3LYGA

Crystal structure of ntf2-like protein of unknown function (yp_270605.1) from colwellia psychrerythraea 34h at 1.61 a resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
120
structure length
120
Chain Sequence
GMNLANIVQRGWEALGAGDFDTLVTDYVEKMIFIMPGQADVLKGRQAFRSALDNLGEILPPGFEITGLRQLEGENEIVSIVEWKSDKMIASQLSVLFKFEGDQIYEERWFVDTEQWKSVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of NTF2-like protein of unknown function (YP_270605.1) from Colwellia psychrerythraea 34H at 1.61 A resolution
rcsb
source organism Colwellia psychrerythraea
molecule tags Structural genomics, unknown function
molecule keywords NTF2-like protein of unknown function
total genus 35
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2010-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3lygA00
3EF8A 3F8HA 4XBTA 5HGRA 1IDPA 1JN5A 5IG4A 3EHCA 2K54A 5IEPA 2F99A 1O7WB 1O7PB 5AIFA 2GBXB 5BVBA 4R9LA 1ULJB 2PZVA 3NV0A 1EA2A 4HM0B 4HM6B 3BLZA 1TUHA 5TGNA 1OGXA 2HMLB 3MYTA 3RGRA 3KSPA 3ROBA 4HJLB 1BUQA 1DMMA 3KKGA 3ER7A 5IEOA 5IERA 5IF6A 3FZWA 2GBWB 1OCVA 3KE7A 3WMDA 8CHOA 3G0KA 4FCJA 3IPTA 4HKVB 1GS3A 4HZ9B 4ORLA 3FH1A 1E97A 1EG9B 1ZX2A 2A15A 3HK4A 1Q40A 4L8PA 3MHEA 4WYKA 1JKGB 2XRXB 3LYGA 4OUQA 4J9AA 5EVHA 5AIGA 3FSDA 1OHSA 4L7KA 4X2HA 4XBXA 5CF1A 1HKXA 2F86B 2QIYA 2XR8B 3DMCA 1O7MB 3NUVA 5AIHA 5CF2A 1QJGA 3GZRA 1GYBA 5IENA 1JN5B 1W02A 3KZTA 3SOYA 2CHCA 2RCDA 1Q42A 2Z76A 3H3HA 2W2CA 1QMAA 3F7XA 4I4KA 5BXQA 4HM4B 5JPPA 2CKFB 5STDA 4XDWA 5IG5A 3T8UA 3NM2A 1STDA 2UX0A 1UUWB 3SOAA 2BMQB 3FLJA 1GY7A 1JB5A 1Z1SA 3A76A 1OF5B 4HM2B 4LEHA 2RFRA 3G8ZA 1VZZA 3VGNA 3E99A 2YFLB 3NBRA 3MKIA 4Q53A 3DXOA 3DZLA 3K0ZA 3OWYA 4HM7B 3EX9A 2XSOB 1C7HA 1W6YA 4WWUC 3STDA 3CPOA 5IG0A 2GEXA 3MG3A 4STDA 1OHPA 1Q40B 3JUNA 1K41A 3OX9A 4GB5A 4WYKB 5KP4A 5CXOA 1DMNA 3OWSA 5AEUB 3EJVA 1OPYA 4R1KA 2Z7AA 5CK6A 2GEYA 3B4PA 5G2GA 1GY6A 4XM4A 5FW5A 3M8CA 4K1UA 3EBYA 1OH0A 5AI1A 2HMKB 4LGQA 4HM5B 1E3VA 3EBTA 5AIIA 2YFIB 1E3RA 2QGUA 3JUPA 1W01A 3OWUA 3BB9A 4IIAA 4X2OA 4HVNA 2OWPA 3LZAA 3D9RA 2BMOB 5DREA 3S5CA 3UNLA 1NDOB 1U5OA 4H3UA 1S5AA 3GZBA 3F7SA 1ZO2A 4LMIA 3HZPA 6STDA 1OUNA 3MSOA 1OF5A 3GWRA 1DMQA 3FGYA 3Q90A 3F8XA 4FCMA 3OV4A 3JUQA 3EN8A 4N3VA 3H51A 3EC9A 5D82A 1O7NB 1ASKA 3EQQB 4XDVA 2XSHB 3JUMA 3T8NA 4MJDA 3UJMA 4K1VA 4KVHA 3DM8A 5IG3A 5KP1A 3HX8A 5AEWB 3B7CA 1ISKA 3OXAA 1O7HB 1TP6A 3B8LA 4PEJA 1UUVB 2I9WA 3JUOA 1JB2A 1WQLB 3ECFA 4R9KA 1W00A 1OGZA 3F14A 4HM3B 3GZYB 5CLKA 5DRVA 1NU3A 1ULIB 3RGAA 2BNGA 3EN1B 4XBYA 5JPUA 3I0YA 2B1XB 3DUKA 4U13A 5KP3A 2HMOB 2HMJB 4HM1B 3NV0B 1JKGA 3NXJA 4HZBB 4CDLA 2F98A 3VSYA 3MG2A 1GY5A 2JQ5A 3B4OA 1CQSA 4HM8B 5D81A 7STDA 1O7GB 3G16A 2Z77A 2HMMB 1SJWA 2IMJA 3CNMA 5D83A 1NWWA 3SEDA 2HMNB 2B24B 3FKAA 3NHXA 3MG1A 2BMRB 3F9SA 4RZMA 2YFJB 4XB5A 2RGQA 1OHOA 3CNXA 3F40A 3GZXB 4WP5A 1AR0A 3FF2A 1JB4A 3FF0A 4J8TA 4L8OA 2R4IA 2GXFA 4OVMA 1A2KA 2INXA 3GRDA 3K7CA 2STDA 3CU3A
chains in the Genus database with same CATH superfamily
1M1XB 7RNTA 5HGRA 1A2VA 1R4CA 2ZHXB 3LOYA 2RSXA 3CCM3 1M9GA 1VQ93 5EQLA 3URPA 1UI7A 2BU4A 2GBXB 3U97A 4BU4A 2PZVA 1GOVA 6GSPA 5TGNA 3DGLA 1FZUA 3MYTA 2ZL8A 1ROVA 2AADA 1K28A 3D4AA 3LT8A 1YJN3 1J2BA 1OCVA 2Q07A 3KFQC 4BIRA 4EXRA 3IPTA 4R80A 2UGIA 1PYLA 1RN7A 1ROAA 3KIIA 5IW9A 3FH1A 1E97A 3D5IA 4MMXB 4RBNA 1RGCA 4WYKA 1JKGB 3WOFB 4K90B 1T2HA 5AYRB 4X2HA 1FGOA 1M904 1RGAA 1HKXA 2XF3A 3DMCA 1JNQA 5AIHA 3V98A 3VF1A 5IENA 1JN5B 5BIRA 4BTWA 1W6GA 1X1UA 3H3HA 4I4KA 2CK3H 1LQMB 3NBBA 3ALAA 1AVKA 2YX9A 4XDWA 5IG5A 3CCS3 3NM2A 2UX0A 3NM7A 3AMOA 3SOAA 4RNYA 1LOXA 2CWTA 1YVSA 1TU5A 2OQEC 3WA3A 1JB5A 1I2GA 2CFLA 2H0HA 2MF7A 3PXMA 2RFRA 1VQ63 4MEIA 4N6LA 3DXOA 5GSPA 1IQYA 4HM7B 3EX9A 1W6YA 5ELUA 3EB8A 1RNBA 2GEXA 3LXUX 3CC23 1OHPA 3OX9A 4HYZA 1K41A 1RSNA 1RRHA 5CXOA 2BT3A 3OWSA 1B3SA 5CK6A 2HOHA 1I2FA 2SARA 3B4PA 5G2GA 1G0TA 5FW5A 3M8CA 1LXEA 4AKZA 4J5KA 4LYLB 1Y4KA 1UUGB 3DGOA 2W03A 2OTJ3 1FYSA 3T0UA 1RHLA 3JUPA 1W01A 4IIAA 1JBSA 2O9UX 3FG1A 1YJ93 1U5OA 1MWSA 3GZBA 3HOHA 2XEPA 1OF5A 1ZS7A 3Q90A 3X40A 2FGTA 1DVDA 5I97A 1O7NB 3N9HA 3JUMA 3K63A 1UW1A 1MWTA 3JVCA 1ZGXA 3HX8A 1YNVX 1B27A 3OXAA 1ISKA 1I2EA 2F56A 1BRGA 1TP6A 2WOFA 3DH2A 4AKYA 3G4S3 1W00A 3CXC2 3V92A 1YHQ3 2E2TA 3CC73 1G02A 1RDSA 3RGAA 2WGQA 3OW22 2BNGA 1NO3A 4XBYA 5JPUA 1M1K4 1RGHA 2BIRA 1N9JA 2L1SA 2P09A 2KF5A 2XH9A 3PCRA 1K734 3AGOA 1JV2B 2KF6A 1VQM3 2F98A 3N54B 4KT3B 3BNDA 5D81A 2JQ5A 4HM8B 1IVUA 4JRFA 2JDIH 1B2MA 1GMRA 1NWWA 3FKAA 3WDGB 1N8QA 3KSED 4IPBA 2W6JH 2WGOA 1JRQA 1TIJA 3AHSA 3LT9A 5EVHA 4OVMA 3FF0A 4J8TA 2IUKA 1A2KA 3GRDA 3K7CA 1BAOA 2STDA 3CU3A 1LRAA 2IY2A 1JZDA 1NB3I 4XBTA 1IDPA 1JN5A 2CC3A 3NQZA 3EHCA 1YIJ3 2E2VA 1UGIA 1B20A 2KF4A 1BSBA 4R9LA 3BNCA 4N6OB 4HM6B 4GSPA 3BLZA 3KCHA 1IVWA 1TUHA 3CCQ3 2HMLB 3KSPA 3QRDA 3ROBA 3D79A 1HZ1A 1Q7Y4 1DMMA 4HBRA 1EKMA 4N6NB 3CCJ3 1AVLA 1BANA 1MOLA 3FZWA 2GBWB 4FR9A 3WMDA 1GOUA 1YI23 3Q3FA 4HKVB 5M1AA 4BTYA 1TFOA 4AEQA 1EG9B 3O8YA 3CME3 1Q40A 3N8BA 3MHEA 2XRXB 2P05A 3QK9A 1IYYA 3DGNA 3DGMA 5AIGA 3FSDA 4L7KA 2F86B 1FGRA 1QJGA 1LOYA 1RGGA 3K9MC 3SXXA 1GYBA 5IG3A 5BXQA 2RCDA 2Z76A 1KD14 3F7XA 4KZ1A 1US1A 2O3OA 2F5MA 1JBRA 3S28A 3T8UA 2J8XB 1U8CB 1UI8A 2BMQB 4NPBA 1GY7A 1LQGC 1RMSA 3E99A 5HOHA 3K5TA 3NBRA 3MKIA 4H61A 4Q53A 1JBTA 4MMYB 2CWUA 3K0ZA 4N6V0 3ZG5A 1AQZA 2XSOB 3STDA 3CCV3 2CFKA 1CYVA 4GB5A 4EV5A 2ZA4A 1DMNA 5AEUB 5G1KA 1OPYA 2CFGA 2GEYA 4XM4A 1BSCA 2W9QA 1VQO3 1BSAA 3EBYA 4EC6A 2IA7A 1Q864 1DETA 4LGQA 1QAKA 4HM5B 1E3VA 1BSEA 1E3RA 2CG0A 3CCE3 1LOWA 4HVNA 1IK3A 3FG3A 1WMNA 3F7SA 3HZPA 1IVXA 1MGWA 3JUQA 3EN8A 4KFFA 3EC9A 1L5GB 4KVHA 1N5HA 3DM8A 3WODG 5KP1A 3IMAB 2ML5A 1I3IA 2I9WA 3JUOA 1JB2A 1WQLB 2OTL3 4BL3A 1OGZA 4HM3B 3GZYB 4GHOA 1W2ZA 5CLKA 5DRVA 2OCTA 1GMPA 8RNTA 3MWZA 1MNLA 3EN1B 1SQWA 3DUKA 1FA3A 3CCR3 1JKGA 2LYXA 1GD4A 3VSYA 5JBSA 3MG2A 2CFWA 7STDA 1X1WA 1O7GB 1SIIA 4N6UA 1HU9A 2HMMB 2IMJA 3CNMA 3FCSB 2CWVA 2HMNB 1KWIA 1FUSA 2V1LA 2W04A 1X1YA 1VQ83 2BMRB 2WO0A 4HAAA 4RZMA 2YFJB 1Q7HA 1QALA 1FUWA 1IT7A 3CNXA 3CCL3 1JB4A 1RTUA 1BNEA 1UGHI 2C10A 2CX0A 2R4IA 3LTCA 4L8OA 2H0GA 1DVCA 3EF8A 1PU4A 1CH0A 2CG1A 5IG4A 1TFKA 3FG4A 3PGBA 1DE3A 1O7WB 1B2ZA 5AIFA 1BGSA 3RNTA 1LOVA 1T3BA 2Z6BA 1TRPA 3NV0A 4HM0B 4O2HA 4CCVA 1VQK3 1C54A 1TTOA 4HOHA 1OGXA 1T2IA 4HJLB 3KKGA 3KE7A 8CHOA 2KF3A 3G0KA 2D42A 1BUJA 2CIUA 2IUJA 1ZX2A 2A15A 3HK4A 3NBJA 1HYFA 3SX1A 1YJW3 1FW7A 2CFDA 1I0VA 4OUQA 4J9AA 1AV4A 1OHSA 5CF1A 2XR8B 3MPHA 5RNTA 2C11A 4CJNA 3GZRA 1IQXA 1W02A 3SOYA 5EEOA 1Q42A 4EBGA 1CYUA 1AY7A 5JPPA 1S723 2CKFB 1WMOA 5STDA 1MGRA 3GAXA 1STDA 1B21A 1UUWB 1BNSA 2OQEA 3CCU3 3SYUA 4EV2A 1IV9A 4G1MB 1WMPA 1OF5B 4HM2B 3SLUA 3G8ZA 1F8NA 1VZZA 3VGNA 4BTXA 4N6MA 3CMA3 2YFLB 1TJDA 2RBIA 3V99A 1BRHA 1LVNA 1PFPA 1KSIA 3DZLA 3OWYA 4WFOA 1Q814 1C7HA 3HIIA 1GOYA 3CPOA 2XGLA 1Q40B 1RLSA 3X3ZA 4WYKB 4FMBA 6RNTA 2QA43 5AYSC 1BIRA 4KFEA 4R1KA 3DGYA 4FCZA 1GSPA 3PYJA 1MWRA 3KN4A 3A5EA 2SBLA 2FNQA 1GY6A 2D1WA 3BNEA 4O3VA 3G6E3 5AI1A 1D6UA 3D5GA 3WHOA 2HMKB 1A2PA 3EBTA 5AIIA 2YFIB 2QGUA 3OWUA 4X2OA 2MC8A 3BB9A 2W0QA 1QVG2 2OWPA 3D9RA 3UNLA 3S5CA 1BRIA 6STDA 3S29A 3DY5A 1DMQA 1DYUA 3FGYA 4N3VA 1VQ43 3H51A 3EQQB 1B2SA 4XDVA 3T8NA 2XSHB 3UJMA 4MJDA 4K1VA 1VQ53 3CD63 1R4YA 1WTHA 5G1LA 4DKIA 4EW5A 3S27A 1I0XA 5AEWB 1O7HB 4PEJA 2ML6A 3B8LA 1UUVB 3NQYA 1Q9EA 2F5WA 3ECFA 4FMDA 1G96A 3F14A 1BSDA 1NU3A 3U1WA 5M19A 1IT8A 1RGLA 1RKYA 3Q1CA 2B1XB 1FGTA 5KP3A 2P0XA 2HMOB 2HMJB 4HM1B 3AHWA 1A67A 1BRKA 2KCDA 2XFTA 1GY5A 1I3FA 1FUTA 1CQSA 2WOHA 2Y73A 3B4OA 1T5YA 3G16A 3Q2PA 1IVVA 4IT7A 1YGEA 1NJI4 1NNVA 1SJWA 1K8A4 1VQN3 3NHXA 2B24B 3WR2A 2GSPA 3BNBA 1RGKA 1D6YA 1UCJA 1EUIC 2C4BA 4XB5A 3TDGA 2W9PA 5LC7A 2RGQA 2UUGC 3F40A 1SPUA 3GZXB 3HIGA 4WP5A 2KRTA 3UB1A 4ILFA 2GU1A 2GXFA 2H0IA 1JZOA 3X3YA 1FGQA 2K3DA 3I0YA 1KC84 3LTBA 1QAFA 3F8HA 3L0RA 3X41A 1N5PA 3HI7A 2K54A 2QEX3 5IEPA 2F99A 1O7PB 3D3LA 1RGFA 5BVBA 1RCKA 1W2B2 1ULJB 2ZDJA 1QVF2 9RNTA 1EA2A 3AMOB 3CC43 1SIHA 1K9M4 3RGRA 4BL2A 2L4VA 4O02B 1BUQA 5BU4A 3ER7A 1RN4A 1RNTA 5IEOA 5IERA 1IQ8A 5ELJA 5IF6A 3S67A 3ZG0A 4FCJA 4HZ9B 1GS3A 4K61A 4ORLA 3CPW2 2PNCA 2BO9B 4RNZA 1PY3A 3G713 1STFI 3LYGA 2CH9A 1I8VA 3X3XA 1UCKA 4XBXA 4CPKA 1MWUA 4FMAA 1VQ73 2QIYA 2XFSA 1KQS2 1O7MB 3NUVA 3BIRA 4MMZB 1W5ZA 5CF2A 5LC6A 3I553 4R4KA 4GL6A 3KZTA 1RCLA 2CHCA 2Y74A 2W2CA 1QMAA 1IV7A 4FMCA 1N8R4 4HM4B 2XGNA 4O8SA 1UDII 2CW9A 1GMQA 3LTAA 2IYJA 3FLJA 3LTDA 3GSPA 1Z1SA 3A76A 4LEHA 3UL6A 4NHFA 5M18A 1GD3A 1D6ZA 1RJOA 1V74A 2GU3A 4KFDA 1B2XA 1UCIA 4J5GA 4WWUC 1OACA 5IG0A 3MG3A 4STDA 2FXTA 3NX0A 3JUNA 4QWTA 7GSPA 5KP4A 3UL5A 1VQP3 3IJEB 4N6TA 3EJVA 2Z7AA 1SARA 1N9EA 4RNTA 3PCSA 1EEJA 2OOVA 1BRJA 2OOVC 4K1UA 1OH0A 1JJ22 2M7OA 1A90A 1LNIA 1Q824 2W56A 1VQL3 2E2UA 1BNIA 1RRLA 3LZAA 1WNHA 2BMOB 4LZIA 5DREA 4EYCA 1NDOB 4H3UA 1S5AA 4LMIA 1ZO2A 1W7CA 1TRQA 2R41A 1OUNA 3MSOA 3GWRA 3WA2X 1BOXA 2AAEA 3F8XA 4FCMA 3OV4A 1YGWA 4I5QA 5D82A 1ASKA 3AGNA 3J7Yd 3PZWA 4TX4A 3BU4A 5FGOA 4LSOA 2BHMA 1X1XA 2RNTA 1V57A 1LNHA 2P38A 3B7CA 1BNJA 2KAAA 3EE1A 1V58A 2F4YA 4OK0A 4R9KA 1FGMA 1BVIA 1ULIB 1YIT3 2LQVA 1BU4A 3PS8A 3WOEB 4ZM8A 1BNRA 4U13A 4NREA 2KXGA 5A0OB 3NV0B 4CDLA 1CEWI 4HZBB 2W56B 3X42A 3LMLA 1UCLA 3I563 4WHAA 1W4NA 3SVAA 2Z77A 3RDEA 1W6CA 1YVBI 1BNFA 4JF8A 5D83A 1B2UA 3SEDA 3LH4A 1RN1A 3MG1A 3ZFZA 1RGEA 2P0MA 3F9SA 1BNGA 1NB5I 2CX1A 1BRNL 1I70A 1OHOA 1AR0A 3FF2A 2K0MA 1BRSA 1IU7A 1VQQA 2INXA 4L8PA 3NXJA 1EQKA
chains in the Genus database with same CATH topology
1M1XB 5HGRA 1A2VA 1R4CA 3LOYA 2RSXA 3CCM3 1M9GA 1VQ93 5EQLA 1UI7A 2GBXB 3U97A 2PZVA 5TGNA 3DGLA 3MYTA 2ZL8A 1ROVA 1K28A 3LT8A 1YJN3 1J2BA 1OCVA 2Q07A 3KFQC 4EXRA 3IPTA 4R80A 1ROAA 1RN7A 3KIIA 5IW9A 3FH1A 1E97A 4MMXB 4WYKA 1JKGB 3WOFB 4K90B 5AYRB 4X2HA 1FGOA 1M904 1HKXA 2XF3A 3DMCA 1JNQA 5AIHA 3V98A 3VF1A 5IENA 1JN5B 1W6GA 3H3HA 4I4KA 2CK3H 3NBBA 3ALAA 1AVKA 2YX9A 4XDWA 5IG5A 3CCS3 3NM2A 2UX0A 3NM7A 3AMOA 3SOAA 4RNYA 1LOXA 2CWTA 1TU5A 3WA3A 2OQEC 1JB5A 2CFLA 3PXMA 2MF7A 2RFRA 1VQ63 4MEIA 4N6LA 3DXOA 1IQYA 4HM7B 3EX9A 1W6YA 5ELUA 3EB8A 2GEXA 3LXUX 3CC23 1OHPA 3OX9A 4HYZA 1K41A 1RRHA 5CXOA 2BT3A 3OWSA 5CK6A 3B4PA 5G2GA 5FW5A 3M8CA 1LXEA 4AKZA 1Y4KA 3DGOA 2W03A 2OTJ3 3T0UA 3JUPA 1W01A 4IIAA 2O9UX 3FG1A 1YJ93 1U5OA 3GZBA 2XEPA 1OF5A 3Q90A 3X40A 2FGTA 1DVDA 5I97A 1O7NB 3N9HA 3JUMA 3K63A 1UW1A 3JVCA 3HX8A 1ISKA 3OXAA 1TP6A 2WOFA 4AKYA 3G4S3 1W00A 3CXC2 3V92A 1YHQ3 2E2TA 3CC73 1M1K4 3RGAA 2WGQA 3OW22 2BNGA 1NO3A 4XBYA 5JPUA 1N9JA 2P09A 2XH9A 3PCRA 1K734 1VQM3 1JV2B 2F98A 3N54B 3BNDA 5D81A 2JQ5A 4HM8B 1IVUA 4JRFA 2JDIH 1NWWA 3FKAA 3WDGB 1N8QA 3KSED 4IPBA 2W6JH 2WGOA 1JRQA 1TIJA 3LT9A 5EVHA 4OVMA 3FF0A 4J8TA 2IUKA 1A2KA 3GRDA 3K7CA 2STDA 3CU3A 4XBTA 1NB3I 1IDPA 1JN5A 2CC3A 3NQZA 3EHCA 1YIJ3 2E2VA 4R9LA 3BNCA 4N6OB 4HM6B 3BLZA 3CCQ3 1IVWA 1TUHA 2HMLB 3KSPA 3QRDA 3ROBA 1Q7Y4 1DMMA 4HBRA 1EKMA 4N6NB 3CCJ3 1AVLA 1MOLA 3FZWA 1YI23 2GBWB 4FR9A 3WMDA 4HKVB 4BTYA 1TFOA 4AEQA 1EG9B 3O8YA 3CME3 1Q40A 3N8BA 3MHEA 2XRXB 2P05A 3QK9A 3DGNA 3DGMA 5AIGA 3FSDA 4L7KA 2F86B 1FGRA 1QJGA 3K9MC 3SXXA 1GYBA 5IG3A 5BXQA 2RCDA 2Z76A 1KD14 3F7XA 4KZ1A 1US1A 2O3OA 3S28A 3T8UA 1U8CB 1UI8A 2BMQB 1GY7A 3E99A 3K5TA 3NBRA 3MKIA 4H61A 4Q53A 4MMYB 2CWUA 3K0ZA 4N6V0 2XSOB 3STDA 3CCV3 2CFKA 1CYVA 4GB5A 4EV5A 1DMNA 5AEUB 1OPYA 2CFGA 2GEYA 4XM4A 2W9QA 1VQO3 3EBYA 4EC6A 2IA7A 1Q864 4LGQA 1QAKA 4HM5B 1E3VA 1E3RA 3CCE3 2CG0A 4HVNA 1IK3A 3FG3A 1WMNA 3F7SA 3HZPA 1IVXA 3JUQA 3EN8A 4KFFA 3EC9A 1L5GB 4KVHA 1N5HA 3DM8A 3WODG 5KP1A 3IMAB 2ML5A 2I9WA 3JUOA 1JB2A 1WQLB 2OTL3 1OGZA 4HM3B 3GZYB 5CLKA 1W2ZA 5DRVA 2OCTA 3MWZA 1MNLA 3EN1B 1SQWA 3DUKA 1FA3A 3CCR3 1JKGA 2LYXA 1GD4A 3VSYA 5JBSA 3MG2A 2CFWA 7STDA 1O7GB 1SIIA 4N6UA 1HU9A 3CNMA 2HMMB 2IMJA 3FCSB 2CWVA 2HMNB 1KWIA 2V1LA 2W04A 1VQ83 2BMRB 2WO0A 4RZMA 2YFJB 1QALA 1FUWA 1IT7A 3CNXA 3CCL3 1JB4A 2C10A 4L8OA 2R4IA 3LTCA 1DVCA 3EF8A 1PU4A 2CG1A 5IG4A 1TFKA 3FG4A 3PGBA 1O7WB 5AIFA 2Z6BA 3NV0A 4HM0B 4O2HA 4CCVA 1VQK3 1OGXA 4HJLB 3KKGA 3KE7A 8CHOA 3G0KA 2D42A 2CIUA 2IUJA 1ZX2A 2A15A 3HK4A 3NBJA 3SX1A 1YJW3 2CFDA 4OUQA 4J9AA 1AV4A 1OHSA 5CF1A 2XR8B 3MPHA 2C11A 3GZRA 1IQXA 1W02A 3SOYA 5EEOA 1Q42A 4EBGA 1CYUA 5JPPA 1S723 2CKFB 1WMOA 5STDA 3GAXA 1STDA 1UUWB 2OQEA 3CCU3 4EV2A 1IV9A 4G1MB 1WMPA 1OF5B 4HM2B 3SLUA 3G8ZA 1F8NA 1VZZA 3VGNA 4BTXA 4N6MA 3CMA3 2YFLB 3V99A 1LVNA 1PFPA 3DZLA 1KSIA 3OWYA 4WFOA 1Q814 1C7HA 3HIIA 3CPOA 2XGLA 1Q40B 3X3ZA 4WYKB 4FMBA 2QA43 5AYSC 4KFEA 4R1KA 4FCZA 3PYJA 3KN4A 3BNEA 2SBLA 2FNQA 1GY6A 2D1WA 4O3VA 3G6E3 5AI1A 1D6UA 2HMKB 3EBTA 5AIIA 2YFIB 2QGUA 3OWUA 4X2OA 2MC8A 3BB9A 2W0QA 1QVG2 2OWPA 3D9RA 3UNLA 3S5CA 6STDA 3S29A 3DY5A 1DMQA 1DYUA 3FGYA 4N3VA 1VQ43 3H51A 3EQQB 3T8NA 4XDVA 2XSHB 3UJMA 4MJDA 4K1VA 1VQ53 3CD63 1WTHA 3S27A 5AEWB 1O7HB 4PEJA 2ML6A 3B8LA 1UUVB 3NQYA 3ECFA 4FMDA 1G96A 3F14A 1NU3A 3U1WA 1IT8A 1RKYA 3Q1CA 2B1XB 1FGTA 5KP3A 2P0XA 2HMOB 2HMJB 4HM1B 1A67A 2KCDA 2XFTA 1GY5A 4BTWA 3B4OA 1CQSA 2WOHA 2Y73A 4RBNA 1T5YA 3G16A 3Q2PA 1IVVA 4IT7A 1YGEA 1NJI4 1SJWA 1K8A4 1VQN3 3NHXA 2B24B 3BNBA 1D6YA 3TDGA 4XB5A 2W9PA 5LC7A 2RGQA 3GZXB 3F40A 1SPUA 3HIGA 4WP5A 3UB1A 2KRTA 2GU1A 2GXFA 3X3YA 1FGQA 3I0YA 1KC84 3LTBA 1QAFA 3F8HA 3L0RA 3X41A 1N5PA 3HI7A 2K54A 2QEX3 5IEPA 2F99A 1O7PB 3D3LA 5BVBA 1W2B2 1ULJB 2ZDJA 1QVF2 1EA2A 3AMOB 3CC43 1SIHA 1K9M4 3RGRA 2L4VA 4O02B 1BUQA 3ER7A 5IEOA 5IERA 1IQ8A 5ELJA 5IF6A 3S67A 4FCJA 4HZ9B 1GS3A 4K61A 4ORLA 3CPW2 2PNCA 2BO9B 4RNZA 3G713 1STFI 3LYGA 2CH9A 3X3XA 1KQS2 4XBXA 4FMAA 1VQ73 2QIYA 2XFSA 1O7MB 3NUVA 4MMZB 5CF2A 1W5ZA 3I553 5LC6A 4R4KA 4GL6A 3KZTA 2Y74A 2CHCA 2W2CA 1QMAA 1IV7A 4FMCA 1N8R4 4HM4B 2XGNA 4O8SA 2CW9A 3LTAA 3LTDA 3FLJA 3A76A 1Z1SA 4LEHA 3UL6A 4NHFA 1GD3A 1D6ZA 1RJOA 1V74A 2GU3A 4KFDA 4WWUC 1OACA 5IG0A 3MG3A 4STDA 2FXTA 3NX0A 3JUNA 4QWTA 5KP4A 3UL5A 1VQP3 3IJEB 4N6TA 3EJVA 2Z7AA 1N9EA 3PCSA 2OOVA 2OOVC 4K1UA 1OH0A 1JJ22 2M7OA 1A90A 1Q824 2W56A 1VQL3 2E2UA 1RRLA 3LZAA 1WNHA 2BMOB 4LZIA 5DREA 4EYCA 1NDOB 4H3UA 1S5AA 4LMIA 1ZO2A 1W7CA 1OUNA 3MSOA 3GWRA 3WA2X 4FCMA 3F8XA 3OV4A 5D82A 3J7Yd 1ASKA 3PZWA 4TX4A 5FGOA 4LSOA 2BHMA 1LNHA 2P38A 3B7CA 4OK0A 3EE1A 4R9KA 1FGMA 1ULIB 1YIT3 2LQVA 3PS8A 4ZM8A 3WOEB 4U13A 4NREA 2KXGA 5A0OB 3NV0B 4CDLA 1CEWI 4HZBB 2W56B 3X42A 3LMLA 3I563 4WHAA 1W4NA 3SVAA 2Z77A 3RDEA 1W6CA 1YVBI 4JF8A 5D83A 3SEDA 3LH4A 3MG1A 2P0MA 3F9SA 1NB5I 1OHOA 1AR0A 3FF2A 2K0MA 1IU7A 2INXA 4L8PA 3NXJA 1EQKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EF8 A;  3F8H A;  4XBT A;  5HGR A;  1IDP A;  1JN5 A;  5IG4 A;  3EHC A;  2K54 A;  5IEP A;  2F99 A;  1O7W B;  1O7P B;  5AIF A;  2GBX B;  5BVB A;  4R9L A;  1ULJ B;  2PZV A;  3NV0 A;  1EA2 A;  4HM0 B;  4HM6 B;  3BLZ A;  1TUH A;  5TGN A;  1OGX A;  2HML B;  3MYT A;  3RGR A;  3KSP A;  3ROB A;  4HJL B;  1BUQ A;  1DMM A;  3KKG A;  3ER7 A;  5IEO A;  5IER A;  5IF6 A;  3FZW A;  2GBW B;  1OCV A;  3KE7 A;  3WMD A;  8CHO A;  3G0K A;  4FCJ A;  3IPT A;  4HKV B;  1GS3 A;  4HZ9 B;  4ORL A;  3FH1 A;  1E97 A;  1EG9 B;  1ZX2 A;  2A15 A;  3HK4 A;  1Q40 A;  4L8P A;  3MHE A;  4WYK A;  1JKG B;  2XRX B;  3LYG A;  4OUQ A;  4J9A A;  5EVH A;  5AIG A;  3FSD A;  1OHS A;  4L7K A;  4X2H A;  4XBX A;  5CF1 A;  1HKX A;  2F86 B;  2QIY A;  2XR8 B;  3DMC A;  1O7M B;  3NUV A;  5AIH A;  5CF2 A;  1QJG A;  3GZR A;  1GYB A;  5IEN A;  1JN5 B;  1W02 A;  3KZT A;  3SOY A;  2CHC A;  2RCD A;  1Q42 A;  2Z76 A;  3H3H A;  2W2C A;  1QMA A;  3F7X A;  4I4K A;  5BXQ A;  4HM4 B;  5JPP A;  2CKF B;  5STD A;  4XDW A;  5IG5 A;  3T8U A;  3NM2 A;  1STD A;  2UX0 A;  1UUW B;  3SOA A;  2BMQ B;  3FLJ A;  1GY7 A;  1JB5 A;  1Z1S A;  3A76 A;  1OF5 B;  4HM2 B;  4LEH A;  2RFR A;  3G8Z A;  1VZZ A;  3VGN A;  3E99 A;  2YFL B;  3NBR A;  3MKI A;  4Q53 A;  3DXO A;  3DZL A;  3K0Z A;  3OWY A;  4HM7 B;  3EX9 A;  2XSO B;  1C7H A;  1W6Y A;  4WWU C;  3STD A;  3CPO A;  5IG0 A;  2GEX A;  3MG3 A;  4STD A;  1OHP A;  1Q40 B;  3JUN A;  1K41 A;  3OX9 A;  4GB5 A;  4WYK B;  5KP4 A;  5CXO A;  1DMN A;  3OWS A;  5AEU B;  3EJV A;  1OPY A;  4R1K A;  2Z7A A;  5CK6 A;  2GEY A;  3B4P A;  5G2G A;  1GY6 A;  4XM4 A;  5FW5 A;  3M8C A;  4K1U A;  3EBY A;  1OH0 A;  5AI1 A;  2HMK B;  4LGQ A;  4HM5 B;  1E3V A;  3EBT A;  5AII A;  2YFI B;  1E3R A;  2QGU A;  3JUP A;  1W01 A;  3OWU A;  3BB9 A;  4IIA A;  4X2O A;  4HVN A;  2OWP A;  3LZA A;  3D9R A;  2BMO B;  5DRE A;  3S5C A;  3UNL A;  1NDO B;  1U5O A;  4H3U A;  1S5A A;  3GZB A;  3F7S A;  1ZO2 A;  4LMI A;  3HZP A;  6STD A;  1OUN A;  3MSO A;  1OF5 A;  3GWR A;  1DMQ A;  3FGY A;  3Q90 A;  3F8X A;  4FCM A;  3OV4 A;  3JUQ A;  3EN8 A;  4N3V A;  3H51 A;  3EC9 A;  5D82 A;  1O7N B;  1ASK A;  3EQQ B;  4XDV A;  2XSH B;  3JUM A;  3T8N A;  4MJD A;  3UJM A;  4K1V A;  4KVH A;  3DM8 A;  5IG3 A;  5KP1 A;  3HX8 A;  5AEW B;  3B7C A;  1ISK A;  3OXA A;  1O7H B;  1TP6 A;  3B8L A;  4PEJ A;  1UUV B;  2I9W A;  3JUO A;  1JB2 A;  1WQL B;  3ECF A;  4R9K A;  1W00 A;  1OGZ A;  3F14 A;  4HM3 B;  3GZY B;  5CLK A;  5DRV A;  1NU3 A;  1ULI B;  3RGA A;  2BNG A;  3EN1 B;  4XBY A;  5JPU A;  3I0Y A;  2B1X B;  3DUK A;  4U13 A;  5KP3 A;  2HMO B;  2HMJ B;  4HM1 B;  3NV0 B;  1JKG A;  3NXJ A;  4HZB B;  4CDL A;  2F98 A;  3VSY A;  3MG2 A;  1GY5 A;  2JQ5 A;  3B4O A;  1CQS A;  4HM8 B;  5D81 A;  7STD A;  1O7G B;  3G16 A;  2Z77 A;  2HMM B;  1SJW A;  2IMJ A;  3CNM A;  5D83 A;  1NWW A;  3SED A;  2HMN B;  2B24 B;  3FKA A;  3NHX A;  3MG1 A;  2BMR B;  3F9S A;  4RZM A;  2YFJ B;  4XB5 A;  2RGQ A;  1OHO A;  3CNX A;  3F40 A;  3GZX B;  4WP5 A;  1AR0 A;  3FF2 A;  1JB4 A;  3FF0 A;  4J8T A;  4L8O A;  2R4I A;  2GXF A;  4OVM A;  1A2K A;  2INX A;  3GRD A;  3K7C A;  2STD A;  3CU3 A; 
#chains in the Genus database with same CATH topology
 1M1X B;  7RNT A;  5HGR A;  1A2V A;  1R4C A;  2ZHX B;  3LOY A;  2RSX A;  3CCM 3;  1M9G A;  1VQ9 3;  5EQL A;  3URP A;  1UI7 A;  2BU4 A;  2GBX B;  3U97 A;  4BU4 A;  2PZV A;  1GOV A;  6GSP A;  5TGN A;  3DGL A;  1FZU A;  3MYT A;  2ZL8 A;  1ROV A;  2AAD A;  1K28 A;  3D4A A;  3LT8 A;  1YJN 3;  1J2B A;  1OCV A;  2Q07 A;  3KFQ C;  4BIR A;  4EXR A;  3IPT A;  4R80 A;  2UGI A;  1PYL A;  1RN7 A;  1ROA A;  3KII A;  5IW9 A;  3FH1 A;  1E97 A;  3D5I A;  4MMX B;  4RBN A;  1RGC A;  4WYK A;  1JKG B;  3WOF B;  4K90 B;  1T2H A;  5AYR B;  4X2H A;  1FGO A;  1M90 4;  1RGA A;  1HKX A;  2XF3 A;  3DMC A;  1JNQ A;  5AIH A;  3V98 A;  3VF1 A;  5IEN A;  1JN5 B;  5BIR A;  4BTW A;  1W6G A;  1X1U A;  3H3H A;  4I4K A;  2CK3 H;  1LQM B;  3NBB A;  3ALA A;  1AVK A;  2YX9 A;  4XDW A;  5IG5 A;  3CCS 3;  3NM2 A;  2UX0 A;  3NM7 A;  3AMO A;  3SOA A;  4RNY A;  1LOX A;  2CWT A;  1YVS A;  1TU5 A;  2OQE C;  3WA3 A;  1JB5 A;  1I2G A;  2CFL A;  2H0H A;  2MF7 A;  3PXM A;  2RFR A;  1VQ6 3;  4MEI A;  4N6L A;  3DXO A;  5GSP A;  1IQY A;  4HM7 B;  3EX9 A;  1W6Y A;  5ELU A;  3EB8 A;  1RNB A;  2GEX A;  3LXU X;  3CC2 3;  1OHP A;  3OX9 A;  4HYZ A;  1K41 A;  1RSN A;  1RRH A;  5CXO A;  2BT3 A;  3OWS A;  1B3S A;  5CK6 A;  2HOH A;  1I2F A;  2SAR A;  3B4P A;  5G2G A;  1G0T A;  5FW5 A;  3M8C A;  1LXE A;  4AKZ A;  4J5K A;  4LYL B;  1Y4K A;  1UUG B;  3DGO A;  2W03 A;  2OTJ 3;  1FYS A;  3T0U A;  1RHL A;  3JUP A;  1W01 A;  4IIA A;  1JBS A;  2O9U X;  3FG1 A;  1YJ9 3;  1U5O A;  1MWS A;  3GZB A;  3HOH A;  2XEP A;  1OF5 A;  1ZS7 A;  3Q90 A;  3X40 A;  2FGT A;  1DVD A;  5I97 A;  1O7N B;  3N9H A;  3JUM A;  3K63 A;  1UW1 A;  1MWT A;  3JVC A;  1ZGX A;  3HX8 A;  1YNV X;  1B27 A;  3OXA A;  1ISK A;  1I2E A;  2F56 A;  1BRG A;  1TP6 A;  2WOF A;  3DH2 A;  4AKY A;  3G4S 3;  1W00 A;  3CXC 2;  3V92 A;  1YHQ 3;  2E2T A;  3CC7 3;  1G02 A;  1RDS A;  3RGA A;  2WGQ A;  3OW2 2;  2BNG A;  1NO3 A;  4XBY A;  5JPU A;  1M1K 4;  1RGH A;  2BIR A;  1N9J A;  2L1S A;  2P09 A;  2KF5 A;  2XH9 A;  3PCR A;  1K73 4;  3AGO A;  1JV2 B;  2KF6 A;  1VQM 3;  2F98 A;  3N54 B;  4KT3 B;  3BND A;  5D81 A;  2JQ5 A;  4HM8 B;  1IVU A;  4JRF A;  2JDI H;  1B2M A;  1GMR A;  1NWW A;  3FKA A;  3WDG B;  1N8Q A;  3KSE D;  4IPB A;  2W6J H;  2WGO A;  1JRQ A;  1TIJ A;  3AHS A;  3LT9 A;  5EVH A;  4OVM A;  3FF0 A;  4J8T A;  2IUK A;  1A2K A;  3GRD A;  3K7C A;  1BAO A;  2STD A;  3CU3 A;  1LRA A;  2IY2 A;  1JZD A;  1NB3 I;  4XBT A;  1IDP A;  1JN5 A;  2CC3 A;  3NQZ A;  3EHC A;  1YIJ 3;  2E2V A;  1UGI A;  1B20 A;  2KF4 A;  1BSB A;  4R9L A;  3BNC A;  4N6O B;  4HM6 B;  4GSP A;  3BLZ A;  3KCH A;  1IVW A;  1TUH A;  3CCQ 3;  2HML B;  3KSP A;  3QRD A;  3ROB A;  3D79 A;  1HZ1 A;  1Q7Y 4;  1DMM A;  4HBR A;  1EKM A;  4N6N B;  3CCJ 3;  1AVL A;  1BAN A;  1MOL A;  3FZW A;  2GBW B;  4FR9 A;  3WMD A;  1GOU A;  1YI2 3;  3Q3F A;  4HKV B;  5M1A A;  4BTY A;  1TFO A;  4AEQ A;  1EG9 B;  3O8Y A;  3CME 3;  1Q40 A;  3N8B A;  3MHE A;  2XRX B;  2P05 A;  3QK9 A;  1IYY A;  3DGN A;  3DGM A;  5AIG A;  3FSD A;  4L7K A;  2F86 B;  1FGR A;  1QJG A;  1LOY A;  1RGG A;  3K9M C;  3SXX A;  1GYB A;  5IG3 A;  5BXQ A;  2RCD A;  2Z76 A;  1KD1 4;  3F7X A;  4KZ1 A;  1US1 A;  2O3O A;  2F5M A;  1JBR A;  3S28 A;  3T8U A;  2J8X B;  1U8C B;  1UI8 A;  2BMQ B;  4NPB A;  1GY7 A;  1LQG C;  1RMS A;  3E99 A;  5HOH A;  3K5T A;  3NBR A;  3MKI A;  4H61 A;  4Q53 A;  1JBT A;  4MMY B;  2CWU A;  3K0Z A;  4N6V 0;  3ZG5 A;  1AQZ A;  2XSO B;  3STD A;  3CCV 3;  2CFK A;  1CYV A;  4GB5 A;  4EV5 A;  2ZA4 A;  1DMN A;  5AEU B;  5G1K A;  1OPY A;  2CFG A;  2GEY A;  4XM4 A;  1BSC A;  2W9Q A;  1VQO 3;  1BSA A;  3EBY A;  4EC6 A;  2IA7 A;  1Q86 4;  1DET A;  4LGQ A;  1QAK A;  4HM5 B;  1E3V A;  1BSE A;  1E3R A;  2CG0 A;  3CCE 3;  1LOW A;  4HVN A;  1IK3 A;  3FG3 A;  1WMN A;  3F7S A;  3HZP A;  1IVX A;  1MGW A;  3JUQ A;  3EN8 A;  4KFF A;  3EC9 A;  1L5G B;  4KVH A;  1N5H A;  3DM8 A;  3WOD G;  5KP1 A;  3IMA B;  2ML5 A;  1I3I A;  2I9W A;  3JUO A;  1JB2 A;  1WQL B;  2OTL 3;  4BL3 A;  1OGZ A;  4HM3 B;  3GZY B;  4GHO A;  1W2Z A;  5CLK A;  5DRV A;  2OCT A;  1GMP A;  8RNT A;  3MWZ A;  1MNL A;  3EN1 B;  1SQW A;  3DUK A;  1FA3 A;  3CCR 3;  1JKG A;  2LYX A;  1GD4 A;  3VSY A;  5JBS A;  3MG2 A;  2CFW A;  7STD A;  1X1W A;  1O7G B;  1SII A;  4N6U A;  1HU9 A;  2HMM B;  2IMJ A;  3CNM A;  3FCS B;  2CWV A;  2HMN B;  1KWI A;  1FUS A;  2V1L A;  2W04 A;  1X1Y A;  1VQ8 3;  2BMR B;  2WO0 A;  4HAA A;  4RZM A;  2YFJ B;  1Q7H A;  1QAL A;  1FUW A;  1IT7 A;  3CNX A;  3CCL 3;  1JB4 A;  1RTU A;  1BNE A;  1UGH I;  2C10 A;  2CX0 A;  2R4I A;  3LTC A;  4L8O A;  2H0G A;  1DVC A;  3EF8 A;  1PU4 A;  1CH0 A;  2CG1 A;  5IG4 A;  1TFK A;  3FG4 A;  3PGB A;  1DE3 A;  1O7W B;  1B2Z A;  5AIF A;  1BGS A;  3RNT A;  1LOV A;  1T3B A;  2Z6B A;  1TRP A;  3NV0 A;  4HM0 B;  4O2H A;  4CCV A;  1VQK 3;  1C54 A;  1TTO A;  4HOH A;  1OGX A;  1T2I A;  4HJL B;  3KKG A;  3KE7 A;  8CHO A;  2KF3 A;  3G0K A;  2D42 A;  1BUJ A;  2CIU A;  2IUJ A;  1ZX2 A;  2A15 A;  3HK4 A;  3NBJ A;  1HYF A;  3SX1 A;  1YJW 3;  1FW7 A;  2CFD A;  1I0V A;  4OUQ A;  4J9A A;  1AV4 A;  1OHS A;  5CF1 A;  2XR8 B;  3MPH A;  5RNT A;  2C11 A;  4CJN A;  3GZR A;  1IQX A;  1W02 A;  3SOY A;  5EEO A;  1Q42 A;  4EBG A;  1CYU A;  1AY7 A;  5JPP A;  1S72 3;  2CKF B;  1WMO A;  5STD A;  1MGR A;  3GAX A;  1STD A;  1B21 A;  1UUW B;  1BNS A;  2OQE A;  3CCU 3;  3SYU A;  4EV2 A;  1IV9 A;  4G1M B;  1WMP A;  1OF5 B;  4HM2 B;  3SLU A;  3G8Z A;  1F8N A;  1VZZ A;  3VGN A;  4BTX A;  4N6M A;  3CMA 3;  2YFL B;  1TJD A;  2RBI A;  3V99 A;  1BRH A;  1LVN A;  1PFP A;  1KSI A;  3DZL A;  3OWY A;  4WFO A;  1Q81 4;  1C7H A;  3HII A;  1GOY A;  3CPO A;  2XGL A;  1Q40 B;  1RLS A;  3X3Z A;  4WYK B;  4FMB A;  6RNT A;  2QA4 3;  5AYS C;  1BIR A;  4KFE A;  4R1K A;  3DGY A;  4FCZ A;  1GSP A;  3PYJ A;  1MWR A;  3KN4 A;  3A5E A;  2SBL A;  2FNQ A;  1GY6 A;  2D1W A;  3BNE A;  4O3V A;  3G6E 3;  5AI1 A;  1D6U A;  3D5G A;  3WHO A;  2HMK B;  1A2P A;  3EBT A;  5AII A;  2YFI B;  2QGU A;  3OWU A;  4X2O A;  2MC8 A;  3BB9 A;  2W0Q A;  1QVG 2;  2OWP A;  3D9R A;  3UNL A;  3S5C A;  1BRI A;  6STD A;  3S29 A;  3DY5 A;  1DMQ A;  1DYU A;  3FGY A;  4N3V A;  1VQ4 3;  3H51 A;  3EQQ B;  1B2S A;  4XDV A;  3T8N A;  2XSH B;  3UJM A;  4MJD A;  4K1V A;  1VQ5 3;  3CD6 3;  1R4Y A;  1WTH A;  5G1L A;  4DKI A;  4EW5 A;  3S27 A;  1I0X A;  5AEW B;  1O7H B;  4PEJ A;  2ML6 A;  3B8L A;  1UUV B;  3NQY A;  1Q9E A;  2F5W A;  3ECF A;  4FMD A;  1G96 A;  3F14 A;  1BSD A;  1NU3 A;  3U1W A;  5M19 A;  1IT8 A;  1RGL A;  1RKY A;  3Q1C A;  2B1X B;  1FGT A;  5KP3 A;  2P0X A;  2HMO B;  2HMJ B;  4HM1 B;  3AHW A;  1A67 A;  1BRK A;  2KCD A;  2XFT A;  1GY5 A;  1I3F A;  1FUT A;  1CQS A;  2WOH A;  2Y73 A;  3B4O A;  1T5Y A;  3G16 A;  3Q2P A;  1IVV A;  4IT7 A;  1YGE A;  1NJI 4;  1NNV A;  1SJW A;  1K8A 4;  1VQN 3;  3NHX A;  2B24 B;  3WR2 A;  2GSP A;  3BNB A;  1RGK A;  1D6Y A;  1UCJ A;  1EUI C;  2C4B A;  4XB5 A;  3TDG A;  2W9P A;  5LC7 A;  2RGQ A;  2UUG C;  3F40 A;  1SPU A;  3GZX B;  3HIG A;  4WP5 A;  2KRT A;  3UB1 A;  4ILF A;  2GU1 A;  2GXF A;  2H0I A;  1JZO A;  3X3Y A;  1FGQ A;  2K3D A;  3I0Y A;  1KC8 4;  3LTB A;  1QAF A;  3F8H A;  3L0R A;  3X41 A;  1N5P A;  3HI7 A;  2K54 A;  2QEX 3;  5IEP A;  2F99 A;  1O7P B;  3D3L A;  1RGF A;  5BVB A;  1RCK A;  1W2B 2;  1ULJ B;  2ZDJ A;  1QVF 2;  9RNT A;  1EA2 A;  3AMO B;  3CC4 3;  1SIH A;  1K9M 4;  3RGR A;  4BL2 A;  2L4V A;  4O02 B;  1BUQ A;  5BU4 A;  3ER7 A;  1RN4 A;  1RNT A;  5IEO A;  5IER A;  1IQ8 A;  5ELJ A;  5IF6 A;  3S67 A;  3ZG0 A;  4FCJ A;  4HZ9 B;  1GS3 A;  4K61 A;  4ORL A;  3CPW 2;  2PNC A;  2BO9 B;  4RNZ A;  1PY3 A;  3G71 3;  1STF I;  3LYG A;  2CH9 A;  1I8V A;  3X3X A;  1UCK A;  4XBX A;  4CPK A;  1MWU A;  4FMA A;  1VQ7 3;  2QIY A;  2XFS A;  1KQS 2;  1O7M B;  3NUV A;  3BIR A;  4MMZ B;  1W5Z A;  5CF2 A;  5LC6 A;  3I55 3;  4R4K A;  4GL6 A;  3KZT A;  1RCL A;  2CHC A;  2Y74 A;  2W2C A;  1QMA A;  1IV7 A;  4FMC A;  1N8R 4;  4HM4 B;  2XGN A;  4O8S A;  1UDI I;  2CW9 A;  1GMQ A;  3LTA A;  2IYJ A;  3FLJ A;  3LTD A;  3GSP A;  1Z1S A;  3A76 A;  4LEH A;  3UL6 A;  4NHF A;  5M18 A;  1GD3 A;  1D6Z A;  1RJO A;  1V74 A;  2GU3 A;  4KFD A;  1B2X A;  1UCI A;  4J5G A;  4WWU C;  1OAC A;  5IG0 A;  3MG3 A;  4STD A;  2FXT A;  3NX0 A;  3JUN A;  4QWT A;  7GSP A;  5KP4 A;  3UL5 A;  1VQP 3;  3IJE B;  4N6T A;  3EJV A;  2Z7A A;  1SAR A;  1N9E A;  4RNT A;  3PCS A;  1EEJ A;  2OOV A;  1BRJ A;  2OOV C;  4K1U A;  1OH0 A;  1JJ2 2;  2M7O A;  1A90 A;  1LNI A;  1Q82 4;  2W56 A;  1VQL 3;  2E2U A;  1BNI A;  1RRL A;  3LZA A;  1WNH A;  2BMO B;  4LZI A;  5DRE A;  4EYC A;  1NDO B;  4H3U A;  1S5A A;  4LMI A;  1ZO2 A;  1W7C A;  1TRQ A;  2R41 A;  1OUN A;  3MSO A;  3GWR A;  3WA2 X;  1BOX A;  2AAE A;  3F8X A;  4FCM A;  3OV4 A;  1YGW A;  4I5Q A;  5D82 A;  1ASK A;  3AGN A;  3J7Y d;  3PZW A;  4TX4 A;  3BU4 A;  5FGO A;  4LSO A;  2BHM A;  1X1X A;  2RNT A;  1V57 A;  1LNH A;  2P38 A;  3B7C A;  1BNJ A;  2KAA A;  3EE1 A;  1V58 A;  2F4Y A;  4OK0 A;  4R9K A;  1FGM A;  1BVI A;  1ULI B;  1YIT 3;  2LQV A;  1BU4 A;  3PS8 A;  3WOE B;  4ZM8 A;  1BNR A;  4U13 A;  4NRE A;  2KXG A;  5A0O B;  3NV0 B;  4CDL A;  1CEW I;  4HZB B;  2W56 B;  3X42 A;  3LML A;  1UCL A;  3I56 3;  4WHA A;  1W4N A;  3SVA A;  2Z77 A;  3RDE A;  1W6C A;  1YVB I;  1BNF A;  4JF8 A;  5D83 A;  1B2U A;  3SED A;  3LH4 A;  1RN1 A;  3MG1 A;  3ZFZ A;  1RGE A;  2P0M A;  3F9S A;  1BNG A;  1NB5 I;  2CX1 A;  1BRN L;  1I70 A;  1OHO A;  1AR0 A;  3FF2 A;  2K0M A;  1BRS A;  1IU7 A;  1VQQ A;  2INX A;  4L8P A;  3NXJ A;  1EQK A; 
#chains in the Genus database with same CATH homology
 1M1X B;  5HGR A;  1A2V A;  1R4C A;  3LOY A;  2RSX A;  3CCM 3;  1M9G A;  1VQ9 3;  5EQL A;  1UI7 A;  2GBX B;  3U97 A;  2PZV A;  5TGN A;  3DGL A;  3MYT A;  2ZL8 A;  1ROV A;  1K28 A;  3LT8 A;  1YJN 3;  1J2B A;  1OCV A;  2Q07 A;  3KFQ C;  4EXR A;  3IPT A;  4R80 A;  1ROA A;  1RN7 A;  3KII A;  5IW9 A;  3FH1 A;  1E97 A;  4MMX B;  4WYK A;  1JKG B;  3WOF B;  4K90 B;  5AYR B;  4X2H A;  1FGO A;  1M90 4;  1HKX A;  2XF3 A;  3DMC A;  1JNQ A;  5AIH A;  3V98 A;  3VF1 A;  5IEN A;  1JN5 B;  1W6G A;  3H3H A;  4I4K A;  2CK3 H;  3NBB A;  3ALA A;  1AVK A;  2YX9 A;  4XDW A;  5IG5 A;  3CCS 3;  3NM2 A;  2UX0 A;  3NM7 A;  3AMO A;  3SOA A;  4RNY A;  1LOX A;  2CWT A;  1TU5 A;  3WA3 A;  2OQE C;  1JB5 A;  2CFL A;  3PXM A;  2MF7 A;  2RFR A;  1VQ6 3;  4MEI A;  4N6L A;  3DXO A;  1IQY A;  4HM7 B;  3EX9 A;  1W6Y A;  5ELU A;  3EB8 A;  2GEX A;  3LXU X;  3CC2 3;  1OHP A;  3OX9 A;  4HYZ A;  1K41 A;  1RRH A;  5CXO A;  2BT3 A;  3OWS A;  5CK6 A;  3B4P A;  5G2G A;  5FW5 A;  3M8C A;  1LXE A;  4AKZ A;  1Y4K A;  3DGO A;  2W03 A;  2OTJ 3;  3T0U A;  3JUP A;  1W01 A;  4IIA A;  2O9U X;  3FG1 A;  1YJ9 3;  1U5O A;  3GZB A;  2XEP A;  1OF5 A;  3Q90 A;  3X40 A;  2FGT A;  1DVD A;  5I97 A;  1O7N B;  3N9H A;  3JUM A;  3K63 A;  1UW1 A;  3JVC A;  3HX8 A;  1ISK A;  3OXA A;  1TP6 A;  2WOF A;  4AKY A;  3G4S 3;  1W00 A;  3CXC 2;  3V92 A;  1YHQ 3;  2E2T A;  3CC7 3;  1M1K 4;  3RGA A;  2WGQ A;  3OW2 2;  2BNG A;  1NO3 A;  4XBY A;  5JPU A;  1N9J A;  2P09 A;  2XH9 A;  3PCR A;  1K73 4;  1VQM 3;  1JV2 B;  2F98 A;  3N54 B;  3BND A;  5D81 A;  2JQ5 A;  4HM8 B;  1IVU A;  4JRF A;  2JDI H;  1NWW A;  3FKA A;  3WDG B;  1N8Q A;  3KSE D;  4IPB A;  2W6J H;  2WGO A;  1JRQ A;  1TIJ A;  3LT9 A;  5EVH A;  4OVM A;  3FF0 A;  4J8T A;  2IUK A;  1A2K A;  3GRD A;  3K7C A;  2STD A;  3CU3 A;  4XBT A;  1NB3 I;  1IDP A;  1JN5 A;  2CC3 A;  3NQZ A;  3EHC A;  1YIJ 3;  2E2V A;  4R9L A;  3BNC A;  4N6O B;  4HM6 B;  3BLZ A;  3CCQ 3;  1IVW A;  1TUH A;  2HML B;  3KSP A;  3QRD A;  3ROB A;  1Q7Y 4;  1DMM A;  4HBR A;  1EKM A;  4N6N B;  3CCJ 3;  1AVL A;  1MOL A;  3FZW A;  1YI2 3;  2GBW B;  4FR9 A;  3WMD A;  4HKV B;  4BTY A;  1TFO A;  4AEQ A;  1EG9 B;  3O8Y A;  3CME 3;  1Q40 A;  3N8B A;  3MHE A;  2XRX B;  2P05 A;  3QK9 A;  3DGN A;  3DGM A;  5AIG A;  3FSD A;  4L7K A;  2F86 B;  1FGR A;  1QJG A;  3K9M C;  3SXX A;  1GYB A;  5IG3 A;  5BXQ A;  2RCD A;  2Z76 A;  1KD1 4;  3F7X A;  4KZ1 A;  1US1 A;  2O3O A;  3S28 A;  3T8U A;  1U8C B;  1UI8 A;  2BMQ B;  1GY7 A;  3E99 A;  3K5T A;  3NBR A;  3MKI A;  4H61 A;  4Q53 A;  4MMY B;  2CWU A;  3K0Z A;  4N6V 0;  2XSO B;  3STD A;  3CCV 3;  2CFK A;  1CYV A;  4GB5 A;  4EV5 A;  1DMN A;  5AEU B;  1OPY A;  2CFG A;  2GEY A;  4XM4 A;  2W9Q A;  1VQO 3;  3EBY A;  4EC6 A;  2IA7 A;  1Q86 4;  4LGQ A;  1QAK A;  4HM5 B;  1E3V A;  1E3R A;  3CCE 3;  2CG0 A;  4HVN A;  1IK3 A;  3FG3 A;  1WMN A;  3F7S A;  3HZP A;  1IVX A;  3JUQ A;  3EN8 A;  4KFF A;  3EC9 A;  1L5G B;  4KVH A;  1N5H A;  3DM8 A;  3WOD G;  5KP1 A;  3IMA B;  2ML5 A;  2I9W A;  3JUO A;  1JB2 A;  1WQL B;  2OTL 3;  1OGZ A;  4HM3 B;  3GZY B;  5CLK A;  1W2Z A;  5DRV A;  2OCT A;  3MWZ A;  1MNL A;  3EN1 B;  1SQW A;  3DUK A;  1FA3 A;  3CCR 3;  1JKG A;  2LYX A;  1GD4 A;  3VSY A;  5JBS A;  3MG2 A;  2CFW A;  7STD A;  1O7G B;  1SII A;  4N6U A;  1HU9 A;  3CNM A;  2HMM B;  2IMJ A;  3FCS B;  2CWV A;  2HMN B;  1KWI A;  2V1L A;  2W04 A;  1VQ8 3;  2BMR B;  2WO0 A;  4RZM A;  2YFJ B;  1QAL A;  1FUW A;  1IT7 A;  3CNX A;  3CCL 3;  1JB4 A;  2C10 A;  4L8O A;  2R4I A;  3LTC A;  1DVC A;  3EF8 A;  1PU4 A;  2CG1 A;  5IG4 A;  1TFK A;  3FG4 A;  3PGB A;  1O7W B;  5AIF A;  2Z6B A;  3NV0 A;  4HM0 B;  4O2H A;  4CCV A;  1VQK 3;  1OGX A;  4HJL B;  3KKG A;  3KE7 A;  8CHO A;  3G0K A;  2D42 A;  2CIU A;  2IUJ A;  1ZX2 A;  2A15 A;  3HK4 A;  3NBJ A;  3SX1 A;  1YJW 3;  2CFD A;  4OUQ A;  4J9A A;  1AV4 A;  1OHS A;  5CF1 A;  2XR8 B;  3MPH A;  2C11 A;  3GZR A;  1IQX A;  1W02 A;  3SOY A;  5EEO A;  1Q42 A;  4EBG A;  1CYU A;  5JPP A;  1S72 3;  2CKF B;  1WMO A;  5STD A;  3GAX A;  1STD A;  1UUW B;  2OQE A;  3CCU 3;  4EV2 A;  1IV9 A;  4G1M B;  1WMP A;  1OF5 B;  4HM2 B;  3SLU A;  3G8Z A;  1F8N A;  1VZZ A;  3VGN A;  4BTX A;  4N6M A;  3CMA 3;  2YFL B;  3V99 A;  1LVN A;  1PFP A;  3DZL A;  1KSI A;  3OWY A;  4WFO A;  1Q81 4;  1C7H A;  3HII A;  3CPO A;  2XGL A;  1Q40 B;  3X3Z A;  4WYK B;  4FMB A;  2QA4 3;  5AYS C;  4KFE A;  4R1K A;  4FCZ A;  3PYJ A;  3KN4 A;  3BNE A;  2SBL A;  2FNQ A;  1GY6 A;  2D1W A;  4O3V A;  3G6E 3;  5AI1 A;  1D6U A;  2HMK B;  3EBT A;  5AII A;  2YFI B;  2QGU A;  3OWU A;  4X2O A;  2MC8 A;  3BB9 A;  2W0Q A;  1QVG 2;  2OWP A;  3D9R A;  3UNL A;  3S5C A;  6STD A;  3S29 A;  3DY5 A;  1DMQ A;  1DYU A;  3FGY A;  4N3V A;  1VQ4 3;  3H51 A;  3EQQ B;  3T8N A;  4XDV A;  2XSH B;  3UJM A;  4MJD A;  4K1V A;  1VQ5 3;  3CD6 3;  1WTH A;  3S27 A;  5AEW B;  1O7H B;  4PEJ A;  2ML6 A;  3B8L A;  1UUV B;  3NQY A;  3ECF A;  4FMD A;  1G96 A;  3F14 A;  1NU3 A;  3U1W A;  1IT8 A;  1RKY A;  3Q1C A;  2B1X B;  1FGT A;  5KP3 A;  2P0X A;  2HMO B;  2HMJ B;  4HM1 B;  1A67 A;  2KCD A;  2XFT A;  1GY5 A;  4BTW A;  3B4O A;  1CQS A;  2WOH A;  2Y73 A;  4RBN A;  1T5Y A;  3G16 A;  3Q2P A;  1IVV A;  4IT7 A;  1YGE A;  1NJI 4;  1SJW A;  1K8A 4;  1VQN 3;  3NHX A;  2B24 B;  3BNB A;  1D6Y A;  3TDG A;  4XB5 A;  2W9P A;  5LC7 A;  2RGQ A;  3GZX B;  3F40 A;  1SPU A;  3HIG A;  4WP5 A;  3UB1 A;  2KRT A;  2GU1 A;  2GXF A;  3X3Y A;  1FGQ A;  3I0Y A;  1KC8 4;  3LTB A;  1QAF A;  3F8H A;  3L0R A;  3X41 A;  1N5P A;  3HI7 A;  2K54 A;  2QEX 3;  5IEP A;  2F99 A;  1O7P B;  3D3L A;  5BVB A;  1W2B 2;  1ULJ B;  2ZDJ A;  1QVF 2;  1EA2 A;  3AMO B;  3CC4 3;  1SIH A;  1K9M 4;  3RGR A;  2L4V A;  4O02 B;  1BUQ A;  3ER7 A;  5IEO A;  5IER A;  1IQ8 A;  5ELJ A;  5IF6 A;  3S67 A;  4FCJ A;  4HZ9 B;  1GS3 A;  4K61 A;  4ORL A;  3CPW 2;  2PNC A;  2BO9 B;  4RNZ A;  3G71 3;  1STF I;  3LYG A;  2CH9 A;  3X3X A;  1KQS 2;  4XBX A;  4FMA A;  1VQ7 3;  2QIY A;  2XFS A;  1O7M B;  3NUV A;  4MMZ B;  5CF2 A;  1W5Z A;  3I55 3;  5LC6 A;  4R4K A;  4GL6 A;  3KZT A;  2Y74 A;  2CHC A;  2W2C A;  1QMA A;  1IV7 A;  4FMC A;  1N8R 4;  4HM4 B;  2XGN A;  4O8S A;  2CW9 A;  3LTA A;  3LTD A;  3FLJ A;  3A76 A;  1Z1S A;  4LEH A;  3UL6 A;  4NHF A;  1GD3 A;  1D6Z A;  1RJO A;  1V74 A;  2GU3 A;  4KFD A;  4WWU C;  1OAC A;  5IG0 A;  3MG3 A;  4STD A;  2FXT A;  3NX0 A;  3JUN A;  4QWT A;  5KP4 A;  3UL5 A;  1VQP 3;  3IJE B;  4N6T A;  3EJV A;  2Z7A A;  1N9E A;  3PCS A;  2OOV A;  2OOV C;  4K1U A;  1OH0 A;  1JJ2 2;  2M7O A;  1A90 A;  1Q82 4;  2W56 A;  1VQL 3;  2E2U A;  1RRL A;  3LZA A;  1WNH A;  2BMO B;  4LZI A;  5DRE A;  4EYC A;  1NDO B;  4H3U A;  1S5A A;  4LMI A;  1ZO2 A;  1W7C A;  1OUN A;  3MSO A;  3GWR A;  3WA2 X;  4FCM A;  3F8X A;  3OV4 A;  5D82 A;  3J7Y d;  1ASK A;  3PZW A;  4TX4 A;  5FGO A;  4LSO A;  2BHM A;  1LNH A;  2P38 A;  3B7C A;  4OK0 A;  3EE1 A;  4R9K A;  1FGM A;  1ULI B;  1YIT 3;  2LQV A;  3PS8 A;  4ZM8 A;  3WOE B;  4U13 A;  4NRE A;  2KXG A;  5A0O B;  3NV0 B;  4CDL A;  1CEW I;  4HZB B;  2W56 B;  3X42 A;  3LML A;  3I56 3;  4WHA A;  1W4N A;  3SVA A;  2Z77 A;  3RDE A;  1W6C A;  1YVB I;  4JF8 A;  5D83 A;  3SED A;  3LH4 A;  3MG1 A;  2P0M A;  3F9S A;  1NB5 I;  1OHO A;  1AR0 A;  3FF2 A;  2K0M A;  1IU7 A;  2INX A;  4L8P A;  3NXJ A;  1EQK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...