC6 A;  4TX4 A;  3DM8 A;  3D9R A;  3EB8 A;  2E2U A;  1IVV A;  3OWS A;  5AIH A;  1F8N A;  1CEW I;  5AIG A;  2F98 A;  3NBB A;  2WGO A;  1ZO2 A;  1D6Z A;  2RFR A;  1W2B 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...