4WP5A

Chaetomium thermophilum mex67 ntf2-like domain complexed with mtr2
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
201
structure length
199
Chain Sequence
b'MPTPLPQLPSNVRDGENNVASTFLQAFFQLWDHDRLTLIPQFYDSETTFSVVFATDSPQDPASSSCSKFSRNLNILSPPSTLQRLFVGSNLIADLWKVLPATRHPSLDQTSQWLIDCHTFPHLADPTGMAPYAMGLMINVNGQCEEADISQNLYGTRTFSRCFILGPSKPGAPHPYRVLSDQLTLHTWKPQPAPQVGTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords mRNA export protein
molecule tags Transport protein
source organism Chaetomium thermophilum
publication title Structural characterization of the principal mRNA-export factor Mex67-Mtr2 from Chaetomium thermophilum.
pubmed doi rcsb
total genus 37
structure length 199
sequence length 201
ec nomenclature
pdb deposition date 2014-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4wp5A00
2CKFB 3M8CA 4XB5A 3WMDA 2BMOB 3B7CA 5IEPA 5KP4A 3EBYA 1DMMA 3ECFA 2GBWB 4I4KA 4R9LA 5IG5A 1OPYA 2Z76A 3F7SA 3H51A 4H3UA 2HMJB 4HM1B 2W2CA 4R1KA 4WP5A 5IF6A 3E99A 2BMRB 3STDA 1NWWA 3OXAA 1AR0A 3B8LA 1U5OA 2F99A 3D9RA 4X2OA 3LYGA 5CK6A 1OHOA 3GRDA 4Q53A 2HMMB 2RCDA 4WYKA 1TUHA 1K41A 3B4OA 3F14A 3FH1A 1ULIB 5IENA 3A76A 3OWUA 1O7HB 1W01A 5HGRA 5JPUA 3KSPA 2F86B 2OWPA 3F9SA 4HKVB 3SOAA 1GYBA 3HK4A 5DREA 1NU3A 1TP6A 3H3HA 2YFJB 3BLZA 4HM8B 3DZLA 1Q40A 3CU3A 4WYKB 2IMJA 1NDOB 1ZO2A 1BUQA 4RZMA 3RGRA 3GZYB 3DXOA 3NBRA 1QMAA 2XSOB 2I9WA 1EA2A 2CHCA 4HM5B 5AI1A 5DRVA 4N3VA 1OF5A 4HM7B 3S5CA 3FF2A 3GZRA 1JN5A 3HZPA 1JB2A 1E3VA 1W02A 2GEXA 3JUOA 2PZVA 3ROBA 1ASKA 3MSOA 3F8XA 3GWRA 3NUVA 3OX9A 3EHCA 4OUQA 4IIAA 3EF8A 3F8HA 4KVHA 5AEWB 3NV0A 2BMQB 5KP3A 4L7KA 5BVBA 2BNGA 2QIYA 3ER7A 2HMKB 3UJMA 1E97A 4HM3B 4L8PA 6STDA 1E3RA 5CLKA 3FLJA 1OGZA 3VSYA 4ORLA 1WQLB 3FKAA 3OWYA 1O7NB 4XBTA 3EQQB 3SOYA 1HKXA 3EN8A 1ISKA 3MKIA 4R9KA 1SJWA 3CNXA 8CHOA 4L8OA 1ZX2A 4GB5A 1OUNA 4HJLB 3FZWA 1S5AA 4XBXA 4HZBB 1O7PB 2R4IA 2RGQA 3FF0A 5AIIA 1GY6A 1QJGA 1GY7A 2UX0A 1JB5A 3G16A 5AIHA 1CQSA 1O7MB 3FGYA 2INXA 3EJVA 1JKGB 2B24B 3HX8A 3K0ZA 1OH0A 5D83A 2Z7AA 2HMOB 1GS3A 3FSDA 4CDLA 2GBXB 5D81A 3NV0B 4J8TA 4HM6B 3EN1B 3F40A 3T8UA 3LZAA 2JQ5A 2B1XB 2HMNB 3OWSA 4WWUC 3UNLA 5KP1A 5G2GA 3KZTA 1IDPA 4FCMA 3EX9A 3NM2A 1JN5B 3JUPA 3JUMA 2GEYA 1OF5B 3BB9A 5AEUB 4FCJA 1OHPA 1O7WB 3MG2A 4XBYA 3T8NA 3I0YA 3Q90A 4K1UA 4OVMA 5JPPA 1UUVB 3OV4A 1STDA 5CF2A 5IG3A 4K1VA 5FW5A 3CPOA 4HZ9B 1Q40B 2K54A 3DM8A 5CF1A 1Q42A 3JUQA 5AIGA 2XRXB 3KE7A 3CNMA 3EBTA 4XM4A 5D82A 3B4PA 5TGNA 3RGAA 1JKGA 2XSHB 3KKGA 5AIFA 1UUWB 1W6YA 2YFIB 3MHEA 2RFRA 2YFLB 3DUKA 3IPTA 4LGQA 2GXFA 2Z77A 5STDA 1ULJB 1DMNA 3K7CA 5BXQA 1GY5A 5IG0A 5IERA 3DMCA 3MG3A 4LEHA 2XR8B 5CXOA 4MJDA 1Z1SA 4PEJA 4HM0B 1W00A 3VGNA 1JB4A 1OHSA 1OGXA 2HMLB 3MYTA 3JUNA 4HM4B 4J9AA 3F7XA 4STDA 4U13A 4X2HA 5IEOA 3SEDA 1C7HA 4XDWA 5IG4A 1EG9B 1DMQA 3NHXA 1A2KA 3G0KA 3GZBA 1OCVA 2QGUA 1VZZA 3NXJA 3MG1A 4HVNA 5EVHA 4HM2B 2F98A 3GZXB 4XDVA 7STDA 2STDA 2A15A 3EC9A 4LMIA 3G8ZA 1O7GB
chains in the Genus database with same CATH superfamily
2CKFB 3M8CA 4XB5A 1SIIA 4I5QA 1A2VA 4DKIA 3EBYA 4EV5A 5KP4A 5G1LA 4R9LA 2W9PA 3H51A 3LTBA 4H3UA 2W2CA 1I8VA 2OCTA 1JNQA 1U5OA 1BSBA 2RSXA 3CC43 3JVCA 3G6E3 1IVVA 1RGEA 3GRDA 2BIRA 4FMAA 4KFEA 3S27A 3CPW2 1VQN3 1I3IA 3HOHA 1A2PA 4N6MA 1V74A 5IENA 2WGQA 1O7HB 1FUSA 1W2ZA 2CX1A 2F86B 2C11A 3F9SA 1HU9A 3HK4A 5DREA 1RKYA 4CJNA 1VQ43 4JF8A 1RGFA 4O8SA 2YFJB 1RN7A 3DZLA 1MWUA 1VQO3 1DVDA 1IQ8A 3X3ZA 4KFFA 4WYKB 3CCV3 3LXUX 3S29A 3NBRA 1BUJA 1EA2A 4RBNA 3D3LA 3PCSA 4N3VA 4RNTA 3NQZA 1KWIA 4HM7B 1E3VA 3ZG5A 3LT9A 1X1UA 3F8XA 3GWRA 3LT8A 2OOVC 1YJW3 1RGAA 2FGTA 2UUGC 1HYFA 1MWTA 2OTL3 2QIYA 3ZFZA 3UJMA 1E97A 2WOHA 4ILFA 3VSYA 1OGZA 1BU4A 1BSEA 1Q7HA 1WQLB 2GU1A 3FKAA 3OWYA 1B21A 4XBTA 1JBSA 3EQQB 1ISKA 1UCIA 2CX0A 3MKIA 4R9KA 2SBLA 3GSPA 2W56A 3CNXA 1ZX2A 1LOXA 1WTHA 3CCU3 2W6JH 1OUNA 2H0HA 3DGLA 1V57A 3K5TA 3AHSA 1T5YA 1W6GA 1GD4A 2ML6A 3X42A 1IU7A 1DETA 1D6UA 3CCJ3 1GY6A 1QJGA 1GY7A 3LTCA 1W2B2 1R4YA 4RNZA 5I97A 2P0XA 3LMLA 4GHOA 4GL6A 3U97A 3FGYA 1K734 4BIRA 5D83A 1LOVA 4FMDA 1GS3A 3SX1A 3CCL3 1X1YA 5ELUA 1L5GB 4J8TA 4HM6B 3ZG0A 2HMNB 3OWSA 3UNLA 1BIRA 4FCMA 5AYSC 1JN5B 3JUMA 4EV2A 3NBBA 3J7Yd 3T8NA 3I0YA 3L0RA 4K1UA 2RNTA 2XFTA 2Z6BA 1B2SA 5FW5A 3CPOA 5CF1A 1Q40B 2K54A 3DM8A 4XM4A 1PY3A 2GSPA 1Q864 5AIFA 2CW9A 3D4AA 1UUWB 4AKYA 1DVCA 2RBIA 2WO0A 2RFRA 3IPTA 4LGQA 1BSCA 2GXFA 2Z77A 1YGWA 2W0QA 3MG3A 3D5IA 3PYJA 1YVSA 4MJDA 4N6TA 3G713 3I563 1JB4A 1OHSA 4NHFA 1OGXA 3CMA3 4J9AA 1TU5A 3IJEB 5IEOA 2K0MA 2P38A 5M19A 4XDWA 1GSPA 1EG9B 1QALA 2W56B 3NHXA 1A90A 2KF5A 1RGCA 2WGOA 3MG1A 1UGIA 2P09A 2K3DA 1UI8A 1X1WA 1RGGA 2F98A 1IV9A 2E2VA 4R4KA 2CG1A 1FGQA 3SYUA 4OUQA 4N6V0 1PFPA 1KD14 4OK0A 3WMDA 1BNJA 1N9JA 2E2TA 2BMOB 1BAOA 1RNTA 3B7CA 3TDGA 5IEPA 1DMMA 1ZGXA 1BSAA 2F5WA 3EB8A 5IG5A 1OPYA 3U1WA 3LOYA 1V58A 3WOEB 1UW1A 3STDA 3OXAA 1AR0A 2KF6A 3B8LA 3D9RA 1DE3A 2KCDA 1VQL3 2CWVA 1EUIC 1B3SA 1BRKA 1RHLA 2MF7A 2SARA 4IT7A 4Q53A 3WODG 7GSPA 1K41A 3F14A 3V99A 2XEPA 2YX9A 1FW7A 5AYRB 3AGOA 1R4CA 1RMSA 1IVXA 2OWPA 2IUKA 4FCZA 3SOAA 1GYBA 2IUJA 3I553 1NU3A 4HM8B 3BLZA 4WHAA 2BT3A 1Q40A 1VQ83 4EBGA 2IMJA 2Y74A 1BNEA 2BHMA 5EQLA 1BRSA 6GSPA 1UGHI 2CHCA 3JUOA 1JN5A 2XF3A 3GAXA 4FR9A 1VQP3 1BNRA 4H61A 1ASKA 1AQZA 3NUVA 3EHCA 1RDSA 3PGBA 5AEWB 1A67A 5BVBA 2BMQB 4L7KA 1BRNL 2HMKB 2L1SA 3AHWA 4HM3B 1K9M4 1BRJA 1BANA 1Y4KA 3FLJA 1O7NB 3SOYA 1HKXA 3EN8A 4O3VA 3BNDA 1SJWA 3FG1A 4L8OA 4NREA 2XFSA 3WA3A 1LNIA 4BL2A 1S5AA 2O9UX 1MWSA 3AGNA 4HZBB 3X3YA 1F8NA 1O7PB 2RGQA 3CCM3 1MGWA 1ZS7A 3O8YA 1MNLA 5AIIA 4CPKA 1UDII 2AADA 3G16A 4CCVA 1W7CA 5IW9A 2CFWA 1M904 1JBTA 1ROVA 3EE1A 3EJVA 1G96A 3CD63 3DGMA 2B24B 1C54A 8RNTA 3N9HA 3PS8A 1LXEA 1LOWA 1CEWI 3FSDA 4CDLA 4AKZA 3AMOA 3NV0B 1EQKA 3T8UA 3F40A 1TFOA 2JQ5A 2M7OA 1PU4A 3EX9A 1W4NA 1EEJA 1UCLA 4N6NB 1JZOA 3JUPA 3CC73 1KC84 5AEUB 4XBYA 2BU4A 3N54B 2J8XB 2JDIH 1UUVB 3UL5A 1STDA 4LYLB 4FMCA 1NNVA 2ML5A 2FXTA 3LH4A 4LZIA 3KE7A 3RNTA 2IA7A 2O3OA 1QVG2 4TX4A 2AAEA 2LYXA 1B2XA 3KKGA 3WHOA 1SPUA 2YFIB 2MC8A 3WA2X 2QA43 3PCRA 3KFQC 1T2HA 1DMNA 1G0TA 5BXQA 1Q9EA 1FUTA 3MPHA 3DMCA 2P0MA 4LEHA 2XR8B 5CXOA 1GOUA 4RNYA 1Q814 1SQWA 3Q2PA 3VF1A 2R41A 1M1XB 2HMLB 4EXRA 3F7XA 4STDA 4U13A 2ZHXB 3K9MC 1RLSA 1EKMA 3QRDA 1Q7Y4 3G0KA 3GZBA 3NXJA 2H0IA 1RCLA 1VZZA 3BIRA 2H0GA 3CCE3 1B27A 2ZL8A 1JBRA 3KIIA 1FGOA 3KCHA 2STDA 2A15A 2ZDJA 4LMIA 1RGLA 5KP3A 3LTDA 3V92A 1J2BA 1DYUA 1QAKA 1FGRA 2IY2A 3OW22 2F56A 2GBWB 3HIIA 2Z76A 1RN4A 1JZDA 3F7SA 4N6LA 4R1KA 4WP5A 3V98A 5IF6A 1RNBA 2BMRB 1QVF2 2KF3A 1GOYA 1NWWA 1NB5I 2F99A 1N8QA 4X2OA 1TTOA 3N8BA 4EC6A 1OHOA 1LQGC 1UI7A 1BRIA 1TUHA 4NPBA 2CFGA 3B4OA 2W04A 3FH1A 4N6OB 1BRGA 2D1WA 3OWUA 1W01A 5HGRA 3PXMA 4BTYA 3KSPA 4HKVB 2GU3A 5A0OB 3ALAA 3SVAA 3QK9A 3H3HA 2W03A 1LOYA 3CU3A 4HYZA 4AEQA 3HIGA 1IV7A 1NDOB 1SARA 1BUQA 3PZWA 4RZMA 3GZYB 5DRVA 2XSOB 5AI1A 1RTUA 4HM5B 1Q824 3NQYA 1OF5A 2BO9B 3S5CA 3FF2A 3ROBA 1W02A 3NBJA 1PYLA 3OX9A 1GD3A 1FGTA 3F8HA 1LNHA 1N5PA 1BNGA 3NV0A 2KAAA 4IPBA 1AY7A 4L8PA 2CFKA 1YI23 1NJI4 1E3RA 2WOFA 3D5GA 1FUWA 4O02B 1BNSA 1RRLA 5JBSA 1IQXA 1B20A 1VQQA 5G1KA 2XH9A 1I0XA 2C4BA 1RCKA 4EW5A 3CCR3 1CYVA 4HJLB 4XBXA 3X40A 1BNIA 4MMYB 2ZA4A 2R4IA 3Q1CA 3FF0A 1YGEA 5AIHA 2UX0A 1JB5A 2CFDA 1CQSA 1O7MB 3WOFB 4LSOA 2KRTA 1G02A 1IVWA 2C10A 2F4YA 3CCS3 3K0ZA 1OH0A 3D79A 5LC7A 1VQ63 1WNHA 1I3FA 1KSIA 1GMRA 1JJ22 4WWUC 3WR2A 4R80A 5G2GA 1US1A 1IDPA 1BGSA 1BRHA 2XGLA 3NM2A 1VQM3 3HI7A 4EYCA 1BSDA 1RGHA 1T3BA 4FCJA 2D42A 1B2ZA 1D6ZA 3MG2A 6RNTA 1VQ93 3FG3A 5JPPA 2L4VA 5CF2A 2CIUA 4N6UA 4HZ9B 5M1AA 1Q42A 3IMAB 5AIGA 5TGNA 3RDEA 3X3XA 1N9EA 3B4PA 1UCKA 4K90B 1RJOA 1I0VA 2PNCA 2XSHB 3MHEA 3DUKA 1N5HA 1TJDA 1T2IA 1ULJB 2HOHA 3K7CA 1GY5A 5STDA 2UGIA 3SLUA 5HOHA 5IERA 2CWTA 1YHQ3 1UCJA 4PEJA 5EEOA 4HM0B 1W00A 1S723 2OTJ3 1BOXA 1OACA 1U8CB 3MYTA 4J5GA 1FZUA 3JUNA 4HM4B 3SEDA 3BNEA 3CME3 1GOVA 1C7HA 1YJ93 4HM2B 1DMQA 3CXC2 1A2KA 1WMPA 1I2GA 3Q3FA 4FMBA 1NB3I 3DGYA 2F5MA 4KZ1A 7STDA 3NX0A 1IQYA 1STFI 2IYJA 1RN1A 1O7GB 3UL6A 2W9QA 2Q07A 3DGNA 3ECFA 4I4KA 3UB1A 4HM1B 3DY5A 2HMJB 3E99A 1ROAA 2OOVA 3URPA 2QEX3 5BU4A 2CG0A 1LRAA 3LYGA 4HOHA 1UUGB 5CK6A 4ZM8A 5M18A 4WYKA 2HMMB 2RCDA 3T0UA 2XGNA 1HZ1A 3CC23 4J5KA 1ULIB 3A76A 2E2UA 5ELJA 1TRQA 1LVNA 4QWTA 5JPUA 1JV2B 4K61A 1TP6A 4BTXA 1QAFA 2KF4A 1ZO2A 3RGRA 4KT3B 3DXOA 3MWZA 1QMAA 4KFDA 2I9WA 1VQ73 3FG4A 3G4S3 3K63A 3GZRA 3HZPA 1JB2A 2GEXA 2Y73A 4MMXB 2PZVA 3MSOA 1IT7A 1AVKA 1GMQA 1JRQA 1VQK3 1W5ZA 3X41A 4IIAA 3EF8A 4KVHA 2BNGA 2CFLA 3ER7A 2CC3A 1FGMA 6STDA 1M9GA 3KN4A 5CLKA 1CYUA 2LQVA 2FNQA 4ORLA 3NM7A 4WFOA 5GSPA 2OQEA 4BU4A 1LQMB 2V1LA 5BIRA 8CHOA 5RNTA 4GB5A 3FZWA 1I2FA 1TFKA 3A5EA 1YNVX 1BVIA 1NO3A 4MEIA 1MWRA 2CWUA 1IYYA 1BNFA 2INXA 3BNCA 1JKGB 3FCSB 1YIJ3 3HX8A 1AVLA 1RGKA 1WMOA 3S67A 2Z7AA 2HMOB 1I70A 4GSPA 2GBXB 5D81A 3EN1B 1N8R4 3LZAA 2B1XB 1YVBI 5KP1A 2P05A 1B2MA 3KZTA 9RNTA 1GMPA 4MMZB 1AV4A 3BU4A 1TIJA 2GEYA 4G1MB 1OF5B 3BB9A 4BTWA 1MOLA 1K8A4 1OHPA 1O7WB 4HBRA 3BNBA 1TRPA 3KSED 1B2UA 3Q90A 1CH0A 3LTAA 4OVMA 3DGOA 3OV4A 5IG3A 1M1K4 1IK3A 4K1VA 1IVUA 1IT8A 3AMOB 1YJN3 3JUQA 5FGOA 2XRXB 2OQEC 3CNMA 3EBTA 5D82A 3RGAA 1JKGA 3SXXA 7RNTA 3DH2A 1W6YA 4BL3A 3WDGB 1FA3A 2YFLB 2CK3H 1RSNA 1SIHA 1I2EA 5IG0A 1RRHA 2KXGA 1FYSA 1Z1SA 3VGNA 4JRFA 4X2HA 2CH9A 5LC6A 5IG4A 1WMNA 1X1XA 3S28A 1K28A 3CCQ3 1D6YA 1MGRA 1OCVA 2QGUA 4HAAA 4HVNA 4O2HA 1W6CA 5EVHA 1KQS2 3GZXB 4XDVA 1YIT3 1VQ53 3EC9A 3G8ZA
chains in the Genus database with same CATH topology
2CKFB 3M8CA 4XB5A 1SIIA 1A2VA 5KP4A 3EBYA 4EV5A 4R9LA 2W9PA 3H51A 3LTBA 4H3UA 2W2CA 2OCTA 1JNQA 1U5OA 2RSXA 3CC43 3JVCA 3G6E3 1IVVA 3GRDA 4FMAA 4KFEA 3S27A 3CPW2 1VQN3 4N6MA 1V74A 5IENA 2WGQA 1O7HB 1W2ZA 2F86B 2C11A 3F9SA 1HU9A 3HK4A 5DREA 1RKYA 1VQ43 4JF8A 4O8SA 2YFJB 1RN7A 3DZLA 1VQO3 1DVDA 1IQ8A 3X3ZA 4KFFA 4WYKB 3CCV3 3LXUX 3S29A 3NBRA 1EA2A 4RBNA 3D3LA 3PCSA 4N3VA 3NQZA 1KWIA 4HM7B 1E3VA 3LT9A 3F8XA 3GWRA 3LT8A 2OOVC 1YJW3 2FGTA 2OTL3 2QIYA 3UJMA 1E97A 2WOHA 3VSYA 1OGZA 5EEOA 1WQLB 2GU1A 3FKAA 3OWYA 4XBTA 3EQQB 1ISKA 3MKIA 4R9KA 2SBLA 2W56A 3CNXA 1ZX2A 1LOXA 1WTHA 3CCU3 2W6JH 1OUNA 3DGLA 3K5TA 1T5YA 1W6GA 1GD4A 2ML6A 3X42A 1IU7A 3CCJ3 1D6UA 1VQP3 1GY6A 1QJGA 1GY7A 3LTCA 1W2B2 4RNZA 5I97A 2P0XA 3LMLA 4GL6A 3U97A 3FGYA 1K734 5D83A 4FMDA 1GS3A 3SX1A 3CCL3 5ELUA 1L5GB 4J8TA 4HM6B 2HMNB 3OWSA 3UNLA 4FCMA 5AYSC 1JN5B 3JUMA 4EV2A 3NBBA 3J7Yd 3T8NA 3I0YA 3L0RA 4K1UA 2XFTA 2Z6BA 5FW5A 3CPOA 5CF1A 1Q40B 2K54A 3DM8A 4XM4A 1Q864 5AIFA 2CW9A 1UUWB 4AKYA 1DVCA 2WO0A 2RFRA 3IPTA 4LGQA 2GXFA 2Z77A 2W0QA 3MG3A 3PYJA 4MJDA 4N6TA 3G713 3I563 1JB4A 1OHSA 4NHFA 1OGXA 3CMA3 4J9AA 1TU5A 3IJEB 5IEOA 2K0MA 2P38A 4XDWA 1QALA 2W56B 1EG9B 3NHXA 1A90A 2WGOA 3MG1A 2P09A 1UI8A 2F98A 1IV9A 2E2VA 4R4KA 2CG1A 1FGQA 4OUQA 4N6V0 1PFPA 1KD14 4OK0A 3WMDA 1N9JA 2E2TA 2BMOB 3B7CA 3TDGA 5IEPA 1DMMA 3EB8A 5IG5A 1OPYA 3U1WA 3LOYA 3WOEB 1UW1A 3STDA 3OXAA 1AR0A 3B8LA 3D9RA 2KCDA 1VQL3 2CWVA 2MF7A 4IT7A 4Q53A 3WODG 1K41A 3F14A 3V99A 2XEPA 2YX9A 5AYRB 1R4CA 1IVXA 2OWPA 2IUKA 4FCZA 3SOAA 1GYBA 2IUJA 3I553 1NU3A 4HM8B 3BLZA 4WHAA 2BT3A 1Q40A 1VQ83 4EBGA 2IMJA 2Y74A 2BHMA 5EQLA 2CHCA 3JUOA 1JN5A 2XF3A 3GAXA 4FR9A 4H61A 1ASKA 3NUVA 3EHCA 3PGBA 5AEWB 1A67A 5BVBA 2BMQB 4L7KA 2HMKB 4HM3B 1K9M4 3FLJA 1Y4KA 1O7NB 3SOYA 1HKXA 3EN8A 4O3VA 3BNDA 1SJWA 3FG1A 4L8OA 4NREA 2XFSA 3WA3A 1S5AA 2O9UX 4HZBB 3X3YA 1F8NA 1O7PB 2RGQA 3CCM3 3O8YA 1MNLA 5AIIA 3G16A 4CCVA 1W7CA 5IW9A 2CFWA 1M904 1ROVA 3EE1A 3EJVA 1G96A 3CD63 3DGMA 2B24B 3N9HA 3PS8A 1LXEA 4CDLA 1CEWI 3FSDA 4AKZA 3AMOA 3NV0B 1EQKA 3T8UA 3F40A 1TFOA 2JQ5A 2M7OA 1PU4A 3EX9A 1W4NA 4N6NB 3CC73 3JUPA 1KC84 5AEUB 4XBYA 3N54B 2JDIH 1UUVB 3UL5A 1STDA 4FMCA 2ML5A 2FXTA 3LH4A 4LZIA 3KE7A 2IA7A 2O3OA 1QVG2 4TX4A 2LYXA 3KKGA 1SPUA 2YFIB 2MC8A 3WA2X 2QA43 3PCRA 3KFQC 1DMNA 5BXQA 3MPHA 3DMCA 2P0MA 4LEHA 2XR8B 5CXOA 4RNYA 1Q814 1SQWA 3Q2PA 3VF1A 1M1XB 2HMLB 4EXRA 3F7XA 4STDA 4U13A 3K9MC 1EKMA 3QRDA 1Q7Y4 3G0KA 3GZBA 3NXJA 1VZZA 3CCE3 2ZL8A 3KIIA 1FGOA 2STDA 2A15A 2ZDJA 4LMIA 5KP3A 3V92A 3LTDA 1J2BA 1DYUA 1QAKA 1FGRA 3OW22 2GBWB 3HIIA 2Z76A 3F7SA 4R1KA 4N6LA 4WP5A 3V98A 5IF6A 2BMRB 1QVF2 1NB5I 1NWWA 2F99A 1N8QA 4X2OA 3N8BA 4EC6A 1OHOA 1UI7A 1TUHA 2CFGA 3B4OA 2W04A 3FH1A 4N6OB 2D1WA 3OWUA 1W01A 5HGRA 3PXMA 4BTYA 3KSPA 4HKVB 2GU3A 5A0OB 3ALAA 3SVAA 3QK9A 3H3HA 2W03A 3CU3A 4HYZA 4AEQA 3HIGA 1IV7A 1NDOB 1BUQA 3PZWA 4RZMA 3GZYB 5DRVA 2XSOB 5AI1A 4HM5B 1Q824 3NQYA 1OF5A 2BO9B 3S5CA 3FF2A 3ROBA 1W02A 3NBJA 3OX9A 1GD3A 1FGTA 3F8HA 1LNHA 1N5PA 3NV0A 4IPBA 4L8PA 2CFKA 1YI23 1NJI4 1E3RA 2WOFA 1FUWA 4O02B 1RRLA 5JBSA 1IQXA 2XH9A 3CCR3 1CYVA 4HJLB 4XBXA 3X40A 4MMYB 2R4IA 3Q1CA 3FF0A 1YGEA 5AIHA 2UX0A 1JB5A 2CFDA 1CQSA 1O7MB 3WOFB 4LSOA 2KRTA 1IVWA 2C10A 3CCS3 3K0ZA 1OH0A 5LC7A 1VQ63 1WNHA 1KSIA 1JJ22 4WWUC 4R80A 5G2GA 1US1A 1IDPA 2XGLA 3NM2A 1VQM3 3HI7A 4EYCA 4FCJA 2D42A 1D6ZA 3MG2A 1VQ93 3FG3A 5JPPA 2L4VA 5CF2A 2CIUA 4N6UA 4HZ9B 1Q42A 3IMAB 5AIGA 5TGNA 3RDEA 3X3XA 1N9EA 3B4PA 4K90B 1RJOA 2PNCA 2XSHB 3MHEA 3DUKA 1N5HA 5STDA 1ULJB 5IERA 3K7CA 1GY5A 3SLUA 2CWTA 1YHQ3 4PEJA 2OTJ3 4HM0B 1W00A 1S723 1OACA 1U8CB 3MYTA 3JUNA 4HM4B 3CME3 3SEDA 3BNEA 1C7HA 1YJ93 4HM2B 1DMQA 3CXC2 1A2KA 1WMPA 4FMBA 1NB3I 4KZ1A 7STDA 3NX0A 1IQYA 1STFI 1O7GB 3UL6A 2W9QA 2Q07A 3DGNA 3ECFA 4I4KA 3UB1A 4HM1B 3DY5A 2HMJB 3E99A 1ROAA 2OOVA 2QEX3 2CG0A 3LYGA 5CK6A 4ZM8A 4WYKA 2HMMB 2RCDA 3T0UA 2XGNA 3CC23 1ULIB 3A76A 2E2UA 5ELJA 1LVNA 4QWTA 5JPUA 1JV2B 4K61A 1TP6A 4BTXA 1QAFA 1ZO2A 3RGRA 3DXOA 3MWZA 1QMAA 4KFDA 2I9WA 1VQ73 3FG4A 3G4S3 3K63A 3GZRA 3HZPA 1JB2A 2GEXA 2Y73A 4MMXB 2PZVA 3MSOA 1IT7A 1AVKA 1JRQA 1VQK3 1W5ZA 3X41A 4IIAA 3EF8A 4KVHA 2BNGA 2CFLA 3ER7A 2CC3A 1FGMA 6STDA 1M9GA 3KN4A 5CLKA 1CYUA 2LQVA 2FNQA 4ORLA 3NM7A 4WFOA 2OQEA 2V1LA 8CHOA 4GB5A 3FZWA 1TFKA 1NO3A 4MEIA 2CWUA 2INXA 3BNCA 1JKGB 3FCSB 1YIJ3 3HX8A 1AVLA 1WMOA 3S67A 2Z7AA 2HMOB 2GBXB 5D81A 3EN1B 1N8R4 3LZAA 2B1XB 1YVBI 5KP1A 2P05A 3KZTA 4MMZB 1AV4A 1TIJA 2GEYA 4G1MB 1OF5B 3BB9A 4BTWA 1MOLA 1K8A4 1OHPA 1O7WB 4HBRA 3BNBA 3KSED 3Q90A 3LTAA 4OVMA 3DGOA 3OV4A 5IG3A 1M1K4 1IK3A 4K1VA 1IVUA 1IT8A 3AMOB 1YJN3 3JUQA 5FGOA 2XRXB 2OQEC 3CNMA 3EBTA 5D82A 3RGAA 1JKGA 3SXXA 1W6YA 3WDGB 1FA3A 2YFLB 2CK3H 1SIHA 5IG0A 1RRHA 2KXGA 1Z1SA 3VGNA 4JRFA 4X2HA 2CH9A 5LC6A 5IG4A 1WMNA 3S28A 1K28A 3CCQ3 1D6YA 1OCVA 2QGUA 4O2HA 5EVHA 4HVNA 1W6CA 1KQS2 3GZXB 4XDVA 1YIT3 1VQ53 3EC9A 3G8ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CKF B;  3M8C A;  4XB5 A;  3WMD A;  2BMO B;  3B7C A;  5IEP A;  5KP4 A;  3EBY A;  1DMM A;  3ECF A;  2GBW B;  4I4K A;  4R9L A;  5IG5 A;  1OPY A;  2Z76 A;  3F7S A;  3H51 A;  4H3U A;  2HMJ B;  4HM1 B;  2W2C A;  4R1K A;  4WP5 A;  5IF6 A;  3E99 A;  2BMR B;  3STD A;  1NWW A;  3OXA A;  1AR0 A;  3B8L A;  1U5O A;  2F99 A;  3D9R A;  4X2O A;  3LYG A;  5CK6 A;  1OHO A;  3GRD A;  4Q53 A;  2HMM B;  2RCD A;  4WYK A;  1TUH A;  1K41 A;  3B4O A;  3F14 A;  3FH1 A;  1ULI B;  5IEN A;  3A76 A;  3OWU A;  1O7H B;  1W01 A;  5HGR A;  5JPU A;  3KSP A;  2F86 B;  2OWP A;  3F9S A;  4HKV B;  3SOA A;  1GYB A;  3HK4 A;  5DRE A;  1NU3 A;  1TP6 A;  3H3H A;  2YFJ B;  3BLZ A;  4HM8 B;  3DZL A;  1Q40 A;  3CU3 A;  4WYK B;  2IMJ A;  1NDO B;  1ZO2 A;  1BUQ A;  4RZM A;  3RGR A;  3GZY B;  3DXO A;  3NBR A;  1QMA A;  2XSO B;  2I9W A;  1EA2 A;  2CHC A;  4HM5 B;  5AI1 A;  5DRV A;  4N3V A;  1OF5 A;  4HM7 B;  3S5C A;  3FF2 A;  3GZR A;  1JN5 A;  3HZP A;  1JB2 A;  1E3V A;  1W02 A;  2GEX A;  3JUO A;  2PZV A;  3ROB A;  1ASK A;  3MSO A;  3F8X A;  3GWR A;  3NUV A;  3OX9 A;  3EHC A;  4OUQ A;  4IIA A;  3EF8 A;  3F8H A;  4KVH A;  5AEW B;  3NV0 A;  2BMQ B;  5KP3 A;  4L7K A;  5BVB A;  2BNG A;  2QIY A;  3ER7 A;  2HMK B;  3UJM A;  1E97 A;  4HM3 B;  4L8P A;  6STD A;  1E3R A;  5CLK A;  3FLJ A;  1OGZ A;  3VSY A;  4ORL A;  1WQL B;  3FKA A;  3OWY A;  1O7N B;  4XBT A;  3EQQ B;  3SOY A;  1HKX A;  3EN8 A;  1ISK A;  3MKI A;  4R9K A;  1SJW A;  3CNX A;  8CHO A;  4L8O A;  1ZX2 A;  4GB5 A;  1OUN A;  4HJL B;  3FZW A;  1S5A A;  4XBX A;  4HZB B;  1O7P B;  2R4I A;  2RGQ A;  3FF0 A;  5AII A;  1GY6 A;  1QJG A;  1GY7 A;  2UX0 A;  1JB5 A;  3G16 A;  5AIH A;  1CQS A;  1O7M B;  3FGY A;  2INX A;  3EJV A;  1JKG B;  2B24 B;  3HX8 A;  3K0Z A;  1OH0 A;  5D83 A;  2Z7A A;  2HMO B;  1GS3 A;  3FSD A;  4CDL A;  2GBX B;  5D81 A;  3NV0 B;  4J8T A;  4HM6 B;  3EN1 B;  3F40 A;  3T8U A;  3LZA A;  2JQ5 A;  2B1X B;  2HMN B;  3OWS A;  4WWU C;  3UNL A;  5KP1 A;  5G2G A;  3KZT A;  1IDP A;  4FCM A;  3EX9 A;  3NM2 A;  1JN5 B;  3JUP A;  3JUM A;  2GEY A;  1OF5 B;  3BB9 A;  5AEU B;  4FCJ A;  1OHP A;  1O7W B;  3MG2 A;  4XBY A;  3T8N A;  3I0Y A;  3Q90 A;  4K1U A;  4OVM A;  5JPP A;  1UUV B;  3OV4 A;  1STD A;  5CF2 A;  5IG3 A;  4K1V A;  5FW5 A;  3CPO A;  4HZ9 B;  1Q40 B;  2K54 A;  3DM8 A;  5CF1 A;  1Q42 A;  3JUQ A;  5AIG A;  2XRX B;  3KE7 A;  3CNM A;  3EBT A;  4XM4 A;  5D82 A;  3B4P A;  5TGN A;  3RGA A;  1JKG A;  2XSH B;  3KKG A;  5AIF A;  1UUW B;  1W6Y A;  2YFI B;  3MHE A;  2RFR A;  2YFL B;  3DUK A;  3IPT A;  4LGQ A;  2GXF A;  2Z77 A;  5STD A;  1ULJ B;  1DMN A;  3K7C A;  5BXQ A;  1GY5 A;  5IG0 A;  5IER A;  3DMC A;  3MG3 A;  4LEH A;  2XR8 B;  5CXO A;  4MJD A;  1Z1S A;  4PEJ A;  4HM0 B;  1W00 A;  3VGN A;  1JB4 A;  1OHS A;  1OGX A;  2HML B;  3MYT A;  3JUN A;  4HM4 B;  4J9A A;  3F7X A;  4STD A;  4U13 A;  4X2H A;  5IEO A;  3SED A;  1C7H A;  4XDW A;  5IG4 A;  1EG9 B;  1DMQ A;  3NHX A;  1A2K A;  3G0K A;  3GZB A;  1OCV A;  2QGU A;  1VZZ A;  3NXJ A;  3MG1 A;  4HVN A;  5EVH A;  4HM2 B;  2F98 A;  3GZX B;  4XDV A;  7STD A;  2STD A;  2A15 A;  3EC9 A;  4LMI A;  3G8Z A;  1O7G B; 
#chains in the Genus database with same CATH topology
 2CKF B;  3M8C A;  4XB5 A;  1SII A;  4I5Q A;  1A2V A;  4DKI A;  3EBY A;  4EV5 A;  5KP4 A;  5G1L A;  4R9L A;  2W9P A;  3H51 A;  3LTB A;  4H3U A;  2W2C A;  1I8V A;  2OCT A;  1JNQ A;  1U5O A;  1BSB A;  2RSX A;  3CC4 3;  3JVC A;  3G6E 3;  1IVV A;  1RGE A;  3GRD A;  2BIR A;  4FMA A;  4KFE A;  3S27 A;  3CPW 2;  1VQN 3;  1I3I A;  3HOH A;  1A2P A;  4N6M A;  1V74 A;  5IEN A;  2WGQ A;  1O7H B;  1FUS A;  1W2Z A;  2CX1 A;  2F86 B;  2C11 A;  3F9S A;  1HU9 A;  3HK4 A;  5DRE A;  1RKY A;  4CJN A;  1VQ4 3;  4JF8 A;  1RGF A;  4O8S A;  2YFJ B;  1RN7 A;  3DZL A;  1MWU A;  1VQO 3;  1DVD A;  1IQ8 A;  3X3Z A;  4KFF A;  4WYK B;  3CCV 3;  3LXU X;  3S29 A;  3NBR A;  1BUJ A;  1EA2 A;  4RBN A;  3D3L A;  3PCS A;  4N3V A;  4RNT A;  3NQZ A;  1KWI A;  4HM7 B;  1E3V A;  3ZG5 A;  3LT9 A;  1X1U A;  3F8X A;  3GWR A;  3LT8 A;  2OOV C;  1YJW 3;  1RGA A;  2FGT A;  2UUG C;  1HYF A;  1MWT A;  2OTL 3;  2QIY A;  3ZFZ A;  3UJM A;  1E97 A;  2WOH A;  4ILF A;  3VSY A;  1OGZ A;  1BU4 A;  1BSE A;  1Q7H A;  1WQL B;  2GU1 A;  3FKA A;  3OWY A;  1B21 A;  4XBT A;  1JBS A;  3EQQ B;  1ISK A;  1UCI A;  2CX0 A;  3MKI A;  4R9K A;  2SBL A;  3GSP A;  2W56 A;  3CNX A;  1ZX2 A;  1LOX A;  1WTH A;  3CCU 3;  2W6J H;  1OUN A;  2H0H A;  3DGL A;  1V57 A;  3K5T A;  3AHS A;  1T5Y A;  1W6G A;  1GD4 A;  2ML6 A;  3X42 A;  1IU7 A;  1DET A;  1D6U A;  3CCJ 3;  1GY6 A;  1QJG A;  1GY7 A;  3LTC A;  1W2B 2;  1R4Y A;  4RNZ A;  5I97 A;  2P0X A;  3LML A;  4GHO A;  4GL6 A;  3U97 A;  3FGY A;  1K73 4;  4BIR A;  5D83 A;  1LOV A;  4FMD A;  1GS3 A;  3SX1 A;  3CCL 3;  1X1Y A;  5ELU A;  1L5G B;  4J8T A;  4HM6 B;  3ZG0 A;  2HMN B;  3OWS A;  3UNL A;  1BIR A;  4FCM A;  5AYS C;  1JN5 B;  3JUM A;  4EV2 A;  3NBB A;  3J7Y d;  3T8N A;  3I0Y A;  3L0R A;  4K1U A;  2RNT A;  2XFT A;  2Z6B A;  1B2S A;  5FW5 A;  3CPO A;  5CF1 A;  1Q40 B;  2K54 A;  3DM8 A;  4XM4 A;  1PY3 A;  2GSP A;  1Q86 4;  5AIF A;  2CW9 A;  3D4A A;  1UUW B;  4AKY A;  1DVC A;  2RBI A;  2WO0 A;  2RFR A;  3IPT A;  4LGQ A;  1BSC A;  2GXF A;  2Z77 A;  1YGW A;  2W0Q A;  3MG3 A;  3D5I A;  3PYJ A;  1YVS A;  4MJD A;  4N6T A;  3G71 3;  3I56 3;  1JB4 A;  1OHS A;  4NHF A;  1OGX A;  3CMA 3;  4J9A A;  1TU5 A;  3IJE B;  5IEO A;  2K0M A;  2P38 A;  5M19 A;  4XDW A;  1GSP A;  1EG9 B;  1QAL A;  2W56 B;  3NHX A;  1A90 A;  2KF5 A;  1RGC A;  2WGO A;  3MG1 A;  1UGI A;  2P09 A;  2K3D A;  1UI8 A;  1X1W A;  1RGG A;  2F98 A;  1IV9 A;  2E2V A;  4R4K A;  2CG1 A;  1FGQ A;  3SYU A;  4OUQ A;  4N6V 0;  1PFP A;  1KD1 4;  4OK0 A;  3WMD A;  1BNJ A;  1N9J A;  2E2T A;  2BMO B;  1BAO A;  1RNT A;  3B7C A;  3TDG A;  5IEP A;  1DMM A;  1ZGX A;  1BSA A;  2F5W A;  3EB8 A;  5IG5 A;  1OPY A;  3U1W A;  3LOY A;  1V58 A;  3WOE B;  1UW1 A;  3STD A;  3OXA A;  1AR0 A;  2KF6 A;  3B8L A;  3D9R A;  1DE3 A;  2KCD A;  1VQL 3;  2CWV A;  1EUI C;  1B3S A;  1BRK A;  1RHL A;  2MF7 A;  2SAR A;  4IT7 A;  4Q53 A;  3WOD G;  7GSP A;  1K41 A;  3F14 A;  3V99 A;  2XEP A;  2YX9 A;  1FW7 A;  5AYR B;  3AGO A;  1R4C A;  1RMS A;  1IVX A;  2OWP A;  2IUK A;  4FCZ A;  3SOA A;  1GYB A;  2IUJ A;  3I55 3;  1NU3 A;  4HM8 B;  3BLZ A;  4WHA A;  2BT3 A;  1Q40 A;  1VQ8 3;  4EBG A;  2IMJ A;  2Y74 A;  1BNE A;  2BHM A;  5EQL A;  1BRS A;  6GSP A;  1UGH I;  2CHC A;  3JUO A;  1JN5 A;  2XF3 A;  3GAX A;  4FR9 A;  1VQP 3;  1BNR A;  4H61 A;  1ASK A;  1AQZ A;  3NUV A;  3EHC A;  1RDS A;  3PGB A;  5AEW B;  1A67 A;  5BVB A;  2BMQ B;  4L7K A;  1BRN L;  2HMK B;  2L1S A;  3AHW A;  4HM3 B;  1K9M 4;  1BRJ A;  1BAN A;  1Y4K A;  3FLJ A;  1O7N B;  3SOY A;  1HKX A;  3EN8 A;  4O3V A;  3BND A;  1SJW A;  3FG1 A;  4L8O A;  4NRE A;  2XFS A;  3WA3 A;  1LNI A;  4BL2 A;  1S5A A;  2O9U X;  1MWS A;  3AGN A;  4HZB B;  3X3Y A;  1F8N A;  1O7P B;  2RGQ A;  3CCM 3;  1MGW A;  1ZS7 A;  3O8Y A;  1MNL A;  5AII A;  4CPK A;  1UDI I;  2AAD A;  3G16 A;  4CCV A;  1W7C A;  5IW9 A;  2CFW A;  1M90 4;  1JBT A;  1ROV A;  3EE1 A;  3EJV A;  1G96 A;  3CD6 3;  3DGM A;  2B24 B;  1C54 A;  8RNT A;  3N9H A;  3PS8 A;  1LXE A;  1LOW A;  1CEW I;  3FSD A;  4CDL A;  4AKZ A;  3AMO A;  3NV0 B;  1EQK A;  3T8U A;  3F40 A;  1TFO A;  2JQ5 A;  2M7O A;  1PU4 A;  3EX9 A;  1W4N A;  1EEJ A;  1UCL A;  4N6N B;  1JZO A;  3JUP A;  3CC7 3;  1KC8 4;  5AEU B;  4XBY A;  2BU4 A;  3N54 B;  2J8X B;  2JDI H;  1UUV B;  3UL5 A;  1STD A;  4LYL B;  4FMC A;  1NNV A;  2ML5 A;  2FXT A;  3LH4 A;  4LZI A;  3KE7 A;  3RNT A;  2IA7 A;  2O3O A;  1QVG 2;  4TX4 A;  2AAE A;  2LYX A;  1B2X A;  3KKG A;  3WHO A;  1SPU A;  2YFI B;  2MC8 A;  3WA2 X;  2QA4 3;  3PCR A;  3KFQ C;  1T2H A;  1DMN A;  1G0T A;  5BXQ A;  1Q9E A;  1FUT A;  3MPH A;  3DMC A;  2P0M A;  4LEH A;  2XR8 B;  5CXO A;  1GOU A;  4RNY A;  1Q81 4;  1SQW A;  3Q2P A;  3VF1 A;  2R41 A;  1M1X B;  2HML B;  4EXR A;  3F7X A;  4STD A;  4U13 A;  2ZHX B;  3K9M C;  1RLS A;  1EKM A;  3QRD A;  1Q7Y 4;  3G0K A;  3GZB A;  3NXJ A;  2H0I A;  1RCL A;  1VZZ A;  3BIR A;  2H0G A;  3CCE 3;  1B27 A;  2ZL8 A;  1JBR A;  3KII A;  1FGO A;  3KCH A;  2STD A;  2A15 A;  2ZDJ A;  4LMI A;  1RGL A;  5KP3 A;  3LTD A;  3V92 A;  1J2B A;  1DYU A;  1QAK A;  1FGR A;  2IY2 A;  3OW2 2;  2F56 A;  2GBW B;  3HII A;  2Z76 A;  1RN4 A;  1JZD A;  3F7S A;  4N6L A;  4R1K A;  4WP5 A;  3V98 A;  5IF6 A;  1RNB A;  2BMR B;  1QVF 2;  2KF3 A;  1GOY A;  1NWW A;  1NB5 I;  2F99 A;  1N8Q A;  4X2O A;  1TTO A;  3N8B A;  4EC6 A;  1OHO A;  1LQG C;  1UI7 A;  1BRI A;  1TUH A;  4NPB A;  2CFG A;  3B4O A;  2W04 A;  3FH1 A;  4N6O B;  1BRG A;  2D1W A;  3OWU A;  1W01 A;  5HGR A;  3PXM A;  4BTY A;  3KSP A;  4HKV B;  2GU3 A;  5A0O B;  3ALA A;  3SVA A;  3QK9 A;  3H3H A;  2W03 A;  1LOY A;  3CU3 A;  4HYZ A;  4AEQ A;  3HIG A;  1IV7 A;  1NDO B;  1SAR A;  1BUQ A;  3PZW A;  4RZM A;  3GZY B;  5DRV A;  2XSO B;  5AI1 A;  1RTU A;  4HM5 B;  1Q82 4;  3NQY A;  1OF5 A;  2BO9 B;  3S5C A;  3FF2 A;  3ROB A;  1W02 A;  3NBJ A;  1PYL A;  3OX9 A;  1GD3 A;  1FGT A;  3F8H A;  1LNH A;  1N5P A;  1BNG A;  3NV0 A;  2KAA A;  4IPB A;  1AY7 A;  4L8P A;  2CFK A;  1YI2 3;  1NJI 4;  1E3R A;  2WOF A;  3D5G A;  1FUW A;  4O02 B;  1BNS A;  1RRL A;  5JBS A;  1IQX A;  1B20 A;  1VQQ A;  5G1K A;  2XH9 A;  1I0X A;  2C4B A;  1RCK A;  4EW5 A;  3CCR 3;  1CYV A;  4HJL B;  4XBX A;  3X40 A;  1BNI A;  4MMY B;  2ZA4 A;  2R4I A;  3Q1C A;  3FF0 A;  1YGE A;  5AIH A;  2UX0 A;  1JB5 A;  2CFD A;  1CQS A;  1O7M B;  3WOF B;  4LSO A;  2KRT A;  1G02 A;  1IVW A;  2C10 A;  2F4Y A;  3CCS 3;  3K0Z A;  1OH0 A;  3D79 A;  5LC7 A;  1VQ6 3;  1WNH A;  1I3F A;  1KSI A;  1GMR A;  1JJ2 2;  4WWU C;  3WR2 A;  4R80 A;  5G2G A;  1US1 A;  1IDP A;  1BGS A;  1BRH A;  2XGL A;  3NM2 A;  1VQM 3;  3HI7 A;  4EYC A;  1BSD A;  1RGH A;  1T3B A;  4FCJ A;  2D42 A;  1B2Z A;  1D6Z A;  3MG2 A;  6RNT A;  1VQ9 3;  3FG3 A;  5JPP A;  2L4V A;  5CF2 A;  2CIU A;  4N6U A;  4HZ9 B;  5M1A A;  1Q42 A;  3IMA B;  5AIG A;  5TGN A;  3RDE A;  3X3X A;  1N9E A;  3B4P A;  1UCK A;  4K90 B;  1RJO A;  1I0V A;  2PNC A;  2XSH B;  3MHE A;  3DUK A;  1N5H A;  1TJD A;  1T2I A;  1ULJ B;  2HOH A;  3K7C A;  1GY5 A;  5STD A;  2UGI A;  3SLU A;  5HOH A;  5IER A;  2CWT A;  1YHQ 3;  1UCJ A;  4PEJ A;  5EEO A;  4HM0 B;  1W00 A;  1S72 3;  2OTJ 3;  1BOX A;  1OAC A;  1U8C B;  3MYT A;  4J5G A;  1FZU A;  3JUN A;  4HM4 B;  3SED A;  3BNE A;  3CME 3;  1GOV A;  1C7H A;  1YJ9 3;  4HM2 B;  1DMQ A;  3CXC 2;  1A2K A;  1WMP A;  1I2G A;  3Q3F A;  4FMB A;  1NB3 I;  3DGY A;  2F5M A;  4KZ1 A;  7STD A;  3NX0 A;  1IQY A;  1STF I;  2IYJ A;  1RN1 A;  1O7G B;  3UL6 A;  2W9Q A;  2Q07 A;  3DGN A;  3ECF A;  4I4K A;  3UB1 A;  4HM1 B;  3DY5 A;  2HMJ B;  3E99 A;  1ROA A;  2OOV A;  3URP A;  2QEX 3;  5BU4 A;  2CG0 A;  1LRA A;  3LYG A;  4HOH A;  1UUG B;  5CK6 A;  4ZM8 A;  5M18 A;  4WYK A;  2HMM B;  2RCD A;  3T0U A;  2XGN A;  1HZ1 A;  3CC2 3;  4J5K A;  1ULI B;  3A76 A;  2E2U A;  5ELJ A;  1TRQ A;  1LVN A;  4QWT A;  5JPU A;  1JV2 B;  4K61 A;  1TP6 A;  4BTX A;  1QAF A;  2KF4 A;  1ZO2 A;  3RGR A;  4KT3 B;  3DXO A;  3MWZ A;  1QMA A;  4KFD A;  2I9W A;  1VQ7 3;  3FG4 A;  3G4S 3;  3K63 A;  3GZR A;  3HZP A;  1JB2 A;  2GEX A;  2Y73 A;  4MMX B;  2PZV A;  3MSO A;  1IT7 A;  1AVK A;  1GMQ A;  1JRQ A;  1VQK 3;  1W5Z A;  3X41 A;  4IIA A;  3EF8 A;  4KVH A;  2BNG A;  2CFL A;  3ER7 A;  2CC3 A;  1FGM A;  6STD A;  1M9G A;  3KN4 A;  5CLK A;  1CYU A;  2LQV A;  2FNQ A;  4ORL A;  3NM7 A;  4WFO A;  5GSP A;  2OQE A;  4BU4 A;  1LQM B;  2V1L A;  5BIR A;  8CHO A;  5RNT A;  4GB5 A;  3FZW A;  1I2F A;  1TFK A;  3A5E A;  1YNV X;  1BVI A;  1NO3 A;  4MEI A;  1MWR A;  2CWU A;  1IYY A;  1BNF A;  2INX A;  3BNC A;  1JKG B;  3FCS B;  1YIJ 3;  3HX8 A;  1AVL A;  1RGK A;  1WMO A;  3S67 A;  2Z7A A;  2HMO B;  1I70 A;  4GSP A;  2GBX B;  5D81 A;  3EN1 B;  1N8R 4;  3LZA A;  2B1X B;  1YVB I;  5KP1 A;  2P05 A;  1B2M A;  3KZT A;  9RNT A;  1GMP A;  4MMZ B;  1AV4 A;  3BU4 A;  1TIJ A;  2GEY A;  4G1M B;  1OF5 B;  3BB9 A;  4BTW A;  1MOL A;  1K8A 4;  1OHP A;  1O7W B;  4HBR A;  3BNB A;  1TRP A;  3KSE D;  1B2U A;  3Q90 A;  1CH0 A;  3LTA A;  4OVM A;  3DGO A;  3OV4 A;  5IG3 A;  1M1K 4;  1IK3 A;  4K1V A;  1IVU A;  1IT8 A;  3AMO B;  1YJN 3;  3JUQ A;  5FGO A;  2XRX B;  2OQE C;  3CNM A;  3EBT A;  5D82 A;  3RGA A;  1JKG A;  3SXX A;  7RNT A;  3DH2 A;  1W6Y A;  4BL3 A;  3WDG B;  1FA3 A;  2YFL B;  2CK3 H;  1RSN A;  1SIH A;  1I2E A;  5IG0 A;  1RRH A;  2KXG A;  1FYS A;  1Z1S A;  3VGN A;  4JRF A;  4X2H A;  2CH9 A;  5LC6 A;  5IG4 A;  1WMN A;  1X1X A;  3S28 A;  1K28 A;  3CCQ 3;  1D6Y A;  1MGR A;  1OCV A;  2QGU A;  4HAA A;  4HVN A;  4O2H A;  1W6C A;  5EVH A;  1KQS 2;  3GZX B;  4XDV A;  1YIT 3;  1VQ5 3;  3EC9 A;  3G8Z A; 
#chains in the Genus database with same CATH homology
 2CKF B;  3M8C A;  4XB5 A;  1SII A;  1A2V A;  5KP4 A;  3EBY A;  4EV5 A;  4R9L A;  2W9P A;  3H51 A;  3LTB A;  4H3U A;  2W2C A;  2OCT A;  1JNQ A;  1U5O A;  2RSX A;  3CC4 3;  3JVC A;  3G6E 3;  1IVV A;  3GRD A;  4FMA A;  4KFE A;  3S27 A;  3CPW 2;  1VQN 3;  4N6M A;  1V74 A;  5IEN A;  2WGQ A;  1O7H B;  1W2Z A;  2F86 B;  2C11 A;  3F9S A;  1HU9 A;  3HK4 A;  5DRE A;  1RKY A;  1VQ4 3;  4JF8 A;  4O8S A;  2YFJ B;  1RN7 A;  3DZL A;  1VQO 3;  1DVD A;  1IQ8 A;  3X3Z A;  4KFF A;  4WYK B;  3CCV 3;  3LXU X;  3S29 A;  3NBR A;  1EA2 A;  4RBN A;  3D3L A;  3PCS A;  4N3V A;  3NQZ A;  1KWI A;  4HM7 B;  1E3V A;  3LT9 A;  3F8X A;  3GWR A;  3LT8 A;  2OOV C;  1YJW 3;  2FGT A;  2OTL 3;  2QIY A;  3UJM A;  1E97 A;  2WOH A;  3VSY A;  1OGZ A;  5EEO A;  1WQL B;  2GU1 A;  3FKA A;  3OWY A;  4XBT A;  3EQQ B;  1ISK A;  3MKI A;  4R9K A;  2SBL A;  2W56 A;  3CNX A;  1ZX2 A;  1LOX A;  1WTH A;  3CCU 3;  2W6J H;  1OUN A;  3DGL A;  3K5T A;  1T5Y A;  1W6G A;  1GD4 A;  2ML6 A;  3X42 A;  1IU7 A;  3CCJ 3;  1D6U A;  1VQP 3;  1GY6 A;  1QJG A;  1GY7 A;  3LTC A;  1W2B 2;  4RNZ A;  5I97 A;  2P0X A;  3LML A;  4GL6 A;  3U97 A;  3FGY A;  1K73 4;  5D83 A;  4FMD A;  1GS3 A;  3SX1 A;  3CCL 3;  5ELU A;  1L5G B;  4J8T A;  4HM6 B;  2HMN B;  3OWS A;  3UNL A;  4FCM A;  5AYS C;  1JN5 B;  3JUM A;  4EV2 A;  3NBB A;  3J7Y d;  3T8N A;  3I0Y A;  3L0R A;  4K1U A;  2XFT A;  2Z6B A;  5FW5 A;  3CPO A;  5CF1 A;  1Q40 B;  2K54 A;  3DM8 A;  4XM4 A;  1Q86 4;  5AIF A;  2CW9 A;  1UUW B;  4AKY A;  1DVC A;  2WO0 A;  2RFR A;  3IPT A;  4LGQ A;  2GXF A;  2Z77 A;  2W0Q A;  3MG3 A;  3PYJ A;  4MJD A;  4N6T A;  3G71 3;  3I56 3;  1JB4 A;  1OHS A;  4NHF A;  1OGX A;  3CMA 3;  4J9A A;  1TU5 A;  3IJE B;  5IEO A;  2K0M A;  2P38 A;  4XDW A;  1QAL A;  2W56 B;  1EG9 B;  3NHX A;  1A90 A;  2WGO A;  3MG1 A;  2P09 A;  1UI8 A;  2F98 A;  1IV9 A;  2E2V A;  4R4K A;  2CG1 A;  1FGQ A;  4OUQ A;  4N6V 0;  1PFP A;  1KD1 4;  4OK0 A;  3WMD A;  1N9J A;  2E2T A;  2BMO B;  3B7C A;  3TDG A;  5IEP A;  1DMM A;  3EB8 A;  5IG5 A;  1OPY A;  3U1W A;  3LOY A;  3WOE B;  1UW1 A;  3STD A;  3OXA A;  1AR0 A;  3B8L A;  3D9R A;  2KCD A;  1VQL 3;  2CWV A;  2MF7 A;  4IT7 A;  4Q53 A;  3WOD G;  1K41 A;  3F14 A;  3V99 A;  2XEP A;  2YX9 A;  5AYR B;  1R4C A;  1IVX A;  2OWP A;  2IUK A;  4FCZ A;  3SOA A;  1GYB A;  2IUJ A;  3I55 3;  1NU3 A;  4HM8 B;  3BLZ A;  4WHA A;  2BT3 A;  1Q40 A;  1VQ8 3;  4EBG A;  2IMJ A;  2Y74 A;  2BHM A;  5EQL A;  2CHC A;  3JUO A;  1JN5 A;  2XF3 A;  3GAX A;  4FR9 A;  4H61 A;  1ASK A;  3NUV A;  3EHC A;  3PGB A;  5AEW B;  1A67 A;  5BVB A;  2BMQ B;  4L7K A;  2HMK B;  4HM3 B;  1K9M 4;  3FLJ A;  1Y4K A;  1O7N B;  3SOY A;  1HKX A;  3EN8 A;  4O3V A;  3BND A;  1SJW A;  3FG1 A;  4L8O A;  4NRE A;  2XFS A;  3WA3 A;  1S5A A;  2O9U X;  4HZB B;  3X3Y A;  1F8N A;  1O7P B;  2RGQ A;  3CCM 3;  3O8Y A;  1MNL A;  5AII A;  3G16 A;  4CCV A;  1W7C A;  5IW9 A;  2CFW A;  1M90 4;  1ROV A;  3EE1 A;  3EJV A;  1G96 A;  3CD6 3;  3DGM A;  2B24 B;  3N9H A;  3PS8 A;  1LXE A;  4CDL A;  1CEW I;  3FSD A;  4AKZ A;  3AMO A;  3NV0 B;  1EQK A;  3T8U A;  3F40 A;  1TFO A;  2JQ5 A;  2M7O A;  1PU4 A;  3EX9 A;  1W4N A;  4N6N B;  3CC7 3;  3JUP A;  1KC8 4;  5AEU B;  4XBY A;  3N54 B;  2JDI H;  1UUV B;  3UL5 A;  1STD A;  4FMC A;  2ML5 A;  2FXT A;  3LH4 A;  4LZI A;  3KE7 A;  2IA7 A;  2O3O A;  1QVG 2;  4TX4 A;  2LYX A;  3KKG A;  1SPU A;  2YFI B;  2MC8 A;  3WA2 X;  2QA4 3;  3PCR A;  3KFQ C;  1DMN A;  5BXQ A;  3MPH A;  3DMC A;  2P0M A;  4LEH A;  2XR8 B;  5CXO A;  4RNY A;  1Q81 4;  1SQW A;  3Q2P A;  3VF1 A;  1M1X B;  2HML B;  4EXR A;  3F7X A;  4STD A;  4U13 A;  3K9M C;  1EKM A;  3QRD A;  1Q7Y 4;  3G0K A;  3GZB A;  3NXJ A;  1VZZ A;  3CCE 3;  2ZL8 A;  3KII A;  1FGO A;  2STD A;  2A15 A;  2ZDJ A;  4LMI A;  5KP3 A;  3V92 A;  3LTD A;  1J2B A;  1DYU A;  1QAK A;  1FGR A;  3OW2 2;  2GBW B;  3HII A;  2Z76 A;  3F7S A;  4R1K A;  4N6L A;  4WP5 A;  3V98 A;  5IF6 A;  2BMR B;  1QVF 2;  1NB5 I;  1NWW A;  2F99 A;  1N8Q A;  4X2O A;  3N8B A;  4EC6 A;  1OHO A;  1UI7 A;  1TUH A;  2CFG A;  3B4O A;  2W04 A;  3FH1 A;  4N6O B;  2D1W A;  3OWU A;  1W01 A;  5HGR A;  3PXM A;  4BTY A;  3KSP A;  4HKV B;  2GU3 A;  5A0O B;  3ALA A;  3SVA A;  3QK9 A;  3H3H A;  2W03 A;  3CU3 A;  4HYZ A;  4AEQ A;  3HIG A;  1IV7 A;  1NDO B;  1BUQ A;  3PZW A;  4RZM A;  3GZY B;  5DRV A;  2XSO B;  5AI1 A;  4HM5 B;  1Q82 4;  3NQY A;  1OF5 A;  2BO9 B;  3S5C A;  3FF2 A;  3ROB A;  1W02 A;  3NBJ A;  3OX9 A;  1GD3 A;  1FGT A;  3F8H A;  1LNH A;  1N5P A;  3NV0 A;  4IPB A;  4L8P A;  2CFK A;  1YI2 3;  1NJI 4;  1E3R A;  2WOF A;  1FUW A;  4O02 B;  1RRL A;  5JBS A;  1IQX A;  2XH9 A;  3CCR 3;  1CYV A;  4HJL B;  4XBX A;  3X40 A;  4MMY B;  2R4I A;  3Q1C A;  3FF0 A;  1YGE A;  5AIH A;  2UX0 A;  1JB5 A;  2CFD A;  1CQS A;  1O7M B;  3WOF B;  4LSO A;  2KRT A;  1IVW A;  2C10 A;  3CCS 3;  3K0Z A;  1OH0 A;  5LC7 A;  1VQ6 3;  1WNH A;  1KSI A;  1JJ2 2;  4WWU C;  4R80 A;  5G2G A;  1US1 A;  1IDP A;  2XGL A;  3NM2 A;  1VQM 3;  3HI7 A;  4EYC A;  4FCJ A;  2D42 A;  1D6Z A;  3MG2 A;  1VQ9 3;  3FG3 A;  5JPP A;  2L4V A;  5CF2 A;  2CIU A;  4N6U A;  4HZ9 B;  1Q42 A;  3IMA B;  5AIG A;  5TGN A;  3RDE A;  3X3X A;  1N9E A;  3B4P A;  4K90 B;  1RJO A;  2PNC A;  2XSH B;  3MHE A;  3DUK A;  1N5H A;  5STD A;  1ULJ B;  5IER A;  3K7C A;  1GY5 A;  3SLU A;  2CWT A;  1YHQ 3;  4PEJ A;  2OTJ 3;  4HM0 B;  1W00 A;  1S72 3;  1OAC A;  1U8C B;  3MYT A;  3JUN A;  4HM4 B;  3CME 3;  3SED A;  3BNE A;  1C7H A;  1YJ9 3;  4HM2 B;  1DMQ A;  3CXC 2;  1A2K A;  1WMP A;  4FMB A;  1NB3 I;  4KZ1 A;  7STD A;  3NX0 A;  1IQY A;  1STF I;  1O7G B;  3UL6 A;  2W9Q A;  2Q07 A;  3DGN A;  3ECF A;  4I4K A;  3UB1 A;  4HM1 B;  3DY5 A;  2HMJ B;  3E99 A;  1ROA A;  2OOV A;  2QEX 3;  2CG0 A;  3LYG A;  5CK6 A;  4ZM8 A;  4WYK A;  2HMM B;  2RCD A;  3T0U A;  2XGN A;  3CC2 3;  1ULI B;  3A76 A;  2E2U A;  5ELJ A;  1LVN A;  4QWT A;  5JPU A;  1JV2 B;  4K61 A;  1TP6 A;  4BTX A;  1QAF A;  1ZO2 A;  3RGR A;  3DXO A;  3MWZ A;  1QMA A;  4KFD A;  2I9W A;  1VQ7 3;  3FG4 A;  3G4S 3;  3K63 A;  3GZR A;  3HZP A;  1JB2 A;  2GEX A;  2Y73 A;  4MMX B;  2PZV A;  3MSO A;  1IT7 A;  1AVK A;  1JRQ A;  1VQK 3;  1W5Z A;  3X41 A;  4IIA A;  3EF8 A;  4KVH A;  2BNG A;  2CFL A;  3ER7 A;  2CC3 A;  1FGM A;  6STD A;  1M9G A;  3KN4 A;  5CLK A;  1CYU A;  2LQV A;  2FNQ A;  4ORL A;  3NM7 A;  4WFO A;  2OQE A;  2V1L A;  8CHO A;  4GB5 A;  3FZW A;  1TFK A;  1NO3 A;  4MEI A;  2CWU A;  2INX A;  3BNC A;  1JKG B;  3FCS B;  1YIJ 3;  3HX8 A;  1AVL A;  1WMO A;  3S67 A;  2Z7A A;  2HMO B;  2GBX B;  5D81 A;  3EN1 B;  1N8R 4;  3LZA A;  2B1X B;  1YVB I;  5KP1 A;  2P05 A;  3KZT A;  4MMZ B;  1AV4 A;  1TIJ A;  2GEY A;  4G1M B;  1OF5 B;  3BB9 A;  4BTW A;  1MOL A;  1K8A 4;  1OHP A;  1O7W B;  4HBR A;  3BNB A;  3KSE D;  3Q90 A;  3LTA A;  4OVM A;  3DGO A;  3OV4 A;  5IG3 A;  1M1K 4;  1IK3 A;  4K1V A;  1IVU A;  1IT8 A;  3AMO B;  1YJN 3;  3JUQ A;  5FGO A;  2XRX B;  2OQE C;  3CNM A;  3EBT A;  5D82 A;  3RGA A;  1JKG A;  3SXX A;  1W6Y A;  3WDG B;  1FA3 A;  2YFL B;  2CK3 H;  1SIH A;  5IG0 A;  1RRH A;  2KXG A;  1Z1S A;  3VGN A;  4JRF A;  4X2H A;  2CH9 A;  5LC6 A;  5IG4 A;  1WMN A;  3S28 A;  1K28 A;  3CCQ 3;  1D6Y A;  1OCV A;  2QGU A;  4O2H A;  5EVH A;  4HVN A;  1W6C A;  1KQS 2;  3GZX B;  4XDV A;  1YIT 3;  1VQ5 3;  3EC9 A;  3G8Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...