4H61A

Structure of the schizosaccharomyces pombe mediator subunit med6
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
137
structure length
137
Chain Sequence
b'HMDLTSIQWRMPEWVQSMGGLRTENVLEYFSQSPFYSHKSNNEMLKMQSQFNALDLGDLNSQLKRLTGIQFVIIHERPPFLWVIQKQNRLNENEVKPLTVYFVCNENIYMAPNAYTLLATRMLNATYCFQKALTKIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mediator of RNA polymerase II transcription subunit 6
publication title Structure of the Mediator head module.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transcription
total genus 39
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04934 Med6 MED6 mediator sub complex component
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.580 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4h61A00
4H61A
chains in the Genus database with same CATH superfamily
3EBTA 1BUJA 1DVDA 3LOYA 3I0YA 4HM8B 3ZFZA 1FGRA 5AIFA 4BL2A 3SEDA 3DM8A 3DY5A 4HM3B 2F56A 5G1LA 1GY7A 1E3VA 2INXA 2L4VA 4HM2B 3F40A 1STFI 3K0ZA 3X3YA 2CWTA 1DMNA 3CNXA 1SPUA 1BUQA 1RCKA 1RHLA 1UUVB 2XGLA 3EN1B 1E97A 1VZZA 3PCSA 1Q7Y4 2W6JH 1BNFA 1MWSA 1RLSA 1I8VA 1ASKA 1JV2B 3H51A 1UCIA 3B4PA 1Q7HA 4GL6A 1UGHI 4OVMA 3STDA 2Z7AA 1ZGXA 1FGMA 3K63A 3LTDA 4N3VA 1LQMB 1WMOA 2HMKB 5IERA 1UCLA 1IT7A 1GY5A 3URPA 5AIHA 2LYXA 3L0RA 1M1XB 2P0MA 1DMQA 1ISKA 1BSDA 3FH1A 3CU3A 1SIIA 1UUWB 1RGEA 2CH9A 3KFQC 3JUNA 1AVLA 2E2TA 2LQVA 1TJDA 1T5YA 2XH9A 3F7XA 4ILFA 1W4NA 3PGBA 3RGAA 2Z6BA 1YJN3 1CYUA 1M904 1M9GA 8RNTA 3N9HA 3CCJ3 3NBRA 3J7Yd 2IYJA 2F4YA 1N5PA 3WDGB 5IF6A 1QAFA 3WR2A 4CDLA 1FGTA 2GU3A 2XGNA 4XBYA 3T8NA 3CMA3 3NQZA 2P38A 4WFOA 4HM5B 4HZBB 2K3DA 2WGQA 3DXOA 2BMQB 3DH2A 1VQQA 3K7CA 1VQM3 3BNBA 3CCE3 1B2XA 3G713 1YJW3 1ZX2A 3UL6A 4R1KA 1AY7A 3SYUA 3CCM3 2UGIA 3GZXB 4ORLA 2XEPA 1FUTA 3GRDA 4K61A 1RN7A 1I3FA 4IIAA 2RBIA 4N6V0 2BMOB 1FUWA 3E99A 2F86B 2E2VA 4N6MA 1C7HA 2IUKA 3X41A 4KT3B 3H3HA 1RGAA 3HI7A 2SBLA 3RNTA 4HKVB 1Q864 4U13A 3ER7A 2QIYA 1O7PB 4EXRA 4R9LA 1FZUA 3NHXA 1MGWA 4LYLB 4ZM8A 1OCVA 2KF5A 3NUVA 1A2PA 3SOAA 3SVAA 4MEIA 3U97A 2KAAA 1WNHA 1YVBI 3KSED 2ZHXB 3GZYB 4N6OB 4OUQA 5AIIA 5DRVA 3ROBA 3PYJA 4HBRA 2HMNB 1VQ43 3FSDA 3SX1A 2CFKA 3NXJA 2XRXB 3CXC2 1M1K4 1A90A 3NM7A 1YJ93 3KIIA 3LZAA 3EQQB 1ROAA 3BIRA 2C4BA 1I0VA 3T0UA 2OOVC 1Y4KA 1OGXA 3D79A 5CLKA 5M1AA 4EC6A 3DGMA 4Q53A 3AMOB 4WYKA 5IEOA 3LMLA 2IMJA 2H0GA 1MOLA 3CCV3 2CX0A 1TRPA 2F5WA 1X1UA 4HZ9B 2FGTA 1GSPA 4STDA 1RRLA 5DREA 3DGLA 1T2IA 4FMDA 4CJNA 1L5GB 3G4S3 3CPW2 1W00A 4KVHA 5D82A 3M8CA 1VQ63 1W2B2 2B1XB 1FGOA 3D3LA 3X3ZA 2Z77A 1YI23 4PEJA 1MWTA 4MMYB 7STDA 1PYLA 2XSHB 5TGNA 4AKYA 2UUGC 1I70A 4LMIA 1TTOA 1ZS7A 1AQZA 3O8YA 2W9QA 4BU4A 2AAEA 1K41A 1T3BA 1B2UA 1NJI4 1BAOA 2YFLB 2F98A 1RGKA 3OV4A 4HM6B 1OHOA 4O8SA 2HMMB 1LRAA 5BU4A 1FGQA 5RNTA 1VQP3 1JN5B 2RSXA 3BU4A 3F14A 3NQYA 2D1WA 1D6ZA 4GB5A 1HU9A 2IA7A 2CFLA 5IG3A 3EN8A 2GSPA 5KP4A 1BANA 4O02B 4N6LA 1I2EA 2OCTA 3UJMA 2QEX3 1QVF2 3SOYA 1W6YA 2W56A 3X3XA 2XF3A 1OHPA 1N9JA 4MMXB 5G2GA 1U8CB 4FCMA 5I97A 1BNGA 1AR0A 1QAKA 1RTUA 2P09A 3ZG5A 1RGCA 3LTCA 3FF0A 3T8UA 2BHMA 1B20A 1JZOA 3F8XA 3ECFA 2KXGA 1HKXA 4HM1B 3S27A 1FA3A 1A2VA 1NDOB 5ELUA 1B3SA 3RDEA 1U5OA 3OX9A 1UGIA 3MHEA 1K8A4 2F99A 2MC8A 1GD3A 3HIIA 1BU4A 1WMNA 4HOHA 4N6NB 1F8NA 3FCSB 1VQK3 3D4AA 4R9KA 4J5KA 3GWRA 4GSPA 1JNQA 1R4YA 4EW5A 1BSCA 1JZDA 1AV4A 1RDSA 1GS3A 1UUGB 1TRQA 3FG1A 2KF4A 2WOHA 2CWUA 1GY6A 1FW7A 3FGYA 1S723 2PZVA 4L7KA 2J8XB 1TFOA 3G6E3 1BVIA 3CCQ3 3Q1CA 2HMJB 4LSOA 5KP3A 4WP5A 3MWZA 3VF1A 2CFGA 2CKFB 2CHCA 3CCU3 4RNZA 1GOUA 2KCDA 3BNCA 1Z1SA 1BRHA 3V92A 3NX0A 2KRTA 1BRSA 2HOHA 3AHWA 1IQYA 4BL3A 5M19A 1C54A 1Q42A 1JB5A 5IW9A 3BNEA 3D5IA 1MNLA 3VGNA 3DGOA 3MG2A 3FF2A 2GEXA 1NWWA 3OWUA 3CNMA 3I563 3MPHA 4GHOA 1YNVX 3KE7A 1MWUA 1UCKA 3EB8A 2BNGA 2IUJA 2GBWB 3OW22 1VQ83 3CCS3 1CQSA 4K90B 5AEUB 1STDA 1BRNL 9RNTA 3I553 4FMCA 1IU7A 1BRJA 1GMPA 1B27A 2OWPA 4MMZB 1RKYA 3CCL3 1N8QA 2BMRB 1IVWA 3JUQA 2YFJB 2Z76A 4LGQA 3MSOA 1OPYA 4I4KA 2D42A 1VQO3 1VQ93 2OTL3 1IK3A 1D6YA 1OF5B 2BT3A 2CIUA 2KF6A 4XM4A 4BTWA 1PY3A 1K9M4 1IV7A 1IV9A 3BNDA 3NV0A 1WTHA 3AHSA 3OWYA 3X42A 1CYVA 3JUOA 1AVKA 2Q07A 1RGLA 1RGGA 2FNQA 1X1WA 5ELJA 5FW5A 4TX4A 1IVUA 2P05A 4NPBA 5JBSA 2BIRA 1LVNA 1EQKA 1QALA 1BIRA 2CWVA 5BXQA 3QK9A 1SARA 1V58A 4QWTA 5FGOA 5AYSC 1OACA 3UL5A 1JN5A 1RN1A 1BSBA 1SJWA 2W0QA 3SLUA 3CPOA 3PZWA 3S29A 1BRGA 3B4OA 3DGYA 1YGEA 4K1VA 1VQ53 1JBSA 3IJEB 1PU4A 1Q40B 1I3IA 2JQ5A 3EJVA 1X1XA 1HYFA 2F5MA 1EKMA 1PFPA 1UW1A 1ULJB 2K0MA 2R41A 5G1KA 3Q90A 3LTAA 2CFWA 3G16A 2IY2A 1QJGA 1BRKA 1RJOA 2QGUA 5JPPA 3CC73 1Q824 2KF3A 4IT7A 1EA2A 2W04A 3FG4A 4EV2A 2O9UX 1O7MB 3ZG0A 4LEHA 7RNTA 3JVCA 1NO3A 5IENA 4EBGA 5A0OB 1JBTA 2SARA 1NB3I 2BO9B 3EE1A 5LC7A 1LNHA 1UI8A 1QVG2 1TUHA 3F9SA 3PCRA 3DUKA 4EV5A 3GZBA 1UI7A 2O3OA 3DZLA 3HOHA 4BTYA 4KZ1A 1JJ22 4RBNA 1N5HA 1LQGC 1MGRA 4WYKB 1RNBA 1JKGB 3MYTA 5IEPA 1W5ZA 5EEOA 2CX1A 4I5QA 3CD63 4H61A 1KQS2 1X1YA 2ML6A 4RZMA 5AI1A 1KD14 3A76A 3FZWA 1NB5I 1O7NB 2HMLB 1VQN3 3B8LA 4FCZA 1GMRA 4MJDA 4HM7B 5EVHA 4AKZA 2STDA 3MKIA 3KZTA 4XDWA 4N6UA 2QA43 3ALAA 3RGRA 4CCVA 3PS8A 2XSOB 4XDVA 1LOWA 4X2OA 3F8HA 3KN4A 7GSPA 5IG0A 2XFTA 1E3RA 3WA3A 2MF7A 2K54A 2L1SA 2WGOA 3GSPA 3GZRA 4BTXA 3CCR3 3DGNA 2FXTA 1MWRA 3GAXA 1GOVA 4JRFA 3DMCA 1ROVA 1TU5A 1B2MA 1EUIC 2XR8B 4IPBA 5HGRA 2OOVA 2I9WA 1I2FA 3AGOA 3TDGA 2E2UA 2RFRA 4JF8A 2RGQA 5CF1A 2YFIB 2B24B 1VQ73 2P0XA 2OTJ3 2GXFA 4LZIA 1RCLA 2WO0A 2CW9A 1W6CA 5D81A 1DE3A 3WOEB 4L8OA 3SXXA 2ZA4A 1LOYA 1BSEA 1BNEA 1TFKA 2CK3H 1FYSA 5JPUA 4RNYA 1IQXA 1O7WB 1UCJA 2W2CA 4FMAA 1RSNA 3EF8A 4WWUC 1W7CA 1FUSA 2W9PA 5AEWB 1I0XA 4KFFA 3OWSA 4O2HA 1BNIA 1BNJA 2BU4A 3G8ZA 2W56B 1BRIA 1GMQA 1RNTA 1DETA 3KSPA 1B21A 1BSAA 4WHAA 1OGZA 2UX0A 2WOFA 1US1A 2RCDA 3S28A 1JB4A 2CFDA 5AIGA 2HMOB 1NNVA 1ZO2A 3FLJA 1D6UA 3Q2PA 1YIJ3 2Y74A 1I2GA 3WHOA 3LT8A 4J9AA 6GSPA 1OF5A 4HAAA 3KCHA 2C11A 1OHSA 2XFSA 2OQEA 3V99A 1CEWI 4KFEA 1RMSA 5BIRA 4OK0A 1Q814 1IYYA 3CME3 1ULIB 2GEYA 2YX9A 3AMOA 4HJLB 1Q9EA 2W03A 1EG9B 4G1MB 2ZL8A 5LC6A 3S67A 3U1WA 4HVNA 4L8PA 4NREA 2CG0A 3VSYA 3WMDA 2CG1A 1RN4A 1IVXA 4FR9A 1CH0A 3IPTA 5CK6A 1DYUA 2H0IA 3CC43 1LOXA 1BNRA 3S5CA 1YGWA 3D9RA 1IVVA 3NBJA 1SQWA 8CHOA 4N6TA 3BLZA 3WODG 1LXEA 2A15A 1OUNA 5CXOA 4X2HA 2PNCA 3EC9A 1Q40A 4FCJA 4H3UA 3D5GA 5GSPA 1G0TA 1KSIA 4NHFA 3UNLA 1S5AA 2V1LA 1A67A 3EHCA 3K9MC 4J8TA 2GBXB 1BGSA 3K5TA 1KC84 1BOXA 1NU3A 1LNIA 1W02A 3HIGA 1W01A 3OXAA 5CF2A 5M18A 4HM0B 1T2HA 3HZPA 2C10A 1EEJA 1UDII 3QRDA 1KWIA 4HYZA 4RNTA 3UB1A 1A2KA 1LOVA 3HK4A 2CC3A 1W2ZA 1HZ1A 1K28A 4XBXA 6STDA 1J2BA 1TP6A 3EBYA 1RGFA 3FG3A 1O7HB 1GYBA 1YIT3 3WOFB 3LT9A 4XBTA 4FMBA 5HOHA 3A5EA 3MG3A 2Y73A 5D83A 1N9EA 2AADA 5AYRB 3WA2X 1JKGA 3G0KA 2R4IA 5STDA 1IT8A 2RNTA 4KFDA 1V57A 1W6GA 1O7GB 1G96A 3AGNA 1K734 4XB5A 1WMPA 4K1UA 3EX9A 4BIRA 1GD4A 1RRHA 1BNSA 2H0HA 3F7SA 1YHQ3 1B2SA 1G02A 4DKIA 1TIJA 4R80A 1B2ZA 5EQLA 4HM4B 3HX8A 4J5GA 1JB2A 1GOYA 1V74A 1YVSA 3JUPA 4O3VA 3V98A 4R4KA 3MG1A 3Q3FA 3N8BA 5KP1A 3NV0B 5BVBA 1JBRA 1OH0A 1R4CA 2ZDJA 1QMAA 3FKAA 3LYGA 3NBBA 3X40A 1IQ8A 4AEQA 6RNTA 3IMAB 4CPKA 3KKGA 4EYCA 5IG5A 1RGHA 2JDIH 3CC23 1JRQA 3NM2A 2GU1A 1N8R4 1WQLB 3BB9A 2M7OA 3LXUX 1DMMA 3B7CA 3LH4A 1SIHA 1VQL3 3LTBA 1DVCA 3PXMA 2ML5A 2OQEC 1IDPA 5IG4A 3JUMA 3N54B
chains in the Genus database with same CATH topology
3EBTA 1DVDA 3LOYA 3I0YA 4HM8B 1FGRA 5AIFA 3SEDA 3DM8A 3DY5A 4HM3B 1GY7A 1E3VA 2INXA 2L4VA 4HM2B 3F40A 1STFI 3K0ZA 3X3YA 2CWTA 1DMNA 3CNXA 1SPUA 1BUQA 1UUVB 2XGLA 3EN1B 1E97A 1VZZA 3PCSA 1Q7Y4 2W6JH 1ASKA 1JV2B 3H51A 3B4PA 4GL6A 4OVMA 3STDA 2Z7AA 3K63A 1FGMA 3LTDA 4N3VA 1WMOA 2HMKB 5IERA 1IT7A 1GY5A 5AIHA 2LYXA 3L0RA 1M1XB 2P0MA 1DMQA 1ISKA 3FH1A 3CU3A 1SIIA 1UUWB 2CH9A 3KFQC 3JUNA 1AVLA 2E2TA 2LQVA 1T5YA 2XH9A 3F7XA 1W4NA 3PGBA 3RGAA 2Z6BA 1YJN3 1CYUA 1M904 1M9GA 3N9HA 3CCJ3 3NBRA 3J7Yd 1N5PA 3WDGB 5IF6A 1QAFA 4CDLA 1FGTA 2GU3A 2XGNA 4XBYA 3T8NA 3CMA3 3NQZA 2P38A 4WFOA 4HM5B 4HZBB 2WGQA 3DXOA 2BMQB 3K7CA 1VQM3 3BNBA 3CCE3 3G713 1YJW3 1ZX2A 3UL6A 4R1KA 3CCM3 3GZXB 4ORLA 2XEPA 3GRDA 4K61A 1RN7A 4N6V0 4IIAA 2BMOB 1FUWA 3E99A 2F86B 2E2VA 4N6MA 1C7HA 2IUKA 3X41A 3H3HA 3HI7A 2SBLA 4HKVB 1Q864 4U13A 3ER7A 2QIYA 1O7PB 4EXRA 4R9LA 3NHXA 4ZM8A 1OCVA 3NUVA 3SOAA 3SVAA 4MEIA 3U97A 1WNHA 1YVBI 3KSED 4N6OB 3GZYB 4OUQA 5DRVA 5AIIA 3ROBA 1VQ43 3PYJA 4HBRA 2HMNB 3FSDA 3SX1A 2CFKA 3NXJA 2XRXB 3CXC2 1M1K4 1A90A 3NM7A 1YJ93 3KIIA 3LZAA 3EQQB 1ROAA 3T0UA 2OOVC 1Y4KA 1OGXA 5CLKA 4EC6A 3DGMA 4Q53A 3AMOB 4WYKA 5IEOA 3LMLA 2IMJA 1MOLA 3CCV3 4HZ9B 2FGTA 4STDA 1RRLA 5DREA 3DGLA 4FMDA 1L5GB 3G4S3 3CPW2 1W00A 4KVHA 5D82A 3M8CA 1VQ63 1W2B2 2B1XB 1FGOA 3D3LA 3X3ZA 2Z77A 1YI23 4PEJA 4MMYB 7STDA 2XSHB 5TGNA 4AKYA 4LMIA 3O8YA 2W9QA 1K41A 1NJI4 2YFLB 4O8SA 2F98A 3OV4A 4HM6B 1OHOA 2HMMB 1FGQA 1VQP3 1JN5B 2RSXA 3F14A 3NQYA 2D1WA 1D6ZA 4GB5A 1HU9A 2IA7A 2CFLA 5IG3A 3EN8A 5KP4A 4O02B 4N6LA 2OCTA 3UJMA 1QVF2 2QEX3 3SOYA 1W6YA 2W56A 3X3XA 2XF3A 1OHPA 1N9JA 4MMXB 5G2GA 1U8CB 4FCMA 5I97A 1AR0A 1QAKA 2P09A 3LTCA 3FF0A 3T8UA 2BHMA 3F8XA 3ECFA 2KXGA 1HKXA 4HM1B 3S27A 1FA3A 1A2VA 1NDOB 5ELUA 3RDEA 1U5OA 3OX9A 3MHEA 1K8A4 2F99A 2MC8A 1GD3A 3HIIA 1WMNA 4N6NB 1F8NA 3FCSB 1VQK3 4R9KA 3GWRA 1JNQA 1AV4A 1GS3A 3FG1A 2WOHA 2CWUA 1GY6A 3FGYA 1S723 2PZVA 4L7KA 3G6E3 1TFOA 3CCQ3 3Q1CA 2HMJB 4LSOA 5KP3A 4WP5A 3MWZA 3VF1A 2CFGA 2CKFB 2CHCA 3CCU3 4RNZA 2KCDA 3BNCA 1Z1SA 3V92A 3NX0A 2KRTA 1IQYA 1Q42A 1JB5A 3BNEA 1MNLA 3VGNA 3DGOA 3MG2A 3FF2A 2GEXA 1NWWA 3OWUA 3CNMA 3I563 3MPHA 3KE7A 3EB8A 2BNGA 2IUJA 2GBWB 3OW22 1VQ83 3CCS3 1CQSA 4K90B 5AEUB 1STDA 3I553 4FMCA 1IU7A 2OWPA 4MMZB 1RKYA 3CCL3 1N8QA 2BMRB 1IVWA 3JUQA 2YFJB 2Z76A 4LGQA 3MSOA 1OPYA 4I4KA 2D42A 1VQO3 1VQ93 2OTL3 1IK3A 1D6YA 1OF5B 2BT3A 2CIUA 4XM4A 4BTWA 1K9M4 1IV7A 1IV9A 3BNDA 3NV0A 1WTHA 3OWYA 3X42A 1CYVA 3JUOA 1AVKA 2Q07A 2FNQA 5ELJA 5FW5A 4TX4A 1IVUA 2P05A 5JBSA 1LVNA 1EQKA 1QALA 2CWVA 5BXQA 3QK9A 4QWTA 5FGOA 3UL5A 5AYSC 1OACA 1JN5A 1SJWA 2W0QA 3SLUA 3CPOA 3PZWA 3S29A 3B4OA 4K1VA 1YGEA 1VQ53 3IJEB 1Q40B 2JQ5A 3EJVA 5IEPA 1EKMA 1PFPA 1UW1A 1ULJB 2K0MA 3Q90A 3LTAA 2CFWA 3G16A 1QJGA 2QGUA 1RJOA 5JPPA 1Q824 3CC73 4IT7A 1EA2A 2W04A 3FG4A 4EV2A 2O9UX 1O7MB 4LEHA 3JVCA 1NO3A 5IENA 4EBGA 5A0OB 1NB3I 2BO9B 3EE1A 5LC7A 1LNHA 1UI8A 1QVG2 1TUHA 3F9SA 3PCRA 3DUKA 4EV5A 3GZBA 1UI7A 2O3OA 3DZLA 4BTYA 4KZ1A 1JJ22 4RBNA 1N5HA 4WYKB 1JKGB 3MYTA 1W5ZA 5EEOA 3CD63 4H61A 1KQS2 2ML6A 4RZMA 5AI1A 1KD14 3A76A 3FZWA 1NB5I 1O7NB 2HMLB 1VQN3 3B8LA 4FCZA 4MJDA 4HM7B 5EVHA 4AKZA 2STDA 3MKIA 3KZTA 4XDWA 4N6UA 2QA43 3ALAA 3RGRA 4CCVA 3PS8A 2XSOB 4XDVA 4X2OA 3F8HA 3KN4A 5IG0A 2XFTA 1E3RA 3WA3A 2MF7A 2K54A 2WGOA 3GZRA 4BTXA 3CCR3 3DGNA 2FXTA 3GAXA 4JRFA 3DMCA 1ROVA 1TU5A 2XR8B 4IPBA 5HGRA 2OOVA 2I9WA 3TDGA 2E2UA 2RFRA 4JF8A 2RGQA 5CF1A 2YFIB 2B24B 1VQ73 2P0XA 2OTJ3 2GXFA 4LZIA 2WO0A 2CW9A 1W6CA 5D81A 3WOEB 4L8OA 3SXXA 1TFKA 2CK3H 5JPUA 4RNYA 1IQXA 1O7WB 2W2CA 4FMAA 3EF8A 4WWUC 1W7CA 2W9PA 5AEWB 4KFFA 3OWSA 4O2HA 3G8ZA 2W56B 3KSPA 4WHAA 1OGZA 2UX0A 2WOFA 1US1A 2RCDA 3S28A 1JB4A 2CFDA 5AIGA 2HMOB 1ZO2A 3FLJA 1D6UA 3Q2PA 1YIJ3 2Y74A 3LT8A 4J9AA 1OF5A 2C11A 1OHSA 2XFSA 2OQEA 3V99A 1CEWI 4KFEA 4OK0A 1Q814 3CME3 1ULIB 2GEYA 2YX9A 3AMOA 4HJLB 2W03A 1EG9B 4G1MB 2ZL8A 5LC6A 3S67A 3U1WA 4HVNA 4L8PA 4NREA 2CG0A 3VSYA 3WMDA 2CG1A 1IVXA 4FR9A 3IPTA 5CK6A 1DYUA 3CC43 1LOXA 3S5CA 3D9RA 1IVVA 3NBJA 1SQWA 8CHOA 4N6TA 3BLZA 3WODG 1LXEA 2A15A 1OUNA 5CXOA 4X2HA 2PNCA 3EC9A 1Q40A 4FCJA 4H3UA 4NHFA 1KSIA 3UNLA 1S5AA 2V1LA 1A67A 3EHCA 3K9MC 4J8TA 2GBXB 3K5TA 1KC84 1NU3A 5CF2A 1W02A 3HIGA 1W01A 3OXAA 4HM0B 3HZPA 2C10A 3QRDA 4HYZA 1KWIA 3UB1A 1A2KA 3HK4A 2CC3A 1W2ZA 1K28A 4XBXA 6STDA 1J2BA 1TP6A 3EBYA 3FG3A 1O7HB 1GYBA 1YIT3 3WOFB 3LT9A 4XBTA 4FMBA 3MG3A 2Y73A 5D83A 1N9EA 1PU4A 5AYRB 3WA2X 1JKGA 3G0KA 2R4IA 5STDA 1IT8A 4KFDA 1W6GA 1O7GB 1G96A 1K734 4XB5A 1WMPA 4K1UA 3EX9A 1GD4A 1RRHA 3F7SA 1YHQ3 1TIJA 4R80A 5EQLA 4HM4B 3HX8A 1JB2A 1V74A 3JUPA 4O3VA 3V98A 4R4KA 3MG1A 3N8BA 5KP1A 3NV0B 5BVBA 1OH0A 1R4CA 2ZDJA 1QMAA 3FKAA 3LYGA 3NBBA 3X40A 1IQ8A 4AEQA 5IW9A 3IMAB 3KKGA 4EYCA 5IG5A 2JDIH 3CC23 1JRQA 3NM2A 2GU1A 1N8R4 1WQLB 3BB9A 2M7OA 3LXUX 1DMMA 3B7CA 3LH4A 1SIHA 1VQL3 3LTBA 1DVCA 3PXMA 2ML5A 2OQEC 1IDPA 5IG4A 3JUMA 3N54B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H61 A; 
#chains in the Genus database with same CATH topology
 3EBT A;  1BUJ A;  1DVD A;  3LOY A;  3I0Y A;  4HM8 B;  3ZFZ A;  1FGR A;  5AIF A;  4BL2 A;  3SED A;  3DM8 A;  3DY5 A;  4HM3 B;  2F56 A;  5G1L A;  1GY7 A;  1E3V A;  2INX A;  2L4V A;  4HM2 B;  3F40 A;  1STF I;  3K0Z A;  3X3Y A;  2CWT A;  1DMN A;  3CNX A;  1SPU A;  1BUQ A;  1RCK A;  1RHL A;  1UUV B;  2XGL A;  3EN1 B;  1E97 A;  1VZZ A;  3PCS A;  1Q7Y 4;  2W6J H;  1BNF A;  1MWS A;  1RLS A;  1I8V A;  1ASK A;  1JV2 B;  3H51 A;  1UCI A;  3B4P A;  1Q7H A;  4GL6 A;  1UGH I;  4OVM A;  3STD A;  2Z7A A;  1ZGX A;  1FGM A;  3K63 A;  3LTD A;  4N3V A;  1LQM B;  1WMO A;  2HMK B;  5IER A;  1UCL A;  1IT7 A;  1GY5 A;  3URP A;  5AIH A;  2LYX A;  3L0R A;  1M1X B;  2P0M A;  1DMQ A;  1ISK A;  1BSD A;  3FH1 A;  3CU3 A;  1SII A;  1UUW B;  1RGE A;  2CH9 A;  3KFQ C;  3JUN A;  1AVL A;  2E2T A;  2LQV A;  1TJD A;  1T5Y A;  2XH9 A;  3F7X A;  4ILF A;  1W4N A;  3PGB A;  3RGA A;  2Z6B A;  1YJN 3;  1CYU A;  1M90 4;  1M9G A;  8RNT A;  3N9H A;  3CCJ 3;  3NBR A;  3J7Y d;  2IYJ A;  2F4Y A;  1N5P A;  3WDG B;  5IF6 A;  1QAF A;  3WR2 A;  4CDL A;  1FGT A;  2GU3 A;  2XGN A;  4XBY A;  3T8N A;  3CMA 3;  3NQZ A;  2P38 A;  4WFO A;  4HM5 B;  4HZB B;  2K3D A;  2WGQ A;  3DXO A;  2BMQ B;  3DH2 A;  1VQQ A;  3K7C A;  1VQM 3;  3BNB A;  3CCE 3;  1B2X A;  3G71 3;  1YJW 3;  1ZX2 A;  3UL6 A;  4R1K A;  1AY7 A;  3SYU A;  3CCM 3;  2UGI A;  3GZX B;  4ORL A;  2XEP A;  1FUT A;  3GRD A;  4K61 A;  1RN7 A;  1I3F A;  4IIA A;  2RBI A;  4N6V 0;  2BMO B;  1FUW A;  3E99 A;  2F86 B;  2E2V A;  4N6M A;  1C7H A;  2IUK A;  3X41 A;  4KT3 B;  3H3H A;  1RGA A;  3HI7 A;  2SBL A;  3RNT A;  4HKV B;  1Q86 4;  4U13 A;  3ER7 A;  2QIY A;  1O7P B;  4EXR A;  4R9L A;  1FZU A;  3NHX A;  1MGW A;  4LYL B;  4ZM8 A;  1OCV A;  2KF5 A;  3NUV A;  1A2P A;  3SOA A;  3SVA A;  4MEI A;  3U97 A;  2KAA A;  1WNH A;  1YVB I;  3KSE D;  2ZHX B;  3GZY B;  4N6O B;  4OUQ A;  5AII A;  5DRV A;  3ROB A;  3PYJ A;  4HBR A;  2HMN B;  1VQ4 3;  3FSD A;  3SX1 A;  2CFK A;  3NXJ A;  2XRX B;  3CXC 2;  1M1K 4;  1A90 A;  3NM7 A;  1YJ9 3;  3KII A;  3LZA A;  3EQQ B;  1ROA A;  3BIR A;  2C4B A;  1I0V A;  3T0U A;  2OOV C;  1Y4K A;  1OGX A;  3D79 A;  5CLK A;  5M1A A;  4EC6 A;  3DGM A;  4Q53 A;  3AMO B;  4WYK A;  5IEO A;  3LML A;  2IMJ A;  2H0G A;  1MOL A;  3CCV 3;  2CX0 A;  1TRP A;  2F5W A;  1X1U A;  4HZ9 B;  2FGT A;  1GSP A;  4STD A;  1RRL A;  5DRE A;  3DGL A;  1T2I A;  4FMD A;  4CJN A;  1L5G B;  3G4S 3;  3CPW 2;  1W00 A;  4KVH A;  5D82 A;  3M8C A;  1VQ6 3;  1W2B 2;  2B1X B;  1FGO A;  3D3L A;  3X3Z A;  2Z77 A;  1YI2 3;  4PEJ A;  1MWT A;  4MMY B;  7STD A;  1PYL A;  2XSH B;  5TGN A;  4AKY A;  2UUG C;  1I70 A;  4LMI A;  1TTO A;  1ZS7 A;  1AQZ A;  3O8Y A;  2W9Q A;  4BU4 A;  2AAE A;  1K41 A;  1T3B A;  1B2U A;  1NJI 4;  1BAO A;  2YFL B;  2F98 A;  1RGK A;  3OV4 A;  4HM6 B;  1OHO A;  4O8S A;  2HMM B;  1LRA A;  5BU4 A;  1FGQ A;  5RNT A;  1VQP 3;  1JN5 B;  2RSX A;  3BU4 A;  3F14 A;  3NQY A;  2D1W A;  1D6Z A;  4GB5 A;  1HU9 A;  2IA7 A;  2CFL A;  5IG3 A;  3EN8 A;  2GSP A;  5KP4 A;  1BAN A;  4O02 B;  4N6L A;  1I2E A;  2OCT A;  3UJM A;  2QEX 3;  1QVF 2;  3SOY A;  1W6Y A;  2W56 A;  3X3X A;  2XF3 A;  1OHP A;  1N9J A;  4MMX B;  5G2G A;  1U8C B;  4FCM A;  5I97 A;  1BNG A;  1AR0 A;  1QAK A;  1RTU A;  2P09 A;  3ZG5 A;  1RGC A;  3LTC A;  3FF0 A;  3T8U A;  2BHM A;  1B20 A;  1JZO A;  3F8X A;  3ECF A;  2KXG A;  1HKX A;  4HM1 B;  3S27 A;  1FA3 A;  1A2V A;  1NDO B;  5ELU A;  1B3S A;  3RDE A;  1U5O A;  3OX9 A;  1UGI A;  3MHE A;  1K8A 4;  2F99 A;  2MC8 A;  1GD3 A;  3HII A;  1BU4 A;  1WMN A;  4HOH A;  4N6N B;  1F8N A;  3FCS B;  1VQK 3;  3D4A A;  4R9K A;  4J5K A;  3GWR A;  4GSP A;  1JNQ A;  1R4Y A;  4EW5 A;  1BSC A;  1JZD A;  1AV4 A;  1RDS A;  1GS3 A;  1UUG B;  1TRQ A;  3FG1 A;  2KF4 A;  2WOH A;  2CWU A;  1GY6 A;  1FW7 A;  3FGY A;  1S72 3;  2PZV A;  4L7K A;  2J8X B;  1TFO A;  3G6E 3;  1BVI A;  3CCQ 3;  3Q1C A;  2HMJ B;  4LSO A;  5KP3 A;  4WP5 A;  3MWZ A;  3VF1 A;  2CFG A;  2CKF B;  2CHC A;  3CCU 3;  4RNZ A;  1GOU A;  2KCD A;  3BNC A;  1Z1S A;  1BRH A;  3V92 A;  3NX0 A;  2KRT A;  1BRS A;  2HOH A;  3AHW A;  1IQY A;  4BL3 A;  5M19 A;  1C54 A;  1Q42 A;  1JB5 A;  5IW9 A;  3BNE A;  3D5I A;  1MNL A;  3VGN A;  3DGO A;  3MG2 A;  3FF2 A;  2GEX A;  1NWW A;  3OWU A;  3CNM A;  3I56 3;  3MPH A;  4GHO A;  1YNV X;  3KE7 A;  1MWU A;  1UCK A;  3EB8 A;  2BNG A;  2IUJ A;  2GBW B;  3OW2 2;  1VQ8 3;  3CCS 3;  1CQS A;  4K90 B;  5AEU B;  1STD A;  1BRN L;  9RNT A;  3I55 3;  4FMC A;  1IU7 A;  1BRJ A;  1GMP A;  1B27 A;  2OWP A;  4MMZ B;  1RKY A;  3CCL 3;  1N8Q A;  2BMR B;  1IVW A;  3JUQ A;  2YFJ B;  2Z76 A;  4LGQ A;  3MSO A;  1OPY A;  4I4K A;  2D42 A;  1VQO 3;  1VQ9 3;  2OTL 3;  1IK3 A;  1D6Y A;  1OF5 B;  2BT3 A;  2CIU A;  2KF6 A;  4XM4 A;  4BTW A;  1PY3 A;  1K9M 4;  1IV7 A;  1IV9 A;  3BND A;  3NV0 A;  1WTH A;  3AHS A;  3OWY A;  3X42 A;  1CYV A;  3JUO A;  1AVK A;  2Q07 A;  1RGL A;  1RGG A;  2FNQ A;  1X1W A;  5ELJ A;  5FW5 A;  4TX4 A;  1IVU A;  2P05 A;  4NPB A;  5JBS A;  2BIR A;  1LVN A;  1EQK A;  1QAL A;  1BIR A;  2CWV A;  5BXQ A;  3QK9 A;  1SAR A;  1V58 A;  4QWT A;  5FGO A;  5AYS C;  1OAC A;  3UL5 A;  1JN5 A;  1RN1 A;  1BSB A;  1SJW A;  2W0Q A;  3SLU A;  3CPO A;  3PZW A;  3S29 A;  1BRG A;  3B4O A;  3DGY A;  1YGE A;  4K1V A;  1VQ5 3;  1JBS A;  3IJE B;  1PU4 A;  1Q40 B;  1I3I A;  2JQ5 A;  3EJV A;  1X1X A;  1HYF A;  2F5M A;  1EKM A;  1PFP A;  1UW1 A;  1ULJ B;  2K0M A;  2R41 A;  5G1K A;  3Q90 A;  3LTA A;  2CFW A;  3G16 A;  2IY2 A;  1QJG A;  1BRK A;  1RJO A;  2QGU A;  5JPP A;  3CC7 3;  1Q82 4;  2KF3 A;  4IT7 A;  1EA2 A;  2W04 A;  3FG4 A;  4EV2 A;  2O9U X;  1O7M B;  3ZG0 A;  4LEH A;  7RNT A;  3JVC A;  1NO3 A;  5IEN A;  4EBG A;  5A0O B;  1JBT A;  2SAR A;  1NB3 I;  2BO9 B;  3EE1 A;  5LC7 A;  1LNH A;  1UI8 A;  1QVG 2;  1TUH A;  3F9S A;  3PCR A;  3DUK A;  4EV5 A;  3GZB A;  1UI7 A;  2O3O A;  3DZL A;  3HOH A;  4BTY A;  4KZ1 A;  1JJ2 2;  4RBN A;  1N5H A;  1LQG C;  1MGR A;  4WYK B;  1RNB A;  1JKG B;  3MYT A;  5IEP A;  1W5Z A;  5EEO A;  2CX1 A;  4I5Q A;  3CD6 3;  4H61 A;  1KQS 2;  1X1Y A;  2ML6 A;  4RZM A;  5AI1 A;  1KD1 4;  3A76 A;  3FZW A;  1NB5 I;  1O7N B;  2HML B;  1VQN 3;  3B8L A;  4FCZ A;  1GMR A;  4MJD A;  4HM7 B;  5EVH A;  4AKZ A;  2STD A;  3MKI A;  3KZT A;  4XDW A;  4N6U A;  2QA4 3;  3ALA A;  3RGR A;  4CCV A;  3PS8 A;  2XSO B;  4XDV A;  1LOW A;  4X2O A;  3F8H A;  3KN4 A;  7GSP A;  5IG0 A;  2XFT A;  1E3R A;  3WA3 A;  2MF7 A;  2K54 A;  2L1S A;  2WGO A;  3GSP A;  3GZR A;  4BTX A;  3CCR 3;  3DGN A;  2FXT A;  1MWR A;  3GAX A;  1GOV A;  4JRF A;  3DMC A;  1ROV A;  1TU5 A;  1B2M A;  1EUI C;  2XR8 B;  4IPB A;  5HGR A;  2OOV A;  2I9W A;  1I2F A;  3AGO A;  3TDG A;  2E2U A;  2RFR A;  4JF8 A;  2RGQ A;  5CF1 A;  2YFI B;  2B24 B;  1VQ7 3;  2P0X A;  2OTJ 3;  2GXF A;  4LZI A;  1RCL A;  2WO0 A;  2CW9 A;  1W6C A;  5D81 A;  1DE3 A;  3WOE B;  4L8O A;  3SXX A;  2ZA4 A;  1LOY A;  1BSE A;  1BNE A;  1TFK A;  2CK3 H;  1FYS A;  5JPU A;  4RNY A;  1IQX A;  1O7W B;  1UCJ A;  2W2C A;  4FMA A;  1RSN A;  3EF8 A;  4WWU C;  1W7C A;  1FUS A;  2W9P A;  5AEW B;  1I0X A;  4KFF A;  3OWS A;  4O2H A;  1BNI A;  1BNJ A;  2BU4 A;  3G8Z A;  2W56 B;  1BRI A;  1GMQ A;  1RNT A;  1DET A;  3KSP A;  1B21 A;  1BSA A;  4WHA A;  1OGZ A;  2UX0 A;  2WOF A;  1US1 A;  2RCD A;  3S28 A;  1JB4 A;  2CFD A;  5AIG A;  2HMO B;  1NNV A;  1ZO2 A;  3FLJ A;  1D6U A;  3Q2P A;  1YIJ 3;  2Y74 A;  1I2G A;  3WHO A;  3LT8 A;  4J9A A;  6GSP A;  1OF5 A;  4HAA A;  3KCH A;  2C11 A;  1OHS A;  2XFS A;  2OQE A;  3V99 A;  1CEW I;  4KFE A;  1RMS A;  5BIR A;  4OK0 A;  1Q81 4;  1IYY A;  3CME 3;  1ULI B;  2GEY A;  2YX9 A;  3AMO A;  4HJL B;  1Q9E A;  2W03 A;  1EG9 B;  4G1M B;  2ZL8 A;  5LC6 A;  3S67 A;  3U1W A;  4HVN A;  4L8P A;  4NRE A;  2CG0 A;  3VSY A;  3WMD A;  2CG1 A;  1RN4 A;  1IVX A;  4FR9 A;  1CH0 A;  3IPT A;  5CK6 A;  1DYU A;  2H0I A;  3CC4 3;  1LOX A;  1BNR A;  3S5C A;  1YGW A;  3D9R A;  1IVV A;  3NBJ A;  1SQW A;  8CHO A;  4N6T A;  3BLZ A;  3WOD G;  1LXE A;  2A15 A;  1OUN A;  5CXO A;  4X2H A;  2PNC A;  3EC9 A;  1Q40 A;  4FCJ A;  4H3U A;  3D5G A;  5GSP A;  1G0T A;  1KSI A;  4NHF A;  3UNL A;  1S5A A;  2V1L A;  1A67 A;  3EHC A;  3K9M C;  4J8T A;  2GBX B;  1BGS A;  3K5T A;  1KC8 4;  1BOX A;  1NU3 A;  1LNI A;  1W02 A;  3HIG A;  1W01 A;  3OXA A;  5CF2 A;  5M18 A;  4HM0 B;  1T2H A;  3HZP A;  2C10 A;  1EEJ A;  1UDI I;  3QRD A;  1KWI A;  4HYZ A;  4RNT A;  3UB1 A;  1A2K A;  1LOV A;  3HK4 A;  2CC3 A;  1W2Z A;  1HZ1 A;  1K28 A;  4XBX A;  6STD A;  1J2B A;  1TP6 A;  3EBY A;  1RGF A;  3FG3 A;  1O7H B;  1GYB A;  1YIT 3;  3WOF B;  3LT9 A;  4XBT A;  4FMB A;  5HOH A;  3A5E A;  3MG3 A;  2Y73 A;  5D83 A;  1N9E A;  2AAD A;  5AYR B;  3WA2 X;  1JKG A;  3G0K A;  2R4I A;  5STD A;  1IT8 A;  2RNT A;  4KFD A;  1V57 A;  1W6G A;  1O7G B;  1G96 A;  3AGN A;  1K73 4;  4XB5 A;  1WMP A;  4K1U A;  3EX9 A;  4BIR A;  1GD4 A;  1RRH A;  1BNS A;  2H0H A;  3F7S A;  1YHQ 3;  1B2S A;  1G02 A;  4DKI A;  1TIJ A;  4R80 A;  1B2Z A;  5EQL A;  4HM4 B;  3HX8 A;  4J5G A;  1JB2 A;  1GOY A;  1V74 A;  1YVS A;  3JUP A;  4O3V A;  3V98 A;  4R4K A;  3MG1 A;  3Q3F A;  3N8B A;  5KP1 A;  3NV0 B;  5BVB A;  1JBR A;  1OH0 A;  1R4C A;  2ZDJ A;  1QMA A;  3FKA A;  3LYG A;  3NBB A;  3X40 A;  1IQ8 A;  4AEQ A;  6RNT A;  3IMA B;  4CPK A;  3KKG A;  4EYC A;  5IG5 A;  1RGH A;  2JDI H;  3CC2 3;  1JRQ A;  3NM2 A;  2GU1 A;  1N8R 4;  1WQL B;  3BB9 A;  2M7O A;  3LXU X;  1DMM A;  3B7C A;  3LH4 A;  1SIH A;  1VQL 3;  3LTB A;  1DVC A;  3PXM A;  2ML5 A;  2OQE C;  1IDP A;  5IG4 A;  3JUM A;  3N54 B; 
#chains in the Genus database with same CATH homology
 3EBT A;  1DVD A;  3LOY A;  3I0Y A;  4HM8 B;  1FGR A;  5AIF A;  3SED A;  3DM8 A;  3DY5 A;  4HM3 B;  1GY7 A;  1E3V A;  2INX A;  2L4V A;  4HM2 B;  3F40 A;  1STF I;  3K0Z A;  3X3Y A;  2CWT A;  1DMN A;  3CNX A;  1SPU A;  1BUQ A;  1UUV B;  2XGL A;  3EN1 B;  1E97 A;  1VZZ A;  3PCS A;  1Q7Y 4;  2W6J H;  1ASK A;  1JV2 B;  3H51 A;  3B4P A;  4GL6 A;  4OVM A;  3STD A;  2Z7A A;  3K63 A;  1FGM A;  3LTD A;  4N3V A;  1WMO A;  2HMK B;  5IER A;  1IT7 A;  1GY5 A;  5AIH A;  2LYX A;  3L0R A;  1M1X B;  2P0M A;  1DMQ A;  1ISK A;  3FH1 A;  3CU3 A;  1SII A;  1UUW B;  2CH9 A;  3KFQ C;  3JUN A;  1AVL A;  2E2T A;  2LQV A;  1T5Y A;  2XH9 A;  3F7X A;  1W4N A;  3PGB A;  3RGA A;  2Z6B A;  1YJN 3;  1CYU A;  1M90 4;  1M9G A;  3N9H A;  3CCJ 3;  3NBR A;  3J7Y d;  1N5P A;  3WDG B;  5IF6 A;  1QAF A;  4CDL A;  1FGT A;  2GU3 A;  2XGN A;  4XBY A;  3T8N A;  3CMA 3;  3NQZ A;  2P38 A;  4WFO A;  4HM5 B;  4HZB B;  2WGQ A;  3DXO A;  2BMQ B;  3K7C A;  1VQM 3;  3BNB A;  3CCE 3;  3G71 3;  1YJW 3;  1ZX2 A;  3UL6 A;  4R1K A;  3CCM 3;  3GZX B;  4ORL A;  2XEP A;  3GRD A;  4K61 A;  1RN7 A;  4N6V 0;  4IIA A;  2BMO B;  1FUW A;  3E99 A;  2F86 B;  2E2V A;  4N6M A;  1C7H A;  2IUK A;  3X41 A;  3H3H A;  3HI7 A;  2SBL A;  4HKV B;  1Q86 4;  4U13 A;  3ER7 A;  2QIY A;  1O7P B;  4EXR A;  4R9L A;  3NHX A;  4ZM8 A;  1OCV A;  3NUV A;  3SOA A;  3SVA A;  4MEI A;  3U97 A;  1WNH A;  1YVB I;  3KSE D;  4N6O B;  3GZY B;  4OUQ A;  5DRV A;  5AII A;  3ROB A;  1VQ4 3;  3PYJ A;  4HBR A;  2HMN B;  3FSD A;  3SX1 A;  2CFK A;  3NXJ A;  2XRX B;  3CXC 2;  1M1K 4;  1A90 A;  3NM7 A;  1YJ9 3;  3KII A;  3LZA A;  3EQQ B;  1ROA A;  3T0U A;  2OOV C;  1Y4K A;  1OGX A;  5CLK A;  4EC6 A;  3DGM A;  4Q53 A;  3AMO B;  4WYK A;  5IEO A;  3LML A;  2IMJ A;  1MOL A;  3CCV 3;  4HZ9 B;  2FGT A;  4STD A;  1RRL A;  5DRE A;  3DGL A;  4FMD A;  1L5G B;  3G4S 3;  3CPW 2;  1W00 A;  4KVH A;  5D82 A;  3M8C A;  1VQ6 3;  1W2B 2;  2B1X B;  1FGO A;  3D3L A;  3X3Z A;  2Z77 A;  1YI2 3;  4PEJ A;  4MMY B;  7STD A;  2XSH B;  5TGN A;  4AKY A;  4LMI A;  3O8Y A;  2W9Q A;  1K41 A;  1NJI 4;  2YFL B;  4O8S A;  2F98 A;  3OV4 A;  4HM6 B;  1OHO A;  2HMM B;  1FGQ A;  1VQP 3;  1JN5 B;  2RSX A;  3F14 A;  3NQY A;  2D1W A;  1D6Z A;  4GB5 A;  1HU9 A;  2IA7 A;  2CFL A;  5IG3 A;  3EN8 A;  5KP4 A;  4O02 B;  4N6L A;  2OCT A;  3UJM A;  1QVF 2;  2QEX 3;  3SOY A;  1W6Y A;  2W56 A;  3X3X A;  2XF3 A;  1OHP A;  1N9J A;  4MMX B;  5G2G A;  1U8C B;  4FCM A;  5I97 A;  1AR0 A;  1QAK A;  2P09 A;  3LTC A;  3FF0 A;  3T8U A;  2BHM A;  3F8X A;  3ECF A;  2KXG A;  1HKX A;  4HM1 B;  3S27 A;  1FA3 A;  1A2V A;  1NDO B;  5ELU A;  3RDE A;  1U5O A;  3OX9 A;  3MHE A;  1K8A 4;  2F99 A;  2MC8 A;  1GD3 A;  3HII A;  1WMN A;  4N6N B;  1F8N A;  3FCS B;  1VQK 3;  4R9K A;  3GWR A;  1JNQ A;  1AV4 A;  1GS3 A;  3FG1 A;  2WOH A;  2CWU A;  1GY6 A;  3FGY A;  1S72 3;  2PZV A;  4L7K A;  3G6E 3;  1TFO A;  3CCQ 3;  3Q1C A;  2HMJ B;  4LSO A;  5KP3 A;  4WP5 A;  3MWZ A;  3VF1 A;  2CFG A;  2CKF B;  2CHC A;  3CCU 3;  4RNZ A;  2KCD A;  3BNC A;  1Z1S A;  3V92 A;  3NX0 A;  2KRT A;  1IQY A;  1Q42 A;  1JB5 A;  3BNE A;  1MNL A;  3VGN A;  3DGO A;  3MG2 A;  3FF2 A;  2GEX A;  1NWW A;  3OWU A;  3CNM A;  3I56 3;  3MPH A;  3KE7 A;  3EB8 A;  2BNG A;  2IUJ A;  2GBW B;  3OW2 2;  1VQ8 3;  3CCS 3;  1CQS A;  4K90 B;  5AEU B;  1STD A;  3I55 3;  4FMC A;  1IU7 A;  2OWP A;  4MMZ B;  1RKY A;  3CCL 3;  1N8Q A;  2BMR B;  1IVW A;  3JUQ A;  2YFJ B;  2Z76 A;  4LGQ A;  3MSO A;  1OPY A;  4I4K A;  2D42 A;  1VQO 3;  1VQ9 3;  2OTL 3;  1IK3 A;  1D6Y A;  1OF5 B;  2BT3 A;  2CIU A;  4XM4 A;  4BTW A;  1K9M 4;  1IV7 A;  1IV9 A;  3BND A;  3NV0 A;  1WTH A;  3OWY A;  3X42 A;  1CYV A;  3JUO A;  1AVK A;  2Q07 A;  2FNQ A;  5ELJ A;  5FW5 A;  4TX4 A;  1IVU A;  2P05 A;  5JBS A;  1LVN A;  1EQK A;  1QAL A;  2CWV A;  5BXQ A;  3QK9 A;  4QWT A;  5FGO A;  3UL5 A;  5AYS C;  1OAC A;  1JN5 A;  1SJW A;  2W0Q A;  3SLU A;  3CPO A;  3PZW A;  3S29 A;  3B4O A;  4K1V A;  1YGE A;  1VQ5 3;  3IJE B;  1Q40 B;  2JQ5 A;  3EJV A;  5IEP A;  1EKM A;  1PFP A;  1UW1 A;  1ULJ B;  2K0M A;  3Q90 A;  3LTA A;  2CFW A;  3G16 A;  1QJG A;  2QGU A;  1RJO A;  5JPP A;  1Q82 4;  3CC7 3;  4IT7 A;  1EA2 A;  2W04 A;  3FG4 A;  4EV2 A;  2O9U X;  1O7M B;  4LEH A;  3JVC A;  1NO3 A;  5IEN A;  4EBG A;  5A0O B;  1NB3 I;  2BO9 B;  3EE1 A;  5LC7 A;  1LNH A;  1UI8 A;  1QVG 2;  1TUH A;  3F9S A;  3PCR A;  3DUK A;  4EV5 A;  3GZB A;  1UI7 A;  2O3O A;  3DZL A;  4BTY A;  4KZ1 A;  1JJ2 2;  4RBN A;  1N5H A;  4WYK B;  1JKG B;  3MYT A;  1W5Z A;  5EEO A;  3CD6 3;  4H61 A;  1KQS 2;  2ML6 A;  4RZM A;  5AI1 A;  1KD1 4;  3A76 A;  3FZW A;  1NB5 I;  1O7N B;  2HML B;  1VQN 3;  3B8L A;  4FCZ A;  4MJD A;  4HM7 B;  5EVH A;  4AKZ A;  2STD A;  3MKI A;  3KZT A;  4XDW A;  4N6U A;  2QA4 3;  3ALA A;  3RGR A;  4CCV A;  3PS8 A;  2XSO B;  4XDV A;  4X2O A;  3F8H A;  3KN4 A;  5IG0 A;  2XFT A;  1E3R A;  3WA3 A;  2MF7 A;  2K54 A;  2WGO A;  3GZR A;  4BTX A;  3CCR 3;  3DGN A;  2FXT A;  3GAX A;  4JRF A;  3DMC A;  1ROV A;  1TU5 A;  2XR8 B;  4IPB A;  5HGR A;  2OOV A;  2I9W A;  3TDG A;  2E2U A;  2RFR A;  4JF8 A;  2RGQ A;  5CF1 A;  2YFI B;  2B24 B;  1VQ7 3;  2P0X A;  2OTJ 3;  2GXF A;  4LZI A;  2WO0 A;  2CW9 A;  1W6C A;  5D81 A;  3WOE B;  4L8O A;  3SXX A;  1TFK A;  2CK3 H;  5JPU A;  4RNY A;  1IQX A;  1O7W B;  2W2C A;  4FMA A;  3EF8 A;  4WWU C;  1W7C A;  2W9P A;  5AEW B;  4KFF A;  3OWS A;  4O2H A;  3G8Z A;  2W56 B;  3KSP A;  4WHA A;  1OGZ A;  2UX0 A;  2WOF A;  1US1 A;  2RCD A;  3S28 A;  1JB4 A;  2CFD A;  5AIG A;  2HMO B;  1ZO2 A;  3FLJ A;  1D6U A;  3Q2P A;  1YIJ 3;  2Y74 A;  3LT8 A;  4J9A A;  1OF5 A;  2C11 A;  1OHS A;  2XFS A;  2OQE A;  3V99 A;  1CEW I;  4KFE A;  4OK0 A;  1Q81 4;  3CME 3;  1ULI B;  2GEY A;  2YX9 A;  3AMO A;  4HJL B;  2W03 A;  1EG9 B;  4G1M B;  2ZL8 A;  5LC6 A;  3S67 A;  3U1W A;  4HVN A;  4L8P A;  4NRE A;  2CG0 A;  3VSY A;  3WMD A;  2CG1 A;  1IVX A;  4FR9 A;  3IPT A;  5CK6 A;  1DYU A;  3CC4 3;  1LOX A;  3S5C A;  3D9R A;  1IVV A;  3NBJ A;  1SQW A;  8CHO A;  4N6T A;  3BLZ A;  3WOD G;  1LXE A;  2A15 A;  1OUN A;  5CXO A;  4X2H A;  2PNC A;  3EC9 A;  1Q40 A;  4FCJ A;  4H3U A;  4NHF A;  1KSI A;  3UNL A;  1S5A A;  2V1L A;  1A67 A;  3EHC A;  3K9M C;  4J8T A;  2GBX B;  3K5T A;  1KC8 4;  1NU3 A;  5CF2 A;  1W02 A;  3HIG A;  1W01 A;  3OXA A;  4HM0 B;  3HZP A;  2C10 A;  3QRD A;  4HYZ A;  1KWI A;  3UB1 A;  1A2K A;  3HK4 A;  2CC3 A;  1W2Z A;  1K28 A;  4XBX A;  6STD A;  1J2B A;  1TP6 A;  3EBY A;  3FG3 A;  1O7H B;  1GYB A;  1YIT 3;  3WOF B;  3LT9 A;  4XBT A;  4FMB A;  3MG3 A;  2Y73 A;  5D83 A;  1N9E A;  1PU4 A;  5AYR B;  3WA2 X;  1JKG A;  3G0K A;  2R4I A;  5STD A;  1IT8 A;  4KFD A;  1W6G A;  1O7G B;  1G96 A;  1K73 4;  4XB5 A;  1WMP A;  4K1U A;  3EX9 A;  1GD4 A;  1RRH A;  3F7S A;  1YHQ 3;  1TIJ A;  4R80 A;  5EQL A;  4HM4 B;  3HX8 A;  1JB2 A;  1V74 A;  3JUP A;  4O3V A;  3V98 A;  4R4K A;  3MG1 A;  3N8B A;  5KP1 A;  3NV0 B;  5BVB A;  1OH0 A;  1R4C A;  2ZDJ A;  1QMA A;  3FKA A;  3LYG A;  3NBB A;  3X40 A;  1IQ8 A;  4AEQ A;  5IW9 A;  3IMA B;  3KKG A;  4EYC A;  5IG5 A;  2JDI H;  3CC2 3;  1JRQ A;  3NM2 A;  2GU1 A;  1N8R 4;  1WQL B;  3BB9 A;  2M7O A;  3LXU X;  1DMM A;  3B7C A;  3LH4 A;  1SIH A;  1VQL 3;  3LTB A;  1DVC A;  3PXM A;  2ML5 A;  2OQE C;  1IDP A;  5IG4 A;  3JUM A;  3N54 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...