4H61A

Structure of the schizosaccharomyces pombe mediator subunit med6
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
137
structure length
137
Chain Sequence
HMDLTSIQWRMPEWVQSMGGLRTENVLEYFSQSPFYSHKSNNEMLKMQSQFNALDLGDLNSQLKRLTGIQFVIIHERPPFLWVIQKQNRLNENEVKPLTVYFVCNENIYMAPNAYTLLATRMLNATYCFQKALTKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Mediator of RNA polymerase II transcription subunit 6
publication title Structure of the Mediator head module.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 39
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04934 Med6 MED6 mediator sub complex component
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.580 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4h61A00
4H61A
chains in the Genus database with same CATH superfamily
3DY5A 4HOHA 2FGTA 3UL5A 3CCJ3 3M8CA 5JPUA 1E3VA 2YX9A 2XGLA 1JN5A 4N6MA 3DM8A 5GSPA 5IEOA 1ZO2A 1UUGB 1I3FA 3NXJA 2WGOA 2GU1A 4MJDA 1QMAA 3CC43 2RFRA 1VQP3 3GAXA 1NB5I 4O8SA 1IVXA 1GOYA 2Z7AA 3D5IA 3OWYA 1TUHA 1GY6A 4BIRA 2BO9B 1BRNL 1UCLA 3UL6A 3JUMA 3BU4A 2CWVA 1IU7A 2QA43 2CC3A 2CK3H 4LMIA 4HM8B 4IPBA 2W03A 5IF6A 5KP1A 4CDLA 2BMOB 2CFGA 1LXEA 2XFSA 1DETA 3AHSA 1GS3A 1GY7A 1STDA 2BMQB 3KN4A 3N54B 1TP6A 2HMOB 4LZIA 4WYKB 4FCMA 2F99A 3U97A 1Q824 1MOLA 2K3DA 3OWSA 1O7GB 5M19A 1BNRA 3KSPA 2FNQA 1JB2A 1VQO3 1GMRA 4K1UA 4BTYA 3OW22 4NREA 4R4KA 1AVKA 4HZ9B 3EBYA 3S28A 1BRSA 1F8NA 5KP4A 3EN8A 4HBRA 5EEOA 1G96A 3EE1A 1BRIA 1R4CA 4BL2A 1TIJA 1BNFA 2H0HA 3DMCA 2ZL8A 3LTAA 5ELUA 1KSIA 3NBJA 3TDGA 3B7CA 3QK9A 2BHMA 1RNBA 1EEJA 1SQWA 4JRFA 1UCIA 1VQ53 4KFDA 3DGLA 1O7HB 3EBTA 1LVNA 1B2UA 1OGZA 2CX0A 1BVIA 7RNTA 3EF8A 1W6GA 3X3YA 5IG4A 2IY2A 1DMQA 2HMLB 1HU9A 1MWTA 1YGEA 3STDA 5AEUB 2CG1A 4IIAA 1N9JA 1UI7A 1YGWA 2BMRB 3HI7A 4HJLB 1KWIA 3NBBA 3GZXB 1WMOA 3LTDA 4HM5B 2RCDA 3CPOA 4MMYB 5AIHA 4BTWA 1OH0A 2D42A 1I3IA 3KIIA 5D81A 4EW5A 1MWUA 2D1WA 1RJOA 2RGQA 2YFLB 4FCZA 4FR9A 1LNIA 2F4YA 1DMNA 1JKGB 1UW1A 2CKFB 1TU5A 3CXC2 1TTOA 1VQK3 1RGGA 2Q07A 3PCRA 4RNTA 3AGOA 1BSDA 3CD63 3DUKA 3FZWA 3I563 1BSAA 1S5AA 1MNLA 3S29A 2P0XA 4J5GA 2AADA 2Y74A 3LXUX 3VSYA 5AIGA 3G6E3 4CPKA 3LMLA 2Z6BA 2HOHA 1WMPA 2P0MA 2UGIA 3ALAA 1BRJA 1LOWA 2XEPA 3MSOA 4WYKA 1YI23 3K7CA 3GRDA 2KAAA 4U13A 1VQL3 3SOYA 9RNTA 5BIRA 1GYBA 3HIGA 3KE7A 1L5GB 2XR8B 1YHQ3 2WOFA 2XFTA 1BNEA 1ULIB 1S723 2JQ5A 1W2ZA 3MG1A 2UX0A 1V74A 1AQZA 2I9WA 5EQLA 5TGNA 1QAKA 3FLJA 3HK4A 2E2UA 1LRAA 5G1LA 1I2FA 1BNSA 1BRKA 5IG0A 3X41A 1AV4A 5HGRA 4AEQA 2K0MA 3PCSA 1QAFA 3URPA 3LT8A 4WWUC 2RBIA 1VQ43 1O7NB 3B4OA 4HM3B 4R9KA 1JNQA 1T5YA 4J9AA 1FUTA 1OHOA 3CME3 4ILFA 3F40A 4N3VA 2RNTA 1UUVB 3IPTA 1IQXA 2KF5A 3AHWA 4XB5A 1YJ93 2W6JH 1OUNA 3LTCA 4O2HA 2Z77A 3KZTA 2E2VA 3PS8A 4I5QA 2BU4A 1D6UA 1ZGXA 3FF0A 1A2PA 4GHOA 1OF5B 4EBGA 1SJWA 3SEDA 3B4PA 3DGMA 2ZDJA 4H61A 1TFKA 2OWPA 3SVAA 5AIFA 1MWRA 1W00A 2Z76A 1PY3A 3WDGB 4CJNA 1NO3A 1I0XA 3MPHA 4K61A 3NV0B 1JKGA 4GL6A 3CCM3 5STDA 1I0VA 1EG9B 3CC23 4XDVA 4EV5A 2J8XB 2P38A 3B8LA 3JUQA 1PFPA 3SOAA 7STDA 1N5HA 3PXMA 3G713 1VQM3 1OHPA 1RGLA 3LZAA 1JJ22 3MG3A 1HKXA 1N8QA 3I0YA 1Q814 2IYJA 2A15A 1B2MA 4I4KA 2QIYA 4STDA 5A0OB 3WOFB 4EV2A 1KC84 1RMSA 3K0ZA 2ZHXB 3MG2A 5EVHA 1CYUA 5M18A 2CFLA 1NU3A 2M7OA 1V58A 2P09A 3F9SA 3LOYA 1RGCA 2CH9A 3NHXA 3UJMA 3S67A 2HMNB 3U1WA 1LQMB 2PZVA 1DVDA 1RRHA 1R4YA 1EUIC 2IA7A 2OCTA 2GEYA 3ER7A 1JBRA 2BNGA 3KKGA 2CWUA 1YJW3 2KCDA 3PZWA 1SIIA 4EC6A 1FA3A 1RLSA 4XBXA 3J7Yd 1NWWA 3FG3A 3V99A 3WR2A 1RN7A 1ZS7A 1ZX2A 2LYXA 4FMBA 4HM0B 3ZFZA 5LC6A 5CF2A 5HOHA 2OOVC 1US1A 3JUNA 3DXOA 4XM4A 3G4S3 4HYZA 2ML6A 3S27A 2OQEC 3I553 1Q7HA 2HMMB 3MHEA 2KF4A 1CQSA 1GOUA 3VF1A 2WGQA 1HZ1A 3ECFA 3WODG 1OGXA 3A76A 1C7HA 2BT3A 4K90B 1A2KA 3PYJA 1M1K4 5BU4A 2OTL3 1BSBA 1IVVA 3EJVA 1RCLA 3ROBA 2O3OA 2HMKB 3HIIA 1CH0A 5I97A 1BU4A 1RN1A 2CG0A 2CW9A 2R4IA 2STDA 5AIIA 2W9QA 1RGAA 1OF5A 4R1KA 1PYLA 1EKMA 4FMCA 1X1YA 4LEHA 2RSXA 5IEPA 1K28A 4TX4A 1ULJB 2KF6A 2FXTA 4H3UA 4N6UA 5AYRB 1FUSA 3NV0A 1UI8A 1W6CA 3RGAA 3SYUA 4KT3B 1N9EA 1BSCA 5AI1A 1JV2B 1EQKA 1MGRA 1T2IA 1E3RA 3BNBA 1Q7Y4 3SXXA 1NDOB 1I2EA 2CFWA 2INXA 5LC7A 1RSNA 4O3VA 1WQLB 2QEX3 3GZBA 1B2SA 1K9M4 1T3BA 1YJN3 4RZMA 4XBTA 1B27A 1M9GA 1JZOA 1RKYA 3FGYA 3T8NA 3ZG5A 5G1KA 1OPYA 3Q2PA 3SLUA 1IVWA 1GMPA 2GU3A 1IV9A 1W4NA 2JDIH 3EN1B 4LYLB 1B2XA 1NNVA 3DGOA 3OX9A 1JZDA 4OK0A 1BGSA 1UUWB 2F86B 3K9MC 1DVCA 1QALA 1FUWA 1TRPA 3LT9A 5CLKA 3DZLA 1E97A 2OOVA 3HX8A 3BB9A 2AAEA 3FG1A 4R80A 1X1UA 3G8ZA 2OQEA 1YIT3 1IQYA 1AR0A 2F5MA 4KFFA 3F8XA 3FKAA 2Y73A 1WTHA 3O8YA 4ZM8A 8RNTA 3E99A 3G0KA 4FMAA 1MGWA 1AY7A 1G02A 2GSPA 3NQYA 1ROVA 4MEIA 1U8CB 1N8R4 1YVBI 3EQQB 1BANA 1K8A4 3CCU3 4J5KA 1LOYA 1Q40B 2XF3A 3MYTA 1RTUA 3EC9A 2YFJB 2BIRA 2H0GA 3F7SA 1FGOA 3D3LA 3FSDA 1TFOA 1UGHI 2ML5A 2PNCA 1Q864 1IT8A 1BAOA 1NJI4 1JBSA 1A2VA 2CWTA 4G1MB 3UNLA 4JF8A 2SARA 4HM1B 4L8OA 1BNIA 2K54A 3BNDA 3UB1A 1EA2A 1B2ZA 1VQN3 5ELJA 4NPBA 2KRTA 3CNMA 4DKIA 1BRGA 1YVSA 1QVG2 1MWSA 3F14A 1FW7A 5G2GA 3CCE3 1A67A 1NB3I 1RDSA 3D9RA 5M1AA 3K63A 2B1XB 3BNCA 2GEXA 4RBNA 2MC8A 1J2BA 3V98A 5KP3A 1FGRA 1RN4A 2F5WA 3CCV3 1GMQA 1UCJA 5AYSC 1FYSA 4BTXA 4HVNA 2W56B 3HOHA 3NX0A 1A90A 4HAAA 1SPUA 3V92A 1VQ83 1RGKA 1LQGC 1YNVX 4BL3A 1RNTA 3Q3FA 4O02B 2HMJB 1C54A 2W2CA 3EB8A 2W04A 7GSPA 3CCR3 1BSEA 4EYCA 3DGYA 2V1LA 3D5GA 5RNTA 1M1XB 5CXOA 2C4BA 4EXRA 2XRXB 3CCQ3 1W7CA 3VGNA 1TRQA 2WO0A 1ISKA 1UDII 1IYYA 2CHCA 1PU4A 2XGNA 2W0QA 1BUQA 1OACA 2E2TA 3ZG0A 2CX1A 6RNTA 5DREA 5CF1A 1LOXA 3NBRA 2C10A 3FF2A 1Q40A 3LH4A 3WOEB 4MMXB 1GSPA 3BLZA 2XSHB 1I8VA 1BRHA 3EHCA 3JUPA 3S5CA 1LNHA 5IERA 1FZUA 3KCHA 3GWRA 4WFOA 1JBTA 4NHFA 4X2OA 1JRQA 1N5PA 3NM2A 2L1SA 3DGNA 1CYVA 2CFDA 1W5ZA 4R9LA 4OVMA 1GD4A 4AKZA 4XDWA 1IK3A 1I2GA 3FH1A 1IV7A 3IMAB 1K734 2UUGC 3GSPA 4K1VA 1FGQA 2F98A 1RHLA 3JVCA 4Q53A 3CCS3 3CMA3 1V57A 4N6NB 2SBLA 2W9PA 1U5OA 3F7XA 4GB5A 2XSOB 1JB4A 3K5TA 2LQVA 4N6TA 5DRVA 1RGHA 3RGRA 3QRDA 1WMNA 3RDEA 5JBSA 4WP5A 4FMDA 1VQ63 1IDPA 2W56A 1WNHA 3N9HA 1Q9EA 1OCVA 1JB5A 1FGTA 1BNJA 1GOVA 2P05A 3AMOB 3FG4A 4RNZA 4QWTA 4HM6B 3WMDA 2WOHA 3OWUA 1BIRA 1UCKA 3A5EA 4PEJA 1RRLA 1W6YA 1D6YA 3CU3A 1B21A 5AEWB 3CC73 1VQ73 3H51A 8CHOA 1W01A 1GY5A 2H0IA 3N8BA 3GZYB 1VQ93 4WHAA 2L4VA 1SARA 1QVF2 1LOVA 1BUJA 1BNGA 3L0RA 3KFQC 4KZ1A 4MMZB 5D82A 1UGIA 4HM2B 1FGMA 1T2HA 4FCJA 1VZZA 1JN5B 4KFEA 5BXQA 2R41A 3OV4A 3KSED 5IG3A 3WA2X 4AKYA 3NQZA 3CCL3 1AVLA 4LSOA 3G16A 3D79A 4N6OB 1Q42A 5D83A 1IT7A 1K41A 3IJEB 3LYGA 3RNTA 1O7MB 1DE3A 1IQ8A 6STDA 1Y4KA 1GD3A 1W02A 3T0UA 3MWZA 3EX9A 2CFKA 5IG5A 3FCSB 4XBYA 4HM4B 1ROAA 1VQQA 2B24B 1BOXA 2ZA4A 1O7WB 5FW5A 5JPPA 1HYFA 3BNEA 1X1WA 5CK6A 2IUKA 1I70A 1X1XA 4HKVB 5IW9A 2YFIB 1STFI 3H3HA 2C11A 3JUOA 3X3ZA 3CPW2 1DYUA 1RCKA 3Q1CA 4HZBB 1D6ZA 4X2HA 2GBXB 3WA3A 2MF7A 1YIJ3 4J8TA 4BU4A 3OXAA 3SX1A 2CIUA 2O9UX 3Q90A 3T8UA 3X42A 1SIHA 3X40A 6GSPA 3NM7A 3PGBA 2GBWB 1O7PB 3HZPA 4ORLA 2GXFA 4IT7A 1CEWI 4LGQA 3CNXA 4OUQA 2KF3A 2KXGA 1RGEA 1OHSA 3MKIA 1IVUA 3NUVA 4GSPA 4L7KA 3AMOA 2IMJA 1RGFA 1Z1SA 3BIRA 1B3SA 1M904 1ASKA 5BVBA 5FGOA 4HM7B 4KVHA 3LTBA 3F8HA 4L8PA 1TJDA 4N6LA 2IUJA 3WHOA 5IENA 3X3XA 3GZRA 4CCVA 2XH9A 2QGUA 4N6V0 4RNYA 1DMMA 1G0TA 1QJGA 1KD14 1W2B2 2F56A 1KQS2 1B20A 3AGNA 3D4AA 2OTJ3 3DH2A
chains in the Genus database with same CATH topology
3DY5A 3UL5A 2FGTA 3CCJ3 3M8CA 5JPUA 1E3VA 2YX9A 2XGLA 1JN5A 4N6MA 3DM8A 5IEOA 1ZO2A 3NXJA 2WGOA 2GU1A 4MJDA 1QMAA 3CC43 2RFRA 1VQP3 3GAXA 1NB5I 4O8SA 1IVXA 2Z7AA 3OWYA 1TUHA 1GY6A 2BO9B 3UL6A 3JUMA 2CWVA 1IU7A 2QA43 2CC3A 2CK3H 4LMIA 4HM8B 4IPBA 2W03A 5IF6A 5KP1A 4CDLA 2BMOB 2CFGA 1LXEA 2XFSA 1GS3A 1GY7A 1STDA 2BMQB 3KN4A 3N54B 1TP6A 2HMOB 4LZIA 4WYKB 4FCMA 2F99A 3U97A 1Q824 1MOLA 3OWSA 1O7GB 3KSPA 2FNQA 1JB2A 1VQO3 4K1UA 4BTYA 3OW22 4NREA 4R4KA 1AVKA 4HZ9B 3EBYA 3S28A 1F8NA 5KP4A 3EN8A 4HBRA 5EEOA 1G96A 3EE1A 1R4CA 1TIJA 3DMCA 2ZL8A 3LTAA 5ELUA 1KSIA 3NBJA 3TDGA 3B7CA 3QK9A 2BHMA 1SQWA 4JRFA 1VQ53 4KFDA 3DGLA 1O7HB 3EBTA 1LVNA 1OGZA 3EF8A 1W6GA 3X3YA 5IG4A 5AEUB 1DMQA 2HMLB 1HU9A 3STDA 1YGEA 2CG1A 4IIAA 1N9JA 1UI7A 2BMRB 3HI7A 4HJLB 1KWIA 3NBBA 3GZXB 1WMOA 3LTDA 4HM5B 2RCDA 3CPOA 4MMYB 5AIHA 4BTWA 1OH0A 2D42A 5D81A 3KIIA 2D1WA 1RJOA 2RGQA 2YFLB 4FCZA 4FR9A 1DMNA 1JKGB 1UW1A 2CKFB 1TU5A 3CXC2 1VQK3 2Q07A 3PCRA 3CD63 3DUKA 3FZWA 3I563 1S5AA 1MNLA 3S29A 2P0XA 3LXUX 2Y74A 3G6E3 3VSYA 5AIGA 3CCQ3 3LMLA 2Z6BA 3ALAA 1WMPA 2P0MA 3MSOA 4WYKA 2XEPA 5IG3A 1YI23 3K7CA 3GRDA 4U13A 1VQL3 3SOYA 1GYBA 3HIGA 3KE7A 1L5GB 2XR8B 1YHQ3 2WOFA 2XFTA 1ULIB 1S723 2JQ5A 1W2ZA 3MG1A 2UX0A 1V74A 5EQLA 2I9WA 5TGNA 1QAKA 3FLJA 3HK4A 2E2UA 5IG0A 3X41A 1AV4A 5HGRA 4AEQA 2K0MA 3PCSA 1QAFA 3LT8A 4WWUC 1VQ43 1O7NB 3B4OA 4HM3B 4R9KA 1JNQA 1T5YA 4J9AA 1OHOA 3CME3 3F40A 4N3VA 1UUVB 3IPTA 1IQXA 4XB5A 1YJ93 2W6JH 1OUNA 3LTCA 4O2HA 2Z77A 3KZTA 2E2VA 3PS8A 1D6UA 3FF0A 1OF5B 4EBGA 1SJWA 3SEDA 3B4PA 3DGMA 2ZDJA 4H61A 1TFKA 2OWPA 3SVAA 5AIFA 1W00A 2Z76A 3WDGB 1NO3A 4K61A 3MPHA 3NV0B 1JKGA 4GL6A 3CCM3 5STDA 1EG9B 3CC23 4XDVA 4EV5A 2P38A 3B8LA 3JUQA 1PFPA 3SOAA 7STDA 1N5HA 3PXMA 3G713 1VQM3 1OHPA 3LZAA 1JJ22 3MG3A 1HKXA 1N8QA 3I0YA 1Q814 2A15A 4I4KA 2QIYA 4STDA 5A0OB 3WOFB 4EV2A 1KC84 3K0ZA 3MG2A 5EVHA 1CYUA 2CFLA 1NU3A 2M7OA 2P09A 3F9SA 3LOYA 3NHXA 2CH9A 3UJMA 3S67A 2HMNB 3U1WA 2PZVA 1DVDA 1RRHA 2IA7A 2OCTA 2GEYA 3ER7A 2BNGA 3KKGA 2CWUA 1YJW3 2KCDA 3PZWA 1SIIA 4EC6A 1FA3A 3J7Yd 4XBXA 1NWWA 3FG3A 3V99A 1RN7A 5CF2A 1ZX2A 2LYXA 4FMBA 4HM0B 5LC6A 2OOVC 1US1A 3JUNA 3DXOA 4XM4A 3G4S3 4HYZA 2ML6A 3S27A 2OQEC 3I553 2HMMB 3MHEA 3VF1A 1CQSA 2WGQA 3ECFA 3WODG 1OGXA 3A76A 1C7HA 2BT3A 4K90B 1A2KA 3PYJA 1M1K4 2OTL3 1IVVA 3EJVA 3ROBA 2O3OA 2HMKB 3HIIA 5I97A 2CG0A 2CW9A 2R4IA 2STDA 5AIIA 2W9QA 1OF5A 4R1KA 1EKMA 4FMCA 4LEHA 2RSXA 5IEPA 1K28A 4TX4A 1ULJB 2FXTA 4H3UA 4N6UA 5AYRB 3NV0A 1UI8A 1W6CA 3RGAA 1N9EA 5AI1A 1JV2B 1EQKA 1E3RA 3BNBA 1Q7Y4 3SXXA 1NDOB 2CFWA 2INXA 5LC7A 4O3VA 2QEX3 1WQLB 3GZBA 1K9M4 1YJN3 4RZMA 4XBTA 1M9GA 1RKYA 3FGYA 3T8NA 1OPYA 3Q2PA 3SLUA 1IVWA 2GU3A 1IV9A 1W4NA 2JDIH 3EN1B 3DGOA 3OX9A 4OK0A 1UUWB 2F86B 3K9MC 1DVCA 1QALA 1FUWA 3LT9A 5CLKA 3DZLA 1E97A 2OOVA 3HX8A 3BB9A 4R80A 3FG1A 3G8ZA 2OQEA 1YIT3 1IQYA 1AR0A 4KFFA 3F8XA 3FKAA 2Y73A 1WTHA 3O8YA 4ZM8A 3E99A 3G0KA 4FMAA 3NQYA 1ROVA 4MEIA 1U8CB 1N8R4 1YVBI 3EQQB 1K8A4 3CCU3 1Q40B 2XF3A 3MYTA 3EC9A 2YFJB 3F7SA 1FGOA 3D3LA 3FSDA 1TFOA 2ML5A 2PNCA 1Q864 1NJI4 1IT8A 1A2VA 2CWTA 4G1MB 3UNLA 4JF8A 4HM1B 4L8OA 2K54A 3BNDA 3UB1A 1EA2A 1VQN3 5ELJA 2KRTA 3CNMA 1QVG2 3F14A 5G2GA 3CCE3 1A67A 1NB3I 3D9RA 3K63A 2B1XB 3BNCA 2GEXA 4RBNA 2MC8A 1J2BA 3V98A 5KP3A 1FGRA 3CCV3 5AYSC 4BTXA 4HVNA 2W56B 3NX0A 1A90A 1SPUA 3V92A 1VQ83 4O02B 2HMJB 2W2CA 3EB8A 2W04A 3CCR3 4EYCA 2V1LA 1M1XB 5CXOA 4EXRA 2XRXB 1W7CA 3VGNA 2WO0A 1ISKA 2CHCA 1PU4A 2XGNA 2W0QA 1BUQA 1OACA 2E2TA 5DREA 5CF1A 1LOXA 3NBRA 2C10A 3FF2A 1Q40A 3LH4A 3WOEB 4MMXB 3BLZA 2XSHB 3EHCA 3JUPA 5IERA 3S5CA 1LNHA 3GWRA 4WFOA 4NHFA 4X2OA 1JRQA 1N5PA 3NM2A 3DGNA 1CYVA 2CFDA 1W5ZA 4R9LA 4OVMA 1GD4A 4AKZA 4XDWA 1IK3A 3FH1A 1IV7A 3IMAB 1K734 4K1VA 1FGQA 2F98A 3JVCA 4Q53A 3CCS3 3CMA3 4N6NB 2SBLA 2W9PA 1U5OA 3F7XA 4GB5A 2XSOB 1JB4A 3K5TA 2LQVA 4N6TA 5DRVA 3RGRA 3QRDA 1WMNA 3RDEA 5JBSA 4WP5A 4FMDA 1VQ63 1IDPA 2W56A 1WNHA 3N9HA 1OCVA 1JB5A 1FGTA 2P05A 3AMOB 3FG4A 4RNZA 4QWTA 4HM6B 3WMDA 2WOHA 3OWUA 4PEJA 1RRLA 1W6YA 1D6YA 3CU3A 5AEWB 1VQ73 3CC73 3H51A 8CHOA 1W01A 1GY5A 3N8BA 1VQ93 3GZYB 4WHAA 2L4VA 1QVF2 3L0RA 3KFQC 4KZ1A 4MMZB 5D82A 4HM2B 1FGMA 4FCJA 1VZZA 1JN5B 4KFEA 5BXQA 3OV4A 3KSED 3WA2X 4AKYA 3NQZA 3CCL3 1AVLA 4LSOA 3G16A 4N6OB 1Q42A 5D83A 1IT7A 1K41A 3IJEB 3LYGA 1O7MB 1IQ8A 6STDA 1Y4KA 1GD3A 1W02A 3T0UA 3MWZA 3EX9A 2CFKA 5IG5A 3FCSB 4XBYA 4HM4B 1ROAA 2B24B 5JPPA 1O7WB 5FW5A 3BNEA 5CK6A 2IUKA 4HKVB 5IW9A 2YFIB 1STFI 3H3HA 2C11A 3JUOA 3X3ZA 3CPW2 1DYUA 3Q1CA 4HZBB 1D6ZA 4X2HA 2GBXB 3WA3A 2MF7A 1YIJ3 4J8TA 3OXAA 3SX1A 2CIUA 2O9UX 3Q90A 3T8UA 3X42A 1SIHA 3X40A 3NM7A 3PGBA 2GBWB 1O7PB 3HZPA 4ORLA 2GXFA 4IT7A 1CEWI 4LGQA 3CNXA 4OUQA 2KXGA 1OHSA 3MKIA 1IVUA 4L7KA 3AMOA 2IMJA 1M904 1Z1SA 1ASKA 5BVBA 5FGOA 4HM7B 4KVHA 3LTBA 3F8HA 4L8PA 4N6LA 2IUJA 5IENA 3X3XA 3GZRA 4CCVA 2XH9A 2QGUA 4N6V0 4RNYA 1DMMA 1QJGA 1KD14 1W2B2 1KQS2 2OTJ3 3NUVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H61 A; 
#chains in the Genus database with same CATH topology
 3DY5 A;  4HOH A;  2FGT A;  3UL5 A;  3CCJ 3;  3M8C A;  5JPU A;  1E3V A;  2YX9 A;  2XGL A;  1JN5 A;  4N6M A;  3DM8 A;  5GSP A;  5IEO A;  1ZO2 A;  1UUG B;  1I3F A;  3NXJ A;  2WGO A;  2GU1 A;  4MJD A;  1QMA A;  3CC4 3;  2RFR A;  1VQP 3;  3GAX A;  1NB5 I;  4O8S A;  1IVX A;  1GOY A;  2Z7A A;  3D5I A;  3OWY A;  1TUH A;  1GY6 A;  4BIR A;  2BO9 B;  1BRN L;  1UCL A;  3UL6 A;  3JUM A;  3BU4 A;  2CWV A;  1IU7 A;  2QA4 3;  2CC3 A;  2CK3 H;  4LMI A;  4HM8 B;  4IPB A;  2W03 A;  5IF6 A;  5KP1 A;  4CDL A;  2BMO B;  2CFG A;  1LXE A;  2XFS A;  1DET A;  3AHS A;  1GS3 A;  1GY7 A;  1STD A;  2BMQ B;  3KN4 A;  3N54 B;  1TP6 A;  2HMO B;  4LZI A;  4WYK B;  4FCM A;  2F99 A;  3U97 A;  1Q82 4;  1MOL A;  2K3D A;  3OWS A;  1O7G B;  5M19 A;  1BNR A;  3KSP A;  2FNQ A;  1JB2 A;  1VQO 3;  1GMR A;  4K1U A;  4BTY A;  3OW2 2;  4NRE A;  4R4K A;  1AVK A;  4HZ9 B;  3EBY A;  3S28 A;  1BRS A;  1F8N A;  5KP4 A;  3EN8 A;  4HBR A;  5EEO A;  1G96 A;  3EE1 A;  1BRI A;  1R4C A;  4BL2 A;  1TIJ A;  1BNF A;  2H0H A;  3DMC A;  2ZL8 A;  3LTA A;  5ELU A;  1KSI A;  3NBJ A;  3TDG A;  3B7C A;  3QK9 A;  2BHM A;  1RNB A;  1EEJ A;  1SQW A;  4JRF A;  1UCI A;  1VQ5 3;  4KFD A;  3DGL A;  1O7H B;  3EBT A;  1LVN A;  1B2U A;  1OGZ A;  2CX0 A;  1BVI A;  7RNT A;  3EF8 A;  1W6G A;  3X3Y A;  5IG4 A;  2IY2 A;  1DMQ A;  2HML B;  1HU9 A;  1MWT A;  1YGE A;  3STD A;  5AEU B;  2CG1 A;  4IIA A;  1N9J A;  1UI7 A;  1YGW A;  2BMR B;  3HI7 A;  4HJL B;  1KWI A;  3NBB A;  3GZX B;  1WMO A;  3LTD A;  4HM5 B;  2RCD A;  3CPO A;  4MMY B;  5AIH A;  4BTW A;  1OH0 A;  2D42 A;  1I3I A;  3KII A;  5D81 A;  4EW5 A;  1MWU A;  2D1W A;  1RJO A;  2RGQ A;  2YFL B;  4FCZ A;  4FR9 A;  1LNI A;  2F4Y A;  1DMN A;  1JKG B;  1UW1 A;  2CKF B;  1TU5 A;  3CXC 2;  1TTO A;  1VQK 3;  1RGG A;  2Q07 A;  3PCR A;  4RNT A;  3AGO A;  1BSD A;  3CD6 3;  3DUK A;  3FZW A;  3I56 3;  1BSA A;  1S5A A;  1MNL A;  3S29 A;  2P0X A;  4J5G A;  2AAD A;  2Y74 A;  3LXU X;  3VSY A;  5AIG A;  3G6E 3;  4CPK A;  3LML A;  2Z6B A;  2HOH A;  1WMP A;  2P0M A;  2UGI A;  3ALA A;  1BRJ A;  1LOW A;  2XEP A;  3MSO A;  4WYK A;  1YI2 3;  3K7C A;  3GRD A;  2KAA A;  4U13 A;  1VQL 3;  3SOY A;  9RNT A;  5BIR A;  1GYB A;  3HIG A;  3KE7 A;  1L5G B;  2XR8 B;  1YHQ 3;  2WOF A;  2XFT A;  1BNE A;  1ULI B;  1S72 3;  2JQ5 A;  1W2Z A;  3MG1 A;  2UX0 A;  1V74 A;  1AQZ A;  2I9W A;  5EQL A;  5TGN A;  1QAK A;  3FLJ A;  3HK4 A;  2E2U A;  1LRA A;  5G1L A;  1I2F A;  1BNS A;  1BRK A;  5IG0 A;  3X41 A;  1AV4 A;  5HGR A;  4AEQ A;  2K0M A;  3PCS A;  1QAF A;  3URP A;  3LT8 A;  4WWU C;  2RBI A;  1VQ4 3;  1O7N B;  3B4O A;  4HM3 B;  4R9K A;  1JNQ A;  1T5Y A;  4J9A A;  1FUT A;  1OHO A;  3CME 3;  4ILF A;  3F40 A;  4N3V A;  2RNT A;  1UUV B;  3IPT A;  1IQX A;  2KF5 A;  3AHW A;  4XB5 A;  1YJ9 3;  2W6J H;  1OUN A;  3LTC A;  4O2H A;  2Z77 A;  3KZT A;  2E2V A;  3PS8 A;  4I5Q A;  2BU4 A;  1D6U A;  1ZGX A;  3FF0 A;  1A2P A;  4GHO A;  1OF5 B;  4EBG A;  1SJW A;  3SED A;  3B4P A;  3DGM A;  2ZDJ A;  4H61 A;  1TFK A;  2OWP A;  3SVA A;  5AIF A;  1MWR A;  1W00 A;  2Z76 A;  1PY3 A;  3WDG B;  4CJN A;  1NO3 A;  1I0X A;  3MPH A;  4K61 A;  3NV0 B;  1JKG A;  4GL6 A;  3CCM 3;  5STD A;  1I0V A;  1EG9 B;  3CC2 3;  4XDV A;  4EV5 A;  2J8X B;  2P38 A;  3B8L A;  3JUQ A;  1PFP A;  3SOA A;  7STD A;  1N5H A;  3PXM A;  3G71 3;  1VQM 3;  1OHP A;  1RGL A;  3LZA A;  1JJ2 2;  3MG3 A;  1HKX A;  1N8Q A;  3I0Y A;  1Q81 4;  2IYJ A;  2A15 A;  1B2M A;  4I4K A;  2QIY A;  4STD A;  5A0O B;  3WOF B;  4EV2 A;  1KC8 4;  1RMS A;  3K0Z A;  2ZHX B;  3MG2 A;  5EVH A;  1CYU A;  5M18 A;  2CFL A;  1NU3 A;  2M7O A;  1V58 A;  2P09 A;  3F9S A;  3LOY A;  1RGC A;  2CH9 A;  3NHX A;  3UJM A;  3S67 A;  2HMN B;  3U1W A;  1LQM B;  2PZV A;  1DVD A;  1RRH A;  1R4Y A;  1EUI C;  2IA7 A;  2OCT A;  2GEY A;  3ER7 A;  1JBR A;  2BNG A;  3KKG A;  2CWU A;  1YJW 3;  2KCD A;  3PZW A;  1SII A;  4EC6 A;  1FA3 A;  1RLS A;  4XBX A;  3J7Y d;  1NWW A;  3FG3 A;  3V99 A;  3WR2 A;  1RN7 A;  1ZS7 A;  1ZX2 A;  2LYX A;  4FMB A;  4HM0 B;  3ZFZ A;  5LC6 A;  5CF2 A;  5HOH A;  2OOV C;  1US1 A;  3JUN A;  3DXO A;  4XM4 A;  3G4S 3;  4HYZ A;  2ML6 A;  3S27 A;  2OQE C;  3I55 3;  1Q7H A;  2HMM B;  3MHE A;  2KF4 A;  1CQS A;  1GOU A;  3VF1 A;  2WGQ A;  1HZ1 A;  3ECF A;  3WOD G;  1OGX A;  3A76 A;  1C7H A;  2BT3 A;  4K90 B;  1A2K A;  3PYJ A;  1M1K 4;  5BU4 A;  2OTL 3;  1BSB A;  1IVV A;  3EJV A;  1RCL A;  3ROB A;  2O3O A;  2HMK B;  3HII A;  1CH0 A;  5I97 A;  1BU4 A;  1RN1 A;  2CG0 A;  2CW9 A;  2R4I A;  2STD A;  5AII A;  2W9Q A;  1RGA A;  1OF5 A;  4R1K A;  1PYL A;  1EKM A;  4FMC A;  1X1Y A;  4LEH A;  2RSX A;  5IEP A;  1K28 A;  4TX4 A;  1ULJ B;  2KF6 A;  2FXT A;  4H3U A;  4N6U A;  5AYR B;  1FUS A;  3NV0 A;  1UI8 A;  1W6C A;  3RGA A;  3SYU A;  4KT3 B;  1N9E A;  1BSC A;  5AI1 A;  1JV2 B;  1EQK A;  1MGR A;  1T2I A;  1E3R A;  3BNB A;  1Q7Y 4;  3SXX A;  1NDO B;  1I2E A;  2CFW A;  2INX A;  5LC7 A;  1RSN A;  4O3V A;  1WQL B;  2QEX 3;  3GZB A;  1B2S A;  1K9M 4;  1T3B A;  1YJN 3;  4RZM A;  4XBT A;  1B27 A;  1M9G A;  1JZO A;  1RKY A;  3FGY A;  3T8N A;  3ZG5 A;  5G1K A;  1OPY A;  3Q2P A;  3SLU A;  1IVW A;  1GMP A;  2GU3 A;  1IV9 A;  1W4N A;  2JDI H;  3EN1 B;  4LYL B;  1B2X A;  1NNV A;  3DGO A;  3OX9 A;  1JZD A;  4OK0 A;  1BGS A;  1UUW B;  2F86 B;  3K9M C;  1DVC A;  1QAL A;  1FUW A;  1TRP A;  3LT9 A;  5CLK A;  3DZL A;  1E97 A;  2OOV A;  3HX8 A;  3BB9 A;  2AAE A;  3FG1 A;  4R80 A;  1X1U A;  3G8Z A;  2OQE A;  1YIT 3;  1IQY A;  1AR0 A;  2F5M A;  4KFF A;  3F8X A;  3FKA A;  2Y73 A;  1WTH A;  3O8Y A;  4ZM8 A;  8RNT A;  3E99 A;  3G0K A;  4FMA A;  1MGW A;  1AY7 A;  1G02 A;  2GSP A;  3NQY A;  1ROV A;  4MEI A;  1U8C B;  1N8R 4;  1YVB I;  3EQQ B;  1BAN A;  1K8A 4;  3CCU 3;  4J5K A;  1LOY A;  1Q40 B;  2XF3 A;  3MYT A;  1RTU A;  3EC9 A;  2YFJ B;  2BIR A;  2H0G A;  3F7S A;  1FGO A;  3D3L A;  3FSD A;  1TFO A;  1UGH I;  2ML5 A;  2PNC A;  1Q86 4;  1IT8 A;  1BAO A;  1NJI 4;  1JBS A;  1A2V A;  2CWT A;  4G1M B;  3UNL A;  4JF8 A;  2SAR A;  4HM1 B;  4L8O A;  1BNI A;  2K54 A;  3BND A;  3UB1 A;  1EA2 A;  1B2Z A;  1VQN 3;  5ELJ A;  4NPB A;  2KRT A;  3CNM A;  4DKI A;  1BRG A;  1YVS A;  1QVG 2;  1MWS A;  3F14 A;  1FW7 A;  5G2G A;  3CCE 3;  1A67 A;  1NB3 I;  1RDS A;  3D9R A;  5M1A A;  3K63 A;  2B1X B;  3BNC A;  2GEX A;  4RBN A;  2MC8 A;  1J2B A;  3V98 A;  5KP3 A;  1FGR A;  1RN4 A;  2F5W A;  3CCV 3;  1GMQ A;  1UCJ A;  5AYS C;  1FYS A;  4BTX A;  4HVN A;  2W56 B;  3HOH A;  3NX0 A;  1A90 A;  4HAA A;  1SPU A;  3V92 A;  1VQ8 3;  1RGK A;  1LQG C;  1YNV X;  4BL3 A;  1RNT A;  3Q3F A;  4O02 B;  2HMJ B;  1C54 A;  2W2C A;  3EB8 A;  2W04 A;  7GSP A;  3CCR 3;  1BSE A;  4EYC A;  3DGY A;  2V1L A;  3D5G A;  5RNT A;  1M1X B;  5CXO A;  2C4B A;  4EXR A;  2XRX B;  3CCQ 3;  1W7C A;  3VGN A;  1TRQ A;  2WO0 A;  1ISK A;  1UDI I;  1IYY A;  2CHC A;  1PU4 A;  2XGN A;  2W0Q A;  1BUQ A;  1OAC A;  2E2T A;  3ZG0 A;  2CX1 A;  6RNT A;  5DRE A;  5CF1 A;  1LOX A;  3NBR A;  2C10 A;  3FF2 A;  1Q40 A;  3LH4 A;  3WOE B;  4MMX B;  1GSP A;  3BLZ A;  2XSH B;  1I8V A;  1BRH A;  3EHC A;  3JUP A;  3S5C A;  1LNH A;  5IER A;  1FZU A;  3KCH A;  3GWR A;  4WFO A;  1JBT A;  4NHF A;  4X2O A;  1JRQ A;  1N5P A;  3NM2 A;  2L1S A;  3DGN A;  1CYV A;  2CFD A;  1W5Z A;  4R9L A;  4OVM A;  1GD4 A;  4AKZ A;  4XDW A;  1IK3 A;  1I2G A;  3FH1 A;  1IV7 A;  3IMA B;  1K73 4;  2UUG C;  3GSP A;  4K1V A;  1FGQ A;  2F98 A;  1RHL A;  3JVC A;  4Q53 A;  3CCS 3;  3CMA 3;  1V57 A;  4N6N B;  2SBL A;  2W9P A;  1U5O A;  3F7X A;  4GB5 A;  2XSO B;  1JB4 A;  3K5T A;  2LQV A;  4N6T A;  5DRV A;  1RGH A;  3RGR A;  3QRD A;  1WMN A;  3RDE A;  5JBS A;  4WP5 A;  4FMD A;  1VQ6 3;  1IDP A;  2W56 A;  1WNH A;  3N9H A;  1Q9E A;  1OCV A;  1JB5 A;  1FGT A;  1BNJ A;  1GOV A;  2P05 A;  3AMO B;  3FG4 A;  4RNZ A;  4QWT A;  4HM6 B;  3WMD A;  2WOH A;  3OWU A;  1BIR A;  1UCK A;  3A5E A;  4PEJ A;  1RRL A;  1W6Y A;  1D6Y A;  3CU3 A;  1B21 A;  5AEW B;  3CC7 3;  1VQ7 3;  3H51 A;  8CHO A;  1W01 A;  1GY5 A;  2H0I A;  3N8B A;  3GZY B;  1VQ9 3;  4WHA A;  2L4V A;  1SAR A;  1QVF 2;  1LOV A;  1BUJ A;  1BNG A;  3L0R A;  3KFQ C;  4KZ1 A;  4MMZ B;  5D82 A;  1UGI A;  4HM2 B;  1FGM A;  1T2H A;  4FCJ A;  1VZZ A;  1JN5 B;  4KFE A;  5BXQ A;  2R41 A;  3OV4 A;  3KSE D;  5IG3 A;  3WA2 X;  4AKY A;  3NQZ A;  3CCL 3;  1AVL A;  4LSO A;  3G16 A;  3D79 A;  4N6O B;  1Q42 A;  5D83 A;  1IT7 A;  1K41 A;  3IJE B;  3LYG A;  3RNT A;  1O7M B;  1DE3 A;  1IQ8 A;  6STD A;  1Y4K A;  1GD3 A;  1W02 A;  3T0U A;  3MWZ A;  3EX9 A;  2CFK A;  5IG5 A;  3FCS B;  4XBY A;  4HM4 B;  1ROA A;  1VQQ A;  2B24 B;  1BOX A;  2ZA4 A;  1O7W B;  5FW5 A;  5JPP A;  1HYF A;  3BNE A;  1X1W A;  5CK6 A;  2IUK A;  1I70 A;  1X1X A;  4HKV B;  5IW9 A;  2YFI B;  1STF I;  3H3H A;  2C11 A;  3JUO A;  3X3Z A;  3CPW 2;  1DYU A;  1RCK A;  3Q1C A;  4HZB B;  1D6Z A;  4X2H A;  2GBX B;  3WA3 A;  2MF7 A;  1YIJ 3;  4J8T A;  4BU4 A;  3OXA A;  3SX1 A;  2CIU A;  2O9U X;  3Q90 A;  3T8U A;  3X42 A;  1SIH A;  3X40 A;  6GSP A;  3NM7 A;  3PGB A;  2GBW B;  1O7P B;  3HZP A;  4ORL A;  2GXF A;  4IT7 A;  1CEW I;  4LGQ A;  3CNX A;  4OUQ A;  2KF3 A;  2KXG A;  1RGE A;  1OHS A;  3MKI A;  1IVU A;  3NUV A;  4GSP A;  4L7K A;  3AMO A;  2IMJ A;  1RGF A;  1Z1S A;  3BIR A;  1B3S A;  1M90 4;  1ASK A;  5BVB A;  5FGO A;  4HM7 B;  4KVH A;  3LTB A;  3F8H A;  4L8P A;  1TJD A;  4N6L A;  2IUJ A;  3WHO A;  5IEN A;  3X3X A;  3GZR A;  4CCV A;  2XH9 A;  2QGU A;  4N6V 0;  4RNY A;  1DMM A;  1G0T A;  1QJG A;  1KD1 4;  1W2B 2;  2F56 A;  1KQS 2;  1B20 A;  3AGN A;  3D4A A;  2OTJ 3;  3DH2 A; 
#chains in the Genus database with same CATH homology
 3DY5 A;  3UL5 A;  2FGT A;  3CCJ 3;  3M8C A;  5JPU A;  1E3V A;  2YX9 A;  2XGL A;  1JN5 A;  4N6M A;  3DM8 A;  5IEO A;  1ZO2 A;  3NXJ A;  2WGO A;  2GU1 A;  4MJD A;  1QMA A;  3CC4 3;  2RFR A;  1VQP 3;  3GAX A;  1NB5 I;  4O8S A;  1IVX A;  2Z7A A;  3OWY A;  1TUH A;  1GY6 A;  2BO9 B;  3UL6 A;  3JUM A;  2CWV A;  1IU7 A;  2QA4 3;  2CC3 A;  2CK3 H;  4LMI A;  4HM8 B;  4IPB A;  2W03 A;  5IF6 A;  5KP1 A;  4CDL A;  2BMO B;  2CFG A;  1LXE A;  2XFS A;  1GS3 A;  1GY7 A;  1STD A;  2BMQ B;  3KN4 A;  3N54 B;  1TP6 A;  2HMO B;  4LZI A;  4WYK B;  4FCM A;  2F99 A;  3U97 A;  1Q82 4;  1MOL A;  3OWS A;  1O7G B;  3KSP A;  2FNQ A;  1JB2 A;  1VQO 3;  4K1U A;  4BTY A;  3OW2 2;  4NRE A;  4R4K A;  1AVK A;  4HZ9 B;  3EBY A;  3S28 A;  1F8N A;  5KP4 A;  3EN8 A;  4HBR A;  5EEO A;  1G96 A;  3EE1 A;  1R4C A;  1TIJ A;  3DMC A;  2ZL8 A;  3LTA A;  5ELU A;  1KSI A;  3NBJ A;  3TDG A;  3B7C A;  3QK9 A;  2BHM A;  1SQW A;  4JRF A;  1VQ5 3;  4KFD A;  3DGL A;  1O7H B;  3EBT A;  1LVN A;  1OGZ A;  3EF8 A;  1W6G A;  3X3Y A;  5IG4 A;  5AEU B;  1DMQ A;  2HML B;  1HU9 A;  3STD A;  1YGE A;  2CG1 A;  4IIA A;  1N9J A;  1UI7 A;  2BMR B;  3HI7 A;  4HJL B;  1KWI A;  3NBB A;  3GZX B;  1WMO A;  3LTD A;  4HM5 B;  2RCD A;  3CPO A;  4MMY B;  5AIH A;  4BTW A;  1OH0 A;  2D42 A;  5D81 A;  3KII A;  2D1W A;  1RJO A;  2RGQ A;  2YFL B;  4FCZ A;  4FR9 A;  1DMN A;  1JKG B;  1UW1 A;  2CKF B;  1TU5 A;  3CXC 2;  1VQK 3;  2Q07 A;  3PCR A;  3CD6 3;  3DUK A;  3FZW A;  3I56 3;  1S5A A;  1MNL A;  3S29 A;  2P0X A;  3LXU X;  2Y74 A;  3G6E 3;  3VSY A;  5AIG A;  3CCQ 3;  3LML A;  2Z6B A;  3ALA A;  1WMP A;  2P0M A;  3MSO A;  4WYK A;  2XEP A;  5IG3 A;  1YI2 3;  3K7C A;  3GRD A;  4U13 A;  1VQL 3;  3SOY A;  1GYB A;  3HIG A;  3KE7 A;  1L5G B;  2XR8 B;  1YHQ 3;  2WOF A;  2XFT A;  1ULI B;  1S72 3;  2JQ5 A;  1W2Z A;  3MG1 A;  2UX0 A;  1V74 A;  5EQL A;  2I9W A;  5TGN A;  1QAK A;  3FLJ A;  3HK4 A;  2E2U A;  5IG0 A;  3X41 A;  1AV4 A;  5HGR A;  4AEQ A;  2K0M A;  3PCS A;  1QAF A;  3LT8 A;  4WWU C;  1VQ4 3;  1O7N B;  3B4O A;  4HM3 B;  4R9K A;  1JNQ A;  1T5Y A;  4J9A A;  1OHO A;  3CME 3;  3F40 A;  4N3V A;  1UUV B;  3IPT A;  1IQX A;  4XB5 A;  1YJ9 3;  2W6J H;  1OUN A;  3LTC A;  4O2H A;  2Z77 A;  3KZT A;  2E2V A;  3PS8 A;  1D6U A;  3FF0 A;  1OF5 B;  4EBG A;  1SJW A;  3SED A;  3B4P A;  3DGM A;  2ZDJ A;  4H61 A;  1TFK A;  2OWP A;  3SVA A;  5AIF A;  1W00 A;  2Z76 A;  3WDG B;  1NO3 A;  4K61 A;  3MPH A;  3NV0 B;  1JKG A;  4GL6 A;  3CCM 3;  5STD A;  1EG9 B;  3CC2 3;  4XDV A;  4EV5 A;  2P38 A;  3B8L A;  3JUQ A;  1PFP A;  3SOA A;  7STD A;  1N5H A;  3PXM A;  3G71 3;  1VQM 3;  1OHP A;  3LZA A;  1JJ2 2;  3MG3 A;  1HKX A;  1N8Q A;  3I0Y A;  1Q81 4;  2A15 A;  4I4K A;  2QIY A;  4STD A;  5A0O B;  3WOF B;  4EV2 A;  1KC8 4;  3K0Z A;  3MG2 A;  5EVH A;  1CYU A;  2CFL A;  1NU3 A;  2M7O A;  2P09 A;  3F9S A;  3LOY A;  3NHX A;  2CH9 A;  3UJM A;  3S67 A;  2HMN B;  3U1W A;  2PZV A;  1DVD A;  1RRH A;  2IA7 A;  2OCT A;  2GEY A;  3ER7 A;  2BNG A;  3KKG A;  2CWU A;  1YJW 3;  2KCD A;  3PZW A;  1SII A;  4EC6 A;  1FA3 A;  3J7Y d;  4XBX A;  1NWW A;  3FG3 A;  3V99 A;  1RN7 A;  5CF2 A;  1ZX2 A;  2LYX A;  4FMB A;  4HM0 B;  5LC6 A;  2OOV C;  1US1 A;  3JUN A;  3DXO A;  4XM4 A;  3G4S 3;  4HYZ A;  2ML6 A;  3S27 A;  2OQE C;  3I55 3;  2HMM B;  3MHE A;  3VF1 A;  1CQS A;  2WGQ A;  3ECF A;  3WOD G;  1OGX A;  3A76 A;  1C7H A;  2BT3 A;  4K90 B;  1A2K A;  3PYJ A;  1M1K 4;  2OTL 3;  1IVV A;  3EJV A;  3ROB A;  2O3O A;  2HMK B;  3HII A;  5I97 A;  2CG0 A;  2CW9 A;  2R4I A;  2STD A;  5AII A;  2W9Q A;  1OF5 A;  4R1K A;  1EKM A;  4FMC A;  4LEH A;  2RSX A;  5IEP A;  1K28 A;  4TX4 A;  1ULJ B;  2FXT A;  4H3U A;  4N6U A;  5AYR B;  3NV0 A;  1UI8 A;  1W6C A;  3RGA A;  1N9E A;  5AI1 A;  1JV2 B;  1EQK A;  1E3R A;  3BNB A;  1Q7Y 4;  3SXX A;  1NDO B;  2CFW A;  2INX A;  5LC7 A;  4O3V A;  2QEX 3;  1WQL B;  3GZB A;  1K9M 4;  1YJN 3;  4RZM A;  4XBT A;  1M9G A;  1RKY A;  3FGY A;  3T8N A;  1OPY A;  3Q2P A;  3SLU A;  1IVW A;  2GU3 A;  1IV9 A;  1W4N A;  2JDI H;  3EN1 B;  3DGO A;  3OX9 A;  4OK0 A;  1UUW B;  2F86 B;  3K9M C;  1DVC A;  1QAL A;  1FUW A;  3LT9 A;  5CLK A;  3DZL A;  1E97 A;  2OOV A;  3HX8 A;  3BB9 A;  4R80 A;  3FG1 A;  3G8Z A;  2OQE A;  1YIT 3;  1IQY A;  1AR0 A;  4KFF A;  3F8X A;  3FKA A;  2Y73 A;  1WTH A;  3O8Y A;  4ZM8 A;  3E99 A;  3G0K A;  4FMA A;  3NQY A;  1ROV A;  4MEI A;  1U8C B;  1N8R 4;  1YVB I;  3EQQ B;  1K8A 4;  3CCU 3;  1Q40 B;  2XF3 A;  3MYT A;  3EC9 A;  2YFJ B;  3F7S A;  1FGO A;  3D3L A;  3FSD A;  1TFO A;  2ML5 A;  2PNC A;  1Q86 4;  1NJI 4;  1IT8 A;  1A2V A;  2CWT A;  4G1M B;  3UNL A;  4JF8 A;  4HM1 B;  4L8O A;  2K54 A;  3BND A;  3UB1 A;  1EA2 A;  1VQN 3;  5ELJ A;  2KRT A;  3CNM A;  1QVG 2;  3F14 A;  5G2G A;  3CCE 3;  1A67 A;  1NB3 I;  3D9R A;  3K63 A;  2B1X B;  3BNC A;  2GEX A;  4RBN A;  2MC8 A;  1J2B A;  3V98 A;  5KP3 A;  1FGR A;  3CCV 3;  5AYS C;  4BTX A;  4HVN A;  2W56 B;  3NX0 A;  1A90 A;  1SPU A;  3V92 A;  1VQ8 3;  4O02 B;  2HMJ B;  2W2C A;  3EB8 A;  2W04 A;  3CCR 3;  4EYC A;  2V1L A;  1M1X B;  5CXO A;  4EXR A;  2XRX B;  1W7C A;  3VGN A;  2WO0 A;  1ISK A;  2CHC A;  1PU4 A;  2XGN A;  2W0Q A;  1BUQ A;  1OAC A;  2E2T A;  5DRE A;  5CF1 A;  1LOX A;  3NBR A;  2C10 A;  3FF2 A;  1Q40 A;  3LH4 A;  3WOE B;  4MMX B;  3BLZ A;  2XSH B;  3EHC A;  3JUP A;  5IER A;  3S5C A;  1LNH A;  3GWR A;  4WFO A;  4NHF A;  4X2O A;  1JRQ A;  1N5P A;  3NM2 A;  3DGN A;  1CYV A;  2CFD A;  1W5Z A;  4R9L A;  4OVM A;  1GD4 A;  4AKZ A;  4XDW A;  1IK3 A;  3FH1 A;  1IV7 A;  3IMA B;  1K73 4;  4K1V A;  1FGQ A;  2F98 A;  3JVC A;  4Q53 A;  3CCS 3;  3CMA 3;  4N6N B;  2SBL A;  2W9P A;  1U5O A;  3F7X A;  4GB5 A;  2XSO B;  1JB4 A;  3K5T A;  2LQV A;  4N6T A;  5DRV A;  3RGR A;  3QRD A;  1WMN A;  3RDE A;  5JBS A;  4WP5 A;  4FMD A;  1VQ6 3;  1IDP A;  2W56 A;  1WNH A;  3N9H A;  1OCV A;  1JB5 A;  1FGT A;  2P05 A;  3AMO B;  3FG4 A;  4RNZ A;  4QWT A;  4HM6 B;  3WMD A;  2WOH A;  3OWU A;  4PEJ A;  1RRL A;  1W6Y A;  1D6Y A;  3CU3 A;  5AEW B;  1VQ7 3;  3CC7 3;  3H51 A;  8CHO A;  1W01 A;  1GY5 A;  3N8B A;  1VQ9 3;  3GZY B;  4WHA A;  2L4V A;  1QVF 2;  3L0R A;  3KFQ C;  4KZ1 A;  4MMZ B;  5D82 A;  4HM2 B;  1FGM A;  4FCJ A;  1VZZ A;  1JN5 B;  4KFE A;  5BXQ A;  3OV4 A;  3KSE D;  3WA2 X;  4AKY A;  3NQZ A;  3CCL 3;  1AVL A;  4LSO A;  3G16 A;  4N6O B;  1Q42 A;  5D83 A;  1IT7 A;  1K41 A;  3IJE B;  3LYG A;  1O7M B;  1IQ8 A;  6STD A;  1Y4K A;  1GD3 A;  1W02 A;  3T0U A;  3MWZ A;  3EX9 A;  2CFK A;  5IG5 A;  3FCS B;  4XBY A;  4HM4 B;  1ROA A;  2B24 B;  5JPP A;  1O7W B;  5FW5 A;  3BNE A;  5CK6 A;  2IUK A;  4HKV B;  5IW9 A;  2YFI B;  1STF I;  3H3H A;  2C11 A;  3JUO A;  3X3Z A;  3CPW 2;  1DYU A;  3Q1C A;  4HZB B;  1D6Z A;  4X2H A;  2GBX B;  3WA3 A;  2MF7 A;  1YIJ 3;  4J8T A;  3OXA A;  3SX1 A;  2CIU A;  2O9U X;  3Q90 A;  3T8U A;  3X42 A;  1SIH A;  3X40 A;  3NM7 A;  3PGB A;  2GBW B;  1O7P B;  3HZP A;  4ORL A;  2GXF A;  4IT7 A;  1CEW I;  4LGQ A;  3CNX A;  4OUQ A;  2KXG A;  1OHS A;  3MKI A;  1IVU A;  4L7K A;  3AMO A;  2IMJ A;  1M90 4;  1Z1S A;  1ASK A;  5BVB A;  5FGO A;  4HM7 B;  4KVH A;  3LTB A;  3F8H A;  4L8P A;  4N6L A;  2IUJ A;  5IEN A;  3X3X A;  3GZR A;  4CCV A;  2XH9 A;  2QGU A;  4N6V 0;  4RNY A;  1DMM A;  1QJG A;  1KD1 4;  1W2B 2;  1KQS 2;  2OTJ 3;  3NUV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...