3LYGA

Crystal structure of ntf2-like protein of unknown function (yp_270605.1) from colwellia psychrerythraea 34h at 1.61 a resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
120
structure length
120
Chain Sequence
GMNLANIVQRGWEALGAGDFDTLVTDYVEKMIFIMPGQADVLKGRQAFRSALDNLGEILPPGFEITGLRQLEGENEIVSIVEWKSDKMIASQLSVLFKFEGDQIYEERWFVDTEQWKSVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords NTF2-like protein of unknown function
publication title Crystal structure of NTF2-like protein of unknown function (YP_270605.1) from Colwellia psychrerythraea 34H at 1.61 A resolution
rcsb
source organism Colwellia psychrerythraea
total genus 35
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2010-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3lygA00
3RGAA 1NDOB 7STDA 3K7CA 5AEUB 4H3UA 2XSOB 3MHEA 3EN1B 3S5CA 2UX0A 5IEOA 5CF2A 2F86B 6STDA 3F14A 3FF2A 2IMJA 4HVNA 1W00A 5EVHA 1GS3A 2CKFB 1AR0A 4WYKA 1IDPA 4OUQA 3MKIA 4HM8B 3ECFA 2JQ5A 4WYKB 2R4IA 1GY5A 1HKXA 3G8ZA 3FKAA 3NV0A 4HZ9B 3GWRA 3NUVA 5AIFA 3GZXB 3MG1A 4XBYA 4Q53A 3M8CA 4L8OA 2QIYA 1S5AA 3MG3A 1O7MB 4HZBB 2HMJB 1JKGA 4K1UA 4L7KA 3LZAA 3CNXA 4HJLB 1QJGA 2BMRB 2RFRA 3F8XA 3GRDA 3VGNA 1JKGB 3SOAA 2GXFA 3F7XA 2B1XB 2XRXB 1OHPA 3D9RA 1TP6A 4LGQA 3OWSA 2A15A 2HMKB 2HMNB 1W6YA 4J9AA 3HZPA 2F99A 3G0KA 4MJDA 1Q42A 3OWUA 1ULJB 3IPTA 3CNMA 1O7GB 1CQSA 3EC9A 4HM1B 4XDVA 2GBWB 3H51A 3B4OA 1OF5B 3OWYA 1GYBA 3LYGA 4KVHA 3NXJA 5CF1A 3NHXA 2BMQB 1JN5B 3F40A 4N3VA 3EBTA 4HKVB 4L8PA 2B24B 5D81A 3I0YA 1O7HB 5IG5A 5CXOA 3KE7A 4WWUC 3FF0A 2BNGA 3FH1A 1GY7A 5IERA 3JUNA 4HM2B 2GBXB 4ORLA 1C7HA 2RGQA 4PEJA 3MG2A 1E97A 3FSDA 4J8TA 5IEPA 1OCVA 3EHCA 4GB5A 3VSYA 3EX9A 2BMOB 2HMOB 4FCMA 5IG0A 2GEXA 1EA2A 3E99A 1WQLB 4R9LA 3EJVA 4WP5A 3FZWA 1OGXA 4RZMA 5HGRA 2F98A 2W2CA 3KSPA 1GY6A 3BLZA 4XM4A 1VZZA 1OGZA 2YFLB 3GZBA 2HMLB 4R1KA 1OHSA 3JUQA 5D83A 1ULIB 5IG4A 1K41A 3EQQB 4XBTA 3K0ZA 3NM2A 2CHCA 1UUVB 2YFIB 1OF5A 4IIAA 1NWWA 1O7PB 3BB9A 3F7SA 3STDA 5G2GA 4X2OA 3KZTA 3EF8A 4HM3B 1STDA 5BVBA 1OHOA 1OH0A 1JN5A 1QMAA 3MSOA 3OXAA 4XDWA 4U13A 2Z76A 8CHOA 2YFJB 3EN8A 3Q90A 5JPUA 1W01A 3JUPA 2STDA 3CPOA 4OVMA 3UJMA 1E3RA 1Q40A 5AIGA 5KP3A 3HX8A 5AIIA 4STDA 5STDA 3RGRA 2XR8B 5D82A 4CDLA 1Q40B 5BXQA 4LMIA 2Z7AA 3EBYA 3DZLA 4XBXA 3B8LA 1DMQA 1EG9B 3CU3A 1W02A 2RCDA 3GZYB 4HM7B 1A2KA 3OV4A 3DUKA 3B4PA 2HMMB 1BUQA 3T8UA 5DRVA 4FCJA 4HM5B 3F8HA 3H3HA 4I4KA 5FW5A 1O7NB 3DM8A 3G16A 3A76A 3NV0B 3WMDA 2Z77A 3F9SA 1OPYA 2I9WA 3ROBA 4K1VA 1JB2A 2QGUA 3MYTA 1O7WB 2GEYA 5KP1A 5TGNA 4LEHA 5AEWB 5IENA 1DMMA 4HM4B 1DMNA 1SJWA 5IF6A 2OWPA 3SOYA 5CLKA 3T8NA 1E3VA 1ISKA 4XB5A 1UUWB 3DMCA 5AI1A 2XSHB 3FLJA 1ASKA 2K54A 3FGYA 1ZO2A 5AIHA 1ZX2A 1OUNA 1TUHA 3JUOA 5DREA 5IG3A 4HM0B 1JB4A 5CK6A 3HK4A 2PZVA 1JB5A 4HM6B 3ER7A 1U5OA 2INXA 3DXOA 5JPPA 5KP4A 3OX9A 3GZRA 4X2HA 3NBRA 3SEDA 3JUMA 3KKGA 4R9KA 1Z1SA 1NU3A 3B7CA 3UNLA
chains in the Genus database with same CATH superfamily
3RGAA 1NDOB 1PYLA 3LXUX 3KIIA 7STDA 2XH9A 1IV7A 4GSPA 3K7CA 2IY2A 3RNTA 3CCJ3 2XFTA 4LZIA 3AMOB 5AEUB 4H3UA 2XSOB 3MHEA 3EN1B 3ZG5A 3S5CA 1FZUA 2UX0A 5IEOA 3WODG 2F86B 1DETA 2C10A 3BNDA 5CF2A 6STDA 3D5IA 3F14A 4NPBA 3FF2A 2IMJA 1BNSA 4HVNA 1W00A 2E2UA 1CEWI 1C54A 1LQGC 4RNYA 1W5ZA 2CFLA 5EVHA 1GS3A 2CKFB 1AR0A 4HOHA 4WYKA 1IDPA 1UGIA 4OUQA 3D3LA 2ZA4A 1BNRA 4RNZA 1YNVX 3AHSA 3D4AA 3CC43 1WNHA 4BTWA 3MKIA 4N6MA 3CCR3 1A67A 3CXC2 4HM8B 5GSPA 3CME3 2BIRA 1LOYA 3ECFA 2JQ5A 1IU7A 3LTBA 2CFGA 4EW5A 3DGOA 4TX4A 4WYKB 2R4IA 1GY5A 1HKXA 4EBGA 3G8ZA 1IK3A 1Q824 4FMAA 3DGMA 3FKAA 2L4VA 3NV0A 1IT8A 1IVUA 4HZ9B 1BSDA 1I3IA 2W9PA 3GWRA 3NUVA 3GZXB 1UI8A 5AIFA 5AYRB 3Q1CA 3MG1A 4FCZA 1BOXA 1GMPA 4O8SA 4Q53A 4XBYA 3T0UA 2KF6A 3M8CA 3CCQ3 3OW22 1JBSA 1MWSA 4L8OA 2QIYA 3U97A 4DKIA 1S5AA 3WA3A 4I5QA 1EQKA 4GL6A 3MG3A 1O7MB 1N8R4 4HZBB 2WGOA 1AVKA 2LQVA 2HMJB 1RN1A 7GSPA 1JKGA 2HOHA 4K1UA 2K3DA 4MEIA 5FGOA 1TFOA 2H0IA 1FGMA 4WHAA 4JF8A 4L7KA 1JBTA 3LZAA 3CNXA 4HJLB 1YVSA 1N9EA 3BIRA 1OACA 1RGAA 1B2XA 1QJGA 1UCIA 2BMRB 2P09A 2OQEC 5EQLA 3CCU3 2RFRA 3F8XA 3GRDA 1V58A 3VGNA 4HYZA 1JKGB 1Q7Y4 3SOAA 5M1AA 1UDII 1FUSA 1FGOA 2GXFA 2IUJA 2KF4A 1A2PA 3F7XA 1EEJA 3PYJA 2QEX3 1X1XA 2B1XB 1RRHA 1ROVA 3A5EA 2XRXB 5HOHA 1UCKA 4N6OB 1W2B2 2AADA 5I97A 1RSNA 1RN4A 2ML6A 1STFI 4BL2A 3G4S3 3I553 1OHPA 3WOFB 1KWIA 4ZM8A 1SQWA 2W56B 2XGLA 3D79A 3IJEB 3D9RA 1AV4A 4RNTA 3AHWA 5BU4A 1B2ZA 1TP6A 3NM7A 4LGQA 1D6YA 2D42A 3OWSA 1AY7A 2A15A 2HMKB 4GHOA 2HMNB 1W6YA 1BIRA 2IUKA 1HZ1A 2KF3A 3HZPA 4J9AA 3CC73 3CCM3 1VQK3 1D6UA 1FYSA 2F99A 3NQZA 1B2SA 4KZ1A 3G0KA 3HOHA 4MJDA 1B2MA 1Q42A 1AVLA 3OWUA 5EEOA 3QK9A 1IT7A 2Y73A 2W0QA 1G02A 1ULJB 3IPTA 3CNMA 1O7GB 4HBRA 1IQ8A 1JRQA 1CQSA 2XF3A 3EC9A 3IMAB 1F8NA 1CYUA 4HM1B 4XDVA 5AYSC 4WFOA 3TDGA 2GBWB 2KF5A 3H51A 1I0XA 2CK3H 1OF5B 1LQMB 1V57A 3B4OA 4BIRA 2W9QA 1D6ZA 1B2UA 3OWYA 7RNTA 2KXGA 1GYBA 1RMSA 2F5WA 1BU4A 1NO3A 4BTXA 3AMOA 3X3ZA 2L1SA 4CCVA 3SYUA 1K28A 2O3OA 1R4YA 1GOUA 3X41A 1W4NA 1LXEA 1QVF2 3LYGA 1TFKA 1Q7HA 4KVHA 4IT7A 4AKYA 3G713 3NXJA 2CWVA 1M1XB 1VQP3 1BGSA 2WOHA 1BNIA 3NHXA 5CF1A 2BMQB 2OOVC 1TTOA 1G96A 1CYVA 3GAXA 1JN5B 2IA7A 1LOWA 2CFKA 2M7OA 1A2VA 2RBIA 3F40A 4N3VA 3EBTA 1N9JA 1RGLA 1YHQ3 1GD3A 4HKVB 1IQYA 2B24B 4L8PA 5D81A 2CFWA 3I0YA 2BHMA 2Y74A 1CH0A 1O7HB 1Q814 5IG5A 1SPUA 1X1WA 4MMZB 5CXOA 1VQQA 3KE7A 1JBRA 1ROAA 4WWUC 1M904 3LOYA 3FF0A 1BVIA 8RNTA 1NU3A 2O9UX 1RLSA 2BNGA 3FH1A 1RJOA 5LC7A 2CG0A 1GY7A 3X3XA 9RNTA 1TRQA 5IERA 3JUNA 4HM2B 2GBXB 4ORLA 1C7HA 2RGQA 4PEJA 3LTCA 3MG2A 1RNBA 1E97A 1K8A4 3FG4A 2ZHXB 3FSDA 1LNIA 4N6UA 1LOVA 1VQM3 4J8TA 3S67A 4N6NB 5IEPA 1UGHI 1J2BA 1OCVA 1R4CA 1BRJA 4NREA 1V74A 3FG1A 1LOXA 1RGGA 1SIIA 1RGHA 2CG1A 3JVCA 3EHCA 1GMRA 1BNGA 2CC3A 5M19A 1FGRA 4GB5A 3VSYA 4O3VA 3EX9A 1VQ43 4G1MB 2BMOB 1GOYA 3K9MC 5RNTA 2HMOB 1RDSA 4FCMA 3LTAA 1BSAA 1RGEA 2R41A 4N6LA 5IG0A 2GEXA 2MC8A 4ILFA 1EA2A 1T2IA 3E99A 1IVVA 1W2ZA 4O02B 1Y4KA 1BUJA 1WQLB 1FGQA 1UW1A 4R9LA 1X1UA 3EJVA 5IW9A 1LVNA 4WP5A 2ML5A 3FZWA 1U8CB 1VQ83 1GSPA 2WOFA 1OGXA 2W56A 4RZMA 3V99A 2BO9B 5HGRA 2F98A 3LH4A 1W6GA 2W2CA 1SARA 1QALA 3KSPA 1GY6A 3BLZA 1JJ22 1SIHA 1FGTA 2Q07A 1VZZA 4XM4A 1OGZA 4EV5A 1UCJA 2IYJA 2CH9A 4OK0A 5G1KA 3ZG0A 1VQ73 1KSIA 1N5PA 1BAOA 2YFLB 4N6V0 3KFQC 3GZBA 2HMLB 2P38A 4FMCA 4R1KA 1WMNA 2KCDA 1OHSA 3JUQA 5D83A 1BRKA 1ULIB 5IG4A 3O8YA 4KFFA 1K41A 3S28A 3EQQB 4XBTA 4AEQA 1T2HA 2FNQA 3K0ZA 3NM2A 4MMYB 1I2EA 2CHCA 4AKZA 3CCV3 1YJN3 1UUVB 2YFIB 1I70A 1OF5A 2RNTA 4IIAA 1NWWA 1O7PB 3S29A 1IYYA 1T3BA 6RNTA 1B21A 2Z6BA 1WMOA 3BB9A 4FMBA 4R4KA 1BANA 1I0VA 2GU1A 2P05A 1PFPA 1N5HA 2CIUA 3F7SA 3Q3FA 2OQEA 3UL6A 3STDA 1A90A 1MWRA 4BU4A 1L5GB 4H61A 5G2GA 1YI23 4X2OA 3URPA 4FMDA 1FA3A 3KZTA 2H0GA 1BRHA 1US1A 3EF8A 1ZGXA 1I2GA 4HM3B 1STDA 1BNJA 5BVBA 2BU4A 3WHOA 1Q9EA 3CMA3 2V1LA 4BL3A 2LYXA 1TU5A 1OHOA 2ZL8A 1OH0A 1JN5A 1QMAA 1UCLA 3PCRA 2ZDJA 3MSOA 1BNFA 3OXAA 4XDWA 3HI7A 4U13A 2Z76A 3BNEA 1X1YA 2P0XA 2CFDA 1YIJ3 8CHOA 2YFJB 3UB1A 3EN8A 3HIGA 1LNHA 1RTUA 3KSED 1Q864 3Q90A 2UGIA 1ZS7A 4CPKA 5JPUA 1W01A 3X42A 2OCTA 1RN7A 3JUPA 3S27A 3NX0A 2STDA 2W6JH 1BNEA 3CPOA 3LMLA 2E2TA 4CJNA 4IPBA 1KD14 1VQ93 3WA2X 2KRTA 1MOLA 3GSPA 4OVMA 3UJMA 1QVG2 1BRIA 1VQL3 2GU3A 1E3RA 2OTJ3 1Q40A 1DE3A 3DY5A 5AIGA 3V98A 5KP3A 1FUWA 2UUGC 1MWUA 3HX8A 2F5MA 1JV2B 3PXMA 1PU4A 3CCE3 1MWTA 2C11A 3MPHA 5AIIA 1JZDA 4STDA 5STDA 3SLUA 3RGRA 5JBSA 1YJW3 1FW7A 2XR8B 5D82A 1IQXA 4CDLA 1Q40B 3X40A 3ALAA 3WOEB 5BXQA 2E2VA 1T5YA 3VF1A 5ELUA 1RNTA 4LMIA 4EC6A 3I563 3CPW2 1WMPA 2Z7AA 2YX9A 3DZLA 1IV9A 3EBYA 4XBXA 3B8LA 1RKYA 1IVXA 1DMQA 4RBNA 1N8QA 3WR2A 1EG9B 3DGLA 2CWTA 3CU3A 1VQO3 1NJI4 1W02A 1TRPA 2RCDA 2OOVA 3GZYB 3HIIA 4K61A 2BT3A 2FGTA 3SVAA 1GMQA 1NB3I 3EB8A 2WO0A 1DVDA 4HM7B 4J5KA 1EKMA 1A2KA 3NBJA 1W6CA 3BNCA 4MMXB 1RRLA 1BSCA 2AAEA 3OV4A 1VQ53 1YJ93 1GD4A 3DH2A 3DUKA 3B4PA 1K734 3Q2PA 5BIRA 2HMMB 3NBBA 1BUQA 3T8UA 1FUTA 3PGBA 5LC6A 3SXXA 5DRVA 1M1K4 4FCJA 4HM5B 3F8HA 3H3HA 3J7Yd 1PY3A 3LT9A 2MF7A 2CX1A 3ZFZA 4I4KA 1RGKA 5FW5A 1O7NB 1YGEA 3DM8A 3G16A 3A76A 2F4YA 3NV0B 3LTDA 3PCSA 3WMDA 2Z77A 1LRAA 3F9SA 1VQ63 1OPYA 3QRDA 4KFDA 4FR9A 2I9WA 1BRNL 1RCLA 3ROBA 1UI7A 3NQYA 4K1VA 1JZOA 2H0HA 1JB2A 1QAFA 2D1WA 2QGUA 3AGOA 3MYTA 1O7WB 2GEYA 4J5GA 5KP1A 1MGWA 2RSXA 4KFEA 5TGNA 1YIT3 3AGNA 3CCS3 1DVCA 1I3FA 3X3YA 2W04A 4LEHA 3CCL3 5AEWB 1UUGB 5IENA 1DMMA 4HM4B 2P0MA 5ELJA 3BU4A 3G6E3 1G0TA 2SARA 3D5GA 3V92A 3DGYA 1KQS2 3K5TA 2PNCA 2FXTA 1DMNA 1SJWA 2JDIH 2KAAA 5M18A 1EUIC 3KN4A 4KT3B 5IF6A 1BSEA 1HYFA 2OWPA 3U1WA 3SOYA 6GSPA 1JNQA 1BSBA 5CLKA 3N54B 3T8NA 3CC23 1B20A 3L0RA 1E3VA 2F56A 4HAAA 1TJDA 1K9M4 2OTL3 1YVBI 1ISKA 1B27A 1MNLA 2XGNA 4XB5A 1DYUA 3UL5A 4N6TA 1S723 1RHLA 2CX0A 1UUWB 4JRFA 3DMCA 5AI1A 2XSHB 1RGFA 3BNBA 3FLJA 3SX1A 4EXRA 4LSOA 1ASKA 2J8XB 2K54A 3K63A 3N9HA 1BRSA 2K0MA 3FGYA 1ZO2A 5AIHA 1ZX2A 1OUNA 1TUHA 3JUOA 4K90B 5DREA 5IG3A 3FG3A 4HM0B 3PS8A 1JB4A 1YGWA 2SBLA 5CK6A 3HK4A 2CW9A 3KCHA 2PZVA 3WDGB 4QWTA 3FCSB 1JB5A 4R80A 4HM6B 2GSPA 3N8BA 2CWUA 2XEPA 2QA43 1WTHA 1TIJA 5G1LA 2WGQA 3LT8A 3RDEA 3ER7A 3PZWA 1U5OA 5A0OB 2C4BA 2INXA 1AQZA 3DXOA 3EE1A 1VQN3 4LYLB 4EV2A 5JPPA 5KP4A 1NB5I 3OX9A 1W7CA 1HU9A 1NNVA 1B3SA 1QAKA 3GZRA 4O2HA 4X2HA 4BTYA 2XFSA 4NHFA 4EYCA 1MGRA 3CD63 3NBRA 1I8VA 1M9GA 1KC84 1RCKA 1I2FA 3SEDA 1RGCA 2W03A 3JUMA 3KKGA 1GOVA 3MWZA 1Z1SA 3DGNA 1IVWA 4R9KA 3B7CA 3UNLA 1BRGA
chains in the Genus database with same CATH topology
3RGAA 1NDOB 3LXUX 3KIIA 7STDA 2XH9A 1IV7A 3CCJ3 3K7CA 2XFTA 4LZIA 3AMOB 5AEUB 4H3UA 2XSOB 3MHEA 3EN1B 3S5CA 2UX0A 5IEOA 3WODG 5CF2A 2F86B 3BNDA 2C10A 6STDA 3F14A 3FF2A 2IMJA 4HVNA 1W00A 2E2UA 1CEWI 4RNYA 1W5ZA 2CFLA 5EVHA 1GS3A 2CKFB 1AR0A 4WYKA 1IDPA 4OUQA 3D3LA 4RNZA 3CC43 1WNHA 4BTWA 3MKIA 4N6MA 3CCR3 1A67A 3CXC2 4HM8B 3CME3 3ECFA 2JQ5A 1IU7A 3LTBA 2CFGA 3DGOA 4TX4A 4WYKB 2R4IA 1GY5A 1HKXA 4EBGA 3G8ZA 1IK3A 1Q824 4FMAA 3DGMA 3FKAA 2L4VA 3NV0A 1IT8A 1IVUA 4HZ9B 2W9PA 3GWRA 3NUVA 3GZXB 1UI8A 5AIFA 5AYRB 3Q1CA 3MG1A 4FCZA 4O8SA 4Q53A 4XBYA 3T0UA 3CCQ3 3M8CA 3OW22 4L8OA 2QIYA 3U97A 1S5AA 3WA3A 1EQKA 4GL6A 3MG3A 1O7MB 1N8R4 4HZBB 2WGOA 1AVKA 2LQVA 2HMJB 1JKGA 5FGOA 4K1UA 4MEIA 1TFOA 4WHAA 1FGMA 4JF8A 4L7KA 3LZAA 3CNXA 4HJLB 1N9EA 1W2B2 1OACA 2P09A 1QJGA 2OQEC 3CCU3 2BMRB 5EQLA 2RFRA 3F8XA 3GRDA 3VGNA 4HYZA 1JKGB 1Q7Y4 3SOAA 1FGOA 2GXFA 2IUJA 3F7XA 3PYJA 2QEX3 2B1XB 1RRHA 1ROVA 2XRXB 4N6OB 5I97A 2ML6A 1STFI 3G4S3 3I553 1OHPA 3WOFB 1KWIA 4ZM8A 1SQWA 2W56B 2XGLA 3IJEB 3D9RA 1AV4A 1TP6A 4LGQA 3NM7A 1D6YA 2D42A 3OWSA 2A15A 2HMKB 2HMNB 1W6YA 2IUKA 4J9AA 3CC73 3HZPA 3CCM3 1VQK3 1D6UA 2F99A 3NQZA 4KZ1A 3G0KA 4MJDA 1Q42A 1AVLA 3OWUA 5EEOA 3QK9A 1IT7A 2Y73A 2W0QA 1ULJB 3IPTA 3CNMA 1O7GB 4HBRA 1IQ8A 1JRQA 1CQSA 2XF3A 3EC9A 3IMAB 1F8NA 1CYUA 4HM1B 4XDVA 5AYSC 4WFOA 3TDGA 2GBWB 3H51A 2CK3H 3B4OA 1OF5B 2W9QA 1D6ZA 3OWYA 2KXGA 1GYBA 1NO3A 4BTXA 3AMOA 3X3ZA 4CCVA 1K28A 2O3OA 3X41A 1W4NA 1LXEA 1QVF2 3LYGA 1TFKA 4KVHA 4IT7A 4AKYA 3G713 3NXJA 2CWVA 1M1XB 1VQP3 2WOHA 3NHXA 5CF1A 2BMQB 2OOVC 1G96A 1CYVA 3GAXA 1JN5B 2IA7A 2CFKA 2M7OA 1A2VA 3F40A 4N3VA 3EBTA 1N9JA 1YHQ3 1GD3A 4HKVB 1IQYA 2B24B 4L8PA 5D81A 2CFWA 3I0YA 2BHMA 2Y74A 1O7HB 1Q814 5IG5A 1SPUA 4MMZB 5CXOA 3KE7A 1ROAA 4WWUC 1M904 3LOYA 3FF0A 1NU3A 2O9UX 2BNGA 3FH1A 1RJOA 5LC7A 2CG0A 1GY7A 3X3XA 5IERA 3JUNA 4HM2B 2GBXB 4ORLA 2RGQA 1C7HA 4PEJA 3LTCA 3MG2A 1E97A 1K8A4 3FG4A 3FSDA 4N6UA 1VQM3 4J8TA 3S67A 4N6NB 5IEPA 1J2BA 1OCVA 1R4CA 4NREA 1V74A 3FG1A 1LOXA 1SIIA 2CG1A 3JVCA 3EHCA 2CC3A 1FGRA 4GB5A 3VSYA 4O3VA 3EX9A 1VQ43 4G1MB 2BMOB 3K9MC 2HMOB 4FCMA 3LTAA 4N6LA 5IG0A 2GEXA 2MC8A 1EA2A 3E99A 1IVVA 1W2ZA 4O02B 1Y4KA 1WQLB 1FGQA 1UW1A 4R9LA 5IW9A 3EJVA 1LVNA 4WP5A 2ML5A 3FZWA 1U8CB 1VQ83 2WOFA 2W56A 1OGXA 4RZMA 3V99A 2BO9B 5HGRA 2F98A 3LH4A 1W6GA 2W2CA 1QALA 3KSPA 1GY6A 3BLZA 1JJ22 1SIHA 1FGTA 2Q07A 1VZZA 4XM4A 1OGZA 4EV5A 2CH9A 4OK0A 1VQ73 1KSIA 1N5PA 2YFLB 4N6V0 3KFQC 3GZBA 2HMLB 2P38A 4FMCA 4R1KA 1WMNA 2KCDA 1OHSA 3JUQA 5D83A 1ULIB 5IG4A 3O8YA 4KFFA 1K41A 3S28A 3EQQB 4XBTA 4AEQA 2FNQA 3K0ZA 3NM2A 4MMYB 2CHCA 4AKZA 3CCV3 1YJN3 1UUVB 2YFIB 3S29A 1OF5A 4IIAA 1NWWA 1O7PB 3BB9A 2Z6BA 1WMOA 4FMBA 4R4KA 2GU1A 2P05A 1PFPA 1N5HA 2CIUA 3F7SA 2OQEA 3UL6A 1A90A 3STDA 1L5GB 4H61A 5G2GA 1YI23 4X2OA 4FMDA 1FA3A 3KZTA 1US1A 3EF8A 4HM3B 1STDA 5BVBA 3CMA3 2V1LA 2LYXA 1TU5A 1OHOA 2ZL8A 1OH0A 1JN5A 1QMAA 3PCRA 2ZDJA 3MSOA 3OXAA 4XDWA 3HI7A 4U13A 2Z76A 3BNEA 1YIJ3 2P0XA 2CFDA 8CHOA 2YFJB 3UB1A 3EN8A 3HIGA 1LNHA 3KSED 1Q864 3Q90A 5JPUA 1W01A 3X42A 2OCTA 1RN7A 3JUPA 3S27A 3NX0A 2STDA 2W6JH 3CPOA 3LMLA 2E2TA 4IPBA 1KD14 1VQ93 3WA2X 2KRTA 1MOLA 4OVMA 1QVG2 3UJMA 1VQL3 2GU3A 1E3RA 2OTJ3 1Q40A 3DY5A 5AIGA 3V98A 5KP3A 1FUWA 3HX8A 1JV2B 3PXMA 1PU4A 3CCE3 2C11A 3MPHA 5AIIA 4STDA 5STDA 3SLUA 3RGRA 5JBSA 1YJW3 2XR8B 5D82A 1IQXA 4CDLA 1Q40B 3X40A 3ALAA 3WOEB 5BXQA 2E2VA 1T5YA 3VF1A 5ELUA 4LMIA 4EC6A 3I563 3CPW2 1WMPA 2Z7AA 2YX9A 3DZLA 1IV9A 3EBYA 4XBXA 3B8LA 1RKYA 1IVXA 1DMQA 4RBNA 1N8QA 1EG9B 3DGLA 2CWTA 3CU3A 1VQO3 1NJI4 1W02A 2RCDA 2OOVA 3GZYB 3HIIA 4K61A 2BT3A 2FGTA 3SVAA 1NB3I 3EB8A 2WO0A 1DVDA 4HM7B 1EKMA 1A2KA 3NBJA 1W6CA 3BNCA 4MMXB 1RRLA 1VQ53 3OV4A 1YJ93 1GD4A 3DUKA 3B4PA 1K734 3Q2PA 2HMMB 3NBBA 1BUQA 3T8UA 3PGBA 5LC6A 3SXXA 5DRVA 1M1K4 4FCJA 4HM5B 3F8HA 3H3HA 3J7Yd 3LT9A 2MF7A 4I4KA 5FW5A 1O7NB 1YGEA 3DM8A 3G16A 3A76A 3NV0B 3LTDA 3PCSA 3WMDA 2Z77A 3F9SA 1VQ63 1OPYA 3QRDA 4KFDA 4FR9A 2I9WA 3ROBA 1UI7A 3NQYA 4K1VA 1JB2A 1QAFA 2D1WA 2QGUA 3MYTA 1O7WB 2GEYA 5KP1A 2RSXA 4KFEA 1YIT3 5TGNA 3CCS3 1DVCA 3X3YA 2W04A 4LEHA 3CCL3 5AEWB 5IENA 1DMMA 4HM4B 2P0MA 5ELJA 3G6E3 1KQS2 3V92A 3K5TA 2PNCA 2FXTA 1DMNA 1SJWA 2JDIH 3KN4A 5IF6A 3U1WA 2OWPA 3SOYA 1JNQA 5CLKA 3N54B 3T8NA 3CC23 3L0RA 1E3VA 1K9M4 2OTL3 1YVBI 1ISKA 1MNLA 2XGNA 4XB5A 3UL5A 1DYUA 1S723 4N6TA 1UUWB 4JRFA 3DMCA 5AI1A 2XSHB 3BNBA 3FLJA 3SX1A 4EXRA 4LSOA 1ASKA 2K54A 3K63A 3N9HA 2K0MA 3FGYA 1ZO2A 5AIHA 1ZX2A 1OUNA 1TUHA 3JUOA 4K90B 5DREA 5IG3A 3FG3A 4HM0B 3PS8A 1JB4A 2SBLA 5CK6A 3HK4A 2CW9A 2PZVA 3WDGB 4QWTA 3FCSB 1JB5A 4R80A 4HM6B 3N8BA 2CWUA 2XEPA 2QA43 1WTHA 1TIJA 2WGQA 3LT8A 3RDEA 3ER7A 3PZWA 1U5OA 5A0OB 3EE1A 2INXA 3DXOA 1VQN3 5JPPA 4EV2A 5KP4A 1NB5I 3OX9A 1W7CA 1HU9A 1QAKA 3GZRA 4O2HA 4X2HA 4BTYA 2XFSA 4NHFA 4EYCA 3CD63 3NBRA 1M9GA 1KC84 3SEDA 2W03A 3JUMA 3KKGA 3MWZA 1Z1SA 3DGNA 1IVWA 4R9KA 3B7CA 3UNLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RGA A;  1NDO B;  7STD A;  3K7C A;  5AEU B;  4H3U A;  2XSO B;  3MHE A;  3EN1 B;  3S5C A;  2UX0 A;  5IEO A;  5CF2 A;  2F86 B;  6STD A;  3F14 A;  3FF2 A;  2IMJ A;  4HVN A;  1W00 A;  5EVH A;  1GS3 A;  2CKF B;  1AR0 A;  4WYK A;  1IDP A;  4OUQ A;  3MKI A;  4HM8 B;  3ECF A;  2JQ5 A;  4WYK B;  2R4I A;  1GY5 A;  1HKX A;  3G8Z A;  3FKA A;  3NV0 A;  4HZ9 B;  3GWR A;  3NUV A;  5AIF A;  3GZX B;  3MG1 A;  4XBY A;  4Q53 A;  3M8C A;  4L8O A;  2QIY A;  1S5A A;  3MG3 A;  1O7M B;  4HZB B;  2HMJ B;  1JKG A;  4K1U A;  4L7K A;  3LZA A;  3CNX A;  4HJL B;  1QJG A;  2BMR B;  2RFR A;  3F8X A;  3GRD A;  3VGN A;  1JKG B;  3SOA A;  2GXF A;  3F7X A;  2B1X B;  2XRX B;  1OHP A;  3D9R A;  1TP6 A;  4LGQ A;  3OWS A;  2A15 A;  2HMK B;  2HMN B;  1W6Y A;  4J9A A;  3HZP A;  2F99 A;  3G0K A;  4MJD A;  1Q42 A;  3OWU A;  1ULJ B;  3IPT A;  3CNM A;  1O7G B;  1CQS A;  3EC9 A;  4HM1 B;  4XDV A;  2GBW B;  3H51 A;  3B4O A;  1OF5 B;  3OWY A;  1GYB A;  3LYG A;  4KVH A;  3NXJ A;  5CF1 A;  3NHX A;  2BMQ B;  1JN5 B;  3F40 A;  4N3V A;  3EBT A;  4HKV B;  4L8P A;  2B24 B;  5D81 A;  3I0Y A;  1O7H B;  5IG5 A;  5CXO A;  3KE7 A;  4WWU C;  3FF0 A;  2BNG A;  3FH1 A;  1GY7 A;  5IER A;  3JUN A;  4HM2 B;  2GBX B;  4ORL A;  1C7H A;  2RGQ A;  4PEJ A;  3MG2 A;  1E97 A;  3FSD A;  4J8T A;  5IEP A;  1OCV A;  3EHC A;  4GB5 A;  3VSY A;  3EX9 A;  2BMO B;  2HMO B;  4FCM A;  5IG0 A;  2GEX A;  1EA2 A;  3E99 A;  1WQL B;  4R9L A;  3EJV A;  4WP5 A;  3FZW A;  1OGX A;  4RZM A;  5HGR A;  2F98 A;  2W2C A;  3KSP A;  1GY6 A;  3BLZ A;  4XM4 A;  1VZZ A;  1OGZ A;  2YFL B;  3GZB A;  2HML B;  4R1K A;  1OHS A;  3JUQ A;  5D83 A;  1ULI B;  5IG4 A;  1K41 A;  3EQQ B;  4XBT A;  3K0Z A;  3NM2 A;  2CHC A;  1UUV B;  2YFI B;  1OF5 A;  4IIA A;  1NWW A;  1O7P B;  3BB9 A;  3F7S A;  3STD A;  5G2G A;  4X2O A;  3KZT A;  3EF8 A;  4HM3 B;  1STD A;  5BVB A;  1OHO A;  1OH0 A;  1JN5 A;  1QMA A;  3MSO A;  3OXA A;  4XDW A;  4U13 A;  2Z76 A;  8CHO A;  2YFJ B;  3EN8 A;  3Q90 A;  5JPU A;  1W01 A;  3JUP A;  2STD A;  3CPO A;  4OVM A;  3UJM A;  1E3R A;  1Q40 A;  5AIG A;  5KP3 A;  3HX8 A;  5AII A;  4STD A;  5STD A;  3RGR A;  2XR8 B;  5D82 A;  4CDL A;  1Q40 B;  5BXQ A;  4LMI A;  2Z7A A;  3EBY A;  3DZL A;  4XBX A;  3B8L A;  1DMQ A;  1EG9 B;  3CU3 A;  1W02 A;  2RCD A;  3GZY B;  4HM7 B;  1A2K A;  3OV4 A;  3DUK A;  3B4P A;  2HMM B;  1BUQ A;  3T8U A;  5DRV A;  4FCJ A;  4HM5 B;  3F8H A;  3H3H A;  4I4K A;  5FW5 A;  1O7N B;  3DM8 A;  3G16 A;  3A76 A;  3NV0 B;  3WMD A;  2Z77 A;  3F9S A;  1OPY A;  2I9W A;  3ROB A;  4K1V A;  1JB2 A;  2QGU A;  3MYT A;  1O7W B;  2GEY A;  5KP1 A;  5TGN A;  4LEH A;  5AEW B;  5IEN A;  1DMM A;  4HM4 B;  1DMN A;  1SJW A;  5IF6 A;  2OWP A;  3SOY A;  5CLK A;  3T8N A;  1E3V A;  1ISK A;  4XB5 A;  1UUW B;  3DMC A;  5AI1 A;  2XSH B;  3FLJ A;  1ASK A;  2K54 A;  3FGY A;  1ZO2 A;  5AIH A;  1ZX2 A;  1OUN A;  1TUH A;  3JUO A;  5DRE A;  5IG3 A;  4HM0 B;  1JB4 A;  5CK6 A;  3HK4 A;  2PZV A;  1JB5 A;  4HM6 B;  3ER7 A;  1U5O A;  2INX A;  3DXO A;  5JPP A;  5KP4 A;  3OX9 A;  3GZR A;  4X2H A;  3NBR A;  3SED A;  3JUM A;  3KKG A;  4R9K A;  1Z1S A;  1NU3 A;  3B7C A;  3UNL A; 
#chains in the Genus database with same CATH topology
 3RGA A;  1NDO B;  1PYL A;  3LXU X;  3KII A;  7STD A;  2XH9 A;  1IV7 A;  4GSP A;  3K7C A;  2IY2 A;  3RNT A;  3CCJ 3;  2XFT A;  4LZI A;  3AMO B;  5AEU B;  4H3U A;  2XSO B;  3MHE A;  3EN1 B;  3ZG5 A;  3S5C A;  1FZU A;  2UX0 A;  5IEO A;  3WOD G;  2F86 B;  1DET A;  2C10 A;  3BND A;  5CF2 A;  6STD A;  3D5I A;  3F14 A;  4NPB A;  3FF2 A;  2IMJ A;  1BNS A;  4HVN A;  1W00 A;  2E2U A;  1CEW I;  1C54 A;  1LQG C;  4RNY A;  1W5Z A;  2CFL A;  5EVH A;  1GS3 A;  2CKF B;  1AR0 A;  4HOH A;  4WYK A;  1IDP A;  1UGI A;  4OUQ A;  3D3L A;  2ZA4 A;  1BNR A;  4RNZ A;  1YNV X;  3AHS A;  3D4A A;  3CC4 3;  1WNH A;  4BTW A;  3MKI A;  4N6M A;  3CCR 3;  1A67 A;  3CXC 2;  4HM8 B;  5GSP A;  3CME 3;  2BIR A;  1LOY A;  3ECF A;  2JQ5 A;  1IU7 A;  3LTB A;  2CFG A;  4EW5 A;  3DGO A;  4TX4 A;  4WYK B;  2R4I A;  1GY5 A;  1HKX A;  4EBG A;  3G8Z A;  1IK3 A;  1Q82 4;  4FMA A;  3DGM A;  3FKA A;  2L4V A;  3NV0 A;  1IT8 A;  1IVU A;  4HZ9 B;  1BSD A;  1I3I A;  2W9P A;  3GWR A;  3NUV A;  3GZX B;  1UI8 A;  5AIF A;  5AYR B;  3Q1C A;  3MG1 A;  4FCZ A;  1BOX A;  1GMP A;  4O8S A;  4Q53 A;  4XBY A;  3T0U A;  2KF6 A;  3M8C A;  3CCQ 3;  3OW2 2;  1JBS A;  1MWS A;  4L8O A;  2QIY A;  3U97 A;  4DKI A;  1S5A A;  3WA3 A;  4I5Q A;  1EQK A;  4GL6 A;  3MG3 A;  1O7M B;  1N8R 4;  4HZB B;  2WGO A;  1AVK A;  2LQV A;  2HMJ B;  1RN1 A;  7GSP A;  1JKG A;  2HOH A;  4K1U A;  2K3D A;  4MEI A;  5FGO A;  1TFO A;  2H0I A;  1FGM A;  4WHA A;  4JF8 A;  4L7K A;  1JBT A;  3LZA A;  3CNX A;  4HJL B;  1YVS A;  1N9E A;  3BIR A;  1OAC A;  1RGA A;  1B2X A;  1QJG A;  1UCI A;  2BMR B;  2P09 A;  2OQE C;  5EQL A;  3CCU 3;  2RFR A;  3F8X A;  3GRD A;  1V58 A;  3VGN A;  4HYZ A;  1JKG B;  1Q7Y 4;  3SOA A;  5M1A A;  1UDI I;  1FUS A;  1FGO A;  2GXF A;  2IUJ A;  2KF4 A;  1A2P A;  3F7X A;  1EEJ A;  3PYJ A;  2QEX 3;  1X1X A;  2B1X B;  1RRH A;  1ROV A;  3A5E A;  2XRX B;  5HOH A;  1UCK A;  4N6O B;  1W2B 2;  2AAD A;  5I97 A;  1RSN A;  1RN4 A;  2ML6 A;  1STF I;  4BL2 A;  3G4S 3;  3I55 3;  1OHP A;  3WOF B;  1KWI A;  4ZM8 A;  1SQW A;  2W56 B;  2XGL A;  3D79 A;  3IJE B;  3D9R A;  1AV4 A;  4RNT A;  3AHW A;  5BU4 A;  1B2Z A;  1TP6 A;  3NM7 A;  4LGQ A;  1D6Y A;  2D42 A;  3OWS A;  1AY7 A;  2A15 A;  2HMK B;  4GHO A;  2HMN B;  1W6Y A;  1BIR A;  2IUK A;  1HZ1 A;  2KF3 A;  3HZP A;  4J9A A;  3CC7 3;  3CCM 3;  1VQK 3;  1D6U A;  1FYS A;  2F99 A;  3NQZ A;  1B2S A;  4KZ1 A;  3G0K A;  3HOH A;  4MJD A;  1B2M A;  1Q42 A;  1AVL A;  3OWU A;  5EEO A;  3QK9 A;  1IT7 A;  2Y73 A;  2W0Q A;  1G02 A;  1ULJ B;  3IPT A;  3CNM A;  1O7G B;  4HBR A;  1IQ8 A;  1JRQ A;  1CQS A;  2XF3 A;  3EC9 A;  3IMA B;  1F8N A;  1CYU A;  4HM1 B;  4XDV A;  5AYS C;  4WFO A;  3TDG A;  2GBW B;  2KF5 A;  3H51 A;  1I0X A;  2CK3 H;  1OF5 B;  1LQM B;  1V57 A;  3B4O A;  4BIR A;  2W9Q A;  1D6Z A;  1B2U A;  3OWY A;  7RNT A;  2KXG A;  1GYB A;  1RMS A;  2F5W A;  1BU4 A;  1NO3 A;  4BTX A;  3AMO A;  3X3Z A;  2L1S A;  4CCV A;  3SYU A;  1K28 A;  2O3O A;  1R4Y A;  1GOU A;  3X41 A;  1W4N A;  1LXE A;  1QVF 2;  3LYG A;  1TFK A;  1Q7H A;  4KVH A;  4IT7 A;  4AKY A;  3G71 3;  3NXJ A;  2CWV A;  1M1X B;  1VQP 3;  1BGS A;  2WOH A;  1BNI A;  3NHX A;  5CF1 A;  2BMQ B;  2OOV C;  1TTO A;  1G96 A;  1CYV A;  3GAX A;  1JN5 B;  2IA7 A;  1LOW A;  2CFK A;  2M7O A;  1A2V A;  2RBI A;  3F40 A;  4N3V A;  3EBT A;  1N9J A;  1RGL A;  1YHQ 3;  1GD3 A;  4HKV B;  1IQY A;  2B24 B;  4L8P A;  5D81 A;  2CFW A;  3I0Y A;  2BHM A;  2Y74 A;  1CH0 A;  1O7H B;  1Q81 4;  5IG5 A;  1SPU A;  1X1W A;  4MMZ B;  5CXO A;  1VQQ A;  3KE7 A;  1JBR A;  1ROA A;  4WWU C;  1M90 4;  3LOY A;  3FF0 A;  1BVI A;  8RNT A;  1NU3 A;  2O9U X;  1RLS A;  2BNG A;  3FH1 A;  1RJO A;  5LC7 A;  2CG0 A;  1GY7 A;  3X3X A;  9RNT A;  1TRQ A;  5IER A;  3JUN A;  4HM2 B;  2GBX B;  4ORL A;  1C7H A;  2RGQ A;  4PEJ A;  3LTC A;  3MG2 A;  1RNB A;  1E97 A;  1K8A 4;  3FG4 A;  2ZHX B;  3FSD A;  1LNI A;  4N6U A;  1LOV A;  1VQM 3;  4J8T A;  3S67 A;  4N6N B;  5IEP A;  1UGH I;  1J2B A;  1OCV A;  1R4C A;  1BRJ A;  4NRE A;  1V74 A;  3FG1 A;  1LOX A;  1RGG A;  1SII A;  1RGH A;  2CG1 A;  3JVC A;  3EHC A;  1GMR A;  1BNG A;  2CC3 A;  5M19 A;  1FGR A;  4GB5 A;  3VSY A;  4O3V A;  3EX9 A;  1VQ4 3;  4G1M B;  2BMO B;  1GOY A;  3K9M C;  5RNT A;  2HMO B;  1RDS A;  4FCM A;  3LTA A;  1BSA A;  1RGE A;  2R41 A;  4N6L A;  5IG0 A;  2GEX A;  2MC8 A;  4ILF A;  1EA2 A;  1T2I A;  3E99 A;  1IVV A;  1W2Z A;  4O02 B;  1Y4K A;  1BUJ A;  1WQL B;  1FGQ A;  1UW1 A;  4R9L A;  1X1U A;  3EJV A;  5IW9 A;  1LVN A;  4WP5 A;  2ML5 A;  3FZW A;  1U8C B;  1VQ8 3;  1GSP A;  2WOF A;  1OGX A;  2W56 A;  4RZM A;  3V99 A;  2BO9 B;  5HGR A;  2F98 A;  3LH4 A;  1W6G A;  2W2C A;  1SAR A;  1QAL A;  3KSP A;  1GY6 A;  3BLZ A;  1JJ2 2;  1SIH A;  1FGT A;  2Q07 A;  1VZZ A;  4XM4 A;  1OGZ A;  4EV5 A;  1UCJ A;  2IYJ A;  2CH9 A;  4OK0 A;  5G1K A;  3ZG0 A;  1VQ7 3;  1KSI A;  1N5P A;  1BAO A;  2YFL B;  4N6V 0;  3KFQ C;  3GZB A;  2HML B;  2P38 A;  4FMC A;  4R1K A;  1WMN A;  2KCD A;  1OHS A;  3JUQ A;  5D83 A;  1BRK A;  1ULI B;  5IG4 A;  3O8Y A;  4KFF A;  1K41 A;  3S28 A;  3EQQ B;  4XBT A;  4AEQ A;  1T2H A;  2FNQ A;  3K0Z A;  3NM2 A;  4MMY B;  1I2E A;  2CHC A;  4AKZ A;  3CCV 3;  1YJN 3;  1UUV B;  2YFI B;  1I70 A;  1OF5 A;  2RNT A;  4IIA A;  1NWW A;  1O7P B;  3S29 A;  1IYY A;  1T3B A;  6RNT A;  1B21 A;  2Z6B A;  1WMO A;  3BB9 A;  4FMB A;  4R4K A;  1BAN A;  1I0V A;  2GU1 A;  2P05 A;  1PFP A;  1N5H A;  2CIU A;  3F7S A;  3Q3F A;  2OQE A;  3UL6 A;  3STD A;  1A90 A;  1MWR A;  4BU4 A;  1L5G B;  4H61 A;  5G2G A;  1YI2 3;  4X2O A;  3URP A;  4FMD A;  1FA3 A;  3KZT A;  2H0G A;  1BRH A;  1US1 A;  3EF8 A;  1ZGX A;  1I2G A;  4HM3 B;  1STD A;  1BNJ A;  5BVB A;  2BU4 A;  3WHO A;  1Q9E A;  3CMA 3;  2V1L A;  4BL3 A;  2LYX A;  1TU5 A;  1OHO A;  2ZL8 A;  1OH0 A;  1JN5 A;  1QMA A;  1UCL A;  3PCR A;  2ZDJ A;  3MSO A;  1BNF A;  3OXA A;  4XDW A;  3HI7 A;  4U13 A;  2Z76 A;  3BNE A;  1X1Y A;  2P0X A;  2CFD A;  1YIJ 3;  8CHO A;  2YFJ B;  3UB1 A;  3EN8 A;  3HIG A;  1LNH A;  1RTU A;  3KSE D;  1Q86 4;  3Q90 A;  2UGI A;  1ZS7 A;  4CPK A;  5JPU A;  1W01 A;  3X42 A;  2OCT A;  1RN7 A;  3JUP A;  3S27 A;  3NX0 A;  2STD A;  2W6J H;  1BNE A;  3CPO A;  3LML A;  2E2T A;  4CJN A;  4IPB A;  1KD1 4;  1VQ9 3;  3WA2 X;  2KRT A;  1MOL A;  3GSP A;  4OVM A;  3UJM A;  1QVG 2;  1BRI A;  1VQL 3;  2GU3 A;  1E3R A;  2OTJ 3;  1Q40 A;  1DE3 A;  3DY5 A;  5AIG A;  3V98 A;  5KP3 A;  1FUW A;  2UUG C;  1MWU A;  3HX8 A;  2F5M A;  1JV2 B;  3PXM A;  1PU4 A;  3CCE 3;  1MWT A;  2C11 A;  3MPH A;  5AII A;  1JZD A;  4STD A;  5STD A;  3SLU A;  3RGR A;  5JBS A;  1YJW 3;  1FW7 A;  2XR8 B;  5D82 A;  1IQX A;  4CDL A;  1Q40 B;  3X40 A;  3ALA A;  3WOE B;  5BXQ A;  2E2V A;  1T5Y A;  3VF1 A;  5ELU A;  1RNT A;  4LMI A;  4EC6 A;  3I56 3;  3CPW 2;  1WMP A;  2Z7A A;  2YX9 A;  3DZL A;  1IV9 A;  3EBY A;  4XBX A;  3B8L A;  1RKY A;  1IVX A;  1DMQ A;  4RBN A;  1N8Q A;  3WR2 A;  1EG9 B;  3DGL A;  2CWT A;  3CU3 A;  1VQO 3;  1NJI 4;  1W02 A;  1TRP A;  2RCD A;  2OOV A;  3GZY B;  3HII A;  4K61 A;  2BT3 A;  2FGT A;  3SVA A;  1GMQ A;  1NB3 I;  3EB8 A;  2WO0 A;  1DVD A;  4HM7 B;  4J5K A;  1EKM A;  1A2K A;  3NBJ A;  1W6C A;  3BNC A;  4MMX B;  1RRL A;  1BSC A;  2AAE A;  3OV4 A;  1VQ5 3;  1YJ9 3;  1GD4 A;  3DH2 A;  3DUK A;  3B4P A;  1K73 4;  3Q2P A;  5BIR A;  2HMM B;  3NBB A;  1BUQ A;  3T8U A;  1FUT A;  3PGB A;  5LC6 A;  3SXX A;  5DRV A;  1M1K 4;  4FCJ A;  4HM5 B;  3F8H A;  3H3H A;  3J7Y d;  1PY3 A;  3LT9 A;  2MF7 A;  2CX1 A;  3ZFZ A;  4I4K A;  1RGK A;  5FW5 A;  1O7N B;  1YGE A;  3DM8 A;  3G16 A;  3A76 A;  2F4Y A;  3NV0 B;  3LTD A;  3PCS A;  3WMD A;  2Z77 A;  1LRA A;  3F9S A;  1VQ6 3;  1OPY A;  3QRD A;  4KFD A;  4FR9 A;  2I9W A;  1BRN L;  1RCL A;  3ROB A;  1UI7 A;  3NQY A;  4K1V A;  1JZO A;  2H0H A;  1JB2 A;  1QAF A;  2D1W A;  2QGU A;  3AGO A;  3MYT A;  1O7W B;  2GEY A;  4J5G A;  5KP1 A;  1MGW A;  2RSX A;  4KFE A;  5TGN A;  1YIT 3;  3AGN A;  3CCS 3;  1DVC A;  1I3F A;  3X3Y A;  2W04 A;  4LEH A;  3CCL 3;  5AEW B;  1UUG B;  5IEN A;  1DMM A;  4HM4 B;  2P0M A;  5ELJ A;  3BU4 A;  3G6E 3;  1G0T A;  2SAR A;  3D5G A;  3V92 A;  3DGY A;  1KQS 2;  3K5T A;  2PNC A;  2FXT A;  1DMN A;  1SJW A;  2JDI H;  2KAA A;  5M18 A;  1EUI C;  3KN4 A;  4KT3 B;  5IF6 A;  1BSE A;  1HYF A;  2OWP A;  3U1W A;  3SOY A;  6GSP A;  1JNQ A;  1BSB A;  5CLK A;  3N54 B;  3T8N A;  3CC2 3;  1B20 A;  3L0R A;  1E3V A;  2F56 A;  4HAA A;  1TJD A;  1K9M 4;  2OTL 3;  1YVB I;  1ISK A;  1B27 A;  1MNL A;  2XGN A;  4XB5 A;  1DYU A;  3UL5 A;  4N6T A;  1S72 3;  1RHL A;  2CX0 A;  1UUW B;  4JRF A;  3DMC A;  5AI1 A;  2XSH B;  1RGF A;  3BNB A;  3FLJ A;  3SX1 A;  4EXR A;  4LSO A;  1ASK A;  2J8X B;  2K54 A;  3K63 A;  3N9H A;  1BRS A;  2K0M A;  3FGY A;  1ZO2 A;  5AIH A;  1ZX2 A;  1OUN A;  1TUH A;  3JUO A;  4K90 B;  5DRE A;  5IG3 A;  3FG3 A;  4HM0 B;  3PS8 A;  1JB4 A;  1YGW A;  2SBL A;  5CK6 A;  3HK4 A;  2CW9 A;  3KCH A;  2PZV A;  3WDG B;  4QWT A;  3FCS B;  1JB5 A;  4R80 A;  4HM6 B;  2GSP A;  3N8B A;  2CWU A;  2XEP A;  2QA4 3;  1WTH A;  1TIJ A;  5G1L A;  2WGQ A;  3LT8 A;  3RDE A;  3ER7 A;  3PZW A;  1U5O A;  5A0O B;  2C4B A;  2INX A;  1AQZ A;  3DXO A;  3EE1 A;  1VQN 3;  4LYL B;  4EV2 A;  5JPP A;  5KP4 A;  1NB5 I;  3OX9 A;  1W7C A;  1HU9 A;  1NNV A;  1B3S A;  1QAK A;  3GZR A;  4O2H A;  4X2H A;  4BTY A;  2XFS A;  4NHF A;  4EYC A;  1MGR A;  3CD6 3;  3NBR A;  1I8V A;  1M9G A;  1KC8 4;  1RCK A;  1I2F A;  3SED A;  1RGC A;  2W03 A;  3JUM A;  3KKG A;  1GOV A;  3MWZ A;  1Z1S A;  3DGN A;  1IVW A;  4R9K A;  3B7C A;  3UNL A;  1BRG A; 
#chains in the Genus database with same CATH homology
 3RGA A;  1NDO B;  3LXU X;  3KII A;  7STD A;  2XH9 A;  1IV7 A;  3CCJ 3;  3K7C A;  2XFT A;  4LZI A;  3AMO B;  5AEU B;  4H3U A;  2XSO B;  3MHE A;  3EN1 B;  3S5C A;  2UX0 A;  5IEO A;  3WOD G;  5CF2 A;  2F86 B;  3BND A;  2C10 A;  6STD A;  3F14 A;  3FF2 A;  2IMJ A;  4HVN A;  1W00 A;  2E2U A;  1CEW I;  4RNY A;  1W5Z A;  2CFL A;  5EVH A;  1GS3 A;  2CKF B;  1AR0 A;  4WYK A;  1IDP A;  4OUQ A;  3D3L A;  4RNZ A;  3CC4 3;  1WNH A;  4BTW A;  3MKI A;  4N6M A;  3CCR 3;  1A67 A;  3CXC 2;  4HM8 B;  3CME 3;  3ECF A;  2JQ5 A;  1IU7 A;  3LTB A;  2CFG A;  3DGO A;  4TX4 A;  4WYK B;  2R4I A;  1GY5 A;  1HKX A;  4EBG A;  3G8Z A;  1IK3 A;  1Q82 4;  4FMA A;  3DGM A;  3FKA A;  2L4V A;  3NV0 A;  1IT8 A;  1IVU A;  4HZ9 B;  2W9P A;  3GWR A;  3NUV A;  3GZX B;  1UI8 A;  5AIF A;  5AYR B;  3Q1C A;  3MG1 A;  4FCZ A;  4O8S A;  4Q53 A;  4XBY A;  3T0U A;  3CCQ 3;  3M8C A;  3OW2 2;  4L8O A;  2QIY A;  3U97 A;  1S5A A;  3WA3 A;  1EQK A;  4GL6 A;  3MG3 A;  1O7M B;  1N8R 4;  4HZB B;  2WGO A;  1AVK A;  2LQV A;  2HMJ B;  1JKG A;  5FGO A;  4K1U A;  4MEI A;  1TFO A;  4WHA A;  1FGM A;  4JF8 A;  4L7K A;  3LZA A;  3CNX A;  4HJL B;  1N9E A;  1W2B 2;  1OAC A;  2P09 A;  1QJG A;  2OQE C;  3CCU 3;  2BMR B;  5EQL A;  2RFR A;  3F8X A;  3GRD A;  3VGN A;  4HYZ A;  1JKG B;  1Q7Y 4;  3SOA A;  1FGO A;  2GXF A;  2IUJ A;  3F7X A;  3PYJ A;  2QEX 3;  2B1X B;  1RRH A;  1ROV A;  2XRX B;  4N6O B;  5I97 A;  2ML6 A;  1STF I;  3G4S 3;  3I55 3;  1OHP A;  3WOF B;  1KWI A;  4ZM8 A;  1SQW A;  2W56 B;  2XGL A;  3IJE B;  3D9R A;  1AV4 A;  1TP6 A;  4LGQ A;  3NM7 A;  1D6Y A;  2D42 A;  3OWS A;  2A15 A;  2HMK B;  2HMN B;  1W6Y A;  2IUK A;  4J9A A;  3CC7 3;  3HZP A;  3CCM 3;  1VQK 3;  1D6U A;  2F99 A;  3NQZ A;  4KZ1 A;  3G0K A;  4MJD A;  1Q42 A;  1AVL A;  3OWU A;  5EEO A;  3QK9 A;  1IT7 A;  2Y73 A;  2W0Q A;  1ULJ B;  3IPT A;  3CNM A;  1O7G B;  4HBR A;  1IQ8 A;  1JRQ A;  1CQS A;  2XF3 A;  3EC9 A;  3IMA B;  1F8N A;  1CYU A;  4HM1 B;  4XDV A;  5AYS C;  4WFO A;  3TDG A;  2GBW B;  3H51 A;  2CK3 H;  3B4O A;  1OF5 B;  2W9Q A;  1D6Z A;  3OWY A;  2KXG A;  1GYB A;  1NO3 A;  4BTX A;  3AMO A;  3X3Z A;  4CCV A;  1K28 A;  2O3O A;  3X41 A;  1W4N A;  1LXE A;  1QVF 2;  3LYG A;  1TFK A;  4KVH A;  4IT7 A;  4AKY A;  3G71 3;  3NXJ A;  2CWV A;  1M1X B;  1VQP 3;  2WOH A;  3NHX A;  5CF1 A;  2BMQ B;  2OOV C;  1G96 A;  1CYV A;  3GAX A;  1JN5 B;  2IA7 A;  2CFK A;  2M7O A;  1A2V A;  3F40 A;  4N3V A;  3EBT A;  1N9J A;  1YHQ 3;  1GD3 A;  4HKV B;  1IQY A;  2B24 B;  4L8P A;  5D81 A;  2CFW A;  3I0Y A;  2BHM A;  2Y74 A;  1O7H B;  1Q81 4;  5IG5 A;  1SPU A;  4MMZ B;  5CXO A;  3KE7 A;  1ROA A;  4WWU C;  1M90 4;  3LOY A;  3FF0 A;  1NU3 A;  2O9U X;  2BNG A;  3FH1 A;  1RJO A;  5LC7 A;  2CG0 A;  1GY7 A;  3X3X A;  5IER A;  3JUN A;  4HM2 B;  2GBX B;  4ORL A;  2RGQ A;  1C7H A;  4PEJ A;  3LTC A;  3MG2 A;  1E97 A;  1K8A 4;  3FG4 A;  3FSD A;  4N6U A;  1VQM 3;  4J8T A;  3S67 A;  4N6N B;  5IEP A;  1J2B A;  1OCV A;  1R4C A;  4NRE A;  1V74 A;  3FG1 A;  1LOX A;  1SII A;  2CG1 A;  3JVC A;  3EHC A;  2CC3 A;  1FGR A;  4GB5 A;  3VSY A;  4O3V A;  3EX9 A;  1VQ4 3;  4G1M B;  2BMO B;  3K9M C;  2HMO B;  4FCM A;  3LTA A;  4N6L A;  5IG0 A;  2GEX A;  2MC8 A;  1EA2 A;  3E99 A;  1IVV A;  1W2Z A;  4O02 B;  1Y4K A;  1WQL B;  1FGQ A;  1UW1 A;  4R9L A;  5IW9 A;  3EJV A;  1LVN A;  4WP5 A;  2ML5 A;  3FZW A;  1U8C B;  1VQ8 3;  2WOF A;  2W56 A;  1OGX A;  4RZM A;  3V99 A;  2BO9 B;  5HGR A;  2F98 A;  3LH4 A;  1W6G A;  2W2C A;  1QAL A;  3KSP A;  1GY6 A;  3BLZ A;  1JJ2 2;  1SIH A;  1FGT A;  2Q07 A;  1VZZ A;  4XM4 A;  1OGZ A;  4EV5 A;  2CH9 A;  4OK0 A;  1VQ7 3;  1KSI A;  1N5P A;  2YFL B;  4N6V 0;  3KFQ C;  3GZB A;  2HML B;  2P38 A;  4FMC A;  4R1K A;  1WMN A;  2KCD A;  1OHS A;  3JUQ A;  5D83 A;  1ULI B;  5IG4 A;  3O8Y A;  4KFF A;  1K41 A;  3S28 A;  3EQQ B;  4XBT A;  4AEQ A;  2FNQ A;  3K0Z A;  3NM2 A;  4MMY B;  2CHC A;  4AKZ A;  3CCV 3;  1YJN 3;  1UUV B;  2YFI B;  3S29 A;  1OF5 A;  4IIA A;  1NWW A;  1O7P B;  3BB9 A;  2Z6B A;  1WMO A;  4FMB A;  4R4K A;  2GU1 A;  2P05 A;  1PFP A;  1N5H A;  2CIU A;  3F7S A;  2OQE A;  3UL6 A;  1A90 A;  3STD A;  1L5G B;  4H61 A;  5G2G A;  1YI2 3;  4X2O A;  4FMD A;  1FA3 A;  3KZT A;  1US1 A;  3EF8 A;  4HM3 B;  1STD A;  5BVB A;  3CMA 3;  2V1L A;  2LYX A;  1TU5 A;  1OHO A;  2ZL8 A;  1OH0 A;  1JN5 A;  1QMA A;  3PCR A;  2ZDJ A;  3MSO A;  3OXA A;  4XDW A;  3HI7 A;  4U13 A;  2Z76 A;  3BNE A;  1YIJ 3;  2P0X A;  2CFD A;  8CHO A;  2YFJ B;  3UB1 A;  3EN8 A;  3HIG A;  1LNH A;  3KSE D;  1Q86 4;  3Q90 A;  5JPU A;  1W01 A;  3X42 A;  2OCT A;  1RN7 A;  3JUP A;  3S27 A;  3NX0 A;  2STD A;  2W6J H;  3CPO A;  3LML A;  2E2T A;  4IPB A;  1KD1 4;  1VQ9 3;  3WA2 X;  2KRT A;  1MOL A;  4OVM A;  1QVG 2;  3UJM A;  1VQL 3;  2GU3 A;  1E3R A;  2OTJ 3;  1Q40 A;  3DY5 A;  5AIG A;  3V98 A;  5KP3 A;  1FUW A;  3HX8 A;  1JV2 B;  3PXM A;  1PU4 A;  3CCE 3;  2C11 A;  3MPH A;  5AII A;  4STD A;  5STD A;  3SLU A;  3RGR A;  5JBS A;  1YJW 3;  2XR8 B;  5D82 A;  1IQX A;  4CDL A;  1Q40 B;  3X40 A;  3ALA A;  3WOE B;  5BXQ A;  2E2V A;  1T5Y A;  3VF1 A;  5ELU A;  4LMI A;  4EC6 A;  3I56 3;  3CPW 2;  1WMP A;  2Z7A A;  2YX9 A;  3DZL A;  1IV9 A;  3EBY A;  4XBX A;  3B8L A;  1RKY A;  1IVX A;  1DMQ A;  4RBN A;  1N8Q A;  1EG9 B;  3DGL A;  2CWT A;  3CU3 A;  1VQO 3;  1NJI 4;  1W02 A;  2RCD A;  2OOV A;  3GZY B;  3HII A;  4K61 A;  2BT3 A;  2FGT A;  3SVA A;  1NB3 I;  3EB8 A;  2WO0 A;  1DVD A;  4HM7 B;  1EKM A;  1A2K A;  3NBJ A;  1W6C A;  3BNC A;  4MMX B;  1RRL A;  1VQ5 3;  3OV4 A;  1YJ9 3;  1GD4 A;  3DUK A;  3B4P A;  1K73 4;  3Q2P A;  2HMM B;  3NBB A;  1BUQ A;  3T8U A;  3PGB A;  5LC6 A;  3SXX A;  5DRV A;  1M1K 4;  4FCJ A;  4HM5 B;  3F8H A;  3H3H A;  3J7Y d;  3LT9 A;  2MF7 A;  4I4K A;  5FW5 A;  1O7N B;  1YGE A;  3DM8 A;  3G16 A;  3A76 A;  3NV0 B;  3LTD A;  3PCS A;  3WMD A;  2Z77 A;  3F9S A;  1VQ6 3;  1OPY A;  3QRD A;  4KFD A;  4FR9 A;  2I9W A;  3ROB A;  1UI7 A;  3NQY A;  4K1V A;  1JB2 A;  1QAF A;  2D1W A;  2QGU A;  3MYT A;  1O7W B;  2GEY A;  5KP1 A;  2RSX A;  4KFE A;  1YIT 3;  5TGN A;  3CCS 3;  1DVC A;  3X3Y A;  2W04 A;  4LEH A;  3CCL 3;  5AEW B;  5IEN A;  1DMM A;  4HM4 B;  2P0M A;  5ELJ A;  3G6E 3;  1KQS 2;  3V92 A;  3K5T A;  2PNC A;  2FXT A;  1DMN A;  1SJW A;  2JDI H;  3KN4 A;  5IF6 A;  3U1W A;  2OWP A;  3SOY A;  1JNQ A;  5CLK A;  3N54 B;  3T8N A;  3CC2 3;  3L0R A;  1E3V A;  1K9M 4;  2OTL 3;  1YVB I;  1ISK A;  1MNL A;  2XGN A;  4XB5 A;  3UL5 A;  1DYU A;  1S72 3;  4N6T A;  1UUW B;  4JRF A;  3DMC A;  5AI1 A;  2XSH B;  3BNB A;  3FLJ A;  3SX1 A;  4EXR A;  4LSO A;  1ASK A;  2K54 A;  3K63 A;  3N9H A;  2K0M A;  3FGY A;  1ZO2 A;  5AIH A;  1ZX2 A;  1OUN A;  1TUH A;  3JUO A;  4K90 B;  5DRE A;  5IG3 A;  3FG3 A;  4HM0 B;  3PS8 A;  1JB4 A;  2SBL A;  5CK6 A;  3HK4 A;  2CW9 A;  2PZV A;  3WDG B;  4QWT A;  3FCS B;  1JB5 A;  4R80 A;  4HM6 B;  3N8B A;  2CWU A;  2XEP A;  2QA4 3;  1WTH A;  1TIJ A;  2WGQ A;  3LT8 A;  3RDE A;  3ER7 A;  3PZW A;  1U5O A;  5A0O B;  3EE1 A;  2INX A;  3DXO A;  1VQN 3;  5JPP A;  4EV2 A;  5KP4 A;  1NB5 I;  3OX9 A;  1W7C A;  1HU9 A;  1QAK A;  3GZR A;  4O2H A;  4X2H A;  4BTY A;  2XFS A;  4NHF A;  4EYC A;  3CD6 3;  3NBR A;  1M9G A;  1KC8 4;  3SED A;  2W03 A;  3JUM A;  3KKG A;  3MWZ A;  1Z1S A;  3DGN A;  1IVW A;  4R9K A;  3B7C A;  3UNL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...