4WP5A

Chaetomium thermophilum mex67 ntf2-like domain complexed with mtr2
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
201
structure length
199
Chain Sequence
MPTPLPQLPSNVRDGENNVASTFLQAFFQLWDHDRLTLIPQFYDSETTFSVVFATDSPQDPASSSCSKFSRNLNILSPPSTLQRLFVGSNLIADLWKVLPATRHPSLDQTSQWLIDCHTFPHLADPTGMAPYAMGLMINVNGQCEEADISQNLYGTRTFSRCFILGPSKPGAPHPYRVLSDQLTLHTWKPQPAPQVGTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural characterization of the principal mRNA-export factor Mex67-Mtr2 from Chaetomium thermophilum.
pubmed doi rcsb
source organism Chaetomium thermophilum
molecule tags Transport protein
molecule keywords mRNA export protein
total genus 37
structure length 199
sequence length 201
ec nomenclature
pdb deposition date 2014-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4wp5A00
3F14A 3G16A 4XBYA 2XR8B 3ECFA 1O7WB 3NV0B 3IPTA 1SJWA 1W02A 3EX9A 5IF6A 4HKVB 2YFJB 1EA2A 1NWWA 4LGQA 4R9LA 5DREA 3EF8A 4STDA 1NDOB 3DZLA 3JUNA 3HK4A 1ULIB 4WP5A 5BXQA 5CK6A 3EJVA 1AR0A 3B4PA 4FCJA 2HMKB 1QMAA 2K54A 3GWRA 3OWSA 4OVMA 5AI1A 2BMQB 3NV0A 2RFRA 3G8ZA 2CKFB 4HM5B 4K1VA 4OUQA 2STDA 3F8XA 2HMJB 4ORLA 1S5AA 5AIGA 1A2KA 3EQQB 3F9SA 2R4IA 3CU3A 3ROBA 3STDA 5IG3A 4HVNA 1JB4A 3H51A 2PZVA 2B24B 3GZYB 3HZPA 4L8OA 4HM3B 4LMIA 4HJLB 1TP6A 2A15A 3B4OA 1W6YA 2BNGA 5JPPA 1GY6A 3FH1A 5KP1A 3G0KA 1OCVA 1DMQA 1O7NB 3DXOA 3FKAA 4WYKA 3SEDA 8CHOA 3M8CA 1OUNA 3CPOA 1OF5B 2BMRB 1EG9B 2CHCA 1ZO2A 3UJMA 1TUHA 2Z7AA 4PEJA 1O7MB 1STDA 2YFIB 3GZBA 2YFLB 3JUMA 3MYTA 3NM2A 1C7HA 3E99A 6STDA 2GEXA 1O7PB 3CNMA 5IEPA 5KP4A 2GEYA 3F7XA 1CQSA 5DRVA 3MHEA 1O7HB 3EC9A 3OX9A 3FF0A 4X2HA 1DMNA 3NHXA 1HKXA 3FF2A 2GBWB 2Z77A 3LYGA 1GS3A 2QGUA 4H3UA 4XB5A 2BMOB 4I4KA 3FLJA 1QJGA 4HM1B 3EBYA 3KKGA 5IERA 1GYBA 1OF5A 1OHOA 2B1XB 4HM8B 5IG0A 1W00A 3RGAA 1OGZA 4XDVA 3MG1A 3KE7A 5AEWB 3KZTA 3MSOA 3GZXB 1NU3A 5STDA 3EN1B 3K7CA 5HGRA 2XSHB 5BVBA 2HMMB 3A76A 1JB2A 1GY5A 1Q40B 2GXFA 3F7SA 3F8HA 4Q53A 5CXOA 5CF1A 3GRDA 3VGNA 1JKGB 3LZAA 3KSPA 1Q42A 5FW5A 5AEUB 1E3RA 3H3HA 3JUPA 3HX8A 4XDWA 2I9WA 1ULJB 4R1KA 1UUWB 3EHCA 3NXJA 4HM0B 3NBRA 4L8PA 1JN5B 5AIFA 3VSYA 3WMDA 1JB5A 1OGXA 3FGYA 1O7GB 3OWYA 3DMCA 3I0YA 3T8NA 1OHSA 4HZBB 1OPYA 2RGQA 2UX0A 4IIAA 4J8TA 5EVHA 3ER7A 1OHPA 1K41A 3DUKA 5TGNA 1IDPA 2OWPA 5D81A 5IG5A 3GZRA 3DM8A 1E97A 3B8LA 4U13A 2XRXB 4WYKB 5D82A 5IEOA 2F86B 5KP3A 3RGRA 4XBTA 1ASKA 2F99A 5JPUA 5AIHA 4L7KA 3Q90A 4HZ9B 4LEHA 4XBXA 3BLZA 1WQLB 2HMLB 3OWUA 4KVHA 3SOYA 2JQ5A 7STDA 5AIIA 3EN8A 4HM2B 1ISKA 5IG4A 3MKIA 1VZZA 1OH0A 1GY7A 4R9KA 1BUQA 3BB9A 1Q40A 1ZX2A 2IMJA 4MJDA 4K1UA 2RCDA 3SOAA 4N3VA 4CDLA 1DMMA 2HMOB 1W01A 3D9RA 2W2CA 4RZMA 5CLKA 2XSOB 4FCMA 3S5CA 5D83A 4HM7B 1JKGA 2Z76A 3F40A 4X2OA 1Z1SA 2INXA 1U5OA 4GB5A 5CF2A 3MG2A 3JUOA 3B7CA 3UNLA 1E3VA 5G2GA 3FZWA 3JUQA 4WWUC 4J9AA 3T8UA 2GBXB 4HM6B 3EBTA 3CNXA 2QIYA 3OV4A 4HM4B 2F98A 1JN5A 3MG3A 3FSDA 4XM4A 3K0ZA 3OXAA 2HMNB 3NUVA 5IENA 1UUVB
chains in the Genus database with same CATH superfamily
3F14A 4LSOA 3ECFA 3NV0B 2WOHA 1MWTA 3EX9A 4NPBA 5DREA 1QALA 5BIRA 2KXGA 1X1WA 3QRDA 1NDOB 2CWTA 5BXQA 3HK4A 1AV4A 1VQ93 4OVMA 1VQM3 2P05A 1V58A 4N6MA 3SXXA 4OUQA 3NV0A 2O3OA 2RFRA 2CKFB 4K61A 3CCV3 1I70A 1KD14 1JNQA 3CC43 2KAAA 1S5AA 3LT9A 3LOYA 2CFGA 3MPHA 1RNTA 3H51A 4MMZB 3GZYB 4R80A 2CIUA 4HM3B 4HJLB 1TP6A 3LTCA 3B4OA 2BNGA 3AGOA 2ML5A 5KP1A 4KFFA 4WYKA 1O7NB 3DXOA 3SEDA 1Q824 1B2UA 2CG0A 2P38A 3M8CA 3WODG 1JJ22 1B21A 4LYLB 2BMRB 1N8QA 3HOHA 2QEX3 2IA7A 1STDA 4FCZA 1J2BA 1W6GA 2W6JH 5G1LA 1O7PB 1FGQA 1VQ63 3L0RA 1ZGXA 2XF3A 4H61A 1UGHI 2D42A 1O7HB 1GMRA 3GAXA 3NHXA 1HKXA 4MMXB 2GBWB 3LMLA 2BMOB 3V99A 3FLJA 2XH9A 3EBYA 3WA2X 1OHOA 1YIJ3 4BTXA 1OGZA 4XDVA 5EEOA 1I0VA 1Q814 1WMPA 2W0QA 3PXMA 5HGRA 2Z6BA 3K63A 3X3ZA 1TRPA 5BVBA 3F7SA 2F5MA 1JB2A 1Q40B 2GXFA 2Y74A 1FUWA 1W7CA 3VGNA 1JKGB 1CYUA 1T2IA 4RNZA 4CPKA 1Q42A 6RNTA 1I0XA 1BRHA 2F4YA 3JUPA 2I9WA 1B3SA 3NXJA 1JN5B 1JZDA 4CJNA 1EKMA 2WGQA 3I0YA 4EBGA 2RGQA 5TGNA 3ER7A 3WOEB 3DUKA 1X1XA 2OWPA 3LXUX 1LOXA 1MGWA 1B2ZA 2RNTA 3B8LA 3BNEA 3K9MC 4KZ1A 5D82A 4AKYA 2F86B 2KF4A 2M7OA 3RGRA 2F99A 2CG1A 3NBJA 1GOVA 3Q3FA 5AIHA 1EUIC 1LXEA 4KFDA 1BRNL 3BLZA 3D4AA 1WQLB 2WO0A 1JRQA 1R4CA 3SOYA 1VQK3 3QK9A 5AIIA 3EN8A 1VQ43 1M1K4 3S27A 1OH0A 4NREA 1M9GA 3KCHA 1PFPA 3D5GA 4R9KA 1Q40A 3RDEA 2Q07A 1F8NA 4CDLA 2HMOB 2Y73A 5CLKA 1FZUA 2V1LA 2XSOB 5D83A 4AKZA 1RKYA 3D3LA 3O8YA 4IPBA 3NX0A 5G1KA 1G96A 1IQYA 2INXA 4EV5A 1IYYA 5M1AA 2CWUA 4DKIA 1UW1A 3UB1A 1TTOA 1E3VA 1QVF2 4JRFA 1RMSA 3KN4A 3S28A 3T8UA 5AYSC 1DVDA 2GBXB 3FG1A 3EBTA 4HM6B 4I5QA 3TDGA 3OV4A 4BL3A 2F98A 2W03A 3UL6A 1BRGA 1JBSA 1CH0A 1WMOA 1JV2B 3G16A 4XBYA 1DETA 3PZWA 3IPTA 1SJWA 4HKVB 4LGQA 1EEJA 2H0HA 3EF8A 4WP5A 3DZLA 3JUNA 4O02B 1YIT3 1YJ93 2D1WA 2K54A 3U97A 2E2VA 4BIRA 1QVG2 2BMQB 4ORLA 3CCS3 5GSPA 2HMJB 1RCLA 1RN1A 3BNDA 2R4IA 3CU3A 2CX0A 3ROBA 3STDA 4FMDA 3JVCA 4G1MB 3ZG5A 4HVNA 5IG3A 1BNGA 1HYFA 4L8OA 1SIHA 2ZL8A 4LMIA 3CMA3 2A15A 2R41A 5JPPA 3N9HA 1GY6A 1UCLA 3RNTA 2BO9B 1AVKA 1G02A 4FMCA 8CHOA 4EYCA 1W2ZA 3PGBA 1OUNA 7RNTA 1RRLA 1AVLA 3AHSA 1Q7Y4 1EG9B 2CHCA 3BNCA 1I2FA 5AEWB 2Z7AA 3DGLA 4PEJA 1IQXA 1O7MB 2YFIB 1SIIA 3SVAA 1AY7A 1C7HA 3E99A 2GEXA 3CNMA 4AEQA 6STDA 5IEPA 4HAAA 4LZIA 3F7XA 2WOFA 3SLUA 5DRVA 3FCSB 2C4BA 1D6UA 3EC9A 3OX9A 4X2HA 3HIGA 2RSXA 1DYUA 2OTJ3 3LYGA 1BAOA 3NQZA 1QJGA 3DH2A 1SARA 1D6ZA 5IERA 1OF5A 3DGOA 2CC3A 4BTWA 1A67A 1B20A 1X1UA 2GU3A 1IVWA 3AMOB 3KZTA 3GZXB 5STDA 3K7CA 2XSHB 1JZOA 3A76A 1GY5A 1LVNA 1YGEA 5CXOA 3CCU3 3GRDA 1N9EA 2CW9A 2XFSA 1IQ8A 3ZFZA 1VQQA 3DGYA 3BU4A 1ULJB 2K3DA 1UUWB 1FGRA 1QAFA 3LTBA 4JF8A 4R4KA 3VSYA 3WMDA 1GD3A 3NQYA 2CWVA 4WHAA 1BRJA 3DMCA 1FW7A 1OHSA 4EXRA 3LT8A 1CEWI 2K0MA 4IT7A 1BUJA 2J8XB 1X1YA 1IU7A 2KF6A 1E97A 4GL6A 4O3VA 4WYKB 1DE3A 1VQN3 4XBTA 1ASKA 1K734 4RNYA 4HZ9B 1V57A 1EQKA 4MEIA 2HMLB 1IK3A 3OW22 3CCM3 2JDIH 2KF3A 5IG4A 1RGHA 2GU1A 1VZZA 2W56A 1B2SA 2QA43 1BUQA 3BB9A 4K90B 1GOYA 4MJDA 1BOXA 4N3VA 1DMMA 1BSAA 1RTUA 1FUSA 3D9RA 3S5CA 1BNRA 1FYSA 2CFLA 2O9UX 4J5GA 1RGCA 2FNQA 2Z76A 1R4YA 4N6UA 2OQEC 4GB5A 3I553 2XGLA 1IT8A 3FG3A 3KFQC 1NB5I 2BU4A 1FGOA 2AADA 2KRTA 3B7CA 1BU4A 3JUQA 3HIIA 1RLSA 1KQS2 3CNXA 3BNBA 3CC73 2W9QA 2XGNA 3X3YA 1JN5A 2OQEA 3FSDA 4XM4A 1MNLA 2HMNB 2ZDJA 2CFWA 3S29A 1UUVB 2SARA 5JPUA 1US1A 1UCKA 2E2UA 1IT7A 1G0TA 1W02A 2HOHA 4OK0A 4EW5A 1PY3A 5IF6A 2YFJB 3J7Yd 1LRAA 4R9LA 3G4S3 1RN7A 2C10A 2PNCA 1W6CA 3LTAA 5CK6A 1MWSA 1AR0A 2P0XA 3B4PA 2H0IA 2HMKB 3EJVA 3OWSA 3X41A 5AI1A 1U8CB 3IJEB 4HM5B 1LNIA 3F8XA 1A2PA 1YI23 3BIRA 1MGRA 5A0OB 1JB4A 2PZVA 2B24B 3PYJA 1YVSA 5ELJA 1T5YA 4HOHA 1TIJA 2FGTA 3FH1A 5JBSA 3DGMA 3FKAA 1GSPA 3Q1CA 1HU9A 2F56A 1T3BA 2IYJA 1BNSA 4TX4A 3UJMA 1TUHA 1VQL3 1FGTA 1RNBA 2YFLB 1BRKA 3JUMA 3MYTA 1Q864 2AAEA 2F5WA 1FA3A 3WR2A 1YHQ3 1UCIA 1TRQA 1M1XB 1GD4A 1NNVA 5CF1A 3FF2A 4H3UA 1GS3A 2QGUA 1RDSA 3VF1A 4HM1B 1RGEA 3KKGA 1BVIA 1GYBA 3EE1A 1RJOA 5IG0A 1BSBA 3MG1A 3CCQ3 3PCSA 1MWRA 3EN1B 1L5GB 3NM7A 4GHOA 3I563 2ZA4A 3KSPA 1YJN3 1LQGC 3Q2PA 1E3RA 3H3HA 3IMAB 4XDWA 2C11A 1ISKA 3EHCA 3G713 3NBRA 1PYLA 4BL2A 1BSEA 3CPW2 1JB5A 1OGXA 3FGYA 1O7GB 3OWYA 1M904 2SBLA 1B27A 1A2VA 4HZBB 1RHLA 1OPYA 2UX0A 4IIAA 5EVHA 3V98A 1OHPA 1K41A 3X42A 1RGLA 5D81A 2MC8A 4EC6A 3GZRA 3S67A 3DM8A 4U13A 5IG5A 3D5IA 2L1SA 1MOLA 4KFEA 1LNHA 5KP3A 1YVBI 5BU4A 4N6NB 2LQVA 3X3XA 3Q90A 1BSDA 4O8SA 4LEHA 4XBXA 3OWUA 3WDGB 1D6YA 7STDA 3MKIA 3WHOA 2GSPA 1ZX2A 1I2GA 2IMJA 3SX1A 4K1UA 2RCDA 6GSPA 1TFKA 3EB8A 1BNFA 1B2XA 5FGOA 1Q7HA 3CXC2 1W01A 5LC7A 3ZG0A 9RNTA 5IENA 1UCJA 1RSNA 3LH4A 4FCMA 4X2OA 1KWIA 3MG2A 3NBBA 1NO3A 3JUOA 1UDII 1I2EA 5AYRB 4O2HA 3T0UA 1CYVA 2W04A 4WWUC 4J9AA 5IW9A 3LTDA 3KIIA 2QIYA 5M18A 4FMAA 4HM4B 3MG3A 1ZS7A 1VQ83 3K0ZA 2ZHXB 3OXAA 3CC23 2OCTA 1AQZA 1IVVA 2UUGC 2XR8B 1O7WB 2YX9A 1YNVX 1MWUA 3SYUA 1W5ZA 1EA2A 1NWWA 1ROVA 1FGMA 2WGOA 3GSPA 1RRHA 3PCRA 4STDA 2BIRA 5EQLA 5M19A 1ULIB 4HYZA 1C54A 3AGNA 4FCJA 5AIGA 3HI7A 3GWRA 1QMAA 5IEOA 1NB3I 4K1VA 3G8ZA 2STDA 1K9M4 1A2KA 3EQQB 3F9SA 2OOVA 1GMPA 2W56B 1IV7A 2CFKA 2OTL3 1GMQA 3D79A 3HZPA 1KC84 1JBRA 1W6YA 3AHWA 1BNJA 3G0KA 1OCVA 1DMQA 2CH9A 5HOHA 3DY5A 1WNHA 3CPOA 1RCKA 1OF5B 1BSCA 3ALAA 4BU4A 2CFDA 1UGIA 1ZO2A 2OOVC 3K5TA 3GZBA 2MF7A 1GOUA 3NM2A 1VQ73 1N9JA 3CCJ3 1WTHA 5KP4A 1IV9A 2E2TA 2GEYA 3URPA 2L4VA 1W4NA 3WA3A 1YJW3 3UL5A 4HBRA 1Q9EA 1CQSA 2IUKA 1ROAA 3MHEA 7GSPA 2ML6A 3FF0A 1SPUA 1DMNA 1RGKA 2BT3A 2Z77A 4XB5A 2P0MA 1BRIA 1TFOA 4I4KA 4MMYB 3CCR3 8RNTA 2CK3H 1YGWA 1LOVA 4HM8B 2B1XB 1W2B2 1I8VA 1OACA 1W00A 1T2HA 3A5EA 4N6OB 3RGAA 3KE7A 3MSOA 1NU3A 1UI7A 2HMMB 1RGGA 3DGNA 3F8HA 2H0GA 4Q53A 1TU5A 1BGSA 2KCDA 3LZAA 3CCL3 1S723 5ELUA 5FW5A 1BNEA 5AEUB 1NJI4 3KSED 3HX8A 3PS8A 4R1KA 4HM0B 4KT3B 4L8PA 4N6LA 3CD63 1KSIA 5AIFA 1RGAA 3T8NA 5I97A 1TJDA 1JBTA 1A90A 4J8TA 3AMOA 3FG4A 1IDPA 3N54B 1I3IA 2XRXB 5LC6A 1LOYA 2CX1A 1VQO3 1BIRA 4L7KA 4RBNA 3MWZA 1IVXA 1WMNA 2RBIA 1QAKA 2IUJA 1UUGB 4KVHA 4WFOA 2JQ5A 4HM2B 3CME3 1Y4KA 2P09A 1GY7A 2UGIA 4CCVA 3U1WA 1DVCA 3N8BA 4N6V0 4ILFA 1BRSA 1N5PA 3G6E3 1IVUA 3SOAA 4FMBA 4QWTA 4ZM8A 1VQP3 4RZMA 2W2CA 3V92A 1K28A 2W9PA 3X40A 1K8A4 2KF5A 4HM7B 1JKGA 2XFTA 3F40A 1PU4A 1LOWA 1BANA 1Z1SA 1FUTA 1U5OA 2XEPA 5CF2A 3WOFB 1BNIA 4J5KA 3UNLA 4EV2A 5G2GA 1SQWA 1UI8A 2LYXA 3FZWA 4BTYA 1RGFA 1VQ53 1N5HA 1LQMB 4RNTA 1N8R4 2BHMA 1RN4A 2FXTA 1B2MA 4GSPA 1V74A 3CCE3 1STFI 1I3FA 4FR9A 1HZ1A 3NUVA 4NHFA 4N6TA 2IY2A 5RNTA
chains in the Genus database with same CATH topology
3F14A 4LSOA 3ECFA 3NV0B 2WOHA 3EX9A 5DREA 1QALA 2KXGA 3QRDA 1NDOB 2CWTA 5BXQA 3HK4A 1AV4A 1VQ93 4OVMA 1VQM3 2P05A 4N6MA 3SXXA 4OUQA 3NV0A 2O3OA 2RFRA 2CKFB 4K61A 3CCV3 1KD14 3CC43 1JNQA 1S5AA 3LT9A 3LOYA 2CFGA 3MPHA 3H51A 4MMZB 3GZYB 4R80A 2CIUA 4HM3B 4HJLB 1TP6A 3LTCA 3B4OA 2BNGA 2ML5A 5KP1A 4KFFA 4WYKA 1O7NB 3DXOA 3SEDA 1Q824 2CG0A 2P38A 3WODG 3M8CA 1JJ22 2BMRB 1N8QA 2QEX3 2IA7A 1STDA 4FCZA 1J2BA 1W6GA 2W6JH 1O7PB 1FGQA 1VQ63 3L0RA 2XF3A 4H61A 2D42A 1O7HB 3GAXA 3NHXA 1HKXA 4MMXB 2GBWB 3LMLA 2BMOB 3V99A 3FLJA 2XH9A 3EBYA 3WA2X 1OHOA 1YIJ3 4BTXA 1OGZA 4XDVA 5EEOA 1Q814 1WMPA 2W0QA 3PXMA 5HGRA 2Z6BA 3K63A 3X3ZA 5BVBA 3F7SA 2Y74A 1JB2A 1Q40B 2GXFA 1FUWA 1W7CA 3VGNA 1JKGB 1CYUA 4RNZA 1Q42A 3JUPA 2I9WA 3NXJA 1JN5B 1EKMA 2WGQA 3I0YA 4EBGA 2RGQA 5TGNA 3ER7A 3WOEB 3DUKA 2OWPA 3LXUX 1LOXA 3BNEA 3B8LA 3K9MC 4KZ1A 4AKYA 5D82A 2F86B 2M7OA 3RGRA 2F99A 2CG1A 3NBJA 5AIHA 1LXEA 4KFDA 3BLZA 1WQLB 2WO0A 1JRQA 1R4CA 3SOYA 3QK9A 5AIIA 3EN8A 1VQ43 1M1K4 3S27A 1OH0A 4NREA 1M9GA 4R9KA 1PFPA 1Q40A 3RDEA 2Q07A 1F8NA 4CDLA 2HMOB 2Y73A 5CLKA 2V1LA 2XSOB 5D83A 4AKZA 1RKYA 3D3LA 3O8YA 4IPBA 3NX0A 1G96A 1IQYA 2INXA 4EV5A 2CWUA 1UW1A 3UB1A 1QVF2 1E3VA 4JRFA 3KN4A 3S28A 3T8UA 5AYSC 1DVDA 2GBXB 3FG1A 3EBTA 4HM6B 3TDGA 3OV4A 2F98A 2W03A 3UL6A 1WMOA 1JV2B 3G16A 4XBYA 3PZWA 3IPTA 1SJWA 4HKVB 4LGQA 3EF8A 4WP5A 3DZLA 3JUNA 4O02B 1YIT3 1YJ93 2D1WA 2K54A 3U97A 2E2VA 1QVG2 2BMQB 4ORLA 3CCS3 2HMJB 3BNDA 2R4IA 3CU3A 3ROBA 3STDA 4FMDA 3JVCA 4G1MB 5IG3A 4HVNA 4L8OA 1SIHA 2ZL8A 4LMIA 3CMA3 2A15A 5JPPA 3N9HA 1GY6A 2BO9B 1AVKA 4FMCA 8CHOA 4EYCA 1W2ZA 3PGBA 1OUNA 1RRLA 1AVLA 1Q7Y4 1EG9B 2CHCA 3BNCA 5AEWB 3CD63 3DGLA 2Z7AA 4PEJA 1IQXA 2YFIB 1O7MB 1SIIA 3SVAA 1C7HA 3E99A 6STDA 2GEXA 3CNMA 4AEQA 5IEPA 4LZIA 3F7XA 2WOFA 3SLUA 5DRVA 3FCSB 1D6UA 3EC9A 3OX9A 4X2HA 3HIGA 2RSXA 1DYUA 2OTJ3 3LYGA 3NQZA 1QJGA 1D6ZA 5IERA 1OF5A 3DGOA 2CC3A 4BTWA 1A67A 2GU3A 1IVWA 3AMOB 3KZTA 3GZXB 5STDA 3K7CA 2XSHB 3A76A 1GY5A 1LVNA 1YGEA 5CXOA 3CCU3 3GRDA 1N9EA 2CW9A 2XFSA 1IQ8A 1ULJB 3LTBA 1UUWB 1FGRA 1QAFA 4JF8A 4R4KA 3VSYA 3WMDA 1GD3A 3NQYA 2CWVA 4WHAA 3DMCA 1OHSA 4EXRA 3LT8A 1CEWI 2K0MA 4IT7A 1IU7A 4O3VA 1E97A 4GL6A 4WYKB 1VQN3 4XBTA 1ASKA 1K734 4RNYA 4HZ9B 1EQKA 4MEIA 2HMLB 1IK3A 3OW22 3CCM3 2JDIH 5IG4A 2GU1A 1VZZA 2W56A 1BUQA 2QA43 3BB9A 4K90B 4MJDA 4N3VA 1DMMA 3S5CA 3D9RA 2CFLA 2O9UX 2FNQA 2Z76A 4N6UA 2OQEC 4GB5A 3I553 2XGLA 1IT8A 3FG3A 3KFQC 1NB5I 3B7CA 1FGOA 2KRTA 3JUQA 3HIIA 1KQS2 3CNXA 3BNBA 3CC73 2W9QA 2XGNA 3X3YA 1JN5A 2OQEA 3FSDA 4XM4A 1MNLA 2HMNB 2ZDJA 2CFWA 3S29A 1UUVB 5JPUA 1US1A 2E2UA 1IT7A 1W02A 4OK0A 5IF6A 3J7Yd 2YFJB 3G4S3 4R9LA 1RN7A 2C10A 2PNCA 1W6CA 3LTAA 5CK6A 3EJVA 1AR0A 2P0XA 3B4PA 2HMKB 3X41A 3OWSA 1VQK3 5AI1A 1U8CB 3IJEB 4HM5B 3F8XA 1YI23 5A0OB 1JB4A 2PZVA 2B24B 3PYJA 5ELJA 1T5YA 1TIJA 2FGTA 3FH1A 5JBSA 3DGMA 3FKAA 3Q1CA 1HU9A 4TX4A 3UJMA 1TUHA 1VQL3 1FGTA 2YFLB 3JUMA 3MYTA 1Q864 1FA3A 1YHQ3 1M1XB 1GD4A 5CF1A 3FF2A 4H3UA 1GS3A 2QGUA 3VF1A 4HM1B 3KKGA 1GYBA 3EE1A 1RJOA 5IG0A 3MG1A 3CCQ3 3PCSA 3EN1B 1L5GB 3NM7A 3I563 3KSPA 1YJN3 3Q2PA 1E3RA 3H3HA 3IMAB 4XDWA 2C11A 1ISKA 3EHCA 3G713 3NBRA 3CPW2 1JB5A 1OGXA 3FGYA 1O7GB 3OWYA 1M904 2SBLA 1A2VA 4HZBB 1OPYA 2UX0A 4IIAA 5EVHA 3V98A 1OHPA 1K41A 3X42A 5D81A 2MC8A 4EC6A 5IG5A 3GZRA 3S67A 3DM8A 4U13A 1MOLA 4KFEA 1LNHA 5KP3A 1YVBI 4N6NB 2LQVA 3X3XA 3Q90A 4O8SA 4LEHA 4XBXA 3OWUA 3WDGB 1D6YA 7STDA 3MKIA 1ZX2A 2IMJA 3SX1A 4K1UA 2RCDA 1TFKA 3EB8A 5FGOA 3CXC2 1W01A 5LC7A 4FCMA 3LH4A 4X2OA 1KWIA 3MG2A 3NBBA 1NO3A 3JUOA 5AYRB 4O2HA 3T0UA 1CYVA 2W04A 4WWUC 4J9AA 5IW9A 3LTDA 3KIIA 2QIYA 4FMAA 4HM4B 3MG3A 1VQ83 3K0ZA 3OXAA 3CC23 2OCTA 1IVVA 2XR8B 1O7WB 2YX9A 1W5ZA 1EA2A 1NWWA 1ROVA 1FGMA 2WGOA 3PCRA 1RRHA 4STDA 5EQLA 1ULIB 4HYZA 4FCJA 5AIGA 3HI7A 3GWRA 1QMAA 5IEOA 1NB3I 4K1VA 3G8ZA 2STDA 1K9M4 1A2KA 3EQQB 3F9SA 2OOVA 2W56B 1IV7A 2CFKA 2OTL3 3HZPA 1KC84 1W6YA 3G0KA 1OCVA 1DMQA 2CH9A 3DY5A 1WNHA 3CPOA 1OF5B 3ALAA 2CFDA 3K5TA 1ZO2A 2OOVC 3GZBA 2MF7A 3NM2A 1VQ73 1N9JA 3CCJ3 1WTHA 5KP4A 1IV9A 2E2TA 2GEYA 3WA3A 2L4VA 1W4NA 1YJW3 3UL5A 4HBRA 2IUKA 1CQSA 1ROAA 3MHEA 2ML6A 3FF0A 1SPUA 1DMNA 2BT3A 2Z77A 4XB5A 2P0MA 4MMYB 1TFOA 4I4KA 3CCR3 2CK3H 4HM8B 2B1XB 1W2B2 1OACA 1W00A 4N6OB 3RGAA 3KE7A 3MSOA 1NU3A 1UI7A 2HMMB 3DGNA 3F8HA 4Q53A 1TU5A 2KCDA 3CCL3 3LZAA 1S723 5ELUA 5FW5A 5AEUB 1NJI4 3KSED 3HX8A 3PS8A 4R1KA 4HM0B 4L8PA 4N6LA 1KSIA 5AIFA 3T8NA 5I97A 1A90A 4J8TA 3AMOA 3FG4A 1IDPA 3N54B 2XRXB 5LC6A 1VQO3 4L7KA 4RBNA 3MWZA 1IVXA 1WMNA 1QAKA 2IUJA 4KVHA 4WFOA 2JQ5A 4HM2B 3CME3 1Y4KA 2P09A 1GY7A 4CCVA 3U1WA 1DVCA 3N8BA 4N6V0 1N5PA 3G6E3 1IVUA 3SOAA 4FMBA 4QWTA 4ZM8A 1VQP3 4RZMA 2W2CA 3V92A 1K28A 2W9PA 3X40A 1K8A4 4HM7B 1JKGA 2XFTA 3F40A 1PU4A 1Z1SA 2XEPA 1U5OA 5CF2A 3WOFB 3UNLA 4EV2A 5G2GA 1SQWA 1UI8A 2LYXA 3FZWA 4BTYA 1VQ53 1N5HA 1N8R4 2BHMA 2FXTA 1V74A 3CCE3 1STFI 4FR9A 4NHFA 3NUVA 4N6TA 5IENA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F14 A;  3G16 A;  4XBY A;  2XR8 B;  3ECF A;  1O7W B;  3NV0 B;  3IPT A;  1SJW A;  1W02 A;  3EX9 A;  5IF6 A;  4HKV B;  2YFJ B;  1EA2 A;  1NWW A;  4LGQ A;  4R9L A;  5DRE A;  3EF8 A;  4STD A;  1NDO B;  3DZL A;  3JUN A;  3HK4 A;  1ULI B;  4WP5 A;  5BXQ A;  5CK6 A;  3EJV A;  1AR0 A;  3B4P A;  4FCJ A;  2HMK B;  1QMA A;  2K54 A;  3GWR A;  3OWS A;  4OVM A;  5AI1 A;  2BMQ B;  3NV0 A;  2RFR A;  3G8Z A;  2CKF B;  4HM5 B;  4K1V A;  4OUQ A;  2STD A;  3F8X A;  2HMJ B;  4ORL A;  1S5A A;  5AIG A;  1A2K A;  3EQQ B;  3F9S A;  2R4I A;  3CU3 A;  3ROB A;  3STD A;  5IG3 A;  4HVN A;  1JB4 A;  3H51 A;  2PZV A;  2B24 B;  3GZY B;  3HZP A;  4L8O A;  4HM3 B;  4LMI A;  4HJL B;  1TP6 A;  2A15 A;  3B4O A;  1W6Y A;  2BNG A;  5JPP A;  1GY6 A;  3FH1 A;  5KP1 A;  3G0K A;  1OCV A;  1DMQ A;  1O7N B;  3DXO A;  3FKA A;  4WYK A;  3SED A;  8CHO A;  3M8C A;  1OUN A;  3CPO A;  1OF5 B;  2BMR B;  1EG9 B;  2CHC A;  1ZO2 A;  3UJM A;  1TUH A;  2Z7A A;  4PEJ A;  1O7M B;  1STD A;  2YFI B;  3GZB A;  2YFL B;  3JUM A;  3MYT A;  3NM2 A;  1C7H A;  3E99 A;  6STD A;  2GEX A;  1O7P B;  3CNM A;  5IEP A;  5KP4 A;  2GEY A;  3F7X A;  1CQS A;  5DRV A;  3MHE A;  1O7H B;  3EC9 A;  3OX9 A;  3FF0 A;  4X2H A;  1DMN A;  3NHX A;  1HKX A;  3FF2 A;  2GBW B;  2Z77 A;  3LYG A;  1GS3 A;  2QGU A;  4H3U A;  4XB5 A;  2BMO B;  4I4K A;  3FLJ A;  1QJG A;  4HM1 B;  3EBY A;  3KKG A;  5IER A;  1GYB A;  1OF5 A;  1OHO A;  2B1X B;  4HM8 B;  5IG0 A;  1W00 A;  3RGA A;  1OGZ A;  4XDV A;  3MG1 A;  3KE7 A;  5AEW B;  3KZT A;  3MSO A;  3GZX B;  1NU3 A;  5STD A;  3EN1 B;  3K7C A;  5HGR A;  2XSH B;  5BVB A;  2HMM B;  3A76 A;  1JB2 A;  1GY5 A;  1Q40 B;  2GXF A;  3F7S A;  3F8H A;  4Q53 A;  5CXO A;  5CF1 A;  3GRD A;  3VGN A;  1JKG B;  3LZA A;  3KSP A;  1Q42 A;  5FW5 A;  5AEU B;  1E3R A;  3H3H A;  3JUP A;  3HX8 A;  4XDW A;  2I9W A;  1ULJ B;  4R1K A;  1UUW B;  3EHC A;  3NXJ A;  4HM0 B;  3NBR A;  4L8P A;  1JN5 B;  5AIF A;  3VSY A;  3WMD A;  1JB5 A;  1OGX A;  3FGY A;  1O7G B;  3OWY A;  3DMC A;  3I0Y A;  3T8N A;  1OHS A;  4HZB B;  1OPY A;  2RGQ A;  2UX0 A;  4IIA A;  4J8T A;  5EVH A;  3ER7 A;  1OHP A;  1K41 A;  3DUK A;  5TGN A;  1IDP A;  2OWP A;  5D81 A;  5IG5 A;  3GZR A;  3DM8 A;  1E97 A;  3B8L A;  4U13 A;  2XRX B;  4WYK B;  5D82 A;  5IEO A;  2F86 B;  5KP3 A;  3RGR A;  4XBT A;  1ASK A;  2F99 A;  5JPU A;  5AIH A;  4L7K A;  3Q90 A;  4HZ9 B;  4LEH A;  4XBX A;  3BLZ A;  1WQL B;  2HML B;  3OWU A;  4KVH A;  3SOY A;  2JQ5 A;  7STD A;  5AII A;  3EN8 A;  4HM2 B;  1ISK A;  5IG4 A;  3MKI A;  1VZZ A;  1OH0 A;  1GY7 A;  4R9K A;  1BUQ A;  3BB9 A;  1Q40 A;  1ZX2 A;  2IMJ A;  4MJD A;  4K1U A;  2RCD A;  3SOA A;  4N3V A;  4CDL A;  1DMM A;  2HMO B;  1W01 A;  3D9R A;  2W2C A;  4RZM A;  5CLK A;  2XSO B;  4FCM A;  3S5C A;  5D83 A;  4HM7 B;  1JKG A;  2Z76 A;  3F40 A;  4X2O A;  1Z1S A;  2INX A;  1U5O A;  4GB5 A;  5CF2 A;  3MG2 A;  3JUO A;  3B7C A;  3UNL A;  1E3V A;  5G2G A;  3FZW A;  3JUQ A;  4WWU C;  4J9A A;  3T8U A;  2GBX B;  4HM6 B;  3EBT A;  3CNX A;  2QIY A;  3OV4 A;  4HM4 B;  2F98 A;  1JN5 A;  3MG3 A;  3FSD A;  4XM4 A;  3K0Z A;  3OXA A;  2HMN B;  3NUV A;  5IEN A;  1UUV B; 
#chains in the Genus database with same CATH topology
 3F14 A;  4LSO A;  3ECF A;  3NV0 B;  2WOH A;  1MWT A;  3EX9 A;  4NPB A;  5DRE A;  1QAL A;  5BIR A;  2KXG A;  1X1W A;  3QRD A;  1NDO B;  2CWT A;  5BXQ A;  3HK4 A;  1AV4 A;  1VQ9 3;  4OVM A;  1VQM 3;  2P05 A;  1V58 A;  4N6M A;  3SXX A;  4OUQ A;  3NV0 A;  2O3O A;  2RFR A;  2CKF B;  4K61 A;  3CCV 3;  1I70 A;  1KD1 4;  1JNQ A;  3CC4 3;  2KAA A;  1S5A A;  3LT9 A;  3LOY A;  2CFG A;  3MPH A;  1RNT A;  3H51 A;  4MMZ B;  3GZY B;  4R80 A;  2CIU A;  4HM3 B;  4HJL B;  1TP6 A;  3LTC A;  3B4O A;  2BNG A;  3AGO A;  2ML5 A;  5KP1 A;  4KFF A;  4WYK A;  1O7N B;  3DXO A;  3SED A;  1Q82 4;  1B2U A;  2CG0 A;  2P38 A;  3M8C A;  3WOD G;  1JJ2 2;  1B21 A;  4LYL B;  2BMR B;  1N8Q A;  3HOH A;  2QEX 3;  2IA7 A;  1STD A;  4FCZ A;  1J2B A;  1W6G A;  2W6J H;  5G1L A;  1O7P B;  1FGQ A;  1VQ6 3;  3L0R A;  1ZGX A;  2XF3 A;  4H61 A;  1UGH I;  2D42 A;  1O7H B;  1GMR A;  3GAX A;  3NHX A;  1HKX A;  4MMX B;  2GBW B;  3LML A;  2BMO B;  3V99 A;  3FLJ A;  2XH9 A;  3EBY A;  3WA2 X;  1OHO A;  1YIJ 3;  4BTX A;  1OGZ A;  4XDV A;  5EEO A;  1I0V A;  1Q81 4;  1WMP A;  2W0Q A;  3PXM A;  5HGR A;  2Z6B A;  3K63 A;  3X3Z A;  1TRP A;  5BVB A;  3F7S A;  2F5M A;  1JB2 A;  1Q40 B;  2GXF A;  2Y74 A;  1FUW A;  1W7C A;  3VGN A;  1JKG B;  1CYU A;  1T2I A;  4RNZ A;  4CPK A;  1Q42 A;  6RNT A;  1I0X A;  1BRH A;  2F4Y A;  3JUP A;  2I9W A;  1B3S A;  3NXJ A;  1JN5 B;  1JZD A;  4CJN A;  1EKM A;  2WGQ A;  3I0Y A;  4EBG A;  2RGQ A;  5TGN A;  3ER7 A;  3WOE B;  3DUK A;  1X1X A;  2OWP A;  3LXU X;  1LOX A;  1MGW A;  1B2Z A;  2RNT A;  3B8L A;  3BNE A;  3K9M C;  4KZ1 A;  5D82 A;  4AKY A;  2F86 B;  2KF4 A;  2M7O A;  3RGR A;  2F99 A;  2CG1 A;  3NBJ A;  1GOV A;  3Q3F A;  5AIH A;  1EUI C;  1LXE A;  4KFD A;  1BRN L;  3BLZ A;  3D4A A;  1WQL B;  2WO0 A;  1JRQ A;  1R4C A;  3SOY A;  1VQK 3;  3QK9 A;  5AII A;  3EN8 A;  1VQ4 3;  1M1K 4;  3S27 A;  1OH0 A;  4NRE A;  1M9G A;  3KCH A;  1PFP A;  3D5G A;  4R9K A;  1Q40 A;  3RDE A;  2Q07 A;  1F8N A;  4CDL A;  2HMO B;  2Y73 A;  5CLK A;  1FZU A;  2V1L A;  2XSO B;  5D83 A;  4AKZ A;  1RKY A;  3D3L A;  3O8Y A;  4IPB A;  3NX0 A;  5G1K A;  1G96 A;  1IQY A;  2INX A;  4EV5 A;  1IYY A;  5M1A A;  2CWU A;  4DKI A;  1UW1 A;  3UB1 A;  1TTO A;  1E3V A;  1QVF 2;  4JRF A;  1RMS A;  3KN4 A;  3S28 A;  3T8U A;  5AYS C;  1DVD A;  2GBX B;  3FG1 A;  3EBT A;  4HM6 B;  4I5Q A;  3TDG A;  3OV4 A;  4BL3 A;  2F98 A;  2W03 A;  3UL6 A;  1BRG A;  1JBS A;  1CH0 A;  1WMO A;  1JV2 B;  3G16 A;  4XBY A;  1DET A;  3PZW A;  3IPT A;  1SJW A;  4HKV B;  4LGQ A;  1EEJ A;  2H0H A;  3EF8 A;  4WP5 A;  3DZL A;  3JUN A;  4O02 B;  1YIT 3;  1YJ9 3;  2D1W A;  2K54 A;  3U97 A;  2E2V A;  4BIR A;  1QVG 2;  2BMQ B;  4ORL A;  3CCS 3;  5GSP A;  2HMJ B;  1RCL A;  1RN1 A;  3BND A;  2R4I A;  3CU3 A;  2CX0 A;  3ROB A;  3STD A;  4FMD A;  3JVC A;  4G1M B;  3ZG5 A;  4HVN A;  5IG3 A;  1BNG A;  1HYF A;  4L8O A;  1SIH A;  2ZL8 A;  4LMI A;  3CMA 3;  2A15 A;  2R41 A;  5JPP A;  3N9H A;  1GY6 A;  1UCL A;  3RNT A;  2BO9 B;  1AVK A;  1G02 A;  4FMC A;  8CHO A;  4EYC A;  1W2Z A;  3PGB A;  1OUN A;  7RNT A;  1RRL A;  1AVL A;  3AHS A;  1Q7Y 4;  1EG9 B;  2CHC A;  3BNC A;  1I2F A;  5AEW B;  2Z7A A;  3DGL A;  4PEJ A;  1IQX A;  1O7M B;  2YFI B;  1SII A;  3SVA A;  1AY7 A;  1C7H A;  3E99 A;  2GEX A;  3CNM A;  4AEQ A;  6STD A;  5IEP A;  4HAA A;  4LZI A;  3F7X A;  2WOF A;  3SLU A;  5DRV A;  3FCS B;  2C4B A;  1D6U A;  3EC9 A;  3OX9 A;  4X2H A;  3HIG A;  2RSX A;  1DYU A;  2OTJ 3;  3LYG A;  1BAO A;  3NQZ A;  1QJG A;  3DH2 A;  1SAR A;  1D6Z A;  5IER A;  1OF5 A;  3DGO A;  2CC3 A;  4BTW A;  1A67 A;  1B20 A;  1X1U A;  2GU3 A;  1IVW A;  3AMO B;  3KZT A;  3GZX B;  5STD A;  3K7C A;  2XSH B;  1JZO A;  3A76 A;  1GY5 A;  1LVN A;  1YGE A;  5CXO A;  3CCU 3;  3GRD A;  1N9E A;  2CW9 A;  2XFS A;  1IQ8 A;  3ZFZ A;  1VQQ A;  3DGY A;  3BU4 A;  1ULJ B;  2K3D A;  1UUW B;  1FGR A;  1QAF A;  3LTB A;  4JF8 A;  4R4K A;  3VSY A;  3WMD A;  1GD3 A;  3NQY A;  2CWV A;  4WHA A;  1BRJ A;  3DMC A;  1FW7 A;  1OHS A;  4EXR A;  3LT8 A;  1CEW I;  2K0M A;  4IT7 A;  1BUJ A;  2J8X B;  1X1Y A;  1IU7 A;  2KF6 A;  1E97 A;  4GL6 A;  4O3V A;  4WYK B;  1DE3 A;  1VQN 3;  4XBT A;  1ASK A;  1K73 4;  4RNY A;  4HZ9 B;  1V57 A;  1EQK A;  4MEI A;  2HML B;  1IK3 A;  3OW2 2;  3CCM 3;  2JDI H;  2KF3 A;  5IG4 A;  1RGH A;  2GU1 A;  1VZZ A;  2W56 A;  1B2S A;  2QA4 3;  1BUQ A;  3BB9 A;  4K90 B;  1GOY A;  4MJD A;  1BOX A;  4N3V A;  1DMM A;  1BSA A;  1RTU A;  1FUS A;  3D9R A;  3S5C A;  1BNR A;  1FYS A;  2CFL A;  2O9U X;  4J5G A;  1RGC A;  2FNQ A;  2Z76 A;  1R4Y A;  4N6U A;  2OQE C;  4GB5 A;  3I55 3;  2XGL A;  1IT8 A;  3FG3 A;  3KFQ C;  1NB5 I;  2BU4 A;  1FGO A;  2AAD A;  2KRT A;  3B7C A;  1BU4 A;  3JUQ A;  3HII A;  1RLS A;  1KQS 2;  3CNX A;  3BNB A;  3CC7 3;  2W9Q A;  2XGN A;  3X3Y A;  1JN5 A;  2OQE A;  3FSD A;  4XM4 A;  1MNL A;  2HMN B;  2ZDJ A;  2CFW A;  3S29 A;  1UUV B;  2SAR A;  5JPU A;  1US1 A;  1UCK A;  2E2U A;  1IT7 A;  1G0T A;  1W02 A;  2HOH A;  4OK0 A;  4EW5 A;  1PY3 A;  5IF6 A;  2YFJ B;  3J7Y d;  1LRA A;  4R9L A;  3G4S 3;  1RN7 A;  2C10 A;  2PNC A;  1W6C A;  3LTA A;  5CK6 A;  1MWS A;  1AR0 A;  2P0X A;  3B4P A;  2H0I A;  2HMK B;  3EJV A;  3OWS A;  3X41 A;  5AI1 A;  1U8C B;  3IJE B;  4HM5 B;  1LNI A;  3F8X A;  1A2P A;  1YI2 3;  3BIR A;  1MGR A;  5A0O B;  1JB4 A;  2PZV A;  2B24 B;  3PYJ A;  1YVS A;  5ELJ A;  1T5Y A;  4HOH A;  1TIJ A;  2FGT A;  3FH1 A;  5JBS A;  3DGM A;  3FKA A;  1GSP A;  3Q1C A;  1HU9 A;  2F56 A;  1T3B A;  2IYJ A;  1BNS A;  4TX4 A;  3UJM A;  1TUH A;  1VQL 3;  1FGT A;  1RNB A;  2YFL B;  1BRK A;  3JUM A;  3MYT A;  1Q86 4;  2AAE A;  2F5W A;  1FA3 A;  3WR2 A;  1YHQ 3;  1UCI A;  1TRQ A;  1M1X B;  1GD4 A;  1NNV A;  5CF1 A;  3FF2 A;  4H3U A;  1GS3 A;  2QGU A;  1RDS A;  3VF1 A;  4HM1 B;  1RGE A;  3KKG A;  1BVI A;  1GYB A;  3EE1 A;  1RJO A;  5IG0 A;  1BSB A;  3MG1 A;  3CCQ 3;  3PCS A;  1MWR A;  3EN1 B;  1L5G B;  3NM7 A;  4GHO A;  3I56 3;  2ZA4 A;  3KSP A;  1YJN 3;  1LQG C;  3Q2P A;  1E3R A;  3H3H A;  3IMA B;  4XDW A;  2C11 A;  1ISK A;  3EHC A;  3G71 3;  3NBR A;  1PYL A;  4BL2 A;  1BSE A;  3CPW 2;  1JB5 A;  1OGX A;  3FGY A;  1O7G B;  3OWY A;  1M90 4;  2SBL A;  1B27 A;  1A2V A;  4HZB B;  1RHL A;  1OPY A;  2UX0 A;  4IIA A;  5EVH A;  3V98 A;  1OHP A;  1K41 A;  3X42 A;  1RGL A;  5D81 A;  2MC8 A;  4EC6 A;  3GZR A;  3S67 A;  3DM8 A;  4U13 A;  5IG5 A;  3D5I A;  2L1S A;  1MOL A;  4KFE A;  1LNH A;  5KP3 A;  1YVB I;  5BU4 A;  4N6N B;  2LQV A;  3X3X A;  3Q90 A;  1BSD A;  4O8S A;  4LEH A;  4XBX A;  3OWU A;  3WDG B;  1D6Y A;  7STD A;  3MKI A;  3WHO A;  2GSP A;  1ZX2 A;  1I2G A;  2IMJ A;  3SX1 A;  4K1U A;  2RCD A;  6GSP A;  1TFK A;  3EB8 A;  1BNF A;  1B2X A;  5FGO A;  1Q7H A;  3CXC 2;  1W01 A;  5LC7 A;  3ZG0 A;  9RNT A;  5IEN A;  1UCJ A;  1RSN A;  3LH4 A;  4FCM A;  4X2O A;  1KWI A;  3MG2 A;  3NBB A;  1NO3 A;  3JUO A;  1UDI I;  1I2E A;  5AYR B;  4O2H A;  3T0U A;  1CYV A;  2W04 A;  4WWU C;  4J9A A;  5IW9 A;  3LTD A;  3KII A;  2QIY A;  5M18 A;  4FMA A;  4HM4 B;  3MG3 A;  1ZS7 A;  1VQ8 3;  3K0Z A;  2ZHX B;  3OXA A;  3CC2 3;  2OCT A;  1AQZ A;  1IVV A;  2UUG C;  2XR8 B;  1O7W B;  2YX9 A;  1YNV X;  1MWU A;  3SYU A;  1W5Z A;  1EA2 A;  1NWW A;  1ROV A;  1FGM A;  2WGO A;  3GSP A;  1RRH A;  3PCR A;  4STD A;  2BIR A;  5EQL A;  5M19 A;  1ULI B;  4HYZ A;  1C54 A;  3AGN A;  4FCJ A;  5AIG A;  3HI7 A;  3GWR A;  1QMA A;  5IEO A;  1NB3 I;  4K1V A;  3G8Z A;  2STD A;  1K9M 4;  1A2K A;  3EQQ B;  3F9S A;  2OOV A;  1GMP A;  2W56 B;  1IV7 A;  2CFK A;  2OTL 3;  1GMQ A;  3D79 A;  3HZP A;  1KC8 4;  1JBR A;  1W6Y A;  3AHW A;  1BNJ A;  3G0K A;  1OCV A;  1DMQ A;  2CH9 A;  5HOH A;  3DY5 A;  1WNH A;  3CPO A;  1RCK A;  1OF5 B;  1BSC A;  3ALA A;  4BU4 A;  2CFD A;  1UGI A;  1ZO2 A;  2OOV C;  3K5T A;  3GZB A;  2MF7 A;  1GOU A;  3NM2 A;  1VQ7 3;  1N9J A;  3CCJ 3;  1WTH A;  5KP4 A;  1IV9 A;  2E2T A;  2GEY A;  3URP A;  2L4V A;  1W4N A;  3WA3 A;  1YJW 3;  3UL5 A;  4HBR A;  1Q9E A;  1CQS A;  2IUK A;  1ROA A;  3MHE A;  7GSP A;  2ML6 A;  3FF0 A;  1SPU A;  1DMN A;  1RGK A;  2BT3 A;  2Z77 A;  4XB5 A;  2P0M A;  1BRI A;  1TFO A;  4I4K A;  4MMY B;  3CCR 3;  8RNT A;  2CK3 H;  1YGW A;  1LOV A;  4HM8 B;  2B1X B;  1W2B 2;  1I8V A;  1OAC A;  1W00 A;  1T2H A;  3A5E A;  4N6O B;  3RGA A;  3KE7 A;  3MSO A;  1NU3 A;  1UI7 A;  2HMM B;  1RGG A;  3DGN A;  3F8H A;  2H0G A;  4Q53 A;  1TU5 A;  1BGS A;  2KCD A;  3LZA A;  3CCL 3;  1S72 3;  5ELU A;  5FW5 A;  1BNE A;  5AEU B;  1NJI 4;  3KSE D;  3HX8 A;  3PS8 A;  4R1K A;  4HM0 B;  4KT3 B;  4L8P A;  4N6L A;  3CD6 3;  1KSI A;  5AIF A;  1RGA A;  3T8N A;  5I97 A;  1TJD A;  1JBT A;  1A90 A;  4J8T A;  3AMO A;  3FG4 A;  1IDP A;  3N54 B;  1I3I A;  2XRX B;  5LC6 A;  1LOY A;  2CX1 A;  1VQO 3;  1BIR A;  4L7K A;  4RBN A;  3MWZ A;  1IVX A;  1WMN A;  2RBI A;  1QAK A;  2IUJ A;  1UUG B;  4KVH A;  4WFO A;  2JQ5 A;  4HM2 B;  3CME 3;  1Y4K A;  2P09 A;  1GY7 A;  2UGI A;  4CCV A;  3U1W A;  1DVC A;  3N8B A;  4N6V 0;  4ILF A;  1BRS A;  1N5P A;  3G6E 3;  1IVU A;  3SOA A;  4FMB A;  4QWT A;  4ZM8 A;  1VQP 3;  4RZM A;  2W2C A;  3V92 A;  1K28 A;  2W9P A;  3X40 A;  1K8A 4;  2KF5 A;  4HM7 B;  1JKG A;  2XFT A;  3F40 A;  1PU4 A;  1LOW A;  1BAN A;  1Z1S A;  1FUT A;  1U5O A;  2XEP A;  5CF2 A;  3WOF B;  1BNI A;  4J5K A;  3UNL A;  4EV2 A;  5G2G A;  1SQW A;  1UI8 A;  2LYX A;  3FZW A;  4BTY A;  1RGF A;  1VQ5 3;  1N5H A;  1LQM B;  4RNT A;  1N8R 4;  2BHM A;  1RN4 A;  2FXT A;  1B2M A;  4GSP A;  1V74 A;  3CCE 3;  1STF I;  1I3F A;  4FR9 A;  1HZ1 A;  3NUV A;  4NHF A;  4N6T A;  2IY2 A;  5RNT A; 
#chains in the Genus database with same CATH homology
 3F14 A;  4LSO A;  3ECF A;  3NV0 B;  2WOH A;  3EX9 A;  5DRE A;  1QAL A;  2KXG A;  3QRD A;  1NDO B;  2CWT A;  5BXQ A;  3HK4 A;  1AV4 A;  1VQ9 3;  4OVM A;  1VQM 3;  2P05 A;  4N6M A;  3SXX A;  4OUQ A;  3NV0 A;  2O3O A;  2RFR A;  2CKF B;  4K61 A;  3CCV 3;  1KD1 4;  3CC4 3;  1JNQ A;  1S5A A;  3LT9 A;  3LOY A;  2CFG A;  3MPH A;  3H51 A;  4MMZ B;  3GZY B;  4R80 A;  2CIU A;  4HM3 B;  4HJL B;  1TP6 A;  3LTC A;  3B4O A;  2BNG A;  2ML5 A;  5KP1 A;  4KFF A;  4WYK A;  1O7N B;  3DXO A;  3SED A;  1Q82 4;  2CG0 A;  2P38 A;  3WOD G;  3M8C A;  1JJ2 2;  2BMR B;  1N8Q A;  2QEX 3;  2IA7 A;  1STD A;  4FCZ A;  1J2B A;  1W6G A;  2W6J H;  1O7P B;  1FGQ A;  1VQ6 3;  3L0R A;  2XF3 A;  4H61 A;  2D42 A;  1O7H B;  3GAX A;  3NHX A;  1HKX A;  4MMX B;  2GBW B;  3LML A;  2BMO B;  3V99 A;  3FLJ A;  2XH9 A;  3EBY A;  3WA2 X;  1OHO A;  1YIJ 3;  4BTX A;  1OGZ A;  4XDV A;  5EEO A;  1Q81 4;  1WMP A;  2W0Q A;  3PXM A;  5HGR A;  2Z6B A;  3K63 A;  3X3Z A;  5BVB A;  3F7S A;  2Y74 A;  1JB2 A;  1Q40 B;  2GXF A;  1FUW A;  1W7C A;  3VGN A;  1JKG B;  1CYU A;  4RNZ A;  1Q42 A;  3JUP A;  2I9W A;  3NXJ A;  1JN5 B;  1EKM A;  2WGQ A;  3I0Y A;  4EBG A;  2RGQ A;  5TGN A;  3ER7 A;  3WOE B;  3DUK A;  2OWP A;  3LXU X;  1LOX A;  3BNE A;  3B8L A;  3K9M C;  4KZ1 A;  4AKY A;  5D82 A;  2F86 B;  2M7O A;  3RGR A;  2F99 A;  2CG1 A;  3NBJ A;  5AIH A;  1LXE A;  4KFD A;  3BLZ A;  1WQL B;  2WO0 A;  1JRQ A;  1R4C A;  3SOY A;  3QK9 A;  5AII A;  3EN8 A;  1VQ4 3;  1M1K 4;  3S27 A;  1OH0 A;  4NRE A;  1M9G A;  4R9K A;  1PFP A;  1Q40 A;  3RDE A;  2Q07 A;  1F8N A;  4CDL A;  2HMO B;  2Y73 A;  5CLK A;  2V1L A;  2XSO B;  5D83 A;  4AKZ A;  1RKY A;  3D3L A;  3O8Y A;  4IPB A;  3NX0 A;  1G96 A;  1IQY A;  2INX A;  4EV5 A;  2CWU A;  1UW1 A;  3UB1 A;  1QVF 2;  1E3V A;  4JRF A;  3KN4 A;  3S28 A;  3T8U A;  5AYS C;  1DVD A;  2GBX B;  3FG1 A;  3EBT A;  4HM6 B;  3TDG A;  3OV4 A;  2F98 A;  2W03 A;  3UL6 A;  1WMO A;  1JV2 B;  3G16 A;  4XBY A;  3PZW A;  3IPT A;  1SJW A;  4HKV B;  4LGQ A;  3EF8 A;  4WP5 A;  3DZL A;  3JUN A;  4O02 B;  1YIT 3;  1YJ9 3;  2D1W A;  2K54 A;  3U97 A;  2E2V A;  1QVG 2;  2BMQ B;  4ORL A;  3CCS 3;  2HMJ B;  3BND A;  2R4I A;  3CU3 A;  3ROB A;  3STD A;  4FMD A;  3JVC A;  4G1M B;  5IG3 A;  4HVN A;  4L8O A;  1SIH A;  2ZL8 A;  4LMI A;  3CMA 3;  2A15 A;  5JPP A;  3N9H A;  1GY6 A;  2BO9 B;  1AVK A;  4FMC A;  8CHO A;  4EYC A;  1W2Z A;  3PGB A;  1OUN A;  1RRL A;  1AVL A;  1Q7Y 4;  1EG9 B;  2CHC A;  3BNC A;  5AEW B;  3CD6 3;  3DGL A;  2Z7A A;  4PEJ A;  1IQX A;  2YFI B;  1O7M B;  1SII A;  3SVA A;  1C7H A;  3E99 A;  6STD A;  2GEX A;  3CNM A;  4AEQ A;  5IEP A;  4LZI A;  3F7X A;  2WOF A;  3SLU A;  5DRV A;  3FCS B;  1D6U A;  3EC9 A;  3OX9 A;  4X2H A;  3HIG A;  2RSX A;  1DYU A;  2OTJ 3;  3LYG A;  3NQZ A;  1QJG A;  1D6Z A;  5IER A;  1OF5 A;  3DGO A;  2CC3 A;  4BTW A;  1A67 A;  2GU3 A;  1IVW A;  3AMO B;  3KZT A;  3GZX B;  5STD A;  3K7C A;  2XSH B;  3A76 A;  1GY5 A;  1LVN A;  1YGE A;  5CXO A;  3CCU 3;  3GRD A;  1N9E A;  2CW9 A;  2XFS A;  1IQ8 A;  1ULJ B;  3LTB A;  1UUW B;  1FGR A;  1QAF A;  4JF8 A;  4R4K A;  3VSY A;  3WMD A;  1GD3 A;  3NQY A;  2CWV A;  4WHA A;  3DMC A;  1OHS A;  4EXR A;  3LT8 A;  1CEW I;  2K0M A;  4IT7 A;  1IU7 A;  4O3V A;  1E97 A;  4GL6 A;  4WYK B;  1VQN 3;  4XBT A;  1ASK A;  1K73 4;  4RNY A;  4HZ9 B;  1EQK A;  4MEI A;  2HML B;  1IK3 A;  3OW2 2;  3CCM 3;  2JDI H;  5IG4 A;  2GU1 A;  1VZZ A;  2W56 A;  1BUQ A;  2QA4 3;  3BB9 A;  4K90 B;  4MJD A;  4N3V A;  1DMM A;  3S5C A;  3D9R A;  2CFL A;  2O9U X;  2FNQ A;  2Z76 A;  4N6U A;  2OQE C;  4GB5 A;  3I55 3;  2XGL A;  1IT8 A;  3FG3 A;  3KFQ C;  1NB5 I;  3B7C A;  1FGO A;  2KRT A;  3JUQ A;  3HII A;  1KQS 2;  3CNX A;  3BNB A;  3CC7 3;  2W9Q A;  2XGN A;  3X3Y A;  1JN5 A;  2OQE A;  3FSD A;  4XM4 A;  1MNL A;  2HMN B;  2ZDJ A;  2CFW A;  3S29 A;  1UUV B;  5JPU A;  1US1 A;  2E2U A;  1IT7 A;  1W02 A;  4OK0 A;  5IF6 A;  3J7Y d;  2YFJ B;  3G4S 3;  4R9L A;  1RN7 A;  2C10 A;  2PNC A;  1W6C A;  3LTA A;  5CK6 A;  3EJV A;  1AR0 A;  2P0X A;  3B4P A;  2HMK B;  3X41 A;  3OWS A;  1VQK 3;  5AI1 A;  1U8C B;  3IJE B;  4HM5 B;  3F8X A;  1YI2 3;  5A0O B;  1JB4 A;  2PZV A;  2B24 B;  3PYJ A;  5ELJ A;  1T5Y A;  1TIJ A;  2FGT A;  3FH1 A;  5JBS A;  3DGM A;  3FKA A;  3Q1C A;  1HU9 A;  4TX4 A;  3UJM A;  1TUH A;  1VQL 3;  1FGT A;  2YFL B;  3JUM A;  3MYT A;  1Q86 4;  1FA3 A;  1YHQ 3;  1M1X B;  1GD4 A;  5CF1 A;  3FF2 A;  4H3U A;  1GS3 A;  2QGU A;  3VF1 A;  4HM1 B;  3KKG A;  1GYB A;  3EE1 A;  1RJO A;  5IG0 A;  3MG1 A;  3CCQ 3;  3PCS A;  3EN1 B;  1L5G B;  3NM7 A;  3I56 3;  3KSP A;  1YJN 3;  3Q2P A;  1E3R A;  3H3H A;  3IMA B;  4XDW A;  2C11 A;  1ISK A;  3EHC A;  3G71 3;  3NBR A;  3CPW 2;  1JB5 A;  1OGX A;  3FGY A;  1O7G B;  3OWY A;  1M90 4;  2SBL A;  1A2V A;  4HZB B;  1OPY A;  2UX0 A;  4IIA A;  5EVH A;  3V98 A;  1OHP A;  1K41 A;  3X42 A;  5D81 A;  2MC8 A;  4EC6 A;  5IG5 A;  3GZR A;  3S67 A;  3DM8 A;  4U13 A;  1MOL A;  4KFE A;  1LNH A;  5KP3 A;  1YVB I;  4N6N B;  2LQV A;  3X3X A;  3Q90 A;  4O8S A;  4LEH A;  4XBX A;  3OWU A;  3WDG B;  1D6Y A;  7STD A;  3MKI A;  1ZX2 A;  2IMJ A;  3SX1 A;  4K1U A;  2RCD A;  1TFK A;  3EB8 A;  5FGO A;  3CXC 2;  1W01 A;  5LC7 A;  4FCM A;  3LH4 A;  4X2O A;  1KWI A;  3MG2 A;  3NBB A;  1NO3 A;  3JUO A;  5AYR B;  4O2H A;  3T0U A;  1CYV A;  2W04 A;  4WWU C;  4J9A A;  5IW9 A;  3LTD A;  3KII A;  2QIY A;  4FMA A;  4HM4 B;  3MG3 A;  1VQ8 3;  3K0Z A;  3OXA A;  3CC2 3;  2OCT A;  1IVV A;  2XR8 B;  1O7W B;  2YX9 A;  1W5Z A;  1EA2 A;  1NWW A;  1ROV A;  1FGM A;  2WGO A;  3PCR A;  1RRH A;  4STD A;  5EQL A;  1ULI B;  4HYZ A;  4FCJ A;  5AIG A;  3HI7 A;  3GWR A;  1QMA A;  5IEO A;  1NB3 I;  4K1V A;  3G8Z A;  2STD A;  1K9M 4;  1A2K A;  3EQQ B;  3F9S A;  2OOV A;  2W56 B;  1IV7 A;  2CFK A;  2OTL 3;  3HZP A;  1KC8 4;  1W6Y A;  3G0K A;  1OCV A;  1DMQ A;  2CH9 A;  3DY5 A;  1WNH A;  3CPO A;  1OF5 B;  3ALA A;  2CFD A;  3K5T A;  1ZO2 A;  2OOV C;  3GZB A;  2MF7 A;  3NM2 A;  1VQ7 3;  1N9J A;  3CCJ 3;  1WTH A;  5KP4 A;  1IV9 A;  2E2T A;  2GEY A;  3WA3 A;  2L4V A;  1W4N A;  1YJW 3;  3UL5 A;  4HBR A;  2IUK A;  1CQS A;  1ROA A;  3MHE A;  2ML6 A;  3FF0 A;  1SPU A;  1DMN A;  2BT3 A;  2Z77 A;  4XB5 A;  2P0M A;  4MMY B;  1TFO A;  4I4K A;  3CCR 3;  2CK3 H;  4HM8 B;  2B1X B;  1W2B 2;  1OAC A;  1W00 A;  4N6O B;  3RGA A;  3KE7 A;  3MSO A;  1NU3 A;  1UI7 A;  2HMM B;  3DGN A;  3F8H A;  4Q53 A;  1TU5 A;  2KCD A;  3CCL 3;  3LZA A;  1S72 3;  5ELU A;  5FW5 A;  5AEU B;  1NJI 4;  3KSE D;  3HX8 A;  3PS8 A;  4R1K A;  4HM0 B;  4L8P A;  4N6L A;  1KSI A;  5AIF A;  3T8N A;  5I97 A;  1A90 A;  4J8T A;  3AMO A;  3FG4 A;  1IDP A;  3N54 B;  2XRX B;  5LC6 A;  1VQO 3;  4L7K A;  4RBN A;  3MWZ A;  1IVX A;  1WMN A;  1QAK A;  2IUJ A;  4KVH A;  4WFO A;  2JQ5 A;  4HM2 B;  3CME 3;  1Y4K A;  2P09 A;  1GY7 A;  4CCV A;  3U1W A;  1DVC A;  3N8B A;  4N6V 0;  1N5P A;  3G6E 3;  1IVU A;  3SOA A;  4FMB A;  4QWT A;  4ZM8 A;  1VQP 3;  4RZM A;  2W2C A;  3V92 A;  1K28 A;  2W9P A;  3X40 A;  1K8A 4;  4HM7 B;  1JKG A;  2XFT A;  3F40 A;  1PU4 A;  1Z1S A;  2XEP A;  1U5O A;  5CF2 A;  3WOF B;  3UNL A;  4EV2 A;  5G2G A;  1SQW A;  1UI8 A;  2LYX A;  3FZW A;  4BTY A;  1VQ5 3;  1N5H A;  1N8R 4;  2BHM A;  2FXT A;  1V74 A;  3CCE 3;  1STF I;  4FR9 A;  4NHF A;  3NUV A;  4N6T A;  5IEN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...