4WP5A

Chaetomium thermophilum mex67 ntf2-like domain complexed with mtr2
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
201
structure length
199
Chain Sequence
MPTPLPQLPSNVRDGENNVASTFLQAFFQLWDHDRLTLIPQFYDSETTFSVVFATDSPQDPASSSCSKFSRNLNILSPPSTLQRLFVGSNLIADLWKVLPATRHPSLDQTSQWLIDCHTFPHLADPTGMAPYAMGLMINVNGQCEEADISQNLYGTRTFSRCFILGPSKPGAPHPYRVLSDQLTLHTWKPQPAPQVGTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords mRNA export protein
publication title Structural characterization of the principal mRNA-export factor Mex67-Mtr2 from Chaetomium thermophilum.
pubmed doi rcsb
source organism Chaetomium thermophilum
total genus 37
structure length 199
sequence length 201
ec nomenclature
pdb deposition date 2014-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4wp5A00
1OCVA 1SJWA 4FCMA 3CPOA 3KSPA 1W6YA 3M8CA 3NV0B 4R1KA 4XBYA 4HM6B 1Z1SA 1GY7A 5BVBA 1K41A 2Z7AA 2QIYA 3FKAA 3SOYA 1GY6A 4HKVB 1Q40A 1O7NB 3MKIA 3E99A 3T8UA 3MG1A 3GZBA 4U13A 2F99A 3FZWA 2CKFB 4HZ9B 2GBWB 7STDA 3EQQB 1O7PB 4HM2B 3T8NA 2INXA 3OWUA 3JUPA 3DZLA 1TUHA 2BMRB 3IPTA 3FLJA 4X2HA 2HMJB 5CF2A 5IEPA 4L7KA 4HZBB 3DUKA 5CK6A 2A15A 4R9LA 3OX9A 2IMJA 2UX0A 1BUQA 3EC9A 4J9AA 4XM4A 5BXQA 3GZYB 1O7MB 3WMDA 1OHSA 2I9WA 4PEJA 1DMQA 4WWUC 5STDA 4GB5A 3DMCA 3FH1A 5IG3A 3FSDA 3G0KA 3F40A 1OPYA 5AIFA 2GBXB 3CU3A 4L8OA 1JKGA 1DMMA 3GZRA 3G8ZA 1IDPA 2HMNB 3JUNA 4HM1B 1WQLB 5G2GA 3Q90A 1GYBA 3D9RA 1JB5A 3EHCA 1EA2A 2YFJB 4HM0B 5D82A 3EBYA 4WP5A 1O7WB 5JPUA 1Q42A 1JKGB 4HJLB 4HM5B 1E97A 8CHOA 4XBTA 3EX9A 3NBRA 1CQSA 3MHEA 2STDA 6STDA 4XDVA 1STDA 2BMQB 1O7HB 1OH0A 5KP4A 3NUVA 1TP6A 3EN8A 3HZPA 3GRDA 3F9SA 3HK4A 1QJGA 1W02A 1QMAA 5CLKA 1C7HA 3KKGA 1Q40B 3H3HA 2HMKB 3K0ZA 2YFIB 5AIIA 2RFRA 2F86B 1JN5A 3FGYA 1OHOA 4H3UA 1OGZA 3MSOA 3UNLA 2XSHB 5IG0A 4XB5A 4ORLA 4K1VA 1E3RA 5D81A 3JUOA 2K54A 5IF6A 3G16A 1S5AA 3JUQA 2R4IA 1VZZA 1ZX2A 2PZVA 3F14A 2B24B 5KP1A 4LGQA 5JPPA 4STDA 2GEYA 4OVMA 1JB4A 3EBTA 4FCJA 4RZMA 4Q53A 5EVHA 3UJMA 5CXOA 5IG5A 5AEWB 5IENA 3NXJA 5AI1A 4X2OA 5HGRA 3NHXA 3ECFA 1GS3A 2BNGA 4IIAA 5D83A 4KVHA 3EF8A 3B4OA 4CDLA 1UUWB 1NDOB 5AEUB 3OXAA 2OWPA 2RGQA 2Z77A 4R9KA 3NV0A 1EG9B 5DRVA 3CNMA 3CNXA 3I0YA 3F7SA 2JQ5A 5IERA 2W2CA 3BB9A 1DMNA 5AIGA 3DM8A 4I4KA 5IG4A 3B8LA 3S5CA 3RGAA 4XBXA 1OHPA 4J8TA 1ULIB 2XRXB 4OUQA 3MG2A 2HMLB 3DXOA 1U5OA 1ISKA 3HX8A 1AR0A 2HMMB 3MYTA 4HVNA 3OWSA 3KZTA 4L8PA 4MJDA 1W00A 5KP3A 5CF1A 3FF0A 3STDA 3VGNA 3LYGA 4HM7B 3F8HA 3FF2A 2XR8B 3RGRA 1A2KA 4N3VA 1W01A 3H51A 4K1UA 3SEDA 2GEXA 1OGXA 5IEOA 1GY5A 3GWRA 1ZO2A 3OWYA 3F8XA 3BLZA 3KE7A 1JN5B 3ROBA 2Z76A 5FW5A 3OV4A 4HM3B 3B4PA 5AIHA 1OF5A 5TGNA 3LZAA 3MG3A 3B7CA 1ULJB 3A76A 4LMIA 2QGUA 3JUMA 1HKXA 1O7GB 1NU3A 2BMOB 2YFLB 4WYKA 4LEHA 1OF5B 3NM2A 2HMOB 4HM8B 3SOAA 1NWWA 1UUVB 2GXFA 1E3VA 1ASKA 4XDWA 3EN1B 3GZXB 3F7XA 2XSOB 4WYKB 2F98A 3EJVA 4HM4B 1JB2A 3K7CA 2RCDA 2CHCA 2B1XB 5DREA 1OUNA 3ER7A 3VSYA
chains in the Genus database with same CATH superfamily
1A2VA 1OCVA 1RN4A 4EV2A 3WA3A 1VQ53 1SJWA 1D6UA 4FCMA 3CPOA 3AHSA 3S29A 3SYUA 3UL6A 1K9M4 4EW5A 3KSPA 3O8YA 4KFDA 3LMLA 4H61A 3U97A 1NB3I 1W6YA 1RJOA 2KF6A 1B2XA 2H0HA 1LQGC 3M8CA 3WHOA 1VQL3 2W6JH 1B3SA 2CFKA 4AKYA 3NV0B 1RSNA 3PCRA 2OCTA 4R1KA 1Y4KA 4I5QA 1BSDA 2J8XB 1LVNA 2GU1A 4XBYA 1Q814 4HM6B 1US1A 1RLSA 1LXEA 1GY7A 1Z1SA 5GSPA 3TDGA 1DETA 1W5ZA 2W9PA 6RNTA 3CC73 1KD14 4DKIA 1RGLA 1K41A 2Z7AA 1CH0A 5BVBA 4EXRA 2QIYA 3FKAA 3SLUA 2W03A 3SOYA 1TJDA 5FGOA 4RNZA 2Z6BA 1GY6A 3VF1A 4HKVB 1Q40A 4KT3B 1RGEA 1O7NB 3MKIA 3E99A 3MG1A 3N8BA 4J5KA 4FMCA 3T8UA 1IT8A 1FGQA 3GZBA 5ELJA 1RNBA 2C10A 2CW9A 4U13A 5EEOA 1VQ63 2F99A 1JBTA 4HBRA 1BNGA 1FUWA 3FZWA 3CPW2 1RHLA 1DVCA 2CKFB 3KSED 4HZ9B 1Q9EA 3V98A 3LT9A 4EBGA 5BIRA 1N8QA 2GBWB 1BRIA 3ALAA 7STDA 3S27A 4ZM8A 1M1XB 3EQQB 1O7PB 4HM2B 1RMSA 1GMQA 1M904 1AY7A 3PZWA 3T8NA 1AVKA 2XGNA 2INXA 2Q07A 3WODG 8RNTA 3V92A 2V1LA 3N9HA 1I2FA 3OWUA 4BL2A 1GOYA 2XFSA 3JUPA 3Q1CA 2F5WA 3X42A 1YIT3 3DZLA 1RGGA 1FYSA 1TUHA 2BMRB 1VQO3 2QEX3 3URPA 3T0UA 3IPTA 3FLJA 4X2HA 4WHAA 1RGHA 3BNDA 3FCSB 1N9JA 2HMJB 1YJN3 1QAFA 5CF2A 3HIGA 5IEPA 3I553 4MMZB 4L7KA 1BSBA 2CWUA 2GU3A 1YVBI 3DUKA 4HZBB 2A15A 5CK6A 4R9LA 3OX9A 1FGOA 2IMJA 2UX0A 3J7Yd 4BIRA 4KFEA 5RNTA 2C11A 2FGTA 1BUQA 2BO9B 3A5EA 1BNIA 4FMBA 1VQN3 3EC9A 4J9AA 2WGOA 1ZGXA 4XM4A 5BU4A 5BXQA 3GZYB 1O7MB 3WMDA 1T5YA 1OHSA 3WDGB 3BU4A 1BNEA 3S28A 2Y74A 2C4BA 3RNTA 2I9WA 4PEJA 1N5HA 2W04A 1UI7A 1DMQA 3D3LA 1DYUA 1PU4A 1TRQA 1TFKA 4WWUC 5STDA 5A0OB 1SIIA 4GB5A 1Q864 3NM7A 4N6OB 5LC7A 2YX9A 1L5GB 1D6ZA 1T2IA 2BIRA 3X41A 2CG1A 1W6CA 3DMCA 5IW9A 3FH1A 5IG3A 2CG0A 3LH4A 1BU4A 1UCKA 3S67A 1VQP3 5LC6A 2IUJA 3FSDA 4TX4A 2XF3A 3G0KA 1FW7A 1RN1A 3F40A 2SBLA 1MGRA 1OPYA 2CFGA 5AIFA 1NB5I 2GBXB 1BNFA 1MNLA 3CU3A 4L8OA 1JKGA 1DMMA 3GZRA 4LSOA 2ZL8A 5AYRB 3G8ZA 3EE1A 3OW22 1IDPA 2HMNB 5AYSC 3JUNA 1IT7A 4HM1B 4BTXA 5EQLA 1WQLB 1SQWA 1M1K4 1CYVA 5G2GA 3Q90A 4GHOA 1GYBA 2CFDA 2W9QA 1KQS2 4GL6A 3D9RA 1W2B2 1JB5A 3EHCA 1EA2A 2YFJB 4HM0B 5D82A 1GMRA 1VQ73 1X1UA 3EBYA 4WP5A 2ZA4A 1O7WB 4N6V0 1B27A 4OK0A 5JPUA 3WOFB 1IV7A 1RRLA 1Q42A 4N6TA 1T3BA 2CIUA 1DVDA 3BIRA 1VQM3 3SXXA 3AMOA 3D5IA 1YJW3 1BAOA 1LOXA 1TRPA 1JKGB 3DH2A 1YGEA 5M1AA 3I563 1PY3A 1IU7A 1BNJA 1X1YA 3DGYA 1BSEA 1OACA 4HJLB 4HM5B 6GSPA 1AQZA 4AEQA 2OQEC 4EYCA 1E97A 8CHOA 4XBTA 2AAEA 3EX9A 4NREA 1GD3A 2FXTA 3RDEA 3NBRA 3G4S3 1HZ1A 1ROAA 1MWSA 1Q7HA 1CQSA 3MHEA 1K8A4 2STDA 6STDA 2UUGC 3CCJ3 1V58A 4XDVA 1STDA 1BRGA 1FUTA 2BMQB 2MC8A 1UCIA 1O7HB 1YJ93 1UW1A 1OH0A 1V57A 3U1WA 3X40A 1IYYA 1EUIC 1RRHA 1VQQA 5KP4A 1I0VA 3WR2A 3NUVA 1PYLA 1SARA 1TP6A 4MEIA 1MWTA 2M7OA 2ML5A 2IY2A 3CCR3 1B2ZA 2F4YA 2L4VA 3EN8A 1VQ93 3HZPA 2W0QA 4NHFA 3GRDA 2BT3A 2XGLA 2CH9A 2F5MA 2K0MA 3F9SA 1I8VA 1QJGA 1UI8A 1QMAA 1W02A 3HK4A 5CLKA 3CCS3 3CMA3 1C7HA 2RNTA 3KKGA 3NQYA 1N5PA 1KC84 1Q40B 3H3HA 2HMKB 3K0ZA 3ZG5A 2P38A 1G0TA 1LOWA 4FMDA 4R80A 4N6MA 2YFIB 1Q824 1HU9A 3NBJA 5AIIA 3EB8A 2E2VA 1UGHI 2F86B 2RFRA 1JN5A 1QVG2 3GSPA 3BNCA 4CJNA 3FGYA 1OHOA 1RDSA 4H3UA 1OGZA 3DGNA 3MSOA 2FNQA 1G96A 2AADA 2KF3A 3UNLA 2XSHB 5IG0A 4MMXB 4XB5A 4ORLA 3LXUX 4KZ1A 4K1VA 2P05A 4K61A 2K3DA 2OOVA 2JDIH 3NQZA 4EC6A 2WGQA 2XFTA 2LYXA 4RNTA 1E3RA 1IQXA 2XH9A 1UCLA 5D81A 2R41A 4HYZA 3JUOA 1JZDA 2K54A 5IF6A 3G16A 1RCKA 2E2UA 2L1SA 1S5AA 2WOHA 1BOXA 3JUQA 2R4IA 1VZZA 1ZX2A 3BNEA 2PZVA 1U8CB 3F14A 2B24B 5KP1A 4LGQA 4N6NB 3Q2PA 4LZIA 1UCJA 1BVIA 2CC3A 4HOHA 4STDA 5JPPA 1BANA 2GEYA 1IV9A 4OVMA 1BNSA 1JB4A 1TFOA 3EBTA 3FG4A 4BU4A 1Q7Y4 1PFPA 4FCJA 1AVLA 3K9MC 4FCZA 1RGCA 3SVAA 1WMNA 1NO3A 5M18A 1G02A 4RZMA 4Q53A 5EVHA 2BHMA 4HAAA 1BSAA 5CXOA 3UJMA 3K63A 4RBNA 4O8SA 1FZUA 5IG5A 1QVF2 2IA7A 3JVCA 3QK9A 5AEWB 2ZDJA 5IENA 1MWUA 3DY5A 3CC43 3NXJA 1IQ8A 1GOVA 1R4YA 5AI1A 3GAXA 2SARA 4X2OA 1N8R4 3CCL3 1MWRA 3MWZA 1JV2B 5HGRA 1I70A 1IK3A 2MF7A 2W56A 1ZS7A 1TIJA 1W7CA 3NHXA 1BRKA 1S723 3VSYA 3ECFA 3KIIA 1GS3A 2BNGA 1LOYA 9RNTA 1VQK3 4IIAA 1VQ83 1EQKA 5D83A 1GD4A 4KVHA 3D4AA 3EF8A 2KF5A 1RTUA 3B4OA 3NX0A 4CDLA 1UUWB 4GSPA 1UDII 1NDOB 1GSPA 4CPKA 3OXAA 5AEUB 1A67A 1F8NA 2OWPA 1BSCA 2GSPA 2W56B 1KSIA 2P09A 1EKMA 1J2BA 1YHQ3 3D5GA 4O02B 3G6E3 3KFQC 4FR9A 1K734 2BU4A 3CC23 2RGQA 2Z77A 1IQYA 4R9KA 1W4NA 3CD63 1TU5A 2D1WA 1YIJ3 1SPUA 1EG9B 3NV0A 5DRVA 2RSXA 3CNMA 4BL3A 1UGIA 3CME3 1YI23 1NJI4 3CNXA 3I0YA 3F7SA 2JQ5A 2HOHA 4JF8A 3X3ZA 1T2HA 1W6GA 2W2CA 1QALA 5IERA 1IVVA 2CFLA 2CFWA 3BB9A 1DMNA 3AMOB 4O2HA 5AIGA 3DM8A 5JBSA 3LOYA 1A90A 1CYUA 2RBIA 3AHWA 3DGOA 3QRDA 4I4KA 1W2ZA 5IG4A 3B8LA 3S5CA 3SX1A 3RGAA 3BNBA 2PNCA 4K90B 4XBXA 4BTYA 1QAKA 2O3OA 1OHPA 4J8TA 1ULIB 3AGOA 3PYJA 2OTJ3 4RNYA 2XRXB 1MOLA 3MG2A 4OUQA 5ELUA 1BRJA 2ZHXB 3CCQ3 2HMLB 2LQVA 3WOEB 1D6YA 4R4KA 5G1LA 3DXOA 2KAAA 4J5GA 1U5OA 7RNTA 2E2TA 3HIIA 4NPBA 1GMPA 3PGBA 5M19A 2OTL3 1I2EA 1I2GA 1RNTA 3HX8A 1AR0A 1ISKA 2HMMB 2WOFA 3KCHA 2CK3H 3MYTA 1SIHA 4HVNA 4N6UA 1HYFA 3OWSA 4O3VA 3CCV3 1BRSA 3KZTA 3D79A 4L8PA 1CEWI 1LRAA 4WFOA 1RN7A 4MJDA 3DGMA 2CX1A 1LOVA 1W00A 1NNVA 2CX0A 2CWTA 2ML6A 1YVSA 5KP3A 5CF1A 1BRHA 1M9GA 1YNVX 3MPHA 1X1WA 1R4CA 3FF0A 3PCSA 3STDA 1RGAA 3VGNA 3LYGA 1FGRA 1RGKA 1UUGB 3LT8A 3F8HA 4HM7B 3FF2A 3ZG0A 1WMPA 1B2SA 1FGMA 2XR8B 5I97A 3N54B 3RGRA 1I0XA 1WTHA 1A2KA 1MGWA 4N3VA 1W01A 3H51A 4K1UA 3SEDA 3CCU3 2GEXA 1YGWA 1N9EA 1OGXA 5IEOA 1GY5A 3HOHA 3KN4A 1DE3A 3GWRA 1ZO2A 4G1MB 3OWYA 3F8XA 3BLZA 3KE7A 1JN5B 3FG1A 3ROBA 2Z76A 1FA3A 5FW5A 3NBBA 4N6LA 3ZFZA 3OV4A 3AGNA 1BGSA 2KF4A 1TTOA 1LNIA 1RCLA 4HM3B 3LTBA 3B4PA 4LYLB 5AIHA 1AV4A 1B2UA 1LNHA 2O9UX 1OF5A 2P0MA 3DGLA 3G713 3HI7A 3IMAB 4KFFA 3X3YA 1JJ22 5TGNA 1WMOA 1X1XA 3LZAA 3MG3A 1FGTA 3B7CA 1ULJB 2Y73A 1JNQA 3A76A 1B2MA 4IPBA 4LMIA 3UL5A 1K28A 2QGUA 3JUMA 7GSPA 1HKXA 4IT7A 1BNRA 3WA2X 4FMAA 1KWIA 1O7GB 2QA43 1NU3A 2BMOB 2YFLB 4WYKA 1FUSA 3K5TA 4LEHA 2IUKA 1OF5B 3NM2A 2HMOB 2CWVA 4HM8B 2OQEA 3LTDA 3SOAA 1NWWA 2D42A 1RKYA 2KCDA 4JRFA 1STFI 1UUVB 2GXFA 5HOHA 3LTAA 2OOVC 5G1KA 1JZOA 1JBRA 4BTWA 1E3VA 3LTCA 1ASKA 2KRTA 4XDWA 2XEPA 3L0RA 1B20A 1BUJA 3UB1A 3V99A 3CXC2 3EN1B 1BIRA 3GZXB 2H0GA 1WNHA 1GOUA 2H0IA 1IVXA 3F7XA 2XSOB 4WYKB 1C54A 2F98A 3EJVA 1ROVA 1IVWA 2KXGA 4HM4B 4CCVA 4QWTA 1JB2A 1I3FA 4AKZA 3K7CA 2RCDA 4MMYB 3IJEB 3FG3A 2IYJA 2WO0A 3CCE3 3PS8A 2CHCA 1BRNL 2B1XB 3X3XA 1A2PA 1LQMB 5DREA 1JBSA 1JRQA 3PXMA 2F56A 1OUNA 2UGIA 3ER7A 1I3IA 4EV5A 3CCM3 1IVUA 1B21A 1V74A 1VQ43 3Q3FA 4ILFA 2P0XA 1EEJA 1RGFA
chains in the Genus database with same CATH topology
1A2VA 1OCVA 4EV2A 3WA3A 1VQ53 1SJWA 1D6UA 4FCMA 3CPOA 3S29A 3UL6A 1K9M4 3KSPA 3O8YA 4KFDA 3LMLA 4H61A 3U97A 1NB3I 1W6YA 1RJOA 3M8CA 1VQL3 2W6JH 2CFKA 4AKYA 3NV0B 3PCRA 2OCTA 4R1KA 1Y4KA 1LVNA 2GU1A 4XBYA 1Q814 4HM6B 1US1A 1LXEA 1GY7A 1Z1SA 3TDGA 1W5ZA 2W9PA 3CC73 1KD14 5BVBA 1K41A 2Z7AA 4EXRA 2QIYA 3FKAA 3SLUA 2W03A 3SOYA 5FGOA 4RNZA 2Z6BA 1GY6A 3VF1A 4HKVB 1Q40A 1O7NB 3MKIA 3E99A 3MG1A 3N8BA 3T8UA 4FMCA 1IT8A 1FGQA 3GZBA 5ELJA 2C10A 2CW9A 4U13A 5EEOA 1VQ63 2F99A 4HBRA 1FUWA 3FZWA 3CPW2 2CKFB 1DVCA 3KSED 4HZ9B 3V98A 4EBGA 3LT9A 1N8QA 2GBWB 3ALAA 7STDA 3S27A 4ZM8A 1M1XB 3EQQB 1O7PB 4HM2B 1M904 3PZWA 3T8NA 1AVKA 2XGNA 2INXA 2Q07A 3WODG 3V92A 2V1LA 3N9HA 3OWUA 2XFSA 3JUPA 3Q1CA 3X42A 1YIT3 3DZLA 1TUHA 2BMRB 1VQO3 2QEX3 3T0UA 3IPTA 3FLJA 4X2HA 4WHAA 3BNDA 3FCSB 1N9JA 2HMJB 1YJN3 1QAFA 5CF2A 3HIGA 5IEPA 3I553 4MMZB 4L7KA 2CWUA 2GU3A 1YVBI 3DUKA 4HZBB 2A15A 5CK6A 4R9LA 3OX9A 1FGOA 2IMJA 2UX0A 3J7Yd 4KFEA 2C11A 2FGTA 1BUQA 2BO9B 4FMBA 1VQN3 3EC9A 4J9AA 2WGOA 4XM4A 5BXQA 3GZYB 1O7MB 3WMDA 1T5YA 1OHSA 3WDGB 3S28A 2Y74A 2I9WA 4PEJA 1N5HA 2W04A 1UI7A 1DMQA 3D3LA 1DYUA 1PU4A 4WWUC 1TFKA 5STDA 5A0OB 1Q864 1SIIA 4GB5A 3NM7A 4N6OB 5LC7A 2YX9A 1L5GB 1D6ZA 3X41A 2CG1A 1W6CA 3DMCA 5IW9A 3FH1A 5IG3A 2CG0A 3LH4A 1VQP3 3S67A 5LC6A 2IUJA 3FSDA 4TX4A 2XF3A 3G0KA 3F40A 2SBLA 1OPYA 2CFGA 5AIFA 1NB5I 2GBXB 1MNLA 3CU3A 4L8OA 1JKGA 1DMMA 3GZRA 4LSOA 2ZL8A 5AYRB 3G8ZA 3EE1A 3OW22 1IDPA 2HMNB 5AYSC 3JUNA 1IT7A 4HM1B 4BTXA 5EQLA 1WQLB 1SQWA 1M1K4 1CYVA 5G2GA 3Q90A 1GYBA 2CFDA 2W9QA 1KQS2 4GL6A 3D9RA 1W2B2 1JB5A 3EHCA 1EA2A 2YFJB 4HM0B 5D82A 1VQ73 3EBYA 4WP5A 1O7WB 4N6V0 5JPUA 4OK0A 3WOFB 1IV7A 1RRLA 1Q42A 4N6TA 2CIUA 1DVDA 1VQM3 3SXXA 3AMOA 1YJW3 1LOXA 1JKGB 1YGEA 3I563 1IU7A 4HJLB 1OACA 4HM5B 4AEQA 2OQEC 4EYCA 1E97A 8CHOA 4XBTA 3EX9A 4NREA 1GD3A 2FXTA 3RDEA 3NBRA 3G4S3 1ROAA 1CQSA 3MHEA 1K8A4 2STDA 6STDA 3CCJ3 4XDVA 1STDA 2BMQB 2MC8A 1O7HB 1YJ93 1UW1A 1OH0A 3U1WA 3X40A 1RRHA 5KP4A 3NUVA 1TP6A 4MEIA 2M7OA 2ML5A 3CCR3 2L4VA 3EN8A 1VQ93 3HZPA 2W0QA 4NHFA 3GRDA 2BT3A 2XGLA 2CH9A 2K0MA 3F9SA 1UI8A 1QJGA 1W02A 1QMAA 3HK4A 5CLKA 3CCS3 3CMA3 1C7HA 3KKGA 3NQYA 1N5PA 1KC84 1Q40B 3H3HA 2HMKB 3K0ZA 2P38A 4R80A 4FMDA 4N6MA 2YFIB 1Q824 1HU9A 3NBJA 5AIIA 3EB8A 2E2VA 2RFRA 2F86B 1QVG2 1JN5A 3BNCA 3FGYA 1OHOA 4H3UA 1OGZA 3DGNA 3MSOA 2FNQA 1G96A 3UNLA 2XSHB 5IG0A 4MMXB 4XB5A 4ORLA 3LXUX 4KZ1A 4K1VA 2P05A 4K61A 2OOVA 2JDIH 3NQZA 4EC6A 2WGQA 2XFTA 2LYXA 1E3RA 1IQXA 2XH9A 5D81A 4HYZA 3JUOA 2K54A 5IF6A 3G16A 2E2UA 1S5AA 2WOHA 3JUQA 2R4IA 1VZZA 1ZX2A 3BNEA 2PZVA 1U8CB 3F14A 2B24B 5KP1A 4LGQA 4N6NB 3Q2PA 4LZIA 2CC3A 4STDA 5JPPA 2GEYA 1IV9A 4OVMA 1JB4A 1TFOA 3EBTA 3FG4A 1Q7Y4 1PFPA 4FCJA 1AVLA 3K9MC 4FCZA 3SVAA 1WMNA 1NO3A 4RZMA 4Q53A 5EVHA 2BHMA 5CXOA 3UJMA 3K63A 4RBNA 4O8SA 5IG5A 1QVF2 2IA7A 3JVCA 3QK9A 5AEWB 2ZDJA 5IENA 3DY5A 3NXJA 1IQ8A 5AI1A 1N8R4 3GAXA 4X2OA 3CCL3 3MWZA 1JV2B 5HGRA 1IK3A 2MF7A 2W56A 3NHXA 1TIJA 1W7CA 1S723 3VSYA 3ECFA 3KIIA 1GS3A 2BNGA 1VQK3 4IIAA 1VQ83 1EQKA 5D83A 1GD4A 4KVHA 3EF8A 3B4OA 3NX0A 4CDLA 1UUWB 1NDOB 5AEUB 3OXAA 1A67A 1F8NA 2OWPA 2W56B 1KSIA 2P09A 1EKMA 1J2BA 1YHQ3 4O02B 3G6E3 3KFQC 4FR9A 1K734 3CC23 2RGQA 2Z77A 1IQYA 4R9KA 1W4NA 3CD63 1TU5A 2D1WA 1YIJ3 1SPUA 1EG9B 3NV0A 5DRVA 2RSXA 3CNMA 3CME3 1YI23 1NJI4 3CNXA 3I0YA 3F7SA 2JQ5A 4JF8A 3X3ZA 1W6GA 5IERA 2W2CA 1QALA 1IVVA 2CFLA 2CFWA 3BB9A 1DMNA 3AMOB 4O2HA 5AIGA 3DM8A 5JBSA 3LOYA 1A90A 1CYUA 3DGOA 3QRDA 4I4KA 1W2ZA 5IG4A 3B8LA 3S5CA 3SX1A 3RGAA 3BNBA 2PNCA 4K90B 4XBXA 4BTYA 1QAKA 2O3OA 1OHPA 4J8TA 1ULIB 3PYJA 2OTJ3 4RNYA 2XRXB 1MOLA 3MG2A 4OUQA 5ELUA 3CCQ3 2HMLB 2LQVA 3WOEB 1D6YA 4R4KA 3DXOA 1U5OA 2E2TA 3HIIA 3PGBA 2OTL3 1ISKA 3HX8A 1AR0A 2HMMB 2WOFA 3MYTA 2CK3H 4N6UA 1SIHA 4HVNA 3OWSA 4O3VA 3CCV3 3KZTA 4L8PA 1CEWI 4WFOA 1RN7A 4MJDA 3DGMA 1W00A 2CWTA 2ML6A 5KP3A 5CF1A 1M9GA 3MPHA 3PCSA 1R4CA 3FF0A 3STDA 3VGNA 3LYGA 1FGRA 4HM7B 3LT8A 3F8HA 3FF2A 1WMPA 1FGMA 2XR8B 5I97A 3N54B 3RGRA 1WTHA 1A2KA 4N3VA 1W01A 3H51A 4K1UA 3SEDA 3CCU3 2GEXA 1N9EA 1OGXA 5IEOA 1GY5A 3KN4A 3GWRA 1ZO2A 4G1MB 3OWYA 3F8XA 3BLZA 3KE7A 1JN5B 3FG1A 3ROBA 2Z76A 1FA3A 5FW5A 3NBBA 4N6LA 3OV4A 4HM3B 3LTBA 3B4PA 5AIHA 1LNHA 1AV4A 2O9UX 3DGLA 1OF5A 2P0MA 3G713 3HI7A 3IMAB 4KFFA 3X3YA 1JJ22 5TGNA 1WMOA 3LZAA 3MG3A 1FGTA 3B7CA 1ULJB 2Y73A 1JNQA 3A76A 4IPBA 4LMIA 3UL5A 1K28A 2QGUA 3JUMA 1HKXA 4IT7A 3WA2X 4FMAA 1KWIA 1O7GB 2QA43 1NU3A 2BMOB 2YFLB 4WYKA 3K5TA 4LEHA 2IUKA 1OF5B 3NM2A 2HMOB 2CWVA 4HM8B 2OQEA 3LTDA 3SOAA 1NWWA 2D42A 1RKYA 2KCDA 4JRFA 1STFI 1UUVB 2GXFA 3LTAA 2OOVC 4BTWA 1E3VA 3LTCA 1ASKA 2KRTA 4XDWA 2XEPA 3L0RA 3UB1A 3V99A 3CXC2 3EN1B 3GZXB 1WNHA 1IVXA 3F7XA 2XSOB 4WYKB 2F98A 3EJVA 1ROVA 1IVWA 2KXGA 4HM4B 4CCVA 4QWTA 1JB2A 3K7CA 2RCDA 4MMYB 3IJEB 3FG3A 2WO0A 3CCE3 3PS8A 2CHCA 2B1XB 3X3XA 5DREA 1JRQA 3PXMA 1OUNA 3ER7A 4EV5A 3CCM3 1IVUA 1V74A 1VQ43 2P0XA 3CC43 4AKZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OCV A;  1SJW A;  4FCM A;  3CPO A;  3KSP A;  1W6Y A;  3M8C A;  3NV0 B;  4R1K A;  4XBY A;  4HM6 B;  1Z1S A;  1GY7 A;  5BVB A;  1K41 A;  2Z7A A;  2QIY A;  3FKA A;  3SOY A;  1GY6 A;  4HKV B;  1Q40 A;  1O7N B;  3MKI A;  3E99 A;  3T8U A;  3MG1 A;  3GZB A;  4U13 A;  2F99 A;  3FZW A;  2CKF B;  4HZ9 B;  2GBW B;  7STD A;  3EQQ B;  1O7P B;  4HM2 B;  3T8N A;  2INX A;  3OWU A;  3JUP A;  3DZL A;  1TUH A;  2BMR B;  3IPT A;  3FLJ A;  4X2H A;  2HMJ B;  5CF2 A;  5IEP A;  4L7K A;  4HZB B;  3DUK A;  5CK6 A;  2A15 A;  4R9L A;  3OX9 A;  2IMJ A;  2UX0 A;  1BUQ A;  3EC9 A;  4J9A A;  4XM4 A;  5BXQ A;  3GZY B;  1O7M B;  3WMD A;  1OHS A;  2I9W A;  4PEJ A;  1DMQ A;  4WWU C;  5STD A;  4GB5 A;  3DMC A;  3FH1 A;  5IG3 A;  3FSD A;  3G0K A;  3F40 A;  1OPY A;  5AIF A;  2GBX B;  3CU3 A;  4L8O A;  1JKG A;  1DMM A;  3GZR A;  3G8Z A;  1IDP A;  2HMN B;  3JUN A;  4HM1 B;  1WQL B;  5G2G A;  3Q90 A;  1GYB A;  3D9R A;  1JB5 A;  3EHC A;  1EA2 A;  2YFJ B;  4HM0 B;  5D82 A;  3EBY A;  4WP5 A;  1O7W B;  5JPU A;  1Q42 A;  1JKG B;  4HJL B;  4HM5 B;  1E97 A;  8CHO A;  4XBT A;  3EX9 A;  3NBR A;  1CQS A;  3MHE A;  2STD A;  6STD A;  4XDV A;  1STD A;  2BMQ B;  1O7H B;  1OH0 A;  5KP4 A;  3NUV A;  1TP6 A;  3EN8 A;  3HZP A;  3GRD A;  3F9S A;  3HK4 A;  1QJG A;  1W02 A;  1QMA A;  5CLK A;  1C7H A;  3KKG A;  1Q40 B;  3H3H A;  2HMK B;  3K0Z A;  2YFI B;  5AII A;  2RFR A;  2F86 B;  1JN5 A;  3FGY A;  1OHO A;  4H3U A;  1OGZ A;  3MSO A;  3UNL A;  2XSH B;  5IG0 A;  4XB5 A;  4ORL A;  4K1V A;  1E3R A;  5D81 A;  3JUO A;  2K54 A;  5IF6 A;  3G16 A;  1S5A A;  3JUQ A;  2R4I A;  1VZZ A;  1ZX2 A;  2PZV A;  3F14 A;  2B24 B;  5KP1 A;  4LGQ A;  5JPP A;  4STD A;  2GEY A;  4OVM A;  1JB4 A;  3EBT A;  4FCJ A;  4RZM A;  4Q53 A;  5EVH A;  3UJM A;  5CXO A;  5IG5 A;  5AEW B;  5IEN A;  3NXJ A;  5AI1 A;  4X2O A;  5HGR A;  3NHX A;  3ECF A;  1GS3 A;  2BNG A;  4IIA A;  5D83 A;  4KVH A;  3EF8 A;  3B4O A;  4CDL A;  1UUW B;  1NDO B;  5AEU B;  3OXA A;  2OWP A;  2RGQ A;  2Z77 A;  4R9K A;  3NV0 A;  1EG9 B;  5DRV A;  3CNM A;  3CNX A;  3I0Y A;  3F7S A;  2JQ5 A;  5IER A;  2W2C A;  3BB9 A;  1DMN A;  5AIG A;  3DM8 A;  4I4K A;  5IG4 A;  3B8L A;  3S5C A;  3RGA A;  4XBX A;  1OHP A;  4J8T A;  1ULI B;  2XRX B;  4OUQ A;  3MG2 A;  2HML B;  3DXO A;  1U5O A;  1ISK A;  3HX8 A;  1AR0 A;  2HMM B;  3MYT A;  4HVN A;  3OWS A;  3KZT A;  4L8P A;  4MJD A;  1W00 A;  5KP3 A;  5CF1 A;  3FF0 A;  3STD A;  3VGN A;  3LYG A;  4HM7 B;  3F8H A;  3FF2 A;  2XR8 B;  3RGR A;  1A2K A;  4N3V A;  1W01 A;  3H51 A;  4K1U A;  3SED A;  2GEX A;  1OGX A;  5IEO A;  1GY5 A;  3GWR A;  1ZO2 A;  3OWY A;  3F8X A;  3BLZ A;  3KE7 A;  1JN5 B;  3ROB A;  2Z76 A;  5FW5 A;  3OV4 A;  4HM3 B;  3B4P A;  5AIH A;  1OF5 A;  5TGN A;  3LZA A;  3MG3 A;  3B7C A;  1ULJ B;  3A76 A;  4LMI A;  2QGU A;  3JUM A;  1HKX A;  1O7G B;  1NU3 A;  2BMO B;  2YFL B;  4WYK A;  4LEH A;  1OF5 B;  3NM2 A;  2HMO B;  4HM8 B;  3SOA A;  1NWW A;  1UUV B;  2GXF A;  1E3V A;  1ASK A;  4XDW A;  3EN1 B;  3GZX B;  3F7X A;  2XSO B;  4WYK B;  2F98 A;  3EJV A;  4HM4 B;  1JB2 A;  3K7C A;  2RCD A;  2CHC A;  2B1X B;  5DRE A;  1OUN A;  3ER7 A;  3VSY A; 
#chains in the Genus database with same CATH topology
 1A2V A;  1OCV A;  1RN4 A;  4EV2 A;  3WA3 A;  1VQ5 3;  1SJW A;  1D6U A;  4FCM A;  3CPO A;  3AHS A;  3S29 A;  3SYU A;  3UL6 A;  1K9M 4;  4EW5 A;  3KSP A;  3O8Y A;  4KFD A;  3LML A;  4H61 A;  3U97 A;  1NB3 I;  1W6Y A;  1RJO A;  2KF6 A;  1B2X A;  2H0H A;  1LQG C;  3M8C A;  3WHO A;  1VQL 3;  2W6J H;  1B3S A;  2CFK A;  4AKY A;  3NV0 B;  1RSN A;  3PCR A;  2OCT A;  4R1K A;  1Y4K A;  4I5Q A;  1BSD A;  2J8X B;  1LVN A;  2GU1 A;  4XBY A;  1Q81 4;  4HM6 B;  1US1 A;  1RLS A;  1LXE A;  1GY7 A;  1Z1S A;  5GSP A;  3TDG A;  1DET A;  1W5Z A;  2W9P A;  6RNT A;  3CC7 3;  1KD1 4;  4DKI A;  1RGL A;  1K41 A;  2Z7A A;  1CH0 A;  5BVB A;  4EXR A;  2QIY A;  3FKA A;  3SLU A;  2W03 A;  3SOY A;  1TJD A;  5FGO A;  4RNZ A;  2Z6B A;  1GY6 A;  3VF1 A;  4HKV B;  1Q40 A;  4KT3 B;  1RGE A;  1O7N B;  3MKI A;  3E99 A;  3MG1 A;  3N8B A;  4J5K A;  4FMC A;  3T8U A;  1IT8 A;  1FGQ A;  3GZB A;  5ELJ A;  1RNB A;  2C10 A;  2CW9 A;  4U13 A;  5EEO A;  1VQ6 3;  2F99 A;  1JBT A;  4HBR A;  1BNG A;  1FUW A;  3FZW A;  3CPW 2;  1RHL A;  1DVC A;  2CKF B;  3KSE D;  4HZ9 B;  1Q9E A;  3V98 A;  3LT9 A;  4EBG A;  5BIR A;  1N8Q A;  2GBW B;  1BRI A;  3ALA A;  7STD A;  3S27 A;  4ZM8 A;  1M1X B;  3EQQ B;  1O7P B;  4HM2 B;  1RMS A;  1GMQ A;  1M90 4;  1AY7 A;  3PZW A;  3T8N A;  1AVK A;  2XGN A;  2INX A;  2Q07 A;  3WOD G;  8RNT A;  3V92 A;  2V1L A;  3N9H A;  1I2F A;  3OWU A;  4BL2 A;  1GOY A;  2XFS A;  3JUP A;  3Q1C A;  2F5W A;  3X42 A;  1YIT 3;  3DZL A;  1RGG A;  1FYS A;  1TUH A;  2BMR B;  1VQO 3;  2QEX 3;  3URP A;  3T0U A;  3IPT A;  3FLJ A;  4X2H A;  4WHA A;  1RGH A;  3BND A;  3FCS B;  1N9J A;  2HMJ B;  1YJN 3;  1QAF A;  5CF2 A;  3HIG A;  5IEP A;  3I55 3;  4MMZ B;  4L7K A;  1BSB A;  2CWU A;  2GU3 A;  1YVB I;  3DUK A;  4HZB B;  2A15 A;  5CK6 A;  4R9L A;  3OX9 A;  1FGO A;  2IMJ A;  2UX0 A;  3J7Y d;  4BIR A;  4KFE A;  5RNT A;  2C11 A;  2FGT A;  1BUQ A;  2BO9 B;  3A5E A;  1BNI A;  4FMB A;  1VQN 3;  3EC9 A;  4J9A A;  2WGO A;  1ZGX A;  4XM4 A;  5BU4 A;  5BXQ A;  3GZY B;  1O7M B;  3WMD A;  1T5Y A;  1OHS A;  3WDG B;  3BU4 A;  1BNE A;  3S28 A;  2Y74 A;  2C4B A;  3RNT A;  2I9W A;  4PEJ A;  1N5H A;  2W04 A;  1UI7 A;  1DMQ A;  3D3L A;  1DYU A;  1PU4 A;  1TRQ A;  1TFK A;  4WWU C;  5STD A;  5A0O B;  1SII A;  4GB5 A;  1Q86 4;  3NM7 A;  4N6O B;  5LC7 A;  2YX9 A;  1L5G B;  1D6Z A;  1T2I A;  2BIR A;  3X41 A;  2CG1 A;  1W6C A;  3DMC A;  5IW9 A;  3FH1 A;  5IG3 A;  2CG0 A;  3LH4 A;  1BU4 A;  1UCK A;  3S67 A;  1VQP 3;  5LC6 A;  2IUJ A;  3FSD A;  4TX4 A;  2XF3 A;  3G0K A;  1FW7 A;  1RN1 A;  3F40 A;  2SBL A;  1MGR A;  1OPY A;  2CFG A;  5AIF A;  1NB5 I;  2GBX B;  1BNF A;  1MNL A;  3CU3 A;  4L8O A;  1JKG A;  1DMM A;  3GZR A;  4LSO A;  2ZL8 A;  5AYR B;  3G8Z A;  3EE1 A;  3OW2 2;  1IDP A;  2HMN B;  5AYS C;  3JUN A;  1IT7 A;  4HM1 B;  4BTX A;  5EQL A;  1WQL B;  1SQW A;  1M1K 4;  1CYV A;  5G2G A;  3Q90 A;  4GHO A;  1GYB A;  2CFD A;  2W9Q A;  1KQS 2;  4GL6 A;  3D9R A;  1W2B 2;  1JB5 A;  3EHC A;  1EA2 A;  2YFJ B;  4HM0 B;  5D82 A;  1GMR A;  1VQ7 3;  1X1U A;  3EBY A;  4WP5 A;  2ZA4 A;  1O7W B;  4N6V 0;  1B27 A;  4OK0 A;  5JPU A;  3WOF B;  1IV7 A;  1RRL A;  1Q42 A;  4N6T A;  1T3B A;  2CIU A;  1DVD A;  3BIR A;  1VQM 3;  3SXX A;  3AMO A;  3D5I A;  1YJW 3;  1BAO A;  1LOX A;  1TRP A;  1JKG B;  3DH2 A;  1YGE A;  5M1A A;  3I56 3;  1PY3 A;  1IU7 A;  1BNJ A;  1X1Y A;  3DGY A;  1BSE A;  1OAC A;  4HJL B;  4HM5 B;  6GSP A;  1AQZ A;  4AEQ A;  2OQE C;  4EYC A;  1E97 A;  8CHO A;  4XBT A;  2AAE A;  3EX9 A;  4NRE A;  1GD3 A;  2FXT A;  3RDE A;  3NBR A;  3G4S 3;  1HZ1 A;  1ROA A;  1MWS A;  1Q7H A;  1CQS A;  3MHE A;  1K8A 4;  2STD A;  6STD A;  2UUG C;  3CCJ 3;  1V58 A;  4XDV A;  1STD A;  1BRG A;  1FUT A;  2BMQ B;  2MC8 A;  1UCI A;  1O7H B;  1YJ9 3;  1UW1 A;  1OH0 A;  1V57 A;  3U1W A;  3X40 A;  1IYY A;  1EUI C;  1RRH A;  1VQQ A;  5KP4 A;  1I0V A;  3WR2 A;  3NUV A;  1PYL A;  1SAR A;  1TP6 A;  4MEI A;  1MWT A;  2M7O A;  2ML5 A;  2IY2 A;  3CCR 3;  1B2Z A;  2F4Y A;  2L4V A;  3EN8 A;  1VQ9 3;  3HZP A;  2W0Q A;  4NHF A;  3GRD A;  2BT3 A;  2XGL A;  2CH9 A;  2F5M A;  2K0M A;  3F9S A;  1I8V A;  1QJG A;  1UI8 A;  1QMA A;  1W02 A;  3HK4 A;  5CLK A;  3CCS 3;  3CMA 3;  1C7H A;  2RNT A;  3KKG A;  3NQY A;  1N5P A;  1KC8 4;  1Q40 B;  3H3H A;  2HMK B;  3K0Z A;  3ZG5 A;  2P38 A;  1G0T A;  1LOW A;  4FMD A;  4R80 A;  4N6M A;  2YFI B;  1Q82 4;  1HU9 A;  3NBJ A;  5AII A;  3EB8 A;  2E2V A;  1UGH I;  2F86 B;  2RFR A;  1JN5 A;  1QVG 2;  3GSP A;  3BNC A;  4CJN A;  3FGY A;  1OHO A;  1RDS A;  4H3U A;  1OGZ A;  3DGN A;  3MSO A;  2FNQ A;  1G96 A;  2AAD A;  2KF3 A;  3UNL A;  2XSH B;  5IG0 A;  4MMX B;  4XB5 A;  4ORL A;  3LXU X;  4KZ1 A;  4K1V A;  2P05 A;  4K61 A;  2K3D A;  2OOV A;  2JDI H;  3NQZ A;  4EC6 A;  2WGQ A;  2XFT A;  2LYX A;  4RNT A;  1E3R A;  1IQX A;  2XH9 A;  1UCL A;  5D81 A;  2R41 A;  4HYZ A;  3JUO A;  1JZD A;  2K54 A;  5IF6 A;  3G16 A;  1RCK A;  2E2U A;  2L1S A;  1S5A A;  2WOH A;  1BOX A;  3JUQ A;  2R4I A;  1VZZ A;  1ZX2 A;  3BNE A;  2PZV A;  1U8C B;  3F14 A;  2B24 B;  5KP1 A;  4LGQ A;  4N6N B;  3Q2P A;  4LZI A;  1UCJ A;  1BVI A;  2CC3 A;  4HOH A;  4STD A;  5JPP A;  1BAN A;  2GEY A;  1IV9 A;  4OVM A;  1BNS A;  1JB4 A;  1TFO A;  3EBT A;  3FG4 A;  4BU4 A;  1Q7Y 4;  1PFP A;  4FCJ A;  1AVL A;  3K9M C;  4FCZ A;  1RGC A;  3SVA A;  1WMN A;  1NO3 A;  5M18 A;  1G02 A;  4RZM A;  4Q53 A;  5EVH A;  2BHM A;  4HAA A;  1BSA A;  5CXO A;  3UJM A;  3K63 A;  4RBN A;  4O8S A;  1FZU A;  5IG5 A;  1QVF 2;  2IA7 A;  3JVC A;  3QK9 A;  5AEW B;  2ZDJ A;  5IEN A;  1MWU A;  3DY5 A;  3CC4 3;  3NXJ A;  1IQ8 A;  1GOV A;  1R4Y A;  5AI1 A;  3GAX A;  2SAR A;  4X2O A;  1N8R 4;  3CCL 3;  1MWR A;  3MWZ A;  1JV2 B;  5HGR A;  1I70 A;  1IK3 A;  2MF7 A;  2W56 A;  1ZS7 A;  1TIJ A;  1W7C A;  3NHX A;  1BRK A;  1S72 3;  3VSY A;  3ECF A;  3KII A;  1GS3 A;  2BNG A;  1LOY A;  9RNT A;  1VQK 3;  4IIA A;  1VQ8 3;  1EQK A;  5D83 A;  1GD4 A;  4KVH A;  3D4A A;  3EF8 A;  2KF5 A;  1RTU A;  3B4O A;  3NX0 A;  4CDL A;  1UUW B;  4GSP A;  1UDI I;  1NDO B;  1GSP A;  4CPK A;  3OXA A;  5AEU B;  1A67 A;  1F8N A;  2OWP A;  1BSC A;  2GSP A;  2W56 B;  1KSI A;  2P09 A;  1EKM A;  1J2B A;  1YHQ 3;  3D5G A;  4O02 B;  3G6E 3;  3KFQ C;  4FR9 A;  1K73 4;  2BU4 A;  3CC2 3;  2RGQ A;  2Z77 A;  1IQY A;  4R9K A;  1W4N A;  3CD6 3;  1TU5 A;  2D1W A;  1YIJ 3;  1SPU A;  1EG9 B;  3NV0 A;  5DRV A;  2RSX A;  3CNM A;  4BL3 A;  1UGI A;  3CME 3;  1YI2 3;  1NJI 4;  3CNX A;  3I0Y A;  3F7S A;  2JQ5 A;  2HOH A;  4JF8 A;  3X3Z A;  1T2H A;  1W6G A;  2W2C A;  1QAL A;  5IER A;  1IVV A;  2CFL A;  2CFW A;  3BB9 A;  1DMN A;  3AMO B;  4O2H A;  5AIG A;  3DM8 A;  5JBS A;  3LOY A;  1A90 A;  1CYU A;  2RBI A;  3AHW A;  3DGO A;  3QRD A;  4I4K A;  1W2Z A;  5IG4 A;  3B8L A;  3S5C A;  3SX1 A;  3RGA A;  3BNB A;  2PNC A;  4K90 B;  4XBX A;  4BTY A;  1QAK A;  2O3O A;  1OHP A;  4J8T A;  1ULI B;  3AGO A;  3PYJ A;  2OTJ 3;  4RNY A;  2XRX B;  1MOL A;  3MG2 A;  4OUQ A;  5ELU A;  1BRJ A;  2ZHX B;  3CCQ 3;  2HML B;  2LQV A;  3WOE B;  1D6Y A;  4R4K A;  5G1L A;  3DXO A;  2KAA A;  4J5G A;  1U5O A;  7RNT A;  2E2T A;  3HII A;  4NPB A;  1GMP A;  3PGB A;  5M19 A;  2OTL 3;  1I2E A;  1I2G A;  1RNT A;  3HX8 A;  1AR0 A;  1ISK A;  2HMM B;  2WOF A;  3KCH A;  2CK3 H;  3MYT A;  1SIH A;  4HVN A;  4N6U A;  1HYF A;  3OWS A;  4O3V A;  3CCV 3;  1BRS A;  3KZT A;  3D79 A;  4L8P A;  1CEW I;  1LRA A;  4WFO A;  1RN7 A;  4MJD A;  3DGM A;  2CX1 A;  1LOV A;  1W00 A;  1NNV A;  2CX0 A;  2CWT A;  2ML6 A;  1YVS A;  5KP3 A;  5CF1 A;  1BRH A;  1M9G A;  1YNV X;  3MPH A;  1X1W A;  1R4C A;  3FF0 A;  3PCS A;  3STD A;  1RGA A;  3VGN A;  3LYG A;  1FGR A;  1RGK A;  1UUG B;  3LT8 A;  3F8H A;  4HM7 B;  3FF2 A;  3ZG0 A;  1WMP A;  1B2S A;  1FGM A;  2XR8 B;  5I97 A;  3N54 B;  3RGR A;  1I0X A;  1WTH A;  1A2K A;  1MGW A;  4N3V A;  1W01 A;  3H51 A;  4K1U A;  3SED A;  3CCU 3;  2GEX A;  1YGW A;  1N9E A;  1OGX A;  5IEO A;  1GY5 A;  3HOH A;  3KN4 A;  1DE3 A;  3GWR A;  1ZO2 A;  4G1M B;  3OWY A;  3F8X A;  3BLZ A;  3KE7 A;  1JN5 B;  3FG1 A;  3ROB A;  2Z76 A;  1FA3 A;  5FW5 A;  3NBB A;  4N6L A;  3ZFZ A;  3OV4 A;  3AGN A;  1BGS A;  2KF4 A;  1TTO A;  1LNI A;  1RCL A;  4HM3 B;  3LTB A;  3B4P A;  4LYL B;  5AIH A;  1AV4 A;  1B2U A;  1LNH A;  2O9U X;  1OF5 A;  2P0M A;  3DGL A;  3G71 3;  3HI7 A;  3IMA B;  4KFF A;  3X3Y A;  1JJ2 2;  5TGN A;  1WMO A;  1X1X A;  3LZA A;  3MG3 A;  1FGT A;  3B7C A;  1ULJ B;  2Y73 A;  1JNQ A;  3A76 A;  1B2M A;  4IPB A;  4LMI A;  3UL5 A;  1K28 A;  2QGU A;  3JUM A;  7GSP A;  1HKX A;  4IT7 A;  1BNR A;  3WA2 X;  4FMA A;  1KWI A;  1O7G B;  2QA4 3;  1NU3 A;  2BMO B;  2YFL B;  4WYK A;  1FUS A;  3K5T A;  4LEH A;  2IUK A;  1OF5 B;  3NM2 A;  2HMO B;  2CWV A;  4HM8 B;  2OQE A;  3LTD A;  3SOA A;  1NWW A;  2D42 A;  1RKY A;  2KCD A;  4JRF A;  1STF I;  1UUV B;  2GXF A;  5HOH A;  3LTA A;  2OOV C;  5G1K A;  1JZO A;  1JBR A;  4BTW A;  1E3V A;  3LTC A;  1ASK A;  2KRT A;  4XDW A;  2XEP A;  3L0R A;  1B20 A;  1BUJ A;  3UB1 A;  3V99 A;  3CXC 2;  3EN1 B;  1BIR A;  3GZX B;  2H0G A;  1WNH A;  1GOU A;  2H0I A;  1IVX A;  3F7X A;  2XSO B;  4WYK B;  1C54 A;  2F98 A;  3EJV A;  1ROV A;  1IVW A;  2KXG A;  4HM4 B;  4CCV A;  4QWT A;  1JB2 A;  1I3F A;  4AKZ A;  3K7C A;  2RCD A;  4MMY B;  3IJE B;  3FG3 A;  2IYJ A;  2WO0 A;  3CCE 3;  3PS8 A;  2CHC A;  1BRN L;  2B1X B;  3X3X A;  1A2P A;  1LQM B;  5DRE A;  1JBS A;  1JRQ A;  3PXM A;  2F56 A;  1OUN A;  2UGI A;  3ER7 A;  1I3I A;  4EV5 A;  3CCM 3;  1IVU A;  1B21 A;  1V74 A;  1VQ4 3;  3Q3F A;  4ILF A;  2P0X A;  1EEJ A;  1RGF A; 
#chains in the Genus database with same CATH homology
 1A2V A;  1OCV A;  4EV2 A;  3WA3 A;  1VQ5 3;  1SJW A;  1D6U A;  4FCM A;  3CPO A;  3S29 A;  3UL6 A;  1K9M 4;  3KSP A;  3O8Y A;  4KFD A;  3LML A;  4H61 A;  3U97 A;  1NB3 I;  1W6Y A;  1RJO A;  3M8C A;  1VQL 3;  2W6J H;  2CFK A;  4AKY A;  3NV0 B;  3PCR A;  2OCT A;  4R1K A;  1Y4K A;  1LVN A;  2GU1 A;  4XBY A;  1Q81 4;  4HM6 B;  1US1 A;  1LXE A;  1GY7 A;  1Z1S A;  3TDG A;  1W5Z A;  2W9P A;  3CC7 3;  1KD1 4;  5BVB A;  1K41 A;  2Z7A A;  4EXR A;  2QIY A;  3FKA A;  3SLU A;  2W03 A;  3SOY A;  5FGO A;  4RNZ A;  2Z6B A;  1GY6 A;  3VF1 A;  4HKV B;  1Q40 A;  1O7N B;  3MKI A;  3E99 A;  3MG1 A;  3N8B A;  3T8U A;  4FMC A;  1IT8 A;  1FGQ A;  3GZB A;  5ELJ A;  2C10 A;  2CW9 A;  4U13 A;  5EEO A;  1VQ6 3;  2F99 A;  4HBR A;  1FUW A;  3FZW A;  3CPW 2;  2CKF B;  1DVC A;  3KSE D;  4HZ9 B;  3V98 A;  4EBG A;  3LT9 A;  1N8Q A;  2GBW B;  3ALA A;  7STD A;  3S27 A;  4ZM8 A;  1M1X B;  3EQQ B;  1O7P B;  4HM2 B;  1M90 4;  3PZW A;  3T8N A;  1AVK A;  2XGN A;  2INX A;  2Q07 A;  3WOD G;  3V92 A;  2V1L A;  3N9H A;  3OWU A;  2XFS A;  3JUP A;  3Q1C A;  3X42 A;  1YIT 3;  3DZL A;  1TUH A;  2BMR B;  1VQO 3;  2QEX 3;  3T0U A;  3IPT A;  3FLJ A;  4X2H A;  4WHA A;  3BND A;  3FCS B;  1N9J A;  2HMJ B;  1YJN 3;  1QAF A;  5CF2 A;  3HIG A;  5IEP A;  3I55 3;  4MMZ B;  4L7K A;  2CWU A;  2GU3 A;  1YVB I;  3DUK A;  4HZB B;  2A15 A;  5CK6 A;  4R9L A;  3OX9 A;  1FGO A;  2IMJ A;  2UX0 A;  3J7Y d;  4KFE A;  2C11 A;  2FGT A;  1BUQ A;  2BO9 B;  4FMB A;  1VQN 3;  3EC9 A;  4J9A A;  2WGO A;  4XM4 A;  5BXQ A;  3GZY B;  1O7M B;  3WMD A;  1T5Y A;  1OHS A;  3WDG B;  3S28 A;  2Y74 A;  2I9W A;  4PEJ A;  1N5H A;  2W04 A;  1UI7 A;  1DMQ A;  3D3L A;  1DYU A;  1PU4 A;  4WWU C;  1TFK A;  5STD A;  5A0O B;  1Q86 4;  1SII A;  4GB5 A;  3NM7 A;  4N6O B;  5LC7 A;  2YX9 A;  1L5G B;  1D6Z A;  3X41 A;  2CG1 A;  1W6C A;  3DMC A;  5IW9 A;  3FH1 A;  5IG3 A;  2CG0 A;  3LH4 A;  1VQP 3;  3S67 A;  5LC6 A;  2IUJ A;  3FSD A;  4TX4 A;  2XF3 A;  3G0K A;  3F40 A;  2SBL A;  1OPY A;  2CFG A;  5AIF A;  1NB5 I;  2GBX B;  1MNL A;  3CU3 A;  4L8O A;  1JKG A;  1DMM A;  3GZR A;  4LSO A;  2ZL8 A;  5AYR B;  3G8Z A;  3EE1 A;  3OW2 2;  1IDP A;  2HMN B;  5AYS C;  3JUN A;  1IT7 A;  4HM1 B;  4BTX A;  5EQL A;  1WQL B;  1SQW A;  1M1K 4;  1CYV A;  5G2G A;  3Q90 A;  1GYB A;  2CFD A;  2W9Q A;  1KQS 2;  4GL6 A;  3D9R A;  1W2B 2;  1JB5 A;  3EHC A;  1EA2 A;  2YFJ B;  4HM0 B;  5D82 A;  1VQ7 3;  3EBY A;  4WP5 A;  1O7W B;  4N6V 0;  5JPU A;  4OK0 A;  3WOF B;  1IV7 A;  1RRL A;  1Q42 A;  4N6T A;  2CIU A;  1DVD A;  1VQM 3;  3SXX A;  3AMO A;  1YJW 3;  1LOX A;  1JKG B;  1YGE A;  3I56 3;  1IU7 A;  4HJL B;  1OAC A;  4HM5 B;  4AEQ A;  2OQE C;  4EYC A;  1E97 A;  8CHO A;  4XBT A;  3EX9 A;  4NRE A;  1GD3 A;  2FXT A;  3RDE A;  3NBR A;  3G4S 3;  1ROA A;  1CQS A;  3MHE A;  1K8A 4;  2STD A;  6STD A;  3CCJ 3;  4XDV A;  1STD A;  2BMQ B;  2MC8 A;  1O7H B;  1YJ9 3;  1UW1 A;  1OH0 A;  3U1W A;  3X40 A;  1RRH A;  5KP4 A;  3NUV A;  1TP6 A;  4MEI A;  2M7O A;  2ML5 A;  3CCR 3;  2L4V A;  3EN8 A;  1VQ9 3;  3HZP A;  2W0Q A;  4NHF A;  3GRD A;  2BT3 A;  2XGL A;  2CH9 A;  2K0M A;  3F9S A;  1UI8 A;  1QJG A;  1W02 A;  1QMA A;  3HK4 A;  5CLK A;  3CCS 3;  3CMA 3;  1C7H A;  3KKG A;  3NQY A;  1N5P A;  1KC8 4;  1Q40 B;  3H3H A;  2HMK B;  3K0Z A;  2P38 A;  4R80 A;  4FMD A;  4N6M A;  2YFI B;  1Q82 4;  1HU9 A;  3NBJ A;  5AII A;  3EB8 A;  2E2V A;  2RFR A;  2F86 B;  1QVG 2;  1JN5 A;  3BNC A;  3FGY A;  1OHO A;  4H3U A;  1OGZ A;  3DGN A;  3MSO A;  2FNQ A;  1G96 A;  3UNL A;  2XSH B;  5IG0 A;  4MMX B;  4XB5 A;  4ORL A;  3LXU X;  4KZ1 A;  4K1V A;  2P05 A;  4K61 A;  2OOV A;  2JDI H;  3NQZ A;  4EC6 A;  2WGQ A;  2XFT A;  2LYX A;  1E3R A;  1IQX A;  2XH9 A;  5D81 A;  4HYZ A;  3JUO A;  2K54 A;  5IF6 A;  3G16 A;  2E2U A;  1S5A A;  2WOH A;  3JUQ A;  2R4I A;  1VZZ A;  1ZX2 A;  3BNE A;  2PZV A;  1U8C B;  3F14 A;  2B24 B;  5KP1 A;  4LGQ A;  4N6N B;  3Q2P A;  4LZI A;  2CC3 A;  4STD A;  5JPP A;  2GEY A;  1IV9 A;  4OVM A;  1JB4 A;  1TFO A;  3EBT A;  3FG4 A;  1Q7Y 4;  1PFP A;  4FCJ A;  1AVL A;  3K9M C;  4FCZ A;  3SVA A;  1WMN A;  1NO3 A;  4RZM A;  4Q53 A;  5EVH A;  2BHM A;  5CXO A;  3UJM A;  3K63 A;  4RBN A;  4O8S A;  5IG5 A;  1QVF 2;  2IA7 A;  3JVC A;  3QK9 A;  5AEW B;  2ZDJ A;  5IEN A;  3DY5 A;  3NXJ A;  1IQ8 A;  5AI1 A;  1N8R 4;  3GAX A;  4X2O A;  3CCL 3;  3MWZ A;  1JV2 B;  5HGR A;  1IK3 A;  2MF7 A;  2W56 A;  3NHX A;  1TIJ A;  1W7C A;  1S72 3;  3VSY A;  3ECF A;  3KII A;  1GS3 A;  2BNG A;  1VQK 3;  4IIA A;  1VQ8 3;  1EQK A;  5D83 A;  1GD4 A;  4KVH A;  3EF8 A;  3B4O A;  3NX0 A;  4CDL A;  1UUW B;  1NDO B;  5AEU B;  3OXA A;  1A67 A;  1F8N A;  2OWP A;  2W56 B;  1KSI A;  2P09 A;  1EKM A;  1J2B A;  1YHQ 3;  4O02 B;  3G6E 3;  3KFQ C;  4FR9 A;  1K73 4;  3CC2 3;  2RGQ A;  2Z77 A;  1IQY A;  4R9K A;  1W4N A;  3CD6 3;  1TU5 A;  2D1W A;  1YIJ 3;  1SPU A;  1EG9 B;  3NV0 A;  5DRV A;  2RSX A;  3CNM A;  3CME 3;  1YI2 3;  1NJI 4;  3CNX A;  3I0Y A;  3F7S A;  2JQ5 A;  4JF8 A;  3X3Z A;  1W6G A;  5IER A;  2W2C A;  1QAL A;  1IVV A;  2CFL A;  2CFW A;  3BB9 A;  1DMN A;  3AMO B;  4O2H A;  5AIG A;  3DM8 A;  5JBS A;  3LOY A;  1A90 A;  1CYU A;  3DGO A;  3QRD A;  4I4K A;  1W2Z A;  5IG4 A;  3B8L A;  3S5C A;  3SX1 A;  3RGA A;  3BNB A;  2PNC A;  4K90 B;  4XBX A;  4BTY A;  1QAK A;  2O3O A;  1OHP A;  4J8T A;  1ULI B;  3PYJ A;  2OTJ 3;  4RNY A;  2XRX B;  1MOL A;  3MG2 A;  4OUQ A;  5ELU A;  3CCQ 3;  2HML B;  2LQV A;  3WOE B;  1D6Y A;  4R4K A;  3DXO A;  1U5O A;  2E2T A;  3HII A;  3PGB A;  2OTL 3;  1ISK A;  3HX8 A;  1AR0 A;  2HMM B;  2WOF A;  3MYT A;  2CK3 H;  4N6U A;  1SIH A;  4HVN A;  3OWS A;  4O3V A;  3CCV 3;  3KZT A;  4L8P A;  1CEW I;  4WFO A;  1RN7 A;  4MJD A;  3DGM A;  1W00 A;  2CWT A;  2ML6 A;  5KP3 A;  5CF1 A;  1M9G A;  3MPH A;  3PCS A;  1R4C A;  3FF0 A;  3STD A;  3VGN A;  3LYG A;  1FGR A;  4HM7 B;  3LT8 A;  3F8H A;  3FF2 A;  1WMP A;  1FGM A;  2XR8 B;  5I97 A;  3N54 B;  3RGR A;  1WTH A;  1A2K A;  4N3V A;  1W01 A;  3H51 A;  4K1U A;  3SED A;  3CCU 3;  2GEX A;  1N9E A;  1OGX A;  5IEO A;  1GY5 A;  3KN4 A;  3GWR A;  1ZO2 A;  4G1M B;  3OWY A;  3F8X A;  3BLZ A;  3KE7 A;  1JN5 B;  3FG1 A;  3ROB A;  2Z76 A;  1FA3 A;  5FW5 A;  3NBB A;  4N6L A;  3OV4 A;  4HM3 B;  3LTB A;  3B4P A;  5AIH A;  1LNH A;  1AV4 A;  2O9U X;  3DGL A;  1OF5 A;  2P0M A;  3G71 3;  3HI7 A;  3IMA B;  4KFF A;  3X3Y A;  1JJ2 2;  5TGN A;  1WMO A;  3LZA A;  3MG3 A;  1FGT A;  3B7C A;  1ULJ B;  2Y73 A;  1JNQ A;  3A76 A;  4IPB A;  4LMI A;  3UL5 A;  1K28 A;  2QGU A;  3JUM A;  1HKX A;  4IT7 A;  3WA2 X;  4FMA A;  1KWI A;  1O7G B;  2QA4 3;  1NU3 A;  2BMO B;  2YFL B;  4WYK A;  3K5T A;  4LEH A;  2IUK A;  1OF5 B;  3NM2 A;  2HMO B;  2CWV A;  4HM8 B;  2OQE A;  3LTD A;  3SOA A;  1NWW A;  2D42 A;  1RKY A;  2KCD A;  4JRF A;  1STF I;  1UUV B;  2GXF A;  3LTA A;  2OOV C;  4BTW A;  1E3V A;  3LTC A;  1ASK A;  2KRT A;  4XDW A;  2XEP A;  3L0R A;  3UB1 A;  3V99 A;  3CXC 2;  3EN1 B;  3GZX B;  1WNH A;  1IVX A;  3F7X A;  2XSO B;  4WYK B;  2F98 A;  3EJV A;  1ROV A;  1IVW A;  2KXG A;  4HM4 B;  4CCV A;  4QWT A;  1JB2 A;  3K7C A;  2RCD A;  4MMY B;  3IJE B;  3FG3 A;  2WO0 A;  3CCE 3;  3PS8 A;  2CHC A;  2B1X B;  3X3X A;  5DRE A;  1JRQ A;  3PXM A;  1OUN A;  3ER7 A;  4EV5 A;  3CCM 3;  1IVU A;  1V74 A;  1VQ4 3;  2P0X A;  3CC4 3;  4AKZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...