4WP5A

Chaetomium thermophilum mex67 ntf2-like domain complexed with mtr2
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
201
structure length
199
Chain Sequence
MPTPLPQLPSNVRDGENNVASTFLQAFFQLWDHDRLTLIPQFYDSETTFSVVFATDSPQDPASSSCSKFSRNLNILSPPSTLQRLFVGSNLIADLWKVLPATRHPSLDQTSQWLIDCHTFPHLADPTGMAPYAMGLMINVNGQCEEADISQNLYGTRTFSRCFILGPSKPGAPHPYRVLSDQLTLHTWKPQPAPQVGTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural characterization of the principal mRNA-export factor Mex67-Mtr2 from Chaetomium thermophilum.
pubmed doi rcsb
source organism Chaetomium thermophilum
molecule tags Transport protein
molecule keywords mRNA export protein
total genus 37
structure length 199
sequence length 201
ec nomenclature
pdb deposition date 2014-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4wp5A00
3DUKA 2F99A 1S5AA 5KP4A 4L8PA 3MG3A 4WWUC 5AIGA 4J8TA 3ROBA 3HK4A 3F40A 4HM4B 3GZYB 3NUVA 2CHCA 7STDA 3EBTA 5DRVA 3NM2A 3A76A 5AIFA 5KP3A 5IEOA 1CQSA 1OHPA 2Z7AA 3EC9A 4RZMA 1ISKA 4CDLA 2A15A 3BLZA 1OGXA 1TP6A 1W00A 3VSYA 1HKXA 3MG1A 4R9LA 2QIYA 1JN5A 2GBWB 4XDWA 5TGNA 4MJDA 3JUNA 5CF2A 1U5OA 3FF2A 3MSOA 3RGAA 3G8ZA 1SJWA 2B24B 4I4KA 2GXFA 3F7XA 4HVNA 2RFRA 4L8OA 3SEDA 3EX9A 3FGYA 3OWYA 3KE7A 3F8XA 1O7HB 2HMLB 3UJMA 4HJLB 1ULJB 1ULIB 5IG4A 3HZPA 3OV4A 1DMMA 4HM7B 4LEHA 4WYKA 2RCDA 5D81A 3H3HA 1OH0A 3DMCA 4GB5A 4FCJA 2XSOB 1JKGA 1O7NB 3NBRA 3OX9A 4HM6B 4STDA 1BUQA 2GEXA 1JB2A 3OWUA 3Q90A 1UUWB 3B4OA 4KVHA 1W6YA 5AEUB 1E97A 1EG9B 1ZX2A 2HMJB 3CPOA 4PEJA 3D9RA 4HM3B 4WP5A 1EA2A 1OPYA 3GZBA 4IIAA 1UUVB 3CU3A 3GZXB 1OF5A 2RGQA 5D82A 3SOAA 5AI1A 5DREA 4XM4A 5EVHA 3EQQB 3F9SA 3STDA 4R9KA 1VZZA 1A2KA 3JUQA 2BMQB 3S5CA 1GY7A 1C7HA 3B8LA 4K1UA 5IG5A 1W01A 2BNGA 2HMKB 1TUHA 3JUOA 3LZAA 1O7MB 3EBYA 5CK6A 5D83A 1WQLB 4J9AA 3T8NA 5IEPA 3F14A 4XBTA 3WMDA 4HZ9B 1O7GB 5STDA 4L7KA 3GWRA 4N3VA 2W2CA 5G2GA 3NV0A 3JUPA 1OGZA 4U13A 2Z76A 4ORLA 5AIIA 2INXA 3FF0A 2YFLB 3E99A 3IPTA 1O7PB 3NXJA 5CLKA 5KP1A 1JB4A 3MG2A 4HM5B 4R1KA 1GY6A 3GRDA 2PZVA 3EN1B 3KSPA 3FLJA 1E3VA 1W02A 1DMNA 2GBXB 2I9WA 3MYTA 1OUNA 2YFIB 2STDA 3DM8A 3F7SA 2HMOB 3F8HA 3FZWA 1JB5A 1O7WB 5JPUA 4LGQA 5CXOA 5IG0A 1GY5A 1JKGB 1Q40A 4HKVB 1OCVA 3MKIA 1IDPA 3HX8A 3LYGA 4XBXA 1JN5B 3H51A 3EJVA 4HM2B 4XB5A 5AIHA 3KKGA 2QGUA 3B7CA 3CNXA 3G0KA 2CKFB 2UX0A 4X2OA 3JUMA 2JQ5A 5IF6A 1NU3A 1GS3A 1OHOA 3FKAA 4HM0B 2XR8B 4K1VA 3K7CA 4LMIA 4OVMA 3SOYA 5IENA 4X2HA 1AR0A 2OWPA 5CF1A 1QJGA 2IMJA 3I0YA 3B4PA 3ER7A 3GZRA 3MHEA 5BVBA 2BMOB 8CHOA 3EN8A 4WYKB 5IG3A 1ASKA 4FCMA 2R4IA 1NWWA 1STDA 4Q53A 1Q42A 3OXAA 2XSHB 1Q40B 3BB9A 3CNMA 4XBYA 5BXQA 1DMQA 3DXOA 4HM8B 5JPPA 1NDOB 2GEYA 2B1XB 2F98A 5FW5A 1E3RA 3KZTA 3UNLA 1ZO2A 3K0ZA 3EF8A 4HZBB 1OHSA 1Z1SA 2XRXB 3NV0B 2YFJB 1K41A 2K54A 4OUQA 2HMNB 5HGRA 2Z77A 2HMMB 3OWSA 4XDVA 2BMRB 3VGNA 6STDA 1OF5B 3ECFA 3EHCA 3DZLA 2F86B 3G16A 3FSDA 5AEWB 3T8UA 4H3UA 3FH1A 1QMAA 1GYBA 5IERA 3M8CA 3NHXA 4HM1B 3RGRA
chains in the Genus database with same CATH superfamily
4EXRA 1BANA 1B2ZA 1S5AA 4WWUC 2CWVA 2MC8A 1YNVX 1L5GB 3GZYB 1B20A 2CHCA 1VQN3 1B21A 3OW22 1US1A 2JDIH 3I553 1J2BA 2WGOA 5LC7A 1OHPA 3EC9A 4RZMA 1WTHA 2WOFA 3HIIA 1FZUA 1IQXA 2QIYA 3AHWA 3JUNA 1KD14 1A90A 1MGRA 2FXTA 3G8ZA 3N8BA 3CMA3 2CX1A 2KRTA 3GAXA 3X40A 8RNTA 2OQEA 4WHAA 1Q7Y4 5FGOA 1BNJA 3SEDA 4LYLB 4JF8A 1B27A 3UJMA 2QA43 1ULJB 3BNEA 3A5EA 4WYKA 4O3VA 3WA3A 1BUJA 4MMZB 1I0VA 5D81A 1LXEA 4CCVA 3NQZA 3HOHA 1Q9EA 4N6V0 1HZ1A 1CYUA 1JB2A 4BTXA 2OCTA 5AEUB 3CPW2 2BU4A 2FGTA 1EA2A 4EW5A 3SX1A 3V99A 2P0XA 3K5TA 1BNSA 5EVHA 2CIUA 3STDA 2BHMA 1K734 1QVG2 2BMQB 2UGIA 2BNGA 1ROVA 1SPUA 3JUOA 4HBRA 1VQ43 1O7MB 3EBYA 1I8VA 2CG1A 3CCL3 3F14A 1FGTA 4XBTA 1O7GB 2L4VA 2H0GA 3KIIA 4U13A 1DE3A 4EV5A 2OTJ3 2YFLB 3NXJA 1X1WA 2CC3A 4BTWA 3MG2A 4WFOA 3X42A 3X3ZA 1VQ63 1GY6A 2YX9A 2PZVA 3N54B 1DMNA 2GBXB 3MYTA 4J5KA 2STDA 3FZWA 1BSEA 2UUGC 1MNLA 2D1WA 1AY7A 3X3XA 1YIT3 2ZA4A 4HKVB 3D3LA 1NB5I 4XB5A 1BRSA 1IDPA 5JPPA 4HM2B 3CNXA 3G0KA 4R80A 2CFGA 1VQ73 5IF6A 6RNTA 1I2FA 2P09A 3SOYA 5IENA 4NHFA 1JNQA 3CCU3 1KWIA 1BU4A 2OQEC 4GHOA 4EBGA 5CF1A 5IG3A 2BMOB 1RRLA 2CK3H 3DH2A 1D6ZA 1Q40B 4RNYA 1BRKA 2O9UX 4XBYA 3DXOA 5BXQA 5I97A 3G4S3 1VQ83 2B1XB 1I70A 5FW5A 1T2IA 1R4CA 1CEWI 2XH9A 3UNLA 1T2HA 2P38A 3ALAA 3EF8A 4N6UA 1Z1SA 2XRXB 1RKYA 1RGEA 2K54A 1EQKA 1QAKA 2HMNB 2KF5A 1IV7A 3AGOA 3VGNA 2KCDA 4KFDA 3CC43 3EHCA 3DZLA 3V98A 3G16A 1ZGXA 3N9HA 1EKMA 2H0IA 3FH1A 1M904 2AADA 1GYBA 1W2ZA 1BVIA 2OOVA 1LOWA 3RGRA 5IERA 1HYFA 3MG3A 4KFEA 3DGNA 3NBBA 1T5YA 3HK4A 3F40A 2LYXA 3KN4A 4HM4B 3CC73 4N6TA 1UGHI 3MPHA 1B2UA 5DRVA 2F5WA 3NM2A 3A76A 4O02B 5AIFA 5IEOA 5M19A 1GOUA 2Z7AA 1ISKA 1TP6A 2CX0A 2J8XB 2K0MA 1HKXA 1MWTA 4XDWA 5TGNA 2GBWB 4MJDA 3D5GA 1RGKA 2W56B 4KFFA 3FF2A 2CWUA 3RGAA 2V1LA 2GU3A 4I4KA 4HVNA 2RFRA 3ZFZA 4L8OA 4H61A 3SLUA 1PY3A 3FGYA 1BIRA 3OWYA 1B3SA 1O7HB 1I3IA 1M9GA 1ULIB 4HJLB 3HZPA 5IG4A 1DMMA 1FUWA 1IVWA 3H3HA 3GSPA 4STDA 4HM6B 2XSOB 1JKGA 1GMQA 3NBRA 1BUQA 2GEXA 1NB3I 3D5IA 3Q90A 4G1MB 1UUWB 2BT3A 2GSPA 3PCSA 1MWUA 1W6YA 1RGHA 5BIRA 2AAEA 3AMOB 2HMJB 3HI7A 4HAAA 3CCS3 2Y73A 3LMLA 5AYRB 7RNTA 3CCJ3 2IUKA 3K63A 1LQMB 3T0UA 1DVCA 3KSED 4RNTA 2BIRA 1OF5A 2RGQA 5DREA 4XM4A 2Z6BA 5HOHA 4R9KA 1LOYA 1A2KA 3JUQA 4BL3A 1WMOA 4JRFA 3U1WA 1GY7A 3AGNA 3AHSA 4TX4A 3DGOA 1IVUA 3X41A 1AV4A 3S67A 2HMKB 1VQP3 3MWZA 1BNGA 2E2TA 5CK6A 5D83A 3S27A 5IEPA 3UL5A 4HZ9B 1BRNL 1SARA 2XEPA 1BNFA 4L7KA 2ZHXB 3NBJA 2W2CA 5G2GA 1OGZA 1Q824 1B2XA 3EB8A 1BSBA 2Z76A 1PU4A 4ORLA 1RN7A 4N6MA 2INXA 1KQS2 1O7PB 1DYUA 1NO3A 3GRDA 4O8SA 2GU1A 1M1XB 1OUNA 2YFIB 1DETA 2ML6A 3DM8A 2HMOB 3F7SA 2D42A 3F8HA 4LZIA 3CD63 1JB5A 1Q40A 1JKGB 1STFI 1KC84 1OCVA 2CH9A 3HX8A 1JN5B 3BNCA 2RBIA 4N6OB 5AIHA 2QGUA 2PNCA 5M1AA 1UDII 2JQ5A 1Q7HA 1JRQA 1GS3A 1DVDA 1OHOA 2CFKA 2XFTA 2XR8B 1FUTA 4K1VA 1LNIA 3FG1A 4LMIA 4RBNA 3WOFB 1AR0A 5GSPA 2IMJA 3B4PA 3PCRA 3GZRA 5BVBA 3X3YA 1WMNA 8CHOA 3EN8A 1D6YA 1GMRA 1ASKA 4FCMA 3U97A 1PFPA 3Q2PA 3WHOA 1STDA 4Q53A 2HOHA 2XSHB 3BB9A 2W03A 4IT7A 1UI7A 1LNHA 2CFLA 1EUIC 4MMXB 1NJI4 3DGLA 2OOVC 4HZBB 4OUQA 1OHSA 2CW9A 2H0HA 2ML5A 1GSPA 2WGQA 2YFJB 3BNBA 4FCZA 3FCSB 2Z77A 2WO0A 3WA2X 2HMMB 3URPA 1W7CA 1VQQA 3ZG5A 4EC6A 2F86B 1A2VA 5AEWB 1YVSA 5LC6A 3T8UA 3M8CA 1FYSA 3NHXA 4FCJA 4HM1B 3DUKA 1RCKA 1UGIA 3BU4A 1JJ22 2KF4A 4L8PA 1RGAA 3PXMA 5AIGA 4J8TA 1R4YA 2RSXA 1FGQA 3EBTA 2XGNA 2F4YA 1VQK3 1B2MA 1CQSA 1BNIA 3G713 1TIJA 4I5QA 2A15A 1MOLA 4N6LA 1VQL3 3BLZA 1IQYA 2W56A 1N8R4 4R9LA 3KCHA 3SXXA 5JBSA 1YI23 5CF2A 2OTL3 2IA7A 1U5OA 1UCJA 3VF1A 4AEQA 3AMOA 1SJWA 1GOYA 2B24B 1FA3A 4FMDA 3LT8A 2GXFA 3F7XA 5ELJA 2SARA 1FGOA 5AYSC 1IT7A 3LTAA 3EX9A 1LRAA 3F8XA 3SVAA 2HMLB 3WODG 1IVVA 4LEHA 3FG4A 3OV4A 1RCLA 1UI8A 4LSOA 4AKZA 3PS8A 3FG3A 3OX9A 1O7NB 2FNQA 2XFSA 5IW9A 3LTCA 3RDEA 3B4OA 4KVHA 1E97A 1EG9B 1ZX2A 2F56A 4PEJA 4WP5A 3D9RA 4HM3B 1YJW3 4ZM8A 1IYYA 1CH0A 1OPYA 4IIAA 1KSIA 1G02A 1UUVB 3SOAA 1GD3A 5A0OB 1JZOA 5AI1A 1RHLA 4FMCA 3EQQB 2XF3A 1UCKA 1ROAA 1VZZA 3Q3FA 3B8LA 4K90B 1W2B2 5IG5A 3LZAA 1TUHA 1RRHA 1I0XA 1W6CA 5M18A 3JVCA 1UW1A 3WMDA 2C4BA 2Y74A 2R41A 1BGSA 2C11A 3GWRA 2CFDA 2F5MA 3NV0A 3CCQ3 1NNVA 5EEOA 1GOVA 1IK3A 3BIRA 3IPTA 1I2EA 1X1YA 1JB4A 5KP1A 3CCM3 4R1KA 3EN1B 4KT3B 1X1UA 2CG0A 3FLJA 1E3VA 1W02A 2SBLA 1MGWA 1LQGC 1F8NA 1BSCA 1S723 1RNBA 2P05A 4O2HA 1OACA 1V57A 5HGRA 5CXOA 5IG0A 1RLSA 1I2GA 1K28A 4NREA 3EJVA 3ZG0A 3NQYA 3KKGA 1JV2B 2CWTA 3LOYA 1LOVA 2CKFB 3PGBA 1BAOA 4X2OA 3JUMA 6GSPA 3CCE3 1YHQ3 1BNEA 3K7CA 1AVKA 1TTOA 4X2HA 1BRGA 4HOHA 1N9JA 3MHEA 1N5HA 4WYKB 1B2SA 3J7Yd 1A2PA 2R4IA 3KFQC 5EQLA 1Q42A 2KF6A 3CXC2 1U8CB 1DMQA 1YGWA 2E2VA 4GSPA 1NDOB 2GEYA 4HM8B 3G6E3 2W04A 4ILFA 1TU5A 1RDSA 1ZO2A 3QK9A 4FR9A 4R4KA 3NV0B 3Q1CA 3PZWA 1FW7A 1BSAA 1TRPA 1I3FA 3OWSA 3CCV3 6STDA 2O3OA 2RNTA 3CC23 3LXUX 2LQVA 3D4AA 1IQ8A 4KZ1A 4CJNA 1QMAA 3CU3A 4GL6A 3CCR3 2F99A 5KP4A 3EE1A 3ROBA 1JBTA 4FMAA 1W6GA 3NUVA 3WDGB 2ZL8A 5G1KA 7STDA 5KP3A 2IY2A 3D79A 2KXGA 3DGYA 4CDLA 4CPKA 1K8A4 1SQWA 1FUSA 1OGXA 1W00A 2IYJA 3VSYA 1W5ZA 3MG1A 2E2UA 4N6NB 1JN5A 3K9MC 5JPUA 3I563 1YIJ3 3MSOA 1SIHA 1MWSA 5BU4A 2W9QA 9RNTA 2CFWA 3RNTA 1SIIA 3KE7A 1W4NA 2BO9B 4HM7B 3UB1A 2RCDA 2W9PA 1OH0A 3DMCA 4GB5A 1QALA 1RGFA 1T3BA 2W6JH 1RN1A 1CYVA 3OWUA 4BTYA 1LOXA 1N9EA 3DY5A 1RTUA 5G1LA 3CPOA 2KF3A 3IMAB 1JBRA 4K61A 1TRQA 2L1SA 4IPBA 3GZBA 1QAFA 1K9M4 3QRDA 3GZXB 1AVLA 1RGCA 5D82A 4DKIA 1RJOA 4EV2A 3BNDA 3F9SA 2ZDJA 1UCIA 4MEIA 1Q814 1GMPA 3S5CA 1IT8A 1C7HA 4K1UA 1W01A 1LVNA 3NX0A 1A67A 3SYUA 5RNTA 3IJEB 3LTBA 1V58A 1Q864 1WQLB 4J9AA 1VQ53 3WR2A 1D6UA 4J5GA 4QWTA 5STDA 1C54A 4N3VA 3HIGA 1V74A 3JUPA 1IU7A 1RMSA 1VQ93 1YGEA 2K3DA 3O8YA 1HU9A 1MWRA 5AIIA 3FF0A 1YJN3 3E99A 5CLKA 3WOEB 3LTDA 3S28A 1QVF2 1UCLA 4HM5B 4OK0A 1RGGA 1IVXA 1WMPA 1BRIA 3KSPA 1G96A 1BSDA 2I9WA 4HYZA 2W0QA 1WNHA 1O7WB 5ELUA 4LGQA 1X1XA 1FGRA 1GY5A 3PYJA 3T8NA 1Y4KA 3S29A 3MKIA 3LYGA 4XBXA 3H51A 2IUJA 3B7CA 7GSPA 3DGMA 2UX0A 2WOHA 3UL6A 3TDGA 1BNRA 1NU3A 2P0MA 1N8QA 3FKAA 4HM0B 1YVBI 4OVMA 2M7OA 1GD4A 3LH4A 1TJDA 4BU4A 2OWPA 1RN4A 1QJGA 4RNZA 1RNTA 1G0TA 3I0YA 1FGMA 3ER7A 3V92A 1BRJA 1VQO3 1BOXA 1VQM3 2MF7A 3NM7A 1NWWA 1IV9A 1TFOA 1AQZA 3OXAA 4BL2A 1N5PA 3CNMA 4NPBA 1BRHA 2KAAA 4AKYA 2F98A 1E3RA 3KZTA 2C10A 1M1K4 4FMBA 3K0ZA 4MMYB 1ZS7A 1K41A 4EYCA 3CME3 1EEJA 1TFKA 1UUGB 4XDVA 1RGLA 2BMRB 1OF5B 3ECFA 1YJ93 2Q07A 2XGLA 1JBSA 1RSNA 3L0RA 1JZDA 3FSDA 4H3UA 4BIRA 1PYLA 3LT9A 2QEX3
chains in the Genus database with same CATH topology
4EXRA 1S5AA 4WWUC 2CWVA 2MC8A 1L5GB 3GZYB 2CHCA 1VQN3 3OW22 1US1A 2JDIH 3I553 1J2BA 2WGOA 5LC7A 1OHPA 3EC9A 4RZMA 1WTHA 2WOFA 3HIIA 1IQXA 2QIYA 1KD14 3JUNA 1A90A 2FXTA 3G8ZA 3N8BA 3CMA3 2KRTA 3GAXA 3X40A 2OQEA 4WHAA 1Q7Y4 5FGOA 3SEDA 4JF8A 3UJMA 2QA43 1ULJB 3BNEA 4WYKA 4O3VA 3WA3A 4MMZB 5D81A 1LXEA 4CCVA 3NQZA 4N6V0 1CYUA 1JB2A 4BTXA 2OCTA 5AEUB 3CPW2 2FGTA 1EA2A 3SX1A 3V99A 2P0XA 3K5TA 5EVHA 2CIUA 3STDA 2BHMA 1K734 1QVG2 2BMQB 2BNGA 1ROVA 1SPUA 3JUOA 4HBRA 1VQ43 1O7MB 3EBYA 2CG1A 3CCL3 3F14A 1FGTA 4XBTA 1O7GB 2L4VA 3KIIA 4U13A 4EV5A 2OTJ3 2YFLB 3NXJA 2CC3A 4BTWA 3MG2A 4WFOA 3X42A 3X3ZA 1VQ63 1GY6A 2YX9A 2PZVA 3N54B 1DMNA 2GBXB 3MYTA 2STDA 3FZWA 3X3XA 1MNLA 2D1WA 1YIT3 4HKVB 3D3LA 1NB5I 4XB5A 1IDPA 5JPPA 4HM2B 3CNXA 3G0KA 4R80A 2CFGA 1VQ73 5IF6A 2P09A 3SOYA 5IENA 4NHFA 1JNQA 3CCU3 1KWIA 5CF1A 2OQEC 4EBGA 5IG3A 2BMOB 1RRLA 2CK3H 1D6ZA 1Q40B 4RNYA 2O9UX 4XBYA 5BXQA 3DXOA 5I97A 3G4S3 1VQ83 2B1XB 5FW5A 1R4CA 1CEWI 2XH9A 3UNLA 3ALAA 2P38A 4N6UA 3EF8A 1Z1SA 2XRXB 1RKYA 2K54A 1EQKA 1QAKA 2HMNB 1IV7A 3VGNA 2KCDA 4KFDA 3CC43 3EHCA 3DZLA 3V98A 3G16A 3N9HA 1EKMA 3FH1A 1M904 1GYBA 2OOVA 1W2ZA 5IERA 3RGRA 3MG3A 4KFEA 3DGNA 3NBBA 1T5YA 3HK4A 3F40A 2LYXA 3KN4A 4HM4B 3CC73 4N6TA 3MPHA 5DRVA 3NM2A 3A76A 4O02B 5AIFA 5IEOA 2Z7AA 1ISKA 1TP6A 2K0MA 1HKXA 4XDWA 5TGNA 2GBWB 4MJDA 2W56B 4KFFA 3FF2A 2CWUA 3RGAA 2V1LA 2GU3A 4I4KA 4HVNA 2RFRA 4L8OA 4H61A 3SLUA 3FGYA 3OWYA 1O7HB 4HJLB 1M9GA 1ULIB 5IG4A 3HZPA 1DMMA 1FUWA 1IVWA 3H3HA 4STDA 4HM6B 2XSOB 1JKGA 3NBRA 1BUQA 2GEXA 1NB3I 3Q90A 4G1MB 1UUWB 2BT3A 3PCSA 1W6YA 3AMOB 2HMJB 3HI7A 3CCS3 2Y73A 3LMLA 5AYRB 3CCJ3 2IUKA 3K63A 3T0UA 1DVCA 3KSED 1OF5A 2RGQA 5DREA 4XM4A 2Z6BA 4R9KA 3JUQA 1A2KA 1WMOA 4JRFA 3U1WA 1GY7A 4TX4A 3DGOA 1IVUA 3X41A 1AV4A 3S67A 2HMKB 1VQP3 3MWZA 2E2TA 5CK6A 5D83A 3S27A 5IEPA 3UL5A 4HZ9B 2XEPA 4L7KA 3NBJA 2W2CA 5G2GA 1OGZA 1Q824 3EB8A 1PU4A 2Z76A 1KQS2 4ORLA 1RN7A 4N6MA 2INXA 1O7PB 1DYUA 1NO3A 3GRDA 4O8SA 2GU1A 1M1XB 1OUNA 2YFIB 2ML6A 3DM8A 3F7SA 2HMOB 3F8HA 2D42A 4LZIA 3CD63 1JB5A 1Q40A 1JKGB 1STFI 1KC84 1OCVA 2CH9A 3HX8A 1JN5B 3BNCA 5AIHA 4N6OB 2QGUA 2PNCA 2JQ5A 1JRQA 1GS3A 1DVDA 1OHOA 2CFKA 2XFTA 2XR8B 4K1VA 4LMIA 3FG1A 4RBNA 3WOFB 1AR0A 2IMJA 3B4PA 3PCRA 3GZRA 5BVBA 3X3YA 1WMNA 8CHOA 3EN8A 1D6YA 3U97A 1ASKA 4FCMA 1PFPA 3Q2PA 1STDA 4Q53A 3BB9A 2XSHB 4IT7A 2W03A 1UI7A 1LNHA 2CFLA 1NJI4 4MMXB 3DGLA 2OOVC 4HZBB 4OUQA 1OHSA 2CW9A 2ML5A 2WGQA 2YFJB 3BNBA 4FCZA 5HGRA 3FCSB 2Z77A 2WO0A 3WA2X 2HMMB 1W7CA 4EC6A 2F86B 1A2VA 5AEWB 5LC6A 3T8UA 3M8CA 3NHXA 4FCJA 4HM1B 3DUKA 1JJ22 4L8PA 3PXMA 5AIGA 4J8TA 2RSXA 1FGQA 3EBTA 2XGNA 1VQK3 1CQSA 3G713 1TIJA 2A15A 1MOLA 4N6LA 1VQL3 3BLZA 1IQYA 2W56A 1N8R4 4R9LA 3SXXA 5JBSA 1YI23 5CF2A 2OTL3 2IA7A 1U5OA 3VF1A 4AEQA 3AMOA 1SJWA 2B24B 1FA3A 4FMDA 3LT8A 2GXFA 3F7XA 5ELJA 1FGOA 5AYSC 1IT7A 3LTAA 3EX9A 3F8XA 3SVAA 2HMLB 3WODG 1IVVA 4LEHA 3FG4A 3OV4A 1UI8A 4LSOA 4AKZA 3PS8A 3FG3A 3OX9A 1O7NB 2FNQA 2XFSA 5IW9A 3LTCA 3RDEA 3B4OA 4KVHA 1E97A 1EG9B 1ZX2A 4PEJA 4WP5A 1YJW3 3D9RA 4HM3B 4ZM8A 1OPYA 4IIAA 1KSIA 1UUVB 3SOAA 1GD3A 5A0OB 5AI1A 4FMCA 3EQQB 2XF3A 1ROAA 1VZZA 3B8LA 4K90B 1W2B2 5IG5A 3LZAA 1TUHA 1RRHA 1W6CA 3JVCA 1UW1A 3WMDA 2Y74A 2C11A 3GWRA 2CFDA 3NV0A 3CCQ3 5EEOA 1IK3A 3IPTA 5KP1A 1JB4A 3CCM3 4R1KA 3EN1B 2CG0A 3FLJA 1E3VA 1W02A 2SBLA 1F8NA 1S723 2P05A 4O2HA 1OACA 5CXOA 5IG0A 1K28A 4NREA 3EJVA 3NQYA 3KKGA 1JV2B 2CWTA 3LOYA 2CKFB 3PGBA 4X2OA 3JUMA 3CCE3 1YHQ3 3K7CA 1AVKA 4X2HA 1N9JA 3MHEA 1N5HA 4WYKB 3J7Yd 5EQLA 2R4IA 3KFQC 1Q42A 3CXC2 1U8CB 1DMQA 2E2VA 4HM8B 1NDOB 2GEYA 3G6E3 2W04A 1TU5A 1ZO2A 3QK9A 4R4KA 4FR9A 3NV0B 3Q1CA 3PZWA 3OWSA 3CCV3 6STDA 2O3OA 3CC23 3LXUX 2LQVA 4KZ1A 1IQ8A 3CU3A 1QMAA 4GL6A 3CCR3 2F99A 5KP4A 3EE1A 3ROBA 4FMAA 1W6GA 3NUVA 3WDGB 2ZL8A 7STDA 5KP3A 2KXGA 4CDLA 1K8A4 1SQWA 1OGXA 1W00A 3VSYA 1W5ZA 3MG1A 2E2UA 4N6NB 1JN5A 3K9MC 5JPUA 3I563 1YIJ3 3MSOA 1SIHA 2W9QA 2CFWA 1SIIA 3KE7A 1W4NA 2BO9B 4HM7B 3UB1A 2RCDA 2W9PA 1OH0A 3DMCA 4GB5A 1QALA 2W6JH 1CYVA 3OWUA 4BTYA 1LOXA 1N9EA 3DY5A 3CPOA 3IMAB 4K61A 4IPBA 3GZBA 1QAFA 1K9M4 3QRDA 3GZXB 1AVLA 4EV2A 5D82A 1RJOA 3BNDA 3F9SA 2ZDJA 4MEIA 1Q814 3S5CA 1IT8A 1C7HA 4K1UA 1W01A 1LVNA 3NX0A 1A67A 3IJEB 3LTBA 1Q864 1VQ53 1WQLB 4J9AA 1D6UA 4QWTA 5STDA 4N3VA 3HIGA 1V74A 3JUPA 1IU7A 1VQ93 1YGEA 3O8YA 1HU9A 5AIIA 3FF0A 1YJN3 3E99A 5CLKA 3WOEB 3LTDA 3S28A 1QVF2 4HM5B 4OK0A 1IVXA 1WMPA 3KSPA 1G96A 2I9WA 4HYZA 2W0QA 1WNHA 1O7WB 5ELUA 4LGQA 3PYJA 1FGRA 1GY5A 3T8NA 1Y4KA 3S29A 3MKIA 3LYGA 4XBXA 3H51A 2IUJA 3B7CA 3DGMA 2UX0A 2WOHA 3UL6A 3TDGA 1NU3A 2P0MA 1N8QA 3FKAA 4HM0B 1YVBI 4OVMA 2M7OA 1GD4A 3LH4A 2OWPA 1QJGA 4RNZA 3I0YA 3V92A 1FGMA 3ER7A 1VQO3 1VQM3 2MF7A 3NM7A 1NWWA 1IV9A 1TFOA 3OXAA 3CNMA 1N5PA 4AKYA 2F98A 1E3RA 3KZTA 2C10A 1M1K4 4FMBA 3K0ZA 4MMYB 1K41A 4EYCA 3CME3 1TFKA 4XDVA 2BMRB 1OF5B 3ECFA 1YJ93 2Q07A 2XGLA 3L0RA 3FSDA 4H3UA 3LT9A 2QEX3
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DUK A;  2F99 A;  1S5A A;  5KP4 A;  4L8P A;  3MG3 A;  4WWU C;  5AIG A;  4J8T A;  3ROB A;  3HK4 A;  3F40 A;  4HM4 B;  3GZY B;  3NUV A;  2CHC A;  7STD A;  3EBT A;  5DRV A;  3NM2 A;  3A76 A;  5AIF A;  5KP3 A;  5IEO A;  1CQS A;  1OHP A;  2Z7A A;  3EC9 A;  4RZM A;  1ISK A;  4CDL A;  2A15 A;  3BLZ A;  1OGX A;  1TP6 A;  1W00 A;  3VSY A;  1HKX A;  3MG1 A;  4R9L A;  2QIY A;  1JN5 A;  2GBW B;  4XDW A;  5TGN A;  4MJD A;  3JUN A;  5CF2 A;  1U5O A;  3FF2 A;  3MSO A;  3RGA A;  3G8Z A;  1SJW A;  2B24 B;  4I4K A;  2GXF A;  3F7X A;  4HVN A;  2RFR A;  4L8O A;  3SED A;  3EX9 A;  3FGY A;  3OWY A;  3KE7 A;  3F8X A;  1O7H B;  2HML B;  3UJM A;  4HJL B;  1ULJ B;  1ULI B;  5IG4 A;  3HZP A;  3OV4 A;  1DMM A;  4HM7 B;  4LEH A;  4WYK A;  2RCD A;  5D81 A;  3H3H A;  1OH0 A;  3DMC A;  4GB5 A;  4FCJ A;  2XSO B;  1JKG A;  1O7N B;  3NBR A;  3OX9 A;  4HM6 B;  4STD A;  1BUQ A;  2GEX A;  1JB2 A;  3OWU A;  3Q90 A;  1UUW B;  3B4O A;  4KVH A;  1W6Y A;  5AEU B;  1E97 A;  1EG9 B;  1ZX2 A;  2HMJ B;  3CPO A;  4PEJ A;  3D9R A;  4HM3 B;  4WP5 A;  1EA2 A;  1OPY A;  3GZB A;  4IIA A;  1UUV B;  3CU3 A;  3GZX B;  1OF5 A;  2RGQ A;  5D82 A;  3SOA A;  5AI1 A;  5DRE A;  4XM4 A;  5EVH A;  3EQQ B;  3F9S A;  3STD A;  4R9K A;  1VZZ A;  1A2K A;  3JUQ A;  2BMQ B;  3S5C A;  1GY7 A;  1C7H A;  3B8L A;  4K1U A;  5IG5 A;  1W01 A;  2BNG A;  2HMK B;  1TUH A;  3JUO A;  3LZA A;  1O7M B;  3EBY A;  5CK6 A;  5D83 A;  1WQL B;  4J9A A;  3T8N A;  5IEP A;  3F14 A;  4XBT A;  3WMD A;  4HZ9 B;  1O7G B;  5STD A;  4L7K A;  3GWR A;  4N3V A;  2W2C A;  5G2G A;  3NV0 A;  3JUP A;  1OGZ A;  4U13 A;  2Z76 A;  4ORL A;  5AII A;  2INX A;  3FF0 A;  2YFL B;  3E99 A;  3IPT A;  1O7P B;  3NXJ A;  5CLK A;  5KP1 A;  1JB4 A;  3MG2 A;  4HM5 B;  4R1K A;  1GY6 A;  3GRD A;  2PZV A;  3EN1 B;  3KSP A;  3FLJ A;  1E3V A;  1W02 A;  1DMN A;  2GBX B;  2I9W A;  3MYT A;  1OUN A;  2YFI B;  2STD A;  3DM8 A;  3F7S A;  2HMO B;  3F8H A;  3FZW A;  1JB5 A;  1O7W B;  5JPU A;  4LGQ A;  5CXO A;  5IG0 A;  1GY5 A;  1JKG B;  1Q40 A;  4HKV B;  1OCV A;  3MKI A;  1IDP A;  3HX8 A;  3LYG A;  4XBX A;  1JN5 B;  3H51 A;  3EJV A;  4HM2 B;  4XB5 A;  5AIH A;  3KKG A;  2QGU A;  3B7C A;  3CNX A;  3G0K A;  2CKF B;  2UX0 A;  4X2O A;  3JUM A;  2JQ5 A;  5IF6 A;  1NU3 A;  1GS3 A;  1OHO A;  3FKA A;  4HM0 B;  2XR8 B;  4K1V A;  3K7C A;  4LMI A;  4OVM A;  3SOY A;  5IEN A;  4X2H A;  1AR0 A;  2OWP A;  5CF1 A;  1QJG A;  2IMJ A;  3I0Y A;  3B4P A;  3ER7 A;  3GZR A;  3MHE A;  5BVB A;  2BMO B;  8CHO A;  3EN8 A;  4WYK B;  5IG3 A;  1ASK A;  4FCM A;  2R4I A;  1NWW A;  1STD A;  4Q53 A;  1Q42 A;  3OXA A;  2XSH B;  1Q40 B;  3BB9 A;  3CNM A;  4XBY A;  5BXQ A;  1DMQ A;  3DXO A;  4HM8 B;  5JPP A;  1NDO B;  2GEY A;  2B1X B;  2F98 A;  5FW5 A;  1E3R A;  3KZT A;  3UNL A;  1ZO2 A;  3K0Z A;  3EF8 A;  4HZB B;  1OHS A;  1Z1S A;  2XRX B;  3NV0 B;  2YFJ B;  1K41 A;  2K54 A;  4OUQ A;  2HMN B;  5HGR A;  2Z77 A;  2HMM B;  3OWS A;  4XDV A;  2BMR B;  3VGN A;  6STD A;  1OF5 B;  3ECF A;  3EHC A;  3DZL A;  2F86 B;  3G16 A;  3FSD A;  5AEW B;  3T8U A;  4H3U A;  3FH1 A;  1QMA A;  1GYB A;  5IER A;  3M8C A;  3NHX A;  4HM1 B;  3RGR A; 
#chains in the Genus database with same CATH topology
 4EXR A;  1BAN A;  1B2Z A;  1S5A A;  4WWU C;  2CWV A;  2MC8 A;  1YNV X;  1L5G B;  3GZY B;  1B20 A;  2CHC A;  1VQN 3;  1B21 A;  3OW2 2;  1US1 A;  2JDI H;  3I55 3;  1J2B A;  2WGO A;  5LC7 A;  1OHP A;  3EC9 A;  4RZM A;  1WTH A;  2WOF A;  3HII A;  1FZU A;  1IQX A;  2QIY A;  3AHW A;  3JUN A;  1KD1 4;  1A90 A;  1MGR A;  2FXT A;  3G8Z A;  3N8B A;  3CMA 3;  2CX1 A;  2KRT A;  3GAX A;  3X40 A;  8RNT A;  2OQE A;  4WHA A;  1Q7Y 4;  5FGO A;  1BNJ A;  3SED A;  4LYL B;  4JF8 A;  1B27 A;  3UJM A;  2QA4 3;  1ULJ B;  3BNE A;  3A5E A;  4WYK A;  4O3V A;  3WA3 A;  1BUJ A;  4MMZ B;  1I0V A;  5D81 A;  1LXE A;  4CCV A;  3NQZ A;  3HOH A;  1Q9E A;  4N6V 0;  1HZ1 A;  1CYU A;  1JB2 A;  4BTX A;  2OCT A;  5AEU B;  3CPW 2;  2BU4 A;  2FGT A;  1EA2 A;  4EW5 A;  3SX1 A;  3V99 A;  2P0X A;  3K5T A;  1BNS A;  5EVH A;  2CIU A;  3STD A;  2BHM A;  1K73 4;  1QVG 2;  2BMQ B;  2UGI A;  2BNG A;  1ROV A;  1SPU A;  3JUO A;  4HBR A;  1VQ4 3;  1O7M B;  3EBY A;  1I8V A;  2CG1 A;  3CCL 3;  3F14 A;  1FGT A;  4XBT A;  1O7G B;  2L4V A;  2H0G A;  3KII A;  4U13 A;  1DE3 A;  4EV5 A;  2OTJ 3;  2YFL B;  3NXJ A;  1X1W A;  2CC3 A;  4BTW A;  3MG2 A;  4WFO A;  3X42 A;  3X3Z A;  1VQ6 3;  1GY6 A;  2YX9 A;  2PZV A;  3N54 B;  1DMN A;  2GBX B;  3MYT A;  4J5K A;  2STD A;  3FZW A;  1BSE A;  2UUG C;  1MNL A;  2D1W A;  1AY7 A;  3X3X A;  1YIT 3;  2ZA4 A;  4HKV B;  3D3L A;  1NB5 I;  4XB5 A;  1BRS A;  1IDP A;  5JPP A;  4HM2 B;  3CNX A;  3G0K A;  4R80 A;  2CFG A;  1VQ7 3;  5IF6 A;  6RNT A;  1I2F A;  2P09 A;  3SOY A;  5IEN A;  4NHF A;  1JNQ A;  3CCU 3;  1KWI A;  1BU4 A;  2OQE C;  4GHO A;  4EBG A;  5CF1 A;  5IG3 A;  2BMO B;  1RRL A;  2CK3 H;  3DH2 A;  1D6Z A;  1Q40 B;  4RNY A;  1BRK A;  2O9U X;  4XBY A;  3DXO A;  5BXQ A;  5I97 A;  3G4S 3;  1VQ8 3;  2B1X B;  1I70 A;  5FW5 A;  1T2I A;  1R4C A;  1CEW I;  2XH9 A;  3UNL A;  1T2H A;  2P38 A;  3ALA A;  3EF8 A;  4N6U A;  1Z1S A;  2XRX B;  1RKY A;  1RGE A;  2K54 A;  1EQK A;  1QAK A;  2HMN B;  2KF5 A;  1IV7 A;  3AGO A;  3VGN A;  2KCD A;  4KFD A;  3CC4 3;  3EHC A;  3DZL A;  3V98 A;  3G16 A;  1ZGX A;  3N9H A;  1EKM A;  2H0I A;  3FH1 A;  1M90 4;  2AAD A;  1GYB A;  1W2Z A;  1BVI A;  2OOV A;  1LOW A;  3RGR A;  5IER A;  1HYF A;  3MG3 A;  4KFE A;  3DGN A;  3NBB A;  1T5Y A;  3HK4 A;  3F40 A;  2LYX A;  3KN4 A;  4HM4 B;  3CC7 3;  4N6T A;  1UGH I;  3MPH A;  1B2U A;  5DRV A;  2F5W A;  3NM2 A;  3A76 A;  4O02 B;  5AIF A;  5IEO A;  5M19 A;  1GOU A;  2Z7A A;  1ISK A;  1TP6 A;  2CX0 A;  2J8X B;  2K0M A;  1HKX A;  1MWT A;  4XDW A;  5TGN A;  2GBW B;  4MJD A;  3D5G A;  1RGK A;  2W56 B;  4KFF A;  3FF2 A;  2CWU A;  3RGA A;  2V1L A;  2GU3 A;  4I4K A;  4HVN A;  2RFR A;  3ZFZ A;  4L8O A;  4H61 A;  3SLU A;  1PY3 A;  3FGY A;  1BIR A;  3OWY A;  1B3S A;  1O7H B;  1I3I A;  1M9G A;  1ULI B;  4HJL B;  3HZP A;  5IG4 A;  1DMM A;  1FUW A;  1IVW A;  3H3H A;  3GSP A;  4STD A;  4HM6 B;  2XSO B;  1JKG A;  1GMQ A;  3NBR A;  1BUQ A;  2GEX A;  1NB3 I;  3D5I A;  3Q90 A;  4G1M B;  1UUW B;  2BT3 A;  2GSP A;  3PCS A;  1MWU A;  1W6Y A;  1RGH A;  5BIR A;  2AAE A;  3AMO B;  2HMJ B;  3HI7 A;  4HAA A;  3CCS 3;  2Y73 A;  3LML A;  5AYR B;  7RNT A;  3CCJ 3;  2IUK A;  3K63 A;  1LQM B;  3T0U A;  1DVC A;  3KSE D;  4RNT A;  2BIR A;  1OF5 A;  2RGQ A;  5DRE A;  4XM4 A;  2Z6B A;  5HOH A;  4R9K A;  1LOY A;  1A2K A;  3JUQ A;  4BL3 A;  1WMO A;  4JRF A;  3U1W A;  1GY7 A;  3AGN A;  3AHS A;  4TX4 A;  3DGO A;  1IVU A;  3X41 A;  1AV4 A;  3S67 A;  2HMK B;  1VQP 3;  3MWZ A;  1BNG A;  2E2T A;  5CK6 A;  5D83 A;  3S27 A;  5IEP A;  3UL5 A;  4HZ9 B;  1BRN L;  1SAR A;  2XEP A;  1BNF A;  4L7K A;  2ZHX B;  3NBJ A;  2W2C A;  5G2G A;  1OGZ A;  1Q82 4;  1B2X A;  3EB8 A;  1BSB A;  2Z76 A;  1PU4 A;  4ORL A;  1RN7 A;  4N6M A;  2INX A;  1KQS 2;  1O7P B;  1DYU A;  1NO3 A;  3GRD A;  4O8S A;  2GU1 A;  1M1X B;  1OUN A;  2YFI B;  1DET A;  2ML6 A;  3DM8 A;  2HMO B;  3F7S A;  2D42 A;  3F8H A;  4LZI A;  3CD6 3;  1JB5 A;  1Q40 A;  1JKG B;  1STF I;  1KC8 4;  1OCV A;  2CH9 A;  3HX8 A;  1JN5 B;  3BNC A;  2RBI A;  4N6O B;  5AIH A;  2QGU A;  2PNC A;  5M1A A;  1UDI I;  2JQ5 A;  1Q7H A;  1JRQ A;  1GS3 A;  1DVD A;  1OHO A;  2CFK A;  2XFT A;  2XR8 B;  1FUT A;  4K1V A;  1LNI A;  3FG1 A;  4LMI A;  4RBN A;  3WOF B;  1AR0 A;  5GSP A;  2IMJ A;  3B4P A;  3PCR A;  3GZR A;  5BVB A;  3X3Y A;  1WMN A;  8CHO A;  3EN8 A;  1D6Y A;  1GMR A;  1ASK A;  4FCM A;  3U97 A;  1PFP A;  3Q2P A;  3WHO A;  1STD A;  4Q53 A;  2HOH A;  2XSH B;  3BB9 A;  2W03 A;  4IT7 A;  1UI7 A;  1LNH A;  2CFL A;  1EUI C;  4MMX B;  1NJI 4;  3DGL A;  2OOV C;  4HZB B;  4OUQ A;  1OHS A;  2CW9 A;  2H0H A;  2ML5 A;  1GSP A;  2WGQ A;  2YFJ B;  3BNB A;  4FCZ A;  3FCS B;  2Z77 A;  2WO0 A;  3WA2 X;  2HMM B;  3URP A;  1W7C A;  1VQQ A;  3ZG5 A;  4EC6 A;  2F86 B;  1A2V A;  5AEW B;  1YVS A;  5LC6 A;  3T8U A;  3M8C A;  1FYS A;  3NHX A;  4FCJ A;  4HM1 B;  3DUK A;  1RCK A;  1UGI A;  3BU4 A;  1JJ2 2;  2KF4 A;  4L8P A;  1RGA A;  3PXM A;  5AIG A;  4J8T A;  1R4Y A;  2RSX A;  1FGQ A;  3EBT A;  2XGN A;  2F4Y A;  1VQK 3;  1B2M A;  1CQS A;  1BNI A;  3G71 3;  1TIJ A;  4I5Q A;  2A15 A;  1MOL A;  4N6L A;  1VQL 3;  3BLZ A;  1IQY A;  2W56 A;  1N8R 4;  4R9L A;  3KCH A;  3SXX A;  5JBS A;  1YI2 3;  5CF2 A;  2OTL 3;  2IA7 A;  1U5O A;  1UCJ A;  3VF1 A;  4AEQ A;  3AMO A;  1SJW A;  1GOY A;  2B24 B;  1FA3 A;  4FMD A;  3LT8 A;  2GXF A;  3F7X A;  5ELJ A;  2SAR A;  1FGO A;  5AYS C;  1IT7 A;  3LTA A;  3EX9 A;  1LRA A;  3F8X A;  3SVA A;  2HML B;  3WOD G;  1IVV A;  4LEH A;  3FG4 A;  3OV4 A;  1RCL A;  1UI8 A;  4LSO A;  4AKZ A;  3PS8 A;  3FG3 A;  3OX9 A;  1O7N B;  2FNQ A;  2XFS A;  5IW9 A;  3LTC A;  3RDE A;  3B4O A;  4KVH A;  1E97 A;  1EG9 B;  1ZX2 A;  2F56 A;  4PEJ A;  4WP5 A;  3D9R A;  4HM3 B;  1YJW 3;  4ZM8 A;  1IYY A;  1CH0 A;  1OPY A;  4IIA A;  1KSI A;  1G02 A;  1UUV B;  3SOA A;  1GD3 A;  5A0O B;  1JZO A;  5AI1 A;  1RHL A;  4FMC A;  3EQQ B;  2XF3 A;  1UCK A;  1ROA A;  1VZZ A;  3Q3F A;  3B8L A;  4K90 B;  1W2B 2;  5IG5 A;  3LZA A;  1TUH A;  1RRH A;  1I0X A;  1W6C A;  5M18 A;  3JVC A;  1UW1 A;  3WMD A;  2C4B A;  2Y74 A;  2R41 A;  1BGS A;  2C11 A;  3GWR A;  2CFD A;  2F5M A;  3NV0 A;  3CCQ 3;  1NNV A;  5EEO A;  1GOV A;  1IK3 A;  3BIR A;  3IPT A;  1I2E A;  1X1Y A;  1JB4 A;  5KP1 A;  3CCM 3;  4R1K A;  3EN1 B;  4KT3 B;  1X1U A;  2CG0 A;  3FLJ A;  1E3V A;  1W02 A;  2SBL A;  1MGW A;  1LQG C;  1F8N A;  1BSC A;  1S72 3;  1RNB A;  2P05 A;  4O2H A;  1OAC A;  1V57 A;  5HGR A;  5CXO A;  5IG0 A;  1RLS A;  1I2G A;  1K28 A;  4NRE A;  3EJV A;  3ZG0 A;  3NQY A;  3KKG A;  1JV2 B;  2CWT A;  3LOY A;  1LOV A;  2CKF B;  3PGB A;  1BAO A;  4X2O A;  3JUM A;  6GSP A;  3CCE 3;  1YHQ 3;  1BNE A;  3K7C A;  1AVK A;  1TTO A;  4X2H A;  1BRG A;  4HOH A;  1N9J A;  3MHE A;  1N5H A;  4WYK B;  1B2S A;  3J7Y d;  1A2P A;  2R4I A;  3KFQ C;  5EQL A;  1Q42 A;  2KF6 A;  3CXC 2;  1U8C B;  1DMQ A;  1YGW A;  2E2V A;  4GSP A;  1NDO B;  2GEY A;  4HM8 B;  3G6E 3;  2W04 A;  4ILF A;  1TU5 A;  1RDS A;  1ZO2 A;  3QK9 A;  4FR9 A;  4R4K A;  3NV0 B;  3Q1C A;  3PZW A;  1FW7 A;  1BSA A;  1TRP A;  1I3F A;  3OWS A;  3CCV 3;  6STD A;  2O3O A;  2RNT A;  3CC2 3;  3LXU X;  2LQV A;  3D4A A;  1IQ8 A;  4KZ1 A;  4CJN A;  1QMA A;  3CU3 A;  4GL6 A;  3CCR 3;  2F99 A;  5KP4 A;  3EE1 A;  3ROB A;  1JBT A;  4FMA A;  1W6G A;  3NUV A;  3WDG B;  2ZL8 A;  5G1K A;  7STD A;  5KP3 A;  2IY2 A;  3D79 A;  2KXG A;  3DGY A;  4CDL A;  4CPK A;  1K8A 4;  1SQW A;  1FUS A;  1OGX A;  1W00 A;  2IYJ A;  3VSY A;  1W5Z A;  3MG1 A;  2E2U A;  4N6N B;  1JN5 A;  3K9M C;  5JPU A;  3I56 3;  1YIJ 3;  3MSO A;  1SIH A;  1MWS A;  5BU4 A;  2W9Q A;  9RNT A;  2CFW A;  3RNT A;  1SII A;  3KE7 A;  1W4N A;  2BO9 B;  4HM7 B;  3UB1 A;  2RCD A;  2W9P A;  1OH0 A;  3DMC A;  4GB5 A;  1QAL A;  1RGF A;  1T3B A;  2W6J H;  1RN1 A;  1CYV A;  3OWU A;  4BTY A;  1LOX A;  1N9E A;  3DY5 A;  1RTU A;  5G1L A;  3CPO A;  2KF3 A;  3IMA B;  1JBR A;  4K61 A;  1TRQ A;  2L1S A;  4IPB A;  3GZB A;  1QAF A;  1K9M 4;  3QRD A;  3GZX B;  1AVL A;  1RGC A;  5D82 A;  4DKI A;  1RJO A;  4EV2 A;  3BND A;  3F9S A;  2ZDJ A;  1UCI A;  4MEI A;  1Q81 4;  1GMP A;  3S5C A;  1IT8 A;  1C7H A;  4K1U A;  1W01 A;  1LVN A;  3NX0 A;  1A67 A;  3SYU A;  5RNT A;  3IJE B;  3LTB A;  1V58 A;  1Q86 4;  1WQL B;  4J9A A;  1VQ5 3;  3WR2 A;  1D6U A;  4J5G A;  4QWT A;  5STD A;  1C54 A;  4N3V A;  3HIG A;  1V74 A;  3JUP A;  1IU7 A;  1RMS A;  1VQ9 3;  1YGE A;  2K3D A;  3O8Y A;  1HU9 A;  1MWR A;  5AII A;  3FF0 A;  1YJN 3;  3E99 A;  5CLK A;  3WOE B;  3LTD A;  3S28 A;  1QVF 2;  1UCL A;  4HM5 B;  4OK0 A;  1RGG A;  1IVX A;  1WMP A;  1BRI A;  3KSP A;  1G96 A;  1BSD A;  2I9W A;  4HYZ A;  2W0Q A;  1WNH A;  1O7W B;  5ELU A;  4LGQ A;  1X1X A;  1FGR A;  1GY5 A;  3PYJ A;  3T8N A;  1Y4K A;  3S29 A;  3MKI A;  3LYG A;  4XBX A;  3H51 A;  2IUJ A;  3B7C A;  7GSP A;  3DGM A;  2UX0 A;  2WOH A;  3UL6 A;  3TDG A;  1BNR A;  1NU3 A;  2P0M A;  1N8Q A;  3FKA A;  4HM0 B;  1YVB I;  4OVM A;  2M7O A;  1GD4 A;  3LH4 A;  1TJD A;  4BU4 A;  2OWP A;  1RN4 A;  1QJG A;  4RNZ A;  1RNT A;  1G0T A;  3I0Y A;  1FGM A;  3ER7 A;  3V92 A;  1BRJ A;  1VQO 3;  1BOX A;  1VQM 3;  2MF7 A;  3NM7 A;  1NWW A;  1IV9 A;  1TFO A;  1AQZ A;  3OXA A;  4BL2 A;  1N5P A;  3CNM A;  4NPB A;  1BRH A;  2KAA A;  4AKY A;  2F98 A;  1E3R A;  3KZT A;  2C10 A;  1M1K 4;  4FMB A;  3K0Z A;  4MMY B;  1ZS7 A;  1K41 A;  4EYC A;  3CME 3;  1EEJ A;  1TFK A;  1UUG B;  4XDV A;  1RGL A;  2BMR B;  1OF5 B;  3ECF A;  1YJ9 3;  2Q07 A;  2XGL A;  1JBS A;  1RSN A;  3L0R A;  1JZD A;  3FSD A;  4H3U A;  4BIR A;  1PYL A;  3LT9 A;  2QEX 3; 
#chains in the Genus database with same CATH homology
 4EXR A;  1S5A A;  4WWU C;  2CWV A;  2MC8 A;  1L5G B;  3GZY B;  2CHC A;  1VQN 3;  3OW2 2;  1US1 A;  2JDI H;  3I55 3;  1J2B A;  2WGO A;  5LC7 A;  1OHP A;  3EC9 A;  4RZM A;  1WTH A;  2WOF A;  3HII A;  1IQX A;  2QIY A;  1KD1 4;  3JUN A;  1A90 A;  2FXT A;  3G8Z A;  3N8B A;  3CMA 3;  2KRT A;  3GAX A;  3X40 A;  2OQE A;  4WHA A;  1Q7Y 4;  5FGO A;  3SED A;  4JF8 A;  3UJM A;  2QA4 3;  1ULJ B;  3BNE A;  4WYK A;  4O3V A;  3WA3 A;  4MMZ B;  5D81 A;  1LXE A;  4CCV A;  3NQZ A;  4N6V 0;  1CYU A;  1JB2 A;  4BTX A;  2OCT A;  5AEU B;  3CPW 2;  2FGT A;  1EA2 A;  3SX1 A;  3V99 A;  2P0X A;  3K5T A;  5EVH A;  2CIU A;  3STD A;  2BHM A;  1K73 4;  1QVG 2;  2BMQ B;  2BNG A;  1ROV A;  1SPU A;  3JUO A;  4HBR A;  1VQ4 3;  1O7M B;  3EBY A;  2CG1 A;  3CCL 3;  3F14 A;  1FGT A;  4XBT A;  1O7G B;  2L4V A;  3KII A;  4U13 A;  4EV5 A;  2OTJ 3;  2YFL B;  3NXJ A;  2CC3 A;  4BTW A;  3MG2 A;  4WFO A;  3X42 A;  3X3Z A;  1VQ6 3;  1GY6 A;  2YX9 A;  2PZV A;  3N54 B;  1DMN A;  2GBX B;  3MYT A;  2STD A;  3FZW A;  3X3X A;  1MNL A;  2D1W A;  1YIT 3;  4HKV B;  3D3L A;  1NB5 I;  4XB5 A;  1IDP A;  5JPP A;  4HM2 B;  3CNX A;  3G0K A;  4R80 A;  2CFG A;  1VQ7 3;  5IF6 A;  2P09 A;  3SOY A;  5IEN A;  4NHF A;  1JNQ A;  3CCU 3;  1KWI A;  5CF1 A;  2OQE C;  4EBG A;  5IG3 A;  2BMO B;  1RRL A;  2CK3 H;  1D6Z A;  1Q40 B;  4RNY A;  2O9U X;  4XBY A;  5BXQ A;  3DXO A;  5I97 A;  3G4S 3;  1VQ8 3;  2B1X B;  5FW5 A;  1R4C A;  1CEW I;  2XH9 A;  3UNL A;  3ALA A;  2P38 A;  4N6U A;  3EF8 A;  1Z1S A;  2XRX B;  1RKY A;  2K54 A;  1EQK A;  1QAK A;  2HMN B;  1IV7 A;  3VGN A;  2KCD A;  4KFD A;  3CC4 3;  3EHC A;  3DZL A;  3V98 A;  3G16 A;  3N9H A;  1EKM A;  3FH1 A;  1M90 4;  1GYB A;  2OOV A;  1W2Z A;  5IER A;  3RGR A;  3MG3 A;  4KFE A;  3DGN A;  3NBB A;  1T5Y A;  3HK4 A;  3F40 A;  2LYX A;  3KN4 A;  4HM4 B;  3CC7 3;  4N6T A;  3MPH A;  5DRV A;  3NM2 A;  3A76 A;  4O02 B;  5AIF A;  5IEO A;  2Z7A A;  1ISK A;  1TP6 A;  2K0M A;  1HKX A;  4XDW A;  5TGN A;  2GBW B;  4MJD A;  2W56 B;  4KFF A;  3FF2 A;  2CWU A;  3RGA A;  2V1L A;  2GU3 A;  4I4K A;  4HVN A;  2RFR A;  4L8O A;  4H61 A;  3SLU A;  3FGY A;  3OWY A;  1O7H B;  4HJL B;  1M9G A;  1ULI B;  5IG4 A;  3HZP A;  1DMM A;  1FUW A;  1IVW A;  3H3H A;  4STD A;  4HM6 B;  2XSO B;  1JKG A;  3NBR A;  1BUQ A;  2GEX A;  1NB3 I;  3Q90 A;  4G1M B;  1UUW B;  2BT3 A;  3PCS A;  1W6Y A;  3AMO B;  2HMJ B;  3HI7 A;  3CCS 3;  2Y73 A;  3LML A;  5AYR B;  3CCJ 3;  2IUK A;  3K63 A;  3T0U A;  1DVC A;  3KSE D;  1OF5 A;  2RGQ A;  5DRE A;  4XM4 A;  2Z6B A;  4R9K A;  3JUQ A;  1A2K A;  1WMO A;  4JRF A;  3U1W A;  1GY7 A;  4TX4 A;  3DGO A;  1IVU A;  3X41 A;  1AV4 A;  3S67 A;  2HMK B;  1VQP 3;  3MWZ A;  2E2T A;  5CK6 A;  5D83 A;  3S27 A;  5IEP A;  3UL5 A;  4HZ9 B;  2XEP A;  4L7K A;  3NBJ A;  2W2C A;  5G2G A;  1OGZ A;  1Q82 4;  3EB8 A;  1PU4 A;  2Z76 A;  1KQS 2;  4ORL A;  1RN7 A;  4N6M A;  2INX A;  1O7P B;  1DYU A;  1NO3 A;  3GRD A;  4O8S A;  2GU1 A;  1M1X B;  1OUN A;  2YFI B;  2ML6 A;  3DM8 A;  3F7S A;  2HMO B;  3F8H A;  2D42 A;  4LZI A;  3CD6 3;  1JB5 A;  1Q40 A;  1JKG B;  1STF I;  1KC8 4;  1OCV A;  2CH9 A;  3HX8 A;  1JN5 B;  3BNC A;  5AIH A;  4N6O B;  2QGU A;  2PNC A;  2JQ5 A;  1JRQ A;  1GS3 A;  1DVD A;  1OHO A;  2CFK A;  2XFT A;  2XR8 B;  4K1V A;  4LMI A;  3FG1 A;  4RBN A;  3WOF B;  1AR0 A;  2IMJ A;  3B4P A;  3PCR A;  3GZR A;  5BVB A;  3X3Y A;  1WMN A;  8CHO A;  3EN8 A;  1D6Y A;  3U97 A;  1ASK A;  4FCM A;  1PFP A;  3Q2P A;  1STD A;  4Q53 A;  3BB9 A;  2XSH B;  4IT7 A;  2W03 A;  1UI7 A;  1LNH A;  2CFL A;  1NJI 4;  4MMX B;  3DGL A;  2OOV C;  4HZB B;  4OUQ A;  1OHS A;  2CW9 A;  2ML5 A;  2WGQ A;  2YFJ B;  3BNB A;  4FCZ A;  5HGR A;  3FCS B;  2Z77 A;  2WO0 A;  3WA2 X;  2HMM B;  1W7C A;  4EC6 A;  2F86 B;  1A2V A;  5AEW B;  5LC6 A;  3T8U A;  3M8C A;  3NHX A;  4FCJ A;  4HM1 B;  3DUK A;  1JJ2 2;  4L8P A;  3PXM A;  5AIG A;  4J8T A;  2RSX A;  1FGQ A;  3EBT A;  2XGN A;  1VQK 3;  1CQS A;  3G71 3;  1TIJ A;  2A15 A;  1MOL A;  4N6L A;  1VQL 3;  3BLZ A;  1IQY A;  2W56 A;  1N8R 4;  4R9L A;  3SXX A;  5JBS A;  1YI2 3;  5CF2 A;  2OTL 3;  2IA7 A;  1U5O A;  3VF1 A;  4AEQ A;  3AMO A;  1SJW A;  2B24 B;  1FA3 A;  4FMD A;  3LT8 A;  2GXF A;  3F7X A;  5ELJ A;  1FGO A;  5AYS C;  1IT7 A;  3LTA A;  3EX9 A;  3F8X A;  3SVA A;  2HML B;  3WOD G;  1IVV A;  4LEH A;  3FG4 A;  3OV4 A;  1UI8 A;  4LSO A;  4AKZ A;  3PS8 A;  3FG3 A;  3OX9 A;  1O7N B;  2FNQ A;  2XFS A;  5IW9 A;  3LTC A;  3RDE A;  3B4O A;  4KVH A;  1E97 A;  1EG9 B;  1ZX2 A;  4PEJ A;  4WP5 A;  1YJW 3;  3D9R A;  4HM3 B;  4ZM8 A;  1OPY A;  4IIA A;  1KSI A;  1UUV B;  3SOA A;  1GD3 A;  5A0O B;  5AI1 A;  4FMC A;  3EQQ B;  2XF3 A;  1ROA A;  1VZZ A;  3B8L A;  4K90 B;  1W2B 2;  5IG5 A;  3LZA A;  1TUH A;  1RRH A;  1W6C A;  3JVC A;  1UW1 A;  3WMD A;  2Y74 A;  2C11 A;  3GWR A;  2CFD A;  3NV0 A;  3CCQ 3;  5EEO A;  1IK3 A;  3IPT A;  5KP1 A;  1JB4 A;  3CCM 3;  4R1K A;  3EN1 B;  2CG0 A;  3FLJ A;  1E3V A;  1W02 A;  2SBL A;  1F8N A;  1S72 3;  2P05 A;  4O2H A;  1OAC A;  5CXO A;  5IG0 A;  1K28 A;  4NRE A;  3EJV A;  3NQY A;  3KKG A;  1JV2 B;  2CWT A;  3LOY A;  2CKF B;  3PGB A;  4X2O A;  3JUM A;  3CCE 3;  1YHQ 3;  3K7C A;  1AVK A;  4X2H A;  1N9J A;  3MHE A;  1N5H A;  4WYK B;  3J7Y d;  5EQL A;  2R4I A;  3KFQ C;  1Q42 A;  3CXC 2;  1U8C B;  1DMQ A;  2E2V A;  4HM8 B;  1NDO B;  2GEY A;  3G6E 3;  2W04 A;  1TU5 A;  1ZO2 A;  3QK9 A;  4R4K A;  4FR9 A;  3NV0 B;  3Q1C A;  3PZW A;  3OWS A;  3CCV 3;  6STD A;  2O3O A;  3CC2 3;  3LXU X;  2LQV A;  4KZ1 A;  1IQ8 A;  3CU3 A;  1QMA A;  4GL6 A;  3CCR 3;  2F99 A;  5KP4 A;  3EE1 A;  3ROB A;  4FMA A;  1W6G A;  3NUV A;  3WDG B;  2ZL8 A;  7STD A;  5KP3 A;  2KXG A;  4CDL A;  1K8A 4;  1SQW A;  1OGX A;  1W00 A;  3VSY A;  1W5Z A;  3MG1 A;  2E2U A;  4N6N B;  1JN5 A;  3K9M C;  5JPU A;  3I56 3;  1YIJ 3;  3MSO A;  1SIH A;  2W9Q A;  2CFW A;  1SII A;  3KE7 A;  1W4N A;  2BO9 B;  4HM7 B;  3UB1 A;  2RCD A;  2W9P A;  1OH0 A;  3DMC A;  4GB5 A;  1QAL A;  2W6J H;  1CYV A;  3OWU A;  4BTY A;  1LOX A;  1N9E A;  3DY5 A;  3CPO A;  3IMA B;  4K61 A;  4IPB A;  3GZB A;  1QAF A;  1K9M 4;  3QRD A;  3GZX B;  1AVL A;  4EV2 A;  5D82 A;  1RJO A;  3BND A;  3F9S A;  2ZDJ A;  4MEI A;  1Q81 4;  3S5C A;  1IT8 A;  1C7H A;  4K1U A;  1W01 A;  1LVN A;  3NX0 A;  1A67 A;  3IJE B;  3LTB A;  1Q86 4;  1VQ5 3;  1WQL B;  4J9A A;  1D6U A;  4QWT A;  5STD A;  4N3V A;  3HIG A;  1V74 A;  3JUP A;  1IU7 A;  1VQ9 3;  1YGE A;  3O8Y A;  1HU9 A;  5AII A;  3FF0 A;  1YJN 3;  3E99 A;  5CLK A;  3WOE B;  3LTD A;  3S28 A;  1QVF 2;  4HM5 B;  4OK0 A;  1IVX A;  1WMP A;  3KSP A;  1G96 A;  2I9W A;  4HYZ A;  2W0Q A;  1WNH A;  1O7W B;  5ELU A;  4LGQ A;  3PYJ A;  1FGR A;  1GY5 A;  3T8N A;  1Y4K A;  3S29 A;  3MKI A;  3LYG A;  4XBX A;  3H51 A;  2IUJ A;  3B7C A;  3DGM A;  2UX0 A;  2WOH A;  3UL6 A;  3TDG A;  1NU3 A;  2P0M A;  1N8Q A;  3FKA A;  4HM0 B;  1YVB I;  4OVM A;  2M7O A;  1GD4 A;  3LH4 A;  2OWP A;  1QJG A;  4RNZ A;  3I0Y A;  3V92 A;  1FGM A;  3ER7 A;  1VQO 3;  1VQM 3;  2MF7 A;  3NM7 A;  1NWW A;  1IV9 A;  1TFO A;  3OXA A;  3CNM A;  1N5P A;  4AKY A;  2F98 A;  1E3R A;  3KZT A;  2C10 A;  1M1K 4;  4FMB A;  3K0Z A;  4MMY B;  1K41 A;  4EYC A;  3CME 3;  1TFK A;  4XDV A;  2BMR B;  1OF5 B;  3ECF A;  1YJ9 3;  2Q07 A;  2XGL A;  3L0R A;  3FSD A;  4H3U A;  3LT9 A;  2QEX 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...