4WP5A

Chaetomium thermophilum mex67 ntf2-like domain complexed with mtr2
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
201
structure length
199
Chain Sequence
MPTPLPQLPSNVRDGENNVASTFLQAFFQLWDHDRLTLIPQFYDSETTFSVVFATDSPQDPASSSCSKFSRNLNILSPPSTLQRLFVGSNLIADLWKVLPATRHPSLDQTSQWLIDCHTFPHLADPTGMAPYAMGLMINVNGQCEEADISQNLYGTRTFSRCFILGPSKPGAPHPYRVLSDQLTLHTWKPQPAPQVGTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords mRNA export protein
publication title Structural characterization of the principal mRNA-export factor Mex67-Mtr2 from Chaetomium thermophilum.
pubmed doi rcsb
source organism Chaetomium thermophilum
molecule tags Transport protein
total genus 37
structure length 199
sequence length 201
ec nomenclature
pdb deposition date 2014-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4wp5A00
4H3UA 3SOYA 3H3HA 2GBWB 2Z77A 1O7PB 3GZRA 1GY7A 1O7HB 1BUQA 1DMNA 4L8OA 3A76A 4HM1B 3KSPA 2UX0A 4L8PA 1OGZA 1JN5B 4WYKA 2OWPA 1OHSA 5CF1A 4R1KA 5CLKA 2B24B 3SEDA 1OPYA 3Q90A 1JB2A 5AEWB 5IG3A 5AIFA 2GEYA 1TP6A 3NHXA 5IEOA 2HMKB 4XDVA 2PZVA 3EX9A 1O7NB 2W2CA 3EJVA 3NXJA 4LGQA 1GY5A 2GXFA 3BB9A 4X2HA 3OWSA 5JPPA 3I0YA 5BVBA 3B8LA 1A2KA 3FH1A 2HMLB 2CKFB 1JN5A 4J8TA 2F98A 3HK4A 3OXAA 3H51A 4HM8B 3CNMA 4U13A 1QJGA 1K41A 3VGNA 2BMQB 3EBTA 6STDA 1NWWA 1OGXA 4WYKB 4XM4A 1ASKA 1IDPA 1Q40A 5AIIA 4L7KA 2YFIB 3RGRA 4Q53A 5TGNA 2YFJB 4J9AA 3G16A 4I4KA 2F99A 4FCJA 4OVMA 3F7SA 5KP1A 1VZZA 3CU3A 8CHOA 1EA2A 3JUNA 1OF5B 3OWYA 2K54A 1EG9B 4HM6B 4HZ9B 1E97A 1OCVA 3G0KA 3MG1A 4XB5A 3UJMA 3OX9A 2Z76A 5CXOA 3T8NA 3HX8A 3G8ZA 4R9LA 1OHOA 3SOAA 1Q42A 5IERA 5AI1A 3KE7A 3EBYA 3NBRA 1W00A 3RGAA 3JUOA 3GZBA 1W01A 1JB4A 3FLJA 3MSOA 3OWUA 3DMCA 5HGRA 1ZX2A 3WMDA 3VSYA 5AEUB 3FSDA 4HJLB 1WQLB 7STDA 2GEXA 1DMMA 1Q40B 3F14A 1OF5A 1NDOB 3MHEA 2HMNB 1HKXA 3NV0A 3FKAA 3HZPA 2RGQA 1ZO2A 1NU3A 2INXA 4LEHA 2QIYA 3NUVA 1AR0A 3FGYA 3F9SA 1ISKA 1O7MB 2RFRA 1Z1SA 4HM5B 1OUNA 5AIHA 3LZAA 1OHPA 1DMQA 3FF2A 3ECFA 3KZTA 3S5CA 5IG5A 3FF0A 3ER7A 3B7CA 1O7WB 2R4IA 3M8CA 3B4OA 4KVHA 3GRDA 3JUMA 3IPTA 3GWRA 4XDWA 4ORLA 3D9RA 1E3RA 3EN1B 1ULJB 4HM3B 3K7CA 3EF8A 3OV4A 3JUPA 3MYTA 3EQQB 1E3VA 2BMOB 3EHCA 4LMIA 4K1UA 4HZBB 1UUWB 3FZWA 2XRXB 3NV0B 1QMAA 4X2OA 2A15A 5CF2A 5D83A 2B1XB 2IMJA 1GY6A 5D81A 1UUVB 1GYBA 2XSOB 3MG3A 4HM7B 3EN8A 3BLZA 3STDA 2F86B 3JUQA 4WWUC 3EC9A 1ULIB 2YFLB 3F8HA 4XBTA 1GS3A 1C7HA 4STDA 4IIAA 1OH0A 4XBYA 4WP5A 5KP4A 2BNGA 3DUKA 4MJDA 4XBXA 2XSHB 2Z7AA 5CK6A 1W6YA 5FW5A 3F7XA 5IG0A 2XR8B 1O7GB 3LYGA 5IENA 4FCMA 1JB5A 2GBXB 4HM2B 2HMJB 4HKVB 1SJWA 3K0ZA 5IG4A 2QGUA 3ROBA 3GZYB 3NM2A 1JKGB 3B4PA 5EVHA 1S5AA 4RZMA 3DXOA 4HVNA 1STDA 2HMOB 2HMMB 3CNXA 2STDA 3UNLA 3T8UA 5BXQA 1CQSA 3E99A 5KP3A 5G2GA 4OUQA 3DM8A 5STDA 3F40A 3MKIA 5AIGA 5DRVA 4CDLA 2CHCA 4HM4B 3MG2A 3KKGA 3GZXB 1TUHA 4PEJA 3DZLA 4GB5A 5JPUA 5IF6A 5IEPA 2JQ5A 4K1VA 1JKGA 3CPOA 2BMRB 4R9KA 1W02A 2I9WA 5D82A 2RCDA 5DREA 4HM0B 4N3VA 3F8XA 1U5OA
chains in the Genus database with same CATH superfamily
4H3UA 1YJW3 3SOYA 3H3HA 2GBWB 3CC23 2Z77A 1R4YA 1GMQA 2ZL8A 1O7PB 3GZRA 1S723 1IU7A 1GY7A 1WTHA 3SYUA 1JBTA 1O7HB 4KFEA 1BUQA 1KWIA 1RGGA 2D42A 3HIGA 5ELUA 4J5GA 1DMNA 1VQM3 1BVIA 4L8OA 2CC3A 1IT8A 1BRSA 3A76A 2P0MA 4HM1B 3KSPA 2UX0A 4L8PA 1JBSA 1I2GA 1PFPA 9RNTA 1UGIA 2CFWA 5M19A 1BSDA 1W4NA 2ZA4A 3PZWA 2CWVA 2J8XB 1OGZA 5FGOA 1LNHA 2H0GA 1YJ93 3RNTA 1JN5B 2E2TA 3DGLA 3U1WA 4WYKA 2BT3A 4N6UA 5A0OB 4EV2A 2OWPA 1LQMB 1OHSA 3J7Yd 5CF1A 4R1KA 1T5YA 5AYRB 5CLKA 1RHLA 2GU3A 1GSPA 1RMSA 2B24B 3BU4A 2H0HA 3SEDA 4CCVA 1OPYA 3GSPA 3Q90A 3CCJ3 2OOVC 1GMRA 4RBNA 1B2UA 4RNTA 1JB2A 3X42A 5AEWB 3NQYA 1RGAA 1BSEA 2F56A 1IV7A 2GU1A 3CMA3 1C54A 2IY2A 5IG3A 1MGRA 3D5IA 5AIFA 2D1WA 2GEYA 2KAAA 5IW9A 1TP6A 2CFDA 3NHXA 2CH9A 5IEOA 1YI23 3K9MC 1RJOA 2HMKB 4O8SA 2PZVA 4XDVA 3EX9A 1O7NB 1SPUA 2W2CA 3EJVA 2CFGA 3NXJA 4LGQA 1BNSA 3CCR3 1FUTA 1SQWA 1GY5A 4WHAA 3BNCA 1IYYA 2GXFA 1DYUA 3BB9A 2RNTA 3OWSA 4X2HA 2E2VA 1RSNA 5JPPA 2K0MA 2OCTA 3I0YA 1WMPA 1R4CA 1Y4KA 3N8BA 4RNZA 1W2ZA 5BVBA 4OK0A 3B8LA 5BIRA 1A2KA 3LOYA 5LC7A 1TJDA 1D6UA 3PYJA 3X3ZA 3FH1A 2UUGC 1WMNA 3CC43 2AAEA 4JF8A 3CCM3 2CWUA 4NHFA 3WA3A 4NPBA 4N6V0 3BIRA 4AKZA 2HMLB 4BL2A 1GD3A 3KFQC 2CKFB 1GOVA 1V74A 4HYZA 1JN5A 1EKMA 1B2XA 4J8TA 2F98A 3HK4A 3CCU3 1KQS2 3OXAA 3CXC2 1VQ73 4O2HA 1ZGXA 2KF4A 3NBBA 3H51A 3AGNA 3CNMA 4HM8B 1GD4A 1NO3A 2CFKA 3ALAA 2W9PA 1FYSA 4N6LA 4U13A 3EB8A 3VF1A 1X1WA 2M7OA 1M1K4 1M1XB 1QJGA 3LTDA 1K41A 1QAKA 3VGNA 1FUSA 1G02A 1RN7A 1QVG2 3PS8A 4H61A 2BMQB 2WO0A 1G96A 3EBTA 6STDA 3NM7A 1NWWA 5I97A 1OGXA 1OACA 4WYKB 4XM4A 4FMAA 5JBSA 1Q7HA 1MWSA 1ASKA 1IDPA 3FCSB 1BNRA 1Q40A 2L1SA 4K61A 2W9QA 5AIIA 2OQEC 4L7KA 4MMZB 1LOWA 2YFIB 1IVXA 3RGRA 4Q53A 5TGNA 2YFJB 3SLUA 1BSCA 4J9AA 4ZM8A 3G16A 4I4KA 3HI7A 1SIHA 2F99A 4FCJA 4OVMA 4EYCA 4N6OB 1SARA 1AVKA 3I553 1SIIA 3DGYA 1BNEA 3MWZA 1A2PA 2ML6A 3F7SA 3WODG 1VZZA 5KP1A 1M904 1JZOA 2BU4A 3CU3A 1N9JA 1GOYA 8CHOA 1EA2A 3V92A 3JUNA 2YX9A 2LQVA 3I563 1OF5B 5BU4A 1VQN3 2XFSA 6GSPA 3OWYA 3S67A 2K54A 1YVBI 1EG9B 4FMDA 4HM6B 1L5GB 2W0QA 4HZ9B 1VQ53 1E97A 2SARA 3Q2PA 1OCVA 1LOYA 3AHWA 1VQQA 3G0KA 3MG1A 4J5KA 4JRFA 3OX9A 4LZIA 2Z76A 4I5QA 1AV4A 5CXOA 3T8NA 1N9EA 1IVWA 3HX8A 1UI8A 2V1LA 1QALA 3G8ZA 4R9LA 3KIIA 1DVDA 1OHOA 3SOAA 2ML5A 4TX4A 1HYFA 1YGWA 1Q42A 5G1LA 5AI1A 3KE7A 2KCDA 3EBYA 5IERA 1KC84 5AYSC 4G1MB 2CK3H 3NBRA 1RDSA 1RKYA 1IVUA 1W00A 3RGAA 3JUOA 1I2FA 1X1XA 2XGLA 3GZBA 2O9UX 4IT7A 3A5EA 3NBJA 1BNGA 3QK9A 3PCRA 3Q1CA 1W01A 3DGNA 5M18A 1JB4A 1LNIA 1UGHI 1JZDA 2ZHXB 3FLJA 2RBIA 3MSOA 1STFI 1BUJA 1UCKA 1BRNL 3OWUA 3DMCA 5HGRA 1I2EA 1TFKA 1UCIA 1X1YA 1RCLA 1ZX2A 1NNVA 1UDII 1US1A 2L4VA 3BNEA 3FSDA 3VSYA 3WMDA 5AEUB 1YIJ3 1IQXA 2P09A 3WR2A 2XGNA 1BAOA 3G4S3 1LXEA 2F5WA 2FXTA 2O3OA 3CCV3 4HJLB 2XF3A 2BHMA 1IVVA 2KF6A 2XH9A 1D6YA 1WQLB 4AKYA 7STDA 3UL5A 1JJ22 2GEXA 1DMMA 1Q40B 1B20A 3D79A 1VQ93 1UI7A 5EEOA 3F14A 1DVCA 1OF5A 2OOVA 4MMYB 1BGSA 1NDOB 1WMOA 3MHEA 2CIUA 1LOXA 1MWRA 3G6E3 2UGIA 2HMNB 2C4BA 4ILFA 1HKXA 2WOFA 4O3VA 3NV0A 5LC6A 3FKAA 4BTXA 1TIJA 3HZPA 3PCSA 1I3IA 2KF3A 2C10A 4MEIA 3CME3 3V98A 2RGQA 1WNHA 1ZO2A 1NU3A 1UCJA 2INXA 4LEHA 2QIYA 3NUVA 1AR0A 3FGYA 3F9SA 3X40A 1ISKA 1O7MB 2JDIH 2RFRA 1G0TA 1T2HA 1Z1SA 3MPHA 1NB3I 1Q814 1TTOA 4HM5B 1N8R4 1N8QA 1OUNA 4MMXB 5AIHA 1B3SA 1W7CA 1NJI4 3BNBA 3GAXA 3N54B 3LTAA 2F5MA 3PGBA 1RN1A 2CWTA 3LZAA 3CC73 1AQZA 1Q824 1PYLA 1OHPA 1LVNA 3KN4A 3URPA 1VQL3 1DMQA 1UW1A 3FF2A 2W04A 4O02B 3ECFA 1MWUA 3KZTA 1I0XA 3KSED 4EXRA 1BRJA 2WGOA 3S5CA 2QA43 1RN4A 3HOHA 2XEPA 1VQO3 2ZDJA 3S27A 1D6ZA 5IG5A 1MGWA 3FF0A 1M9GA 2SBLA 8RNTA 2CG1A 1J2BA 3OW22 3ER7A 3B7CA 1O7WB 1B2MA 2Q07A 2W03A 4KZ1A 1FGMA 3U97A 4BL3A 2R4IA 3M8CA 1LRAA 3B4OA 3O8YA 4KVHA 1U8CB 3GRDA 2Y74A 3JUMA 3CCE3 1RGFA 3IPTA 2W6JH 2CW9A 3GWRA 1K734 4XDWA 4ORLA 1F8NA 3D9RA 1E3RA 1B2SA 3FG1A 4KFDA 3UJMA 5IG4A 1FGOA 3EN1B 4GHOA 1CYVA 1ULJB 1X1UA 3K7CA 4HM3B 4N6MA 1K28A 3X41A 3EF8A 1YGEA 2C11A 3OV4A 1V57A 3JUPA 1B21A 4BTYA 1LOVA 2E2UA 4R80A 1Q864 3ZG5A 2K3DA 4HAAA 1BIRA 1FUWA 1I0VA 3HIIA 4XB5A 1UUGB 3MYTA 2OQEA 1MOLA 3EQQB 1E3VA 2BMOB 3AGOA 3EHCA 1BANA 3Q3FA 4LMIA 3LXUX 4K1UA 3X3XA 7GSPA 1RGKA 4HZBB 1UUWB 3FZWA 2XRXB 3NV0B 1JNQA 1IQYA 1QMAA 4X2OA 3NX0A 1BNIA 2A15A 2R41A 2GSPA 4GL6A 5CF2A 4CPKA 5D83A 1EEJA 2OTJ3 1RRHA 3PXMA 2WGQA 1YIT3 2B1XB 4GSPA 3WA2X 1W6GA 2IA7A 3AMOB 4R4KA 3UL6A 2IMJA 1GY6A 2P05A 5D81A 1UUVB 4BU4A 1GYBA 1BRKA 1I3FA 1RCKA 1YVSA 2XSOB 1A67A 1LQGC 4N6NB 1BSBA 1FGQA 3MG3A 4HM7B 2MC8A 3ZG0A 1I8VA 4RNYA 3BNDA 3EN8A 3SX1A 3BLZA 3STDA 3UB1A 2IUKA 1QAFA 3AHSA 2F86B 4LSOA 2Y73A 3JUQA 4WWUC 1YJN3 1PU4A 3EC9A 1ULIB 6RNTA 2YFLB 3F8HA 4XBTA 1IT7A 3V99A 3K63A 1AY7A 1GS3A 1C7HA 1JRQA 4STDA 4IIAA 1FZUA 1IK3A 1VQK3 2Z6BA 1OH0A 4XBYA 3DGMA 4WP5A 5KP4A 1B2ZA 1IV9A 1K8A4 1BRGA 2BNGA 2BIRA 5HOHA 4EV5A 3LT8A 3DUKA 3WHOA 4MJDA 4XBXA 4EW5A 1EQKA 2CG0A 4FR9A 3DGOA 2XSHB 2Z7AA 5CK6A 1DETA 1JV2B 2CX1A 1JBRA 1W6YA 1N5PA 2FGTA 3D4AA 5FW5A 3F7XA 5IG0A 2XR8B 4WFOA 1RLSA 4NREA 1RGCA 1O7GB 4HBRA 1NB5I 1IQ8A 3LYGA 3K5TA 1BU4A 1YNVX 3TDGA 3T0UA 5IENA 1W5ZA 4FCMA 5M1AA 3DH2A 5G1KA 1VQ43 1RRLA 4BTWA 3LTBA 1JB5A 4EBGA 3AMOA 2GBXB 4KFFA 2KF5A 4HM2B 5EQLA 3NQZA 2OTL3 1PY3A 1RNTA 2HMJB 3D5GA 3CCS3 2BO9B 1A90A 2CFLA 1RGLA 3CCL3 1Q7Y4 2CX0A 1TRQA 5RNTA 1CEWI 2PNCA 4HKVB 2HOHA 1SJWA 1A2VA 2WOHA 3K0ZA 1V58A 3SXXA 1BOXA 2QGUA 1HU9A 3ROBA 3GZYB 1KSIA 3KCHA 3LMLA 2P0XA 4FCZA 1TRPA 3NM2A 1GMPA 1JKGB 3IJEB 3B4PA 4IPBA 4AEQA 3SVAA 3JVCA 1I70A 1CYUA 3CPW2 2IYJA 3S28A 5EVHA 1T2IA 1S5AA 4RZMA 2W56B 3N9HA 2QEX3 1B27A 1ROAA 1T3BA 3X3YA 3DXOA 1BRHA 3WOFB 4HVNA 2FNQA 3IMAB 1STDA 2HMOB 1BNFA 2HMMB 2KRTA 2STDA 3CNXA 3FG4A 3FG3A 3QRDA 3UNLA 3EE1A 4FMBA 2H0IA 2KXGA 3CCQ3 1HZ1A 1TU5A 3CD63 2F4YA 2RSXA 3L0RA 2IUJA 3RDEA 4CJNA 1VQP3 1TFOA 3T8UA 4DKIA 5BXQA 1EUIC 1CQSA 3E99A 4FMCA 5KP3A 1BSAA 1W2B2 5G2GA 3DY5A 2P38A 4OUQA 1K9M4 4EC6A 5GSPA 1RNBA 2LYXA 4HOHA 1FGRA 3DM8A 5STDA 1KD14 3F40A 3MKIA 5AIGA 1ZS7A 3G713 5DRVA 1AVLA 1W6CA 5ELJA 4CDLA 2CHCA 1FA3A 1MNLA 4HM4B 3MG2A 1RGEA 4LYLB 3KKGA 1RTUA 3GZXB 4K90B 1TUHA 4PEJA 1Q9EA 3DZLA 1YHQ3 3WOEB 3LH4A 4GB5A 1UCLA 5JPUA 1DE3A 1FGTA 3LT9A 4QWTA 3S29A 5IF6A 1VQ63 7RNTA 5IEPA 2JQ5A 4K1VA 3WDGB 1RGHA 3LTCA 1VQ83 1FW7A 1BNJA 3ZFZA 4KT3B 1JKGA 4N6TA 4BIRA 1GOUA 1ROVA 3CPOA 3D3LA 2BMRB 2XFTA 1CH0A 1MWTA 4R9KA 1W02A 2I9WA 5D82A 2MF7A 1QVF2 1BRIA 1N5HA 2W56A 2RCDA 5DREA 2AADA 4HM0B 4N3VA 3F8XA 1U5OA
chains in the Genus database with same CATH topology
4H3UA 1YJW3 3SOYA 3H3HA 2GBWB 3CC23 2Z77A 2ZL8A 1O7PB 3GZRA 1S723 1IU7A 1GY7A 1WTHA 1O7HB 4KFEA 1BUQA 1KWIA 3HIGA 2D42A 5ELUA 1DMNA 1VQM3 4L8OA 2CC3A 1IT8A 3A76A 2P0MA 4HM1B 3KSPA 2UX0A 4L8PA 1PFPA 2CFWA 1W4NA 3PZWA 5FGOA 2CWVA 1OGZA 1LNHA 1YJ93 1JN5B 2E2TA 3DGLA 3U1WA 4WYKA 2BT3A 4N6UA 5A0OB 4EV2A 2OWPA 1OHSA 3J7Yd 5CF1A 4R1KA 1T5YA 5AYRB 5CLKA 2GU3A 2B24B 3SEDA 1OPYA 3Q90A 3CCJ3 2OOVC 4RBNA 1JB2A 3X42A 5AEWB 3NQYA 1IV7A 2GU1A 3CMA3 5IG3A 5AIFA 2D1WA 2GEYA 5IW9A 1TP6A 2CFDA 3NHXA 2CH9A 5IEOA 1YI23 3K9MC 1RJOA 2HMKB 4O8SA 2PZVA 4XDVA 3EX9A 1O7NB 1SPUA 2W2CA 3EJVA 2CFGA 3NXJA 4LGQA 3CCR3 1SQWA 1GY5A 4WHAA 3BNCA 2GXFA 1DYUA 3BB9A 4X2HA 3OWSA 2E2VA 5JPPA 2K0MA 2OCTA 3I0YA 1WMPA 1R4CA 1Y4KA 3N8BA 4RNZA 1W2ZA 5BVBA 4OK0A 3B8LA 1A2KA 3LOYA 5LC7A 3X3ZA 1D6UA 3PYJA 3FH1A 1WMNA 3CC43 4JF8A 3CCM3 2CWUA 4NHFA 3WA3A 4N6V0 4AKZA 2HMLB 1GD3A 3KFQC 2CKFB 1V74A 4HYZA 1JN5A 1EKMA 4J8TA 2F98A 3HK4A 3CCU3 1KQS2 3OXAA 3CXC2 1VQ73 4O2HA 3NBBA 3H51A 4HM8B 3CNMA 1GD4A 1NO3A 2CFKA 3ALAA 2W9PA 4N6LA 4U13A 3EB8A 3VF1A 2M7OA 1M1K4 1M1XB 1QJGA 3LTDA 1K41A 1QAKA 3VGNA 1RN7A 1QVG2 3PS8A 4H61A 2BMQB 2WO0A 1G96A 3EBTA 6STDA 3NM7A 1NWWA 5I97A 1OGXA 1OACA 4WYKB 4XM4A 4FMAA 5JBSA 1ASKA 1IDPA 3FCSB 1Q40A 4K61A 2W9QA 5AIIA 2OQEC 4L7KA 4MMZB 2YFIB 1IVXA 3RGRA 4Q53A 5TGNA 2YFJB 3SLUA 4J9AA 4ZM8A 3G16A 4I4KA 3HI7A 1SIHA 2F99A 4FCJA 4OVMA 4EYCA 4N6OB 1AVKA 3I553 1SIIA 3MWZA 2ML6A 3F7SA 3WODG 1VZZA 5KP1A 1M904 3CU3A 1N9JA 8CHOA 1EA2A 3V92A 3JUNA 2YX9A 2LQVA 3I563 1OF5B 1VQN3 2XFSA 3OWYA 3S67A 2K54A 1YVBI 1EG9B 4FMDA 4HM6B 1L5GB 2W0QA 4HZ9B 1VQ53 1E97A 3Q2PA 1OCVA 3G0KA 3MG1A 4JRFA 4LZIA 4XB5A 3UJMA 1Q7Y4 3OX9A 2Z76A 5CXOA 1AV4A 3T8NA 1N9EA 1IVWA 3HX8A 1UI8A 2V1LA 1QALA 3G8ZA 4R9LA 3KIIA 1DVDA 1OHOA 3SOAA 2ML5A 4TX4A 1Q42A 5IERA 5AI1A 3KE7A 2KCDA 3EBYA 1KC84 5AYSC 4G1MB 2CK3H 3NBRA 1RKYA 1IVUA 1W00A 3RGAA 3JUOA 2XGLA 3GZBA 2O9UX 4IT7A 3NBJA 3QK9A 3PCRA 3Q1CA 1W01A 3DGNA 1JB4A 3FLJA 3MSOA 1STFI 3OWUA 3DMCA 5HGRA 1TFKA 1ZX2A 2L4VA 1US1A 3BNEA 3VSYA 3FSDA 3WMDA 5AEUB 1YIJ3 1IQXA 2P09A 2XGNA 3G4S3 1LXEA 2FXTA 2O3OA 3CCV3 4HJLB 2XF3A 2BHMA 1IVVA 2XH9A 1D6YA 1WQLB 4AKYA 7STDA 3UL5A 1JJ22 2GEXA 1DMMA 1Q40B 1VQ93 1UI7A 5EEOA 3F14A 1DVCA 1OF5A 2OOVA 4MMYB 1WMOA 1NDOB 3MHEA 2CIUA 1LOXA 3G6E3 2HMNB 1HKXA 2WOFA 4O3VA 3NV0A 5LC6A 3FKAA 4BTXA 1TIJA 3HZPA 3PCSA 4MEIA 2C10A 3CME3 3V98A 2RGQA 1WNHA 1ZO2A 1NU3A 2INXA 4LEHA 2QIYA 3NUVA 1AR0A 3FGYA 3F9SA 3X40A 1ISKA 1O7MB 2JDIH 2RFRA 1Z1SA 3MPHA 1NB3I 1Q814 4HM5B 1N8R4 1N8QA 1OUNA 4MMXB 5AIHA 1W7CA 1NJI4 3BNBA 3GAXA 3N54B 3LTAA 3PGBA 3CC73 2CWTA 3LZAA 1Q824 1OHPA 1LVNA 3KN4A 1VQL3 1DMQA 1UW1A 3FF2A 2W04A 4O02B 3ECFA 3KZTA 3KSED 4EXRA 2WGOA 3S5CA 2QA43 1VQO3 2ZDJA 3S27A 1D6ZA 5IG5A 3FF0A 1M9GA 2SBLA 2CG1A 1J2BA 3OW22 3ER7A 3B7CA 1O7WB 2Q07A 2W03A 4KZ1A 1FGMA 3U97A 2R4IA 3M8CA 3B4OA 3O8YA 4KVHA 1U8CB 3GRDA 2Y74A 3JUMA 3CCE3 3IPTA 2W6JH 2CW9A 3GWRA 1K734 4XDWA 4ORLA 1F8NA 3D9RA 1E3RA 3FG1A 4KFDA 1FGOA 3EN1B 1CYVA 1ULJB 3K7CA 4HM3B 4N6MA 1K28A 3X41A 3EF8A 1YGEA 2C11A 3OV4A 3JUPA 4BTYA 2E2UA 4R80A 1Q864 1FUWA 3HIIA 3MYTA 2OQEA 1MOLA 3EQQB 1E3VA 2BMOB 3EHCA 4LMIA 3X3XA 3LXUX 4K1UA 4HZBB 1UUWB 3FZWA 2XRXB 3NV0B 1JNQA 1IQYA 1QMAA 4X2OA 3NX0A 2A15A 4GL6A 5CF2A 2OTJ3 5D83A 1RRHA 3PXMA 2WGQA 1YIT3 2B1XB 3WA2X 1W6GA 2IA7A 3AMOB 4R4KA 3UL6A 2IMJA 1GY6A 2P05A 5D81A 1UUVB 1GYBA 1A67A 2XSOB 4N6NB 1FGQA 3MG3A 4HM7B 2MC8A 4RNYA 3BNDA 3EN8A 3SX1A 3BLZA 3STDA 3UB1A 2IUKA 1QAFA 2F86B 4LSOA 2Y73A 3JUQA 4WWUC 1YJN3 1PU4A 3EC9A 1ULIB 2YFLB 3F8HA 4XBTA 1IT7A 3V99A 3K63A 1IK3A 1GS3A 1C7HA 1JRQA 4STDA 4IIAA 1VQK3 2Z6BA 1OH0A 4XBYA 3DGMA 4WP5A 5KP4A 1IV9A 1K8A4 2BNGA 1U5OA 3LT8A 4EV5A 3DUKA 4MJDA 4XBXA 1EQKA 2CG0A 4FR9A 3DGOA 2XSHB 2Z7AA 5CK6A 1JV2B 1W6YA 1N5PA 2FGTA 5FW5A 3F7XA 5IG0A 2XR8B 4WFOA 4NREA 1O7GB 4HBRA 1NB5I 1IQ8A 3LYGA 3K5TA 3TDGA 3T0UA 5IENA 1W5ZA 4FCMA 1VQ43 1RRLA 4BTWA 3LTBA 1JB5A 4EBGA 3AMOA 2GBXB 4KFFA 4HM2B 5EQLA 3NQZA 2OTL3 2HMJB 3CCS3 1A90A 2BO9B 2CFLA 3CCL3 1CEWI 2PNCA 4HKVB 1SJWA 1A2VA 2WOHA 3K0ZA 5IG4A 3SXXA 2QGUA 1HU9A 3ROBA 3GZYB 1KSIA 4CCVA 3LMLA 2P0XA 4FCZA 3NM2A 3IJEB 1JKGB 4IPBA 3B4PA 4AEQA 3SVAA 3JVCA 1CYUA 3CPW2 3S28A 5EVHA 1S5AA 4RZMA 2W56B 3N9HA 2QEX3 1ROAA 3X3YA 3DXOA 3WOFB 4HVNA 2FNQA 3IMAB 1STDA 2HMOB 2HMMB 2KRTA 3CNXA 2STDA 3FG4A 3QRDA 3FG3A 3UNLA 3EE1A 4FMBA 2KXGA 3CCQ3 1TU5A 3CD63 2IUJA 2RSXA 3L0RA 3RDEA 1VQP3 1TFOA 3T8UA 5BXQA 1CQSA 3E99A 4FMCA 5KP3A 1W2B2 5G2GA 3DY5A 2P38A 4OUQA 1K9M4 4EC6A 2LYXA 1FGRA 3DM8A 5STDA 1KD14 3F40A 3MKIA 5AIGA 3G713 5DRVA 1AVLA 1W6CA 5ELJA 4CDLA 2CHCA 1FA3A 1MNLA 4HM4B 3MG2A 3KKGA 3GZXB 4K90B 1TUHA 4PEJA 3DZLA 1YHQ3 3WOEB 3LH4A 4GB5A 5JPUA 1FGTA 3LT9A 4QWTA 3S29A 5IF6A 1VQ63 5IEPA 2JQ5A 4K1VA 3WDGB 3LTCA 1VQ83 1JKGA 4N6TA 1ROVA 3CPOA 3D3LA 2BMRB 2XFTA 4R9KA 1W02A 2I9WA 5D82A 2MF7A 1QVF2 2W56A 1N5HA 2RCDA 5DREA 4HM0B 4N3VA 3F8XA 2XEPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H3U A;  3SOY A;  3H3H A;  2GBW B;  2Z77 A;  1O7P B;  3GZR A;  1GY7 A;  1O7H B;  1BUQ A;  1DMN A;  4L8O A;  3A76 A;  4HM1 B;  3KSP A;  2UX0 A;  4L8P A;  1OGZ A;  1JN5 B;  4WYK A;  2OWP A;  1OHS A;  5CF1 A;  4R1K A;  5CLK A;  2B24 B;  3SED A;  1OPY A;  3Q90 A;  1JB2 A;  5AEW B;  5IG3 A;  5AIF A;  2GEY A;  1TP6 A;  3NHX A;  5IEO A;  2HMK B;  4XDV A;  2PZV A;  3EX9 A;  1O7N B;  2W2C A;  3EJV A;  3NXJ A;  4LGQ A;  1GY5 A;  2GXF A;  3BB9 A;  4X2H A;  3OWS A;  5JPP A;  3I0Y A;  5BVB A;  3B8L A;  1A2K A;  3FH1 A;  2HML B;  2CKF B;  1JN5 A;  4J8T A;  2F98 A;  3HK4 A;  3OXA A;  3H51 A;  4HM8 B;  3CNM A;  4U13 A;  1QJG A;  1K41 A;  3VGN A;  2BMQ B;  3EBT A;  6STD A;  1NWW A;  1OGX A;  4WYK B;  4XM4 A;  1ASK A;  1IDP A;  1Q40 A;  5AII A;  4L7K A;  2YFI B;  3RGR A;  4Q53 A;  5TGN A;  2YFJ B;  4J9A A;  3G16 A;  4I4K A;  2F99 A;  4FCJ A;  4OVM A;  3F7S A;  5KP1 A;  1VZZ A;  3CU3 A;  8CHO A;  1EA2 A;  3JUN A;  1OF5 B;  3OWY A;  2K54 A;  1EG9 B;  4HM6 B;  4HZ9 B;  1E97 A;  1OCV A;  3G0K A;  3MG1 A;  4XB5 A;  3UJM A;  3OX9 A;  2Z76 A;  5CXO A;  3T8N A;  3HX8 A;  3G8Z A;  4R9L A;  1OHO A;  3SOA A;  1Q42 A;  5IER A;  5AI1 A;  3KE7 A;  3EBY A;  3NBR A;  1W00 A;  3RGA A;  3JUO A;  3GZB A;  1W01 A;  1JB4 A;  3FLJ A;  3MSO A;  3OWU A;  3DMC A;  5HGR A;  1ZX2 A;  3WMD A;  3VSY A;  5AEU B;  3FSD A;  4HJL B;  1WQL B;  7STD A;  2GEX A;  1DMM A;  1Q40 B;  3F14 A;  1OF5 A;  1NDO B;  3MHE A;  2HMN B;  1HKX A;  3NV0 A;  3FKA A;  3HZP A;  2RGQ A;  1ZO2 A;  1NU3 A;  2INX A;  4LEH A;  2QIY A;  3NUV A;  1AR0 A;  3FGY A;  3F9S A;  1ISK A;  1O7M B;  2RFR A;  1Z1S A;  4HM5 B;  1OUN A;  5AIH A;  3LZA A;  1OHP A;  1DMQ A;  3FF2 A;  3ECF A;  3KZT A;  3S5C A;  5IG5 A;  3FF0 A;  3ER7 A;  3B7C A;  1O7W B;  2R4I A;  3M8C A;  3B4O A;  4KVH A;  3GRD A;  3JUM A;  3IPT A;  3GWR A;  4XDW A;  4ORL A;  3D9R A;  1E3R A;  3EN1 B;  1ULJ B;  4HM3 B;  3K7C A;  3EF8 A;  3OV4 A;  3JUP A;  3MYT A;  3EQQ B;  1E3V A;  2BMO B;  3EHC A;  4LMI A;  4K1U A;  4HZB B;  1UUW B;  3FZW A;  2XRX B;  3NV0 B;  1QMA A;  4X2O A;  2A15 A;  5CF2 A;  5D83 A;  2B1X B;  2IMJ A;  1GY6 A;  5D81 A;  1UUV B;  1GYB A;  2XSO B;  3MG3 A;  4HM7 B;  3EN8 A;  3BLZ A;  3STD A;  2F86 B;  3JUQ A;  4WWU C;  3EC9 A;  1ULI B;  2YFL B;  3F8H A;  4XBT A;  1GS3 A;  1C7H A;  4STD A;  4IIA A;  1OH0 A;  4XBY A;  4WP5 A;  5KP4 A;  2BNG A;  3DUK A;  4MJD A;  4XBX A;  2XSH B;  2Z7A A;  5CK6 A;  1W6Y A;  5FW5 A;  3F7X A;  5IG0 A;  2XR8 B;  1O7G B;  3LYG A;  5IEN A;  4FCM A;  1JB5 A;  2GBX B;  4HM2 B;  2HMJ B;  4HKV B;  1SJW A;  3K0Z A;  5IG4 A;  2QGU A;  3ROB A;  3GZY B;  3NM2 A;  1JKG B;  3B4P A;  5EVH A;  1S5A A;  4RZM A;  3DXO A;  4HVN A;  1STD A;  2HMO B;  2HMM B;  3CNX A;  2STD A;  3UNL A;  3T8U A;  5BXQ A;  1CQS A;  3E99 A;  5KP3 A;  5G2G A;  4OUQ A;  3DM8 A;  5STD A;  3F40 A;  3MKI A;  5AIG A;  5DRV A;  4CDL A;  2CHC A;  4HM4 B;  3MG2 A;  3KKG A;  3GZX B;  1TUH A;  4PEJ A;  3DZL A;  4GB5 A;  5JPU A;  5IF6 A;  5IEP A;  2JQ5 A;  4K1V A;  1JKG A;  3CPO A;  2BMR B;  4R9K A;  1W02 A;  2I9W A;  5D82 A;  2RCD A;  5DRE A;  4HM0 B;  4N3V A;  3F8X A;  1U5O A; 
#chains in the Genus database with same CATH topology
 4H3U A;  1YJW 3;  3SOY A;  3H3H A;  2GBW B;  3CC2 3;  2Z77 A;  1R4Y A;  1GMQ A;  2ZL8 A;  1O7P B;  3GZR A;  1S72 3;  1IU7 A;  1GY7 A;  1WTH A;  3SYU A;  1JBT A;  1O7H B;  4KFE A;  1BUQ A;  1KWI A;  1RGG A;  2D42 A;  3HIG A;  5ELU A;  4J5G A;  1DMN A;  1VQM 3;  1BVI A;  4L8O A;  2CC3 A;  1IT8 A;  1BRS A;  3A76 A;  2P0M A;  4HM1 B;  3KSP A;  2UX0 A;  4L8P A;  1JBS A;  1I2G A;  1PFP A;  9RNT A;  1UGI A;  2CFW A;  5M19 A;  1BSD A;  1W4N A;  2ZA4 A;  3PZW A;  2CWV A;  2J8X B;  1OGZ A;  5FGO A;  1LNH A;  2H0G A;  1YJ9 3;  3RNT A;  1JN5 B;  2E2T A;  3DGL A;  3U1W A;  4WYK A;  2BT3 A;  4N6U A;  5A0O B;  4EV2 A;  2OWP A;  1LQM B;  1OHS A;  3J7Y d;  5CF1 A;  4R1K A;  1T5Y A;  5AYR B;  5CLK A;  1RHL A;  2GU3 A;  1GSP A;  1RMS A;  2B24 B;  3BU4 A;  2H0H A;  3SED A;  4CCV A;  1OPY A;  3GSP A;  3Q90 A;  3CCJ 3;  2OOV C;  1GMR A;  4RBN A;  1B2U A;  4RNT A;  1JB2 A;  3X42 A;  5AEW B;  3NQY A;  1RGA A;  1BSE A;  2F56 A;  1IV7 A;  2GU1 A;  3CMA 3;  1C54 A;  2IY2 A;  5IG3 A;  1MGR A;  3D5I A;  5AIF A;  2D1W A;  2GEY A;  2KAA A;  5IW9 A;  1TP6 A;  2CFD A;  3NHX A;  2CH9 A;  5IEO A;  1YI2 3;  3K9M C;  1RJO A;  2HMK B;  4O8S A;  2PZV A;  4XDV A;  3EX9 A;  1O7N B;  1SPU A;  2W2C A;  3EJV A;  2CFG A;  3NXJ A;  4LGQ A;  1BNS A;  3CCR 3;  1FUT A;  1SQW A;  1GY5 A;  4WHA A;  3BNC A;  1IYY A;  2GXF A;  1DYU A;  3BB9 A;  2RNT A;  3OWS A;  4X2H A;  2E2V A;  1RSN A;  5JPP A;  2K0M A;  2OCT A;  3I0Y A;  1WMP A;  1R4C A;  1Y4K A;  3N8B A;  4RNZ A;  1W2Z A;  5BVB A;  4OK0 A;  3B8L A;  5BIR A;  1A2K A;  3LOY A;  5LC7 A;  1TJD A;  1D6U A;  3PYJ A;  3X3Z A;  3FH1 A;  2UUG C;  1WMN A;  3CC4 3;  2AAE A;  4JF8 A;  3CCM 3;  2CWU A;  4NHF A;  3WA3 A;  4NPB A;  4N6V 0;  3BIR A;  4AKZ A;  2HML B;  4BL2 A;  1GD3 A;  3KFQ C;  2CKF B;  1GOV A;  1V74 A;  4HYZ A;  1JN5 A;  1EKM A;  1B2X A;  4J8T A;  2F98 A;  3HK4 A;  3CCU 3;  1KQS 2;  3OXA A;  3CXC 2;  1VQ7 3;  4O2H A;  1ZGX A;  2KF4 A;  3NBB A;  3H51 A;  3AGN A;  3CNM A;  4HM8 B;  1GD4 A;  1NO3 A;  2CFK A;  3ALA A;  2W9P A;  1FYS A;  4N6L A;  4U13 A;  3EB8 A;  3VF1 A;  1X1W A;  2M7O A;  1M1K 4;  1M1X B;  1QJG A;  3LTD A;  1K41 A;  1QAK A;  3VGN A;  1FUS A;  1G02 A;  1RN7 A;  1QVG 2;  3PS8 A;  4H61 A;  2BMQ B;  2WO0 A;  1G96 A;  3EBT A;  6STD A;  3NM7 A;  1NWW A;  5I97 A;  1OGX A;  1OAC A;  4WYK B;  4XM4 A;  4FMA A;  5JBS A;  1Q7H A;  1MWS A;  1ASK A;  1IDP A;  3FCS B;  1BNR A;  1Q40 A;  2L1S A;  4K61 A;  2W9Q A;  5AII A;  2OQE C;  4L7K A;  4MMZ B;  1LOW A;  2YFI B;  1IVX A;  3RGR A;  4Q53 A;  5TGN A;  2YFJ B;  3SLU A;  1BSC A;  4J9A A;  4ZM8 A;  3G16 A;  4I4K A;  3HI7 A;  1SIH A;  2F99 A;  4FCJ A;  4OVM A;  4EYC A;  4N6O B;  1SAR A;  1AVK A;  3I55 3;  1SII A;  3DGY A;  1BNE A;  3MWZ A;  1A2P A;  2ML6 A;  3F7S A;  3WOD G;  1VZZ A;  5KP1 A;  1M90 4;  1JZO A;  2BU4 A;  3CU3 A;  1N9J A;  1GOY A;  8CHO A;  1EA2 A;  3V92 A;  3JUN A;  2YX9 A;  2LQV A;  3I56 3;  1OF5 B;  5BU4 A;  1VQN 3;  2XFS A;  6GSP A;  3OWY A;  3S67 A;  2K54 A;  1YVB I;  1EG9 B;  4FMD A;  4HM6 B;  1L5G B;  2W0Q A;  4HZ9 B;  1VQ5 3;  1E97 A;  2SAR A;  3Q2P A;  1OCV A;  1LOY A;  3AHW A;  1VQQ A;  3G0K A;  3MG1 A;  4J5K A;  4JRF A;  3OX9 A;  4LZI A;  2Z76 A;  4I5Q A;  1AV4 A;  5CXO A;  3T8N A;  1N9E A;  1IVW A;  3HX8 A;  1UI8 A;  2V1L A;  1QAL A;  3G8Z A;  4R9L A;  3KII A;  1DVD A;  1OHO A;  3SOA A;  2ML5 A;  4TX4 A;  1HYF A;  1YGW A;  1Q42 A;  5G1L A;  5AI1 A;  3KE7 A;  2KCD A;  3EBY A;  5IER A;  1KC8 4;  5AYS C;  4G1M B;  2CK3 H;  3NBR A;  1RDS A;  1RKY A;  1IVU A;  1W00 A;  3RGA A;  3JUO A;  1I2F A;  1X1X A;  2XGL A;  3GZB A;  2O9U X;  4IT7 A;  3A5E A;  3NBJ A;  1BNG A;  3QK9 A;  3PCR A;  3Q1C A;  1W01 A;  3DGN A;  5M18 A;  1JB4 A;  1LNI A;  1UGH I;  1JZD A;  2ZHX B;  3FLJ A;  2RBI A;  3MSO A;  1STF I;  1BUJ A;  1UCK A;  1BRN L;  3OWU A;  3DMC A;  5HGR A;  1I2E A;  1TFK A;  1UCI A;  1X1Y A;  1RCL A;  1ZX2 A;  1NNV A;  1UDI I;  1US1 A;  2L4V A;  3BNE A;  3FSD A;  3VSY A;  3WMD A;  5AEU B;  1YIJ 3;  1IQX A;  2P09 A;  3WR2 A;  2XGN A;  1BAO A;  3G4S 3;  1LXE A;  2F5W A;  2FXT A;  2O3O A;  3CCV 3;  4HJL B;  2XF3 A;  2BHM A;  1IVV A;  2KF6 A;  2XH9 A;  1D6Y A;  1WQL B;  4AKY A;  7STD A;  3UL5 A;  1JJ2 2;  2GEX A;  1DMM A;  1Q40 B;  1B20 A;  3D79 A;  1VQ9 3;  1UI7 A;  5EEO A;  3F14 A;  1DVC A;  1OF5 A;  2OOV A;  4MMY B;  1BGS A;  1NDO B;  1WMO A;  3MHE A;  2CIU A;  1LOX A;  1MWR A;  3G6E 3;  2UGI A;  2HMN B;  2C4B A;  4ILF A;  1HKX A;  2WOF A;  4O3V A;  3NV0 A;  5LC6 A;  3FKA A;  4BTX A;  1TIJ A;  3HZP A;  3PCS A;  1I3I A;  2KF3 A;  2C10 A;  4MEI A;  3CME 3;  3V98 A;  2RGQ A;  1WNH A;  1ZO2 A;  1NU3 A;  1UCJ A;  2INX A;  4LEH A;  2QIY A;  3NUV A;  1AR0 A;  3FGY A;  3F9S A;  3X40 A;  1ISK A;  1O7M B;  2JDI H;  2RFR A;  1G0T A;  1T2H A;  1Z1S A;  3MPH A;  1NB3 I;  1Q81 4;  1TTO A;  4HM5 B;  1N8R 4;  1N8Q A;  1OUN A;  4MMX B;  5AIH A;  1B3S A;  1W7C A;  1NJI 4;  3BNB A;  3GAX A;  3N54 B;  3LTA A;  2F5M A;  3PGB A;  1RN1 A;  2CWT A;  3LZA A;  3CC7 3;  1AQZ A;  1Q82 4;  1PYL A;  1OHP A;  1LVN A;  3KN4 A;  3URP A;  1VQL 3;  1DMQ A;  1UW1 A;  3FF2 A;  2W04 A;  4O02 B;  3ECF A;  1MWU A;  3KZT A;  1I0X A;  3KSE D;  4EXR A;  1BRJ A;  2WGO A;  3S5C A;  2QA4 3;  1RN4 A;  3HOH A;  2XEP A;  1VQO 3;  2ZDJ A;  3S27 A;  1D6Z A;  5IG5 A;  1MGW A;  3FF0 A;  1M9G A;  2SBL A;  8RNT A;  2CG1 A;  1J2B A;  3OW2 2;  3ER7 A;  3B7C A;  1O7W B;  1B2M A;  2Q07 A;  2W03 A;  4KZ1 A;  1FGM A;  3U97 A;  4BL3 A;  2R4I A;  3M8C A;  1LRA A;  3B4O A;  3O8Y A;  4KVH A;  1U8C B;  3GRD A;  2Y74 A;  3JUM A;  3CCE 3;  1RGF A;  3IPT A;  2W6J H;  2CW9 A;  3GWR A;  1K73 4;  4XDW A;  4ORL A;  1F8N A;  3D9R A;  1E3R A;  1B2S A;  3FG1 A;  4KFD A;  3UJM A;  5IG4 A;  1FGO A;  3EN1 B;  4GHO A;  1CYV A;  1ULJ B;  1X1U A;  3K7C A;  4HM3 B;  4N6M A;  1K28 A;  3X41 A;  3EF8 A;  1YGE A;  2C11 A;  3OV4 A;  1V57 A;  3JUP A;  1B21 A;  4BTY A;  1LOV A;  2E2U A;  4R80 A;  1Q86 4;  3ZG5 A;  2K3D A;  4HAA A;  1BIR A;  1FUW A;  1I0V A;  3HII A;  4XB5 A;  1UUG B;  3MYT A;  2OQE A;  1MOL A;  3EQQ B;  1E3V A;  2BMO B;  3AGO A;  3EHC A;  1BAN A;  3Q3F A;  4LMI A;  3LXU X;  4K1U A;  3X3X A;  7GSP A;  1RGK A;  4HZB B;  1UUW B;  3FZW A;  2XRX B;  3NV0 B;  1JNQ A;  1IQY A;  1QMA A;  4X2O A;  3NX0 A;  1BNI A;  2A15 A;  2R41 A;  2GSP A;  4GL6 A;  5CF2 A;  4CPK A;  5D83 A;  1EEJ A;  2OTJ 3;  1RRH A;  3PXM A;  2WGQ A;  1YIT 3;  2B1X B;  4GSP A;  3WA2 X;  1W6G A;  2IA7 A;  3AMO B;  4R4K A;  3UL6 A;  2IMJ A;  1GY6 A;  2P05 A;  5D81 A;  1UUV B;  4BU4 A;  1GYB A;  1BRK A;  1I3F A;  1RCK A;  1YVS A;  2XSO B;  1A67 A;  1LQG C;  4N6N B;  1BSB A;  1FGQ A;  3MG3 A;  4HM7 B;  2MC8 A;  3ZG0 A;  1I8V A;  4RNY A;  3BND A;  3EN8 A;  3SX1 A;  3BLZ A;  3STD A;  3UB1 A;  2IUK A;  1QAF A;  3AHS A;  2F86 B;  4LSO A;  2Y73 A;  3JUQ A;  4WWU C;  1YJN 3;  1PU4 A;  3EC9 A;  1ULI B;  6RNT A;  2YFL B;  3F8H A;  4XBT A;  1IT7 A;  3V99 A;  3K63 A;  1AY7 A;  1GS3 A;  1C7H A;  1JRQ A;  4STD A;  4IIA A;  1FZU A;  1IK3 A;  1VQK 3;  2Z6B A;  1OH0 A;  4XBY A;  3DGM A;  4WP5 A;  5KP4 A;  1B2Z A;  1IV9 A;  1K8A 4;  1BRG A;  2BNG A;  2BIR A;  5HOH A;  4EV5 A;  3LT8 A;  3DUK A;  3WHO A;  4MJD A;  4XBX A;  4EW5 A;  1EQK A;  2CG0 A;  4FR9 A;  3DGO A;  2XSH B;  2Z7A A;  5CK6 A;  1DET A;  1JV2 B;  2CX1 A;  1JBR A;  1W6Y A;  1N5P A;  2FGT A;  3D4A A;  5FW5 A;  3F7X A;  5IG0 A;  2XR8 B;  4WFO A;  1RLS A;  4NRE A;  1RGC A;  1O7G B;  4HBR A;  1NB5 I;  1IQ8 A;  3LYG A;  3K5T A;  1BU4 A;  1YNV X;  3TDG A;  3T0U A;  5IEN A;  1W5Z A;  4FCM A;  5M1A A;  3DH2 A;  5G1K A;  1VQ4 3;  1RRL A;  4BTW A;  3LTB A;  1JB5 A;  4EBG A;  3AMO A;  2GBX B;  4KFF A;  2KF5 A;  4HM2 B;  5EQL A;  3NQZ A;  2OTL 3;  1PY3 A;  1RNT A;  2HMJ B;  3D5G A;  3CCS 3;  2BO9 B;  1A90 A;  2CFL A;  1RGL A;  3CCL 3;  1Q7Y 4;  2CX0 A;  1TRQ A;  5RNT A;  1CEW I;  2PNC A;  4HKV B;  2HOH A;  1SJW A;  1A2V A;  2WOH A;  3K0Z A;  1V58 A;  3SXX A;  1BOX A;  2QGU A;  1HU9 A;  3ROB A;  3GZY B;  1KSI A;  3KCH A;  3LML A;  2P0X A;  4FCZ A;  1TRP A;  3NM2 A;  1GMP A;  1JKG B;  3IJE B;  3B4P A;  4IPB A;  4AEQ A;  3SVA A;  3JVC A;  1I70 A;  1CYU A;  3CPW 2;  2IYJ A;  3S28 A;  5EVH A;  1T2I A;  1S5A A;  4RZM A;  2W56 B;  3N9H A;  2QEX 3;  1B27 A;  1ROA A;  1T3B A;  3X3Y A;  3DXO A;  1BRH A;  3WOF B;  4HVN A;  2FNQ A;  3IMA B;  1STD A;  2HMO B;  1BNF A;  2HMM B;  2KRT A;  2STD A;  3CNX A;  3FG4 A;  3FG3 A;  3QRD A;  3UNL A;  3EE1 A;  4FMB A;  2H0I A;  2KXG A;  3CCQ 3;  1HZ1 A;  1TU5 A;  3CD6 3;  2F4Y A;  2RSX A;  3L0R A;  2IUJ A;  3RDE A;  4CJN A;  1VQP 3;  1TFO A;  3T8U A;  4DKI A;  5BXQ A;  1EUI C;  1CQS A;  3E99 A;  4FMC A;  5KP3 A;  1BSA A;  1W2B 2;  5G2G A;  3DY5 A;  2P38 A;  4OUQ A;  1K9M 4;  4EC6 A;  5GSP A;  1RNB A;  2LYX A;  4HOH A;  1FGR A;  3DM8 A;  5STD A;  1KD1 4;  3F40 A;  3MKI A;  5AIG A;  1ZS7 A;  3G71 3;  5DRV A;  1AVL A;  1W6C A;  5ELJ A;  4CDL A;  2CHC A;  1FA3 A;  1MNL A;  4HM4 B;  3MG2 A;  1RGE A;  4LYL B;  3KKG A;  1RTU A;  3GZX B;  4K90 B;  1TUH A;  4PEJ A;  1Q9E A;  3DZL A;  1YHQ 3;  3WOE B;  3LH4 A;  4GB5 A;  1UCL A;  5JPU A;  1DE3 A;  1FGT A;  3LT9 A;  4QWT A;  3S29 A;  5IF6 A;  1VQ6 3;  7RNT A;  5IEP A;  2JQ5 A;  4K1V A;  3WDG B;  1RGH A;  3LTC A;  1VQ8 3;  1FW7 A;  1BNJ A;  3ZFZ A;  4KT3 B;  1JKG A;  4N6T A;  4BIR A;  1GOU A;  1ROV A;  3CPO A;  3D3L A;  2BMR B;  2XFT A;  1CH0 A;  1MWT A;  4R9K A;  1W02 A;  2I9W A;  5D82 A;  2MF7 A;  1QVF 2;  1BRI A;  1N5H A;  2W56 A;  2RCD A;  5DRE A;  2AAD A;  4HM0 B;  4N3V A;  3F8X A;  1U5O A; 
#chains in the Genus database with same CATH homology
 4H3U A;  1YJW 3;  3SOY A;  3H3H A;  2GBW B;  3CC2 3;  2Z77 A;  2ZL8 A;  1O7P B;  3GZR A;  1S72 3;  1IU7 A;  1GY7 A;  1WTH A;  1O7H B;  4KFE A;  1BUQ A;  1KWI A;  3HIG A;  2D42 A;  5ELU A;  1DMN A;  1VQM 3;  4L8O A;  2CC3 A;  1IT8 A;  3A76 A;  2P0M A;  4HM1 B;  3KSP A;  2UX0 A;  4L8P A;  1PFP A;  2CFW A;  1W4N A;  3PZW A;  5FGO A;  2CWV A;  1OGZ A;  1LNH A;  1YJ9 3;  1JN5 B;  2E2T A;  3DGL A;  3U1W A;  4WYK A;  2BT3 A;  4N6U A;  5A0O B;  4EV2 A;  2OWP A;  1OHS A;  3J7Y d;  5CF1 A;  4R1K A;  1T5Y A;  5AYR B;  5CLK A;  2GU3 A;  2B24 B;  3SED A;  1OPY A;  3Q90 A;  3CCJ 3;  2OOV C;  4RBN A;  1JB2 A;  3X42 A;  5AEW B;  3NQY A;  1IV7 A;  2GU1 A;  3CMA 3;  5IG3 A;  5AIF A;  2D1W A;  2GEY A;  5IW9 A;  1TP6 A;  2CFD A;  3NHX A;  2CH9 A;  5IEO A;  1YI2 3;  3K9M C;  1RJO A;  2HMK B;  4O8S A;  2PZV A;  4XDV A;  3EX9 A;  1O7N B;  1SPU A;  2W2C A;  3EJV A;  2CFG A;  3NXJ A;  4LGQ A;  3CCR 3;  1SQW A;  1GY5 A;  4WHA A;  3BNC A;  2GXF A;  1DYU A;  3BB9 A;  4X2H A;  3OWS A;  2E2V A;  5JPP A;  2K0M A;  2OCT A;  3I0Y A;  1WMP A;  1R4C A;  1Y4K A;  3N8B A;  4RNZ A;  1W2Z A;  5BVB A;  4OK0 A;  3B8L A;  1A2K A;  3LOY A;  5LC7 A;  3X3Z A;  1D6U A;  3PYJ A;  3FH1 A;  1WMN A;  3CC4 3;  4JF8 A;  3CCM 3;  2CWU A;  4NHF A;  3WA3 A;  4N6V 0;  4AKZ A;  2HML B;  1GD3 A;  3KFQ C;  2CKF B;  1V74 A;  4HYZ A;  1JN5 A;  1EKM A;  4J8T A;  2F98 A;  3HK4 A;  3CCU 3;  1KQS 2;  3OXA A;  3CXC 2;  1VQ7 3;  4O2H A;  3NBB A;  3H51 A;  4HM8 B;  3CNM A;  1GD4 A;  1NO3 A;  2CFK A;  3ALA A;  2W9P A;  4N6L A;  4U13 A;  3EB8 A;  3VF1 A;  2M7O A;  1M1K 4;  1M1X B;  1QJG A;  3LTD A;  1K41 A;  1QAK A;  3VGN A;  1RN7 A;  1QVG 2;  3PS8 A;  4H61 A;  2BMQ B;  2WO0 A;  1G96 A;  3EBT A;  6STD A;  3NM7 A;  1NWW A;  5I97 A;  1OGX A;  1OAC A;  4WYK B;  4XM4 A;  4FMA A;  5JBS A;  1ASK A;  1IDP A;  3FCS B;  1Q40 A;  4K61 A;  2W9Q A;  5AII A;  2OQE C;  4L7K A;  4MMZ B;  2YFI B;  1IVX A;  3RGR A;  4Q53 A;  5TGN A;  2YFJ B;  3SLU A;  4J9A A;  4ZM8 A;  3G16 A;  4I4K A;  3HI7 A;  1SIH A;  2F99 A;  4FCJ A;  4OVM A;  4EYC A;  4N6O B;  1AVK A;  3I55 3;  1SII A;  3MWZ A;  2ML6 A;  3F7S A;  3WOD G;  1VZZ A;  5KP1 A;  1M90 4;  3CU3 A;  1N9J A;  8CHO A;  1EA2 A;  3V92 A;  3JUN A;  2YX9 A;  2LQV A;  3I56 3;  1OF5 B;  1VQN 3;  2XFS A;  3OWY A;  3S67 A;  2K54 A;  1YVB I;  1EG9 B;  4FMD A;  4HM6 B;  1L5G B;  2W0Q A;  4HZ9 B;  1VQ5 3;  1E97 A;  3Q2P A;  1OCV A;  3G0K A;  3MG1 A;  4JRF A;  4LZI A;  4XB5 A;  3UJM A;  1Q7Y 4;  3OX9 A;  2Z76 A;  5CXO A;  1AV4 A;  3T8N A;  1N9E A;  1IVW A;  3HX8 A;  1UI8 A;  2V1L A;  1QAL A;  3G8Z A;  4R9L A;  3KII A;  1DVD A;  1OHO A;  3SOA A;  2ML5 A;  4TX4 A;  1Q42 A;  5IER A;  5AI1 A;  3KE7 A;  2KCD A;  3EBY A;  1KC8 4;  5AYS C;  4G1M B;  2CK3 H;  3NBR A;  1RKY A;  1IVU A;  1W00 A;  3RGA A;  3JUO A;  2XGL A;  3GZB A;  2O9U X;  4IT7 A;  3NBJ A;  3QK9 A;  3PCR A;  3Q1C A;  1W01 A;  3DGN A;  1JB4 A;  3FLJ A;  3MSO A;  1STF I;  3OWU A;  3DMC A;  5HGR A;  1TFK A;  1ZX2 A;  2L4V A;  1US1 A;  3BNE A;  3VSY A;  3FSD A;  3WMD A;  5AEU B;  1YIJ 3;  1IQX A;  2P09 A;  2XGN A;  3G4S 3;  1LXE A;  2FXT A;  2O3O A;  3CCV 3;  4HJL B;  2XF3 A;  2BHM A;  1IVV A;  2XH9 A;  1D6Y A;  1WQL B;  4AKY A;  7STD A;  3UL5 A;  1JJ2 2;  2GEX A;  1DMM A;  1Q40 B;  1VQ9 3;  1UI7 A;  5EEO A;  3F14 A;  1DVC A;  1OF5 A;  2OOV A;  4MMY B;  1WMO A;  1NDO B;  3MHE A;  2CIU A;  1LOX A;  3G6E 3;  2HMN B;  1HKX A;  2WOF A;  4O3V A;  3NV0 A;  5LC6 A;  3FKA A;  4BTX A;  1TIJ A;  3HZP A;  3PCS A;  4MEI A;  2C10 A;  3CME 3;  3V98 A;  2RGQ A;  1WNH A;  1ZO2 A;  1NU3 A;  2INX A;  4LEH A;  2QIY A;  3NUV A;  1AR0 A;  3FGY A;  3F9S A;  3X40 A;  1ISK A;  1O7M B;  2JDI H;  2RFR A;  1Z1S A;  3MPH A;  1NB3 I;  1Q81 4;  4HM5 B;  1N8R 4;  1N8Q A;  1OUN A;  4MMX B;  5AIH A;  1W7C A;  1NJI 4;  3BNB A;  3GAX A;  3N54 B;  3LTA A;  3PGB A;  3CC7 3;  2CWT A;  3LZA A;  1Q82 4;  1OHP A;  1LVN A;  3KN4 A;  1VQL 3;  1DMQ A;  1UW1 A;  3FF2 A;  2W04 A;  4O02 B;  3ECF A;  3KZT A;  3KSE D;  4EXR A;  2WGO A;  3S5C A;  2QA4 3;  1VQO 3;  2ZDJ A;  3S27 A;  1D6Z A;  5IG5 A;  3FF0 A;  1M9G A;  2SBL A;  2CG1 A;  1J2B A;  3OW2 2;  3ER7 A;  3B7C A;  1O7W B;  2Q07 A;  2W03 A;  4KZ1 A;  1FGM A;  3U97 A;  2R4I A;  3M8C A;  3B4O A;  3O8Y A;  4KVH A;  1U8C B;  3GRD A;  2Y74 A;  3JUM A;  3CCE 3;  3IPT A;  2W6J H;  2CW9 A;  3GWR A;  1K73 4;  4XDW A;  4ORL A;  1F8N A;  3D9R A;  1E3R A;  3FG1 A;  4KFD A;  1FGO A;  3EN1 B;  1CYV A;  1ULJ B;  3K7C A;  4HM3 B;  4N6M A;  1K28 A;  3X41 A;  3EF8 A;  1YGE A;  2C11 A;  3OV4 A;  3JUP A;  4BTY A;  2E2U A;  4R80 A;  1Q86 4;  1FUW A;  3HII A;  3MYT A;  2OQE A;  1MOL A;  3EQQ B;  1E3V A;  2BMO B;  3EHC A;  4LMI A;  3X3X A;  3LXU X;  4K1U A;  4HZB B;  1UUW B;  3FZW A;  2XRX B;  3NV0 B;  1JNQ A;  1IQY A;  1QMA A;  4X2O A;  3NX0 A;  2A15 A;  4GL6 A;  5CF2 A;  2OTJ 3;  5D83 A;  1RRH A;  3PXM A;  2WGQ A;  1YIT 3;  2B1X B;  3WA2 X;  1W6G A;  2IA7 A;  3AMO B;  4R4K A;  3UL6 A;  2IMJ A;  1GY6 A;  2P05 A;  5D81 A;  1UUV B;  1GYB A;  1A67 A;  2XSO B;  4N6N B;  1FGQ A;  3MG3 A;  4HM7 B;  2MC8 A;  4RNY A;  3BND A;  3EN8 A;  3SX1 A;  3BLZ A;  3STD A;  3UB1 A;  2IUK A;  1QAF A;  2F86 B;  4LSO A;  2Y73 A;  3JUQ A;  4WWU C;  1YJN 3;  1PU4 A;  3EC9 A;  1ULI B;  2YFL B;  3F8H A;  4XBT A;  1IT7 A;  3V99 A;  3K63 A;  1IK3 A;  1GS3 A;  1C7H A;  1JRQ A;  4STD A;  4IIA A;  1VQK 3;  2Z6B A;  1OH0 A;  4XBY A;  3DGM A;  4WP5 A;  5KP4 A;  1IV9 A;  1K8A 4;  2BNG A;  1U5O A;  3LT8 A;  4EV5 A;  3DUK A;  4MJD A;  4XBX A;  1EQK A;  2CG0 A;  4FR9 A;  3DGO A;  2XSH B;  2Z7A A;  5CK6 A;  1JV2 B;  1W6Y A;  1N5P A;  2FGT A;  5FW5 A;  3F7X A;  5IG0 A;  2XR8 B;  4WFO A;  4NRE A;  1O7G B;  4HBR A;  1NB5 I;  1IQ8 A;  3LYG A;  3K5T A;  3TDG A;  3T0U A;  5IEN A;  1W5Z A;  4FCM A;  1VQ4 3;  1RRL A;  4BTW A;  3LTB A;  1JB5 A;  4EBG A;  3AMO A;  2GBX B;  4KFF A;  4HM2 B;  5EQL A;  3NQZ A;  2OTL 3;  2HMJ B;  3CCS 3;  1A90 A;  2BO9 B;  2CFL A;  3CCL 3;  1CEW I;  2PNC A;  4HKV B;  1SJW A;  1A2V A;  2WOH A;  3K0Z A;  5IG4 A;  3SXX A;  2QGU A;  1HU9 A;  3ROB A;  3GZY B;  1KSI A;  4CCV A;  3LML A;  2P0X A;  4FCZ A;  3NM2 A;  3IJE B;  1JKG B;  4IPB A;  3B4P A;  4AEQ A;  3SVA A;  3JVC A;  1CYU A;  3CPW 2;  3S28 A;  5EVH A;  1S5A A;  4RZM A;  2W56 B;  3N9H A;  2QEX 3;  1ROA A;  3X3Y A;  3DXO A;  3WOF B;  4HVN A;  2FNQ A;  3IMA B;  1STD A;  2HMO B;  2HMM B;  2KRT A;  3CNX A;  2STD A;  3FG4 A;  3QRD A;  3FG3 A;  3UNL A;  3EE1 A;  4FMB A;  2KXG A;  3CCQ 3;  1TU5 A;  3CD6 3;  2IUJ A;  2RSX A;  3L0R A;  3RDE A;  1VQP 3;  1TFO A;  3T8U A;  5BXQ A;  1CQS A;  3E99 A;  4FMC A;  5KP3 A;  1W2B 2;  5G2G A;  3DY5 A;  2P38 A;  4OUQ A;  1K9M 4;  4EC6 A;  2LYX A;  1FGR A;  3DM8 A;  5STD A;  1KD1 4;  3F40 A;  3MKI A;  5AIG A;  3G71 3;  5DRV A;  1AVL A;  1W6C A;  5ELJ A;  4CDL A;  2CHC A;  1FA3 A;  1MNL A;  4HM4 B;  3MG2 A;  3KKG A;  3GZX B;  4K90 B;  1TUH A;  4PEJ A;  3DZL A;  1YHQ 3;  3WOE B;  3LH4 A;  4GB5 A;  5JPU A;  1FGT A;  3LT9 A;  4QWT A;  3S29 A;  5IF6 A;  1VQ6 3;  5IEP A;  2JQ5 A;  4K1V A;  3WDG B;  3LTC A;  1VQ8 3;  1JKG A;  4N6T A;  1ROV A;  3CPO A;  3D3L A;  2BMR B;  2XFT A;  4R9K A;  1W02 A;  2I9W A;  5D82 A;  2MF7 A;  1QVF 2;  2W56 A;  1N5H A;  2RCD A;  5DRE A;  4HM0 B;  4N3V A;  3F8X A;  2XEP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...