3LYGA

Crystal structure of ntf2-like protein of unknown function (yp_270605.1) from colwellia psychrerythraea 34h at 1.61 a resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
120
structure length
120
Chain Sequence
b'GMNLANIVQRGWEALGAGDFDTLVTDYVEKMIFIMPGQADVLKGRQAFRSALDNLGEILPPGFEITGLRQLEGENEIVSIVEWKSDKMIASQLSVLFKFEGDQIYEERWFVDTEQWKSVF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NTF2-like protein of unknown function
publication title Crystal structure of NTF2-like protein of unknown function (YP_270605.1) from Colwellia psychrerythraea 34H at 1.61 A resolution
rcsb
source organism Colwellia psychrerythraea
molecule tags Structural genomics, unknown function
total genus 35
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2010-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3lygA00
1A2KA 1ZX2A 4XBYA 4HM7B 1BUQA 3GZXB 1JKGA 4WWUC 2XRXB 1QJGA 3EJVA 5IF6A 3UNLA 2A15A 1OHPA 4N3VA 3SOYA 3GZYB 3MSOA 5DREA 5KP3A 3FH1A 4XBXA 3NUVA 1GY6A 4XB5A 5D83A 3GZBA 5D81A 3KKGA 1K41A 2R4IA 4XBTA 2RFRA 1NU3A 5AEWB 3HZPA 1ISKA 5CXOA 2HMKB 2BMQB 3OV4A 5AIFA 1AR0A 3F8HA 1JB4A 3HK4A 4OUQA 3GZRA 4K1VA 5JPPA 2YFLB 3OXAA 3BB9A 4XDVA 4J9AA 1W00A 3DMCA 3A76A 5DRVA 2UX0A 1U5OA 1GYBA 1C7HA 3GWRA 4WP5A 4I4KA 4HM8B 1JB5A 5IG5A 4LMIA 2BMRB 1OHSA 3T8UA 3CNMA 1QMAA 2JQ5A 1W01A 4ORLA 2K54A 4HM0B 2W2CA 3JUNA 4HVNA 1TP6A 2Z7AA 2RGQA 4LEHA 3KSPA 3OWUA 1O7WB 3DM8A 3EN1B 3SEDA 1W6YA 3EC9A 2GXFA 3OWYA 3I0YA 4OVMA 3NM2A 3UJMA 3B7CA 1IDPA 1O7MB 3MKIA 2BMOB 3FGYA 4L7KA 3SOAA 5G2GA 5AIIA 5BVBA 3B4OA 3MG2A 3H51A 1STDA 5IG4A 4U13A 4R9KA 1OPYA 3EBYA 3F9SA 2YFJB 3EBTA 5FW5A 1OHOA 1OGZA 3F7XA 5IERA 3HX8A 3WMDA 5BXQA 3DXOA 1O7NB 4HJLB 3EQQB 2HMOB 1WQLB 1GY5A 1E97A 3NBRA 4HZBB 4L8OA 1OGXA 1EG9B 2F86B 1EA2A 4HM5B 1OH0A 2STDA 2HMJB 2QGUA 4R1KA 3GRDA 5KP4A 4X2HA 2RCDA 5HGRA 4Q53A 2CHCA 5IENA 5IG3A 3NV0B 2OWPA 3FKAA 1GY7A 1VZZA 3FSDA 4IIAA 2B24B 1OF5B 5CLKA 2Z76A 5AI1A 4K1UA 1W02A 3FF0A 3Q90A 1NWWA 3MHEA 2IMJA 2F98A 3RGRA 3OWSA 4RZMA 3VGNA 1NDOB 1ASKA 3FF2A 4WYKA 1O7HB 4GB5A 4STDA 1Q40B 5IEOA 4PEJA 3G8ZA 5D82A 3M8CA 3MG1A 1ULIB 1JN5A 4R9LA 2CKFB 3JUOA 4XM4A 1TUHA 1Q42A 2HMMB 3CNXA 2B1XB 1ZO2A 2GEXA 2GBXB 3CU3A 3KZTA 1UUWB 3STDA 3S5CA 3F7SA 5IEPA 4WYKB 3JUQA 3F8XA 3E99A 4HZ9B 5TGNA 2XSOB 3H3HA 1S5AA 3MYTA 1JN5B 2I9WA 3ROBA 4KVHA 6STDA 3B8LA 3EF8A 3RGAA 3CPOA 2INXA 4XDWA 1JB2A 2QIYA 1OCVA 4HM1B 1ULJB 3EN8A 5EVHA 5AEUB 3NV0A 4CDLA 5AIGA 5CK6A 8CHOA 1DMQA 3KE7A 4H3UA 2HMNB 5CF2A 5AIHA 1OF5A 4FCJA 3ER7A 1GS3A 3F14A 3DUKA 3EHCA 5KP1A 5CF1A 3LZAA 3MG3A 4HM2B 1Q40A 1Z1SA 1JKGB 2YFIB 4HM4B 4LGQA 1SJWA 1DMMA 2F99A 5IG0A 3JUMA 1HKXA 1DMNA 3FZWA 3IPTA 1E3VA 3K0ZA 3LYGA 2BNGA 5STDA 1UUVB 1E3RA 3B4PA 2GEYA 7STDA 2XR8B 3DZLA 4HM3B 3NXJA 2PZVA 3VSYA 4HM6B 4X2OA 3K7CA 3OX9A 2XSHB 3EX9A 3FLJA 4HKVB 1O7PB 1O7GB 3BLZA 4J8TA 4L8PA 5JPUA 3G0KA 4FCMA 3ECFA 4MJDA 2GBWB 3F40A 2Z77A 3D9RA 3NHXA 1OUNA 2HMLB 3JUPA 1CQSA 3T8NA 3G16A
chains in the Genus database with same CATH superfamily
1A2KA 1ZX2A 4XBYA 2GU3A 3CPW2 2C4BA 1I0XA 5IW9A 1NJI4 4HM7B 3V92A 1BUQA 2CX0A 1YJW3 3LTCA 3GZXB 1BU4A 3JVCA 1TRPA 1W4NA 3CCQ3 1JKGA 1GOVA 2KF3A 4RNZA 1VQM3 1QVG2 1LNIA 4WWUC 1QVF2 2XRXB 1BRHA 1BRSA 1QJGA 1RTUA 2OQEC 6RNTA 1MWRA 3EJVA 5IF6A 3CCU3 1GMRA 1LRAA 4R80A 3UNLA 2A15A 2CG0A 3CCL3 3SVAA 3LTAA 1OHPA 1AQZA 3NX0A 3D79A 1UGHI 5AYSC 4EYCA 4TX4A 1FGOA 3DGNA 4N3VA 5GSPA 3SOYA 1FGRA 1SARA 2PNCA 3GZYB 3MSOA 5DREA 5KP3A 3FH1A 1I70A 3FG3A 3WOEB 3CD63 4FR9A 1NO3A 4XBXA 4KZ1A 3GAXA 3WODG 3X41A 4N6MA 3NUVA 1GY6A 4XB5A 1FGMA 5D83A 3UB1A 2QEX3 3GZBA 2UGIA 5D81A 3NQYA 5M19A 3KKGA 3SYUA 2AADA 4O02B 1CYUA 3ALAA 3CME3 1BSAA 1TTOA 2KF4A 3DGMA 2XF3A 1UUGB 4KFFA 3RNTA 1RNTA 1JNQA 1K41A 2R4IA 1SIIA 1SIHA 1LNHA 2IA7A 4N6V0 4XBTA 2RFRA 4IT7A 1VQL3 2FGTA 2W6JH 4BIRA 2CH9A 1NU3A 5AEWB 3HZPA 1Q824 1JJ22 1ISKA 5CXOA 2HMKB 2BMQB 1BANA 1W6CA 2WOFA 1W2B2 2ZDJA 3I563 3OV4A 3WA3A 5AIFA 3WDGB 1AR0A 4J5KA 3F8HA 1JB4A 4N6TA 1UGIA 3HK4A 1UI7A 4N6UA 1RGKA 4BTXA 2ZA4A 3CC73 4OUQA 4AKZA 3DGOA 1B21A 2XGLA 1PYLA 2Z6BA 1I8VA 2KF5A 3GZRA 3KFQC 2Q07A 4K1VA 5JPPA 1UCKA 2WO0A 1RMSA 2KCDA 2YFLB 3IMAB 3OXAA 4EC6A 1I0VA 1N8R4 2W56A 4GHOA 3BB9A 1X1WA 3K9MC 1GOYA 4I5QA 4FMBA 2CFKA 4J9AA 3DGYA 4XDVA 1W00A 5EEOA 3VF1A 1LOVA 1D6ZA 1TJDA 3DMCA 2UUGC 5ELUA 1BRIA 3A76A 1BOXA 3AGNA 1NNVA 5AYRB 2OTJ3 1FW7A 2CX1A 5DRVA 2UX0A 1J2BA 1GSPA 1U5OA 5ELJA 3MPHA 1D6UA 1GYBA 1C7HA 3GWRA 4WP5A 1RGEA 2OTL3 1AY7A 1PFPA 2QA43 4DKIA 4EXRA 4I4KA 2CWTA 1UDII 1N5PA 1IVUA 2WGQA 4HM8B 7RNTA 1JB5A 5IG5A 3LH4A 4LMIA 2BMRB 3KSED 3V99A 1WNHA 1RKYA 1OHSA 3T8UA 1YVSA 2YX9A 1QMAA 3CNMA 2JQ5A 1W01A 4HBRA 4EV5A 4ORLA 2K54A 1R4YA 1BNSA 4HM0B 2IYJA 3SX1A 1VQO3 2W2CA 1KD14 1RHLA 1IT7A 3CCR3 1RNBA 4AKYA 1VQ93 3JUNA 4HVNA 1TP6A 2Z7AA 1I2EA 1TIJA 1I2GA 2RGQA 4LEHA 2LQVA 3KSPA 2P09A 3OWUA 1O7WB 3DM8A 3EN1B 4N6NB 3HIGA 3SEDA 3WHOA 3G4S3 1RRHA 1B2UA 1RRLA 3LMLA 1W6YA 1HYFA 3EC9A 2GXFA 3OWYA 3I0YA 4OVMA 3BIRA 3NM2A 2RBIA 3MWZA 1VQ63 1VQQA 1GOUA 1G96A 1G02A 1A2PA 1BIRA 1FUSA 1JBRA 1K9M4 1FGQA 3LOYA 3KIIA 3NBBA 3UJMA 1A90A 1GD4A 3B7CA 1IDPA 1O7MB 3MKIA 3PCRA 2BMOB 3RDEA 2MC8A 4O8SA 3V98A 5LC6A 3FGYA 4L7KA 3X42A 1VQN3 2WOHA 1YI23 1RGHA 3SOAA 5G2GA 4RNTA 5AIIA 1CYVA 1SQWA 3B4OA 1RSNA 5BVBA 3MG2A 3CCV3 1F8NA 3H51A 1STDA 2CW9A 3PCSA 3CXC2 5IG4A 4U13A 4R9KA 1VQP3 2GU1A 1OPYA 3EBYA 3WR2A 2D1WA 1BNJA 3LTDA 3U97A 4K61A 1K8A4 3F9SA 2FXTA 2W03A 2YFJB 3GSPA 5LC7A 2L4VA 3EBTA 1B20A 3N8BA 1OHOA 5FW5A 2CFGA 1I3FA 3WA2X 1OGZA 1B2MA 3F7XA 2ML5A 1X1YA 3OW22 5IERA 2E2VA 3HX8A 1I2FA 3BNEA 3KN4A 3WMDA 5M18A 1U8CB 1BNIA 2L1SA 2IUKA 5BXQA 1LOYA 3DXOA 1O7NB 2CFLA 4HJLB 1PU4A 2MF7A 1IQ8A 3EQQB 1JBSA 2HMOB 2XGNA 1YVBI 1BRGA 1DYUA 1GD3A 1QAKA 1WQLB 4NREA 1WMOA 4EBGA 4JRFA 1GY5A 1E97A 1RGCA 2IY2A 2LYXA 1WMPA 2XEPA 3NBRA 4HZBB 5BIRA 4L8OA 4N6LA 8RNTA 2XH9A 1V57A 2P0MA 1Q7Y4 1VQ73 1BVIA 1OGXA 1GMPA 4LYLB 1EG9B 1YHQ3 2F86B 2OCTA 3S67A 1QALA 1EA2A 1N8QA 1N9EA 1MGWA 1IK3A 9RNTA 4HM5B 1W2ZA 4HAAA 3ZG0A 1OH0A 1Q814 2STDA 1L5GB 2HMJB 2QGUA 4R1KA 3GRDA 2CFDA 4MMYB 5A0OB 2P38A 1Y4KA 3LT9A 1YGWA 5KP4A 3D5GA 3FG1A 4X2HA 3X3XA 2RCDA 5HGRA 4H61A 1UCLA 3QRDA 4Q53A 1KC84 2RSXA 1YNVX 3QK9A 2CHCA 4MEIA 5IENA 2O3OA 5IG3A 3Q2PA 5G1KA 3NV0B 2OWPA 2W0QA 3FKAA 1OACA 1GY7A 1BSDA 1VZZA 3FSDA 2BU4A 3KCHA 3K5TA 3NM7A 2CC3A 4IIAA 3AMOB 2E2TA 2B24B 2W04A 1DETA 4MMZB 4O3VA 4FMCA 1OF5B 5CLKA 2Z76A 5AI1A 4NHFA 3AGOA 1AVLA 2OOVC 4K1UA 1W02A 1UI8A 1RN7A 1UCJA 1EEJA 1ZGXA 3FF0A 1D6YA 3Q90A 4K90B 1NWWA 3MHEA 2IMJA 2RNTA 2F98A 3RGRA 3UL6A 1B2ZA 4BL2A 1JRQA 1KSIA 1VQ83 3HI7A 3OWSA 1VQK3 3PS8A 4EW5A 1W7CA 4RZMA 3VGNA 1RGGA 1MWUA 1FZUA 1NDOB 1ASKA 1NB3I 3FF2A 4WYKA 3PGBA 2K0MA 3CCS3 1O7HB 4GB5A 1IV9A 1ROVA 1HU9A 4STDA 1YIJ3 2P0XA 2BO9B 1Q40B 1B3SA 1LXEA 3EE1A 5IEOA 4PEJA 5RNTA 3G8ZA 5D82A 3M8CA 1LOWA 2Y73A 2F56A 1IYYA 3MG1A 2BT3A 1ULIB 1S723 1JN5A 2XFSA 4R9LA 1CH0A 2CKFB 3JUOA 4GSPA 4XM4A 1TUHA 1WTHA 1Q42A 4KT3B 3SXXA 4CJNA 3U1WA 4CPKA 1W5ZA 1SPUA 2HMMB 4BU4A 1BNFA 3CNXA 2B1XB 1IVVA 2XFTA 1JBTA 4WFOA 2E2UA 1RGFA 1ZO2A 1FYSA 1X1XA 2J8XB 2GEXA 3Q3FA 6GSPA 2GBXB 3CU3A 3KZTA 3ZFZA 1UUWB 1V74A 5EQLA 3STDA 1RGLA 1JV2B 3S5CA 3F7SA 2ZHXB 5IEPA 2KF6A 2P05A 2H0GA 4WYKB 1KWIA 4CCVA 3JUQA 1AV4A 3F8XA 2KXGA 3CMA3 3E99A 3PZWA 4HOHA 4HZ9B 5TGNA 4RBNA 4G1MB 2XSOB 1T3BA 4FMAA 1VQ43 2V1LA 3HOHA 1RGAA 1RN1A 1RLSA 1WMNA 4BTWA 2W9PA 1YJN3 3H3HA 1S5AA 3MYTA 4BL3A 1JN5B 2I9WA 1EKMA 4LZIA 3ROBA 4KVHA 4NPBA 1RDSA 6STDA 3TDGA 3B8LA 1LOXA 2M7OA 3X3YA 4ZM8A 3X40A 1MOLA 1TRQA 2W9QA 2H0IA 3EF8A 3CC43 1STFI 4R4KA 3RGAA 5BU4A 1B2XA 3CPOA 3D3LA 3N54B 2INXA 1N9JA 1LQMB 2WGOA 4XDWA 3X3ZA 2KAAA 3AHWA 1JB2A 1EUIC 1QAFA 2QIYA 3CCE3 1DVCA 1A67A 2IUJA 2FNQA 1OCVA 3CCM3 1BRJA 3SLUA 7GSPA 1BRKA 4HM1B 3CCJ3 1ULJB 3EN8A 1K28A 4IPBA 5EVHA 4LSOA 5AEUB 3LT8A 3NV0A 2OOVA 4CDLA 5AIGA 1IT8A 1VQ53 1G0TA 5FGOA 1DE3A 5CK6A 8CHOA 1HZ1A 1DMQA 3KE7A 3BNCA 1M1XB 2HMNB 1IU7A 1MNLA 2Y74A 1N5HA 3AMOA 3K63A 4H3UA 5AIHA 5CF2A 1OF5A 1IQYA 1MWSA 4FCZA 1RN4A 4FCJA 1JZDA 1TU5A 3UL5A 1R4CA 4O2HA 1BRNL 1PY3A 3ER7A 1MGRA 1GS3A 3DY5A 3F14A 3DUKA 3EHCA 5M1AA 5KP1A 1CEWI 1FUWA 2SARA 2K3DA 3NBJA 5CF1A 1IVXA 1US1A 1TFKA 1IVWA 3LZAA 1EQKA 3D4AA 3DH2A 4KFDA 4AEQA 3MG3A 4HM2B 1NB5I 1Q40A 1Z1SA 3DGLA 3G6E3 1JKGB 1B2SA 3I553 4RNYA 5I97A 2KRTA 2YFIB 1ROAA 2C11A 2BIRA 4HM4B 3PXMA 4LGQA 2H0HA 1UW1A 3D5IA 4FMDA 5JBSA 1TFOA 1SJWA 1T5YA 1DMMA 1MWTA 1RCLA 2JDIH 2F99A 5IG0A 3PYJA 1YJ93 1Q9EA 1V58A 3JUMA 1BUJA 1HKXA 1DMNA 3FZWA 4MMXB 3IPTA 4KFEA 4ILFA 3FG4A 1E3VA 3K0ZA 1Q864 3J7Yd 3LYGA 3NQZA 2BHMA 2BNGA 5STDA 1UUVB 1E3RA 1AVKA 3B4PA 2GEYA 3IJEB 7STDA 2F5WA 1W6GA 2XR8B 3DZLA 4EV2A 3EB8A 4HM3B 3G713 3S27A 3NXJA 2CFWA 1JZOA 1X1UA 2R41A 2PZVA 3N9HA 2GSPA 2ML6A 3VSYA 3WOFB 1BAOA 4HM6B 1A2VA 1K734 1IQXA 4X2OA 3K7CA 3OX9A 2SBLA 2XSHB 1LQGC 4N6OB 3EX9A 3FCSB 3BNBA 3FLJA 2F5MA 4GL6A 1FUTA 1LVNA 1T2IA 4HKVB 1O7PB 1O7GB 3BLZA 4BTYA 4J8TA 1FGTA 4L8PA 1BNEA 1BSEA 3BNDA 3HIIA 1RCKA 2HOHA 5JPUA 2OQEA 1FA3A 2ZL8A 3G0KA 3S29A 2C10A 4FCMA 3AHSA 1RJOA 1BNGA 1IV7A 3BU4A 3ECFA 4MJDA 3URPA 1GMQA 1BGSA 4HYZA 2GBWB 3F40A 1BSCA 3L0RA 3CC23 2CWVA 2Z77A 1C54A 5G1LA 3D9RA 2W56B 1M904 3NHXA 1OUNA 3S28A 1BSBA 2HMLB 4J5GA 4OK0A 1I3IA 3T0UA 3JUPA 1YIT3 1M9GA 4JF8A 1T2HA 1CQSA 1B27A 2O9UX 1Q7HA 2CK3H 1UCIA 4WHAA 2D42A 3A5EA 1ZS7A 2CG1A 4QWTA 1BNRA 1DVDA 3O8YA 2CWUA 3ZG5A 1M1K4 3LTBA 3Q1CA 3LXUX 3T8NA 2CIUA 1KQS2 1YGEA 3G16A 5HOHA 2F4YA 2AAEA
chains in the Genus database with same CATH topology
1A2KA 1ZX2A 4XBYA 2GU3A 3CPW2 5IW9A 1NJI4 4HM7B 3V92A 1BUQA 1YJW3 3LTCA 3GZXB 3JVCA 1W4NA 3CCQ3 1JKGA 4RNZA 1VQM3 1QVG2 4WWUC 1QVF2 2XRXB 1QJGA 2OQEC 3EJVA 5IF6A 3CCU3 4R80A 3UNLA 2A15A 2CG0A 3CCL3 3SVAA 3LTAA 1OHPA 3NX0A 5AYSC 4EYCA 4TX4A 1FGOA 3DGNA 4N3VA 3SOYA 1FGRA 2PNCA 3GZYB 3MSOA 5DREA 5KP3A 3FH1A 3FG3A 3WOEB 3CD63 4FR9A 1NO3A 4XBXA 4KZ1A 3GAXA 3WODG 3X41A 4N6MA 3NUVA 1GY6A 4XB5A 1FGMA 5D83A 3UB1A 2QEX3 3GZBA 5D81A 3NQYA 3KKGA 4O02B 1CYUA 3ALAA 3CME3 3DGMA 4KFFA 2XF3A 1JNQA 1K41A 2R4IA 1SIIA 1SIHA 1LNHA 2IA7A 4N6V0 4XBTA 2RFRA 4IT7A 1VQL3 2FGTA 2W6JH 2CH9A 1NU3A 5AEWB 3HZPA 1Q824 1JJ22 1ISKA 5CXOA 2HMKB 2BMQB 1W6CA 1W2B2 2WOFA 2ZDJA 3I563 3OV4A 3WA3A 5AIFA 3WDGB 1AR0A 3F8HA 1JB4A 4N6TA 3HK4A 1UI7A 4N6UA 4BTXA 3CC73 4OUQA 4AKZA 3DGOA 2XGLA 2Z6BA 3GZRA 3KFQC 4K1VA 2Q07A 5JPPA 2WO0A 2YFLB 2KCDA 3IMAB 3OXAA 4EC6A 1N8R4 2W56A 3BB9A 3K9MC 4FMBA 2CFKA 4J9AA 4XDVA 5EEOA 1W00A 3VF1A 1D6ZA 3DMCA 5ELUA 3A76A 5AYRB 2OTJ3 5DRVA 2UX0A 1J2BA 1U5OA 5ELJA 3MPHA 1D6UA 1GYBA 1C7HA 3GWRA 4WP5A 2OTL3 1PFPA 2QA43 4EXRA 4I4KA 2CWTA 1N5PA 1IVUA 2WGQA 4HM8B 1JB5A 5IG5A 3LH4A 4LMIA 2BMRB 3KSED 3V99A 1WNHA 1RKYA 1OHSA 3T8UA 2YX9A 1QMAA 3CNMA 2JQ5A 1W01A 4HBRA 4EV5A 4ORLA 2K54A 4HM0B 3SX1A 1VQO3 2W2CA 1KD14 1IT7A 3CCR3 4AKYA 1VQ93 3JUNA 4HVNA 1TP6A 2Z7AA 1TIJA 2RGQA 4LEHA 2LQVA 3KSPA 2P09A 3OWUA 1O7WB 3DM8A 3EN1B 4N6NB 3HIGA 3SEDA 3G4S3 1RRHA 1RRLA 3LMLA 1W6YA 3EC9A 2GXFA 3OWYA 3I0YA 4OVMA 3NM2A 1VQ63 3MWZA 1G96A 1K9M4 1FGQA 3LOYA 3KIIA 3NBBA 3UJMA 1A90A 1GD4A 3B7CA 1IDPA 1O7MB 3MKIA 3PCRA 2BMOB 3RDEA 2MC8A 4O8SA 3V98A 5LC6A 3FGYA 4L7KA 3X42A 1VQN3 2WOHA 1YI23 3SOAA 5G2GA 5AIIA 1CYVA 1SQWA 3B4OA 5BVBA 3CCV3 3MG2A 1F8NA 3H51A 1STDA 2CW9A 3PCSA 3CXC2 5IG4A 4U13A 4R9KA 1VQP3 2GU1A 1OPYA 3EBYA 2D1WA 3LTDA 3U97A 4K61A 1K8A4 3F9SA 2FXTA 2W03A 2YFJB 5LC7A 1YJN3 2L4VA 3EBTA 3N8BA 5FW5A 1OHOA 3WA2X 2CFGA 1OGZA 3F7XA 2ML5A 3OW22 5IERA 2E2VA 3HX8A 3BNEA 3KN4A 3WMDA 1U8CB 2IUKA 5BXQA 1PU4A 3DXOA 1O7NB 2CFLA 4HJLB 2MF7A 1IQ8A 3EQQB 2HMOB 2XGNA 1YVBI 1DYUA 1GD3A 1QAKA 1WQLB 4NREA 1WMOA 4EBGA 4JRFA 1GY5A 1E97A 2LYXA 3NBRA 1WMPA 2XEPA 4HZBB 4L8OA 4N6LA 2XH9A 2P0MA 1Q7Y4 1VQ73 1OGXA 1EG9B 1YHQ3 2F86B 2OCTA 3S67A 1QALA 1EA2A 1N8QA 1N9EA 1IK3A 4HM5B 1W2ZA 1Q814 1OH0A 2STDA 1L5GB 2HMJB 2QGUA 4R1KA 3GRDA 2CFDA 4MMYB 5A0OB 2P38A 1Y4KA 3LT9A 5KP4A 3FG1A 4X2HA 3X3XA 2RCDA 5HGRA 4H61A 3QRDA 4Q53A 1KC84 2RSXA 3QK9A 2CHCA 4MEIA 5IENA 2O3OA 5IG3A 3Q2PA 3NV0B 2OWPA 2W0QA 3FKAA 1OACA 1GY7A 1VZZA 3FSDA 3NM7A 3K5TA 2CC3A 4IIAA 3AMOB 2E2TA 2B24B 2W04A 4MMZB 4O3VA 4FMCA 1OF5B 5CLKA 2Z76A 5AI1A 4NHFA 1AVLA 2OOVC 4K1UA 1W02A 1UI8A 1RN7A 3FF0A 3Q90A 4K90B 1D6YA 1NWWA 3MHEA 2IMJA 2F98A 3RGRA 3UL6A 1JRQA 1KSIA 1VQ83 3HI7A 3OWSA 1VQK3 3PS8A 1W7CA 4RZMA 3VGNA 1NDOB 1ASKA 1NB3I 3FF2A 4WYKA 3PGBA 2K0MA 3CCS3 1O7HB 4GB5A 1IV9A 1ROVA 1HU9A 4STDA 1YIJ3 2P0XA 2BO9B 1Q40B 1LXEA 3EE1A 5IEOA 4PEJA 3G8ZA 5D82A 3M8CA 2Y73A 3MG1A 2BT3A 1ULIB 1S723 1JN5A 2XFSA 4R9LA 2CKFB 3JUOA 4XM4A 3SXXA 1TUHA 1WTHA 1Q42A 3U1WA 1W5ZA 1SPUA 2HMMB 3CNXA 2B1XB 1IVVA 2XFTA 4WFOA 2E2UA 1ZO2A 2GEXA 2GBXB 3CU3A 3KZTA 1UUWB 1V74A 5EQLA 3STDA 1JV2B 3S5CA 3F7SA 5IEPA 2P05A 4WYKB 1KWIA 4CCVA 3JUQA 1AV4A 3F8XA 2KXGA 3CMA3 3E99A 3PZWA 4HZ9B 5TGNA 4RBNA 4G1MB 2XSOB 4FMAA 1VQ43 2V1LA 1WMNA 4BTWA 2W9PA 3H3HA 1S5AA 3MYTA 1JN5B 2I9WA 1EKMA 4LZIA 3ROBA 4KVHA 6STDA 3TDGA 3B8LA 1LOXA 2M7OA 3X3YA 4ZM8A 3X40A 1MOLA 2W9QA 3EF8A 3CC43 1STFI 4R4KA 3RGAA 3CPOA 3D3LA 3N54B 2INXA 1N9JA 2WGOA 4XDWA 3X3ZA 3CCE3 1JB2A 1QAFA 2QIYA 1DVCA 1A67A 2IUJA 2FNQA 1OCVA 3CCM3 3SLUA 4HM1B 3CCJ3 1ULJB 3EN8A 1K28A 4IPBA 5EVHA 4LSOA 5AEUB 3LT8A 3NV0A 2OOVA 4CDLA 5AIGA 1IT8A 1VQ53 5FGOA 5CK6A 8CHOA 1DMQA 3KE7A 3BNCA 1M1XB 2HMNB 1IU7A 1MNLA 2Y74A 1N5HA 3AMOA 3K63A 4H3UA 5AIHA 5CF2A 1OF5A 1IQYA 4FCZA 4FCJA 1TU5A 3UL5A 1R4CA 4O2HA 3ER7A 1GS3A 3DY5A 3F14A 3DUKA 3EHCA 5KP1A 1CEWI 1FUWA 3NBJA 5CF1A 1IVXA 1US1A 1TFKA 1IVWA 3LZAA 1EQKA 4KFDA 4AEQA 3MG3A 4HM2B 1NB5I 1Q40A 1Z1SA 3DGLA 3G6E3 1JKGB 3I553 4RNYA 5I97A 2KRTA 2YFIB 1ROAA 2C11A 4HM4B 3PXMA 4LGQA 1UW1A 5JBSA 4FMDA 1TFOA 1SJWA 1T5YA 1DMMA 2JDIH 2F99A 5IG0A 3PYJA 1YJ93 3JUMA 1HKXA 1DMNA 3FZWA 4MMXB 3IPTA 4KFEA 3FG4A 1E3VA 3K0ZA 1Q864 3J7Yd 3LYGA 3NQZA 2BHMA 2BNGA 5STDA 1UUVB 1E3RA 1AVKA 3B4PA 2GEYA 3IJEB 7STDA 1W6GA 2XR8B 3DZLA 4EV2A 3EB8A 4HM3B 3G713 3S27A 3NXJA 2CFWA 2PZVA 3N9HA 2ML6A 3VSYA 3WOFB 4HM6B 1A2VA 1K734 1IQXA 4X2OA 3K7CA 3OX9A 2SBLA 2XSHB 4N6OB 3EX9A 3FCSB 3BNBA 3FLJA 4GL6A 1LVNA 4HKVB 1O7PB 1O7GB 3BLZA 4BTYA 4J8TA 1FGTA 4L8PA 3BNDA 3HIIA 5JPUA 2OQEA 1FA3A 2ZL8A 3G0KA 3S29A 2C10A 4FCMA 1RJOA 1IV7A 3ECFA 4MJDA 4HYZA 2GBWB 3F40A 3L0RA 3CC23 2CWVA 2Z77A 3D9RA 2W56B 1M904 3NHXA 1OUNA 3S28A 2HMLB 4OK0A 3T0UA 3JUPA 1YIT3 1M9GA 4JF8A 1CQSA 2O9UX 4WHAA 2CK3H 2D42A 1DVDA 2CG1A 4QWTA 3O8YA 2CWUA 1M1K4 3LTBA 3Q1CA 3LXUX 3T8NA 2CIUA 1KQS2 1YGEA 3G16A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A2K A;  1ZX2 A;  4XBY A;  4HM7 B;  1BUQ A;  3GZX B;  1JKG A;  4WWU C;  2XRX B;  1QJG A;  3EJV A;  5IF6 A;  3UNL A;  2A15 A;  1OHP A;  4N3V A;  3SOY A;  3GZY B;  3MSO A;  5DRE A;  5KP3 A;  3FH1 A;  4XBX A;  3NUV A;  1GY6 A;  4XB5 A;  5D83 A;  3GZB A;  5D81 A;  3KKG A;  1K41 A;  2R4I A;  4XBT A;  2RFR A;  1NU3 A;  5AEW B;  3HZP A;  1ISK A;  5CXO A;  2HMK B;  2BMQ B;  3OV4 A;  5AIF A;  1AR0 A;  3F8H A;  1JB4 A;  3HK4 A;  4OUQ A;  3GZR A;  4K1V A;  5JPP A;  2YFL B;  3OXA A;  3BB9 A;  4XDV A;  4J9A A;  1W00 A;  3DMC A;  3A76 A;  5DRV A;  2UX0 A;  1U5O A;  1GYB A;  1C7H A;  3GWR A;  4WP5 A;  4I4K A;  4HM8 B;  1JB5 A;  5IG5 A;  4LMI A;  2BMR B;  1OHS A;  3T8U A;  3CNM A;  1QMA A;  2JQ5 A;  1W01 A;  4ORL A;  2K54 A;  4HM0 B;  2W2C A;  3JUN A;  4HVN A;  1TP6 A;  2Z7A A;  2RGQ A;  4LEH A;  3KSP A;  3OWU A;  1O7W B;  3DM8 A;  3EN1 B;  3SED A;  1W6Y A;  3EC9 A;  2GXF A;  3OWY A;  3I0Y A;  4OVM A;  3NM2 A;  3UJM A;  3B7C A;  1IDP A;  1O7M B;  3MKI A;  2BMO B;  3FGY A;  4L7K A;  3SOA A;  5G2G A;  5AII A;  5BVB A;  3B4O A;  3MG2 A;  3H51 A;  1STD A;  5IG4 A;  4U13 A;  4R9K A;  1OPY A;  3EBY A;  3F9S A;  2YFJ B;  3EBT A;  5FW5 A;  1OHO A;  1OGZ A;  3F7X A;  5IER A;  3HX8 A;  3WMD A;  5BXQ A;  3DXO A;  1O7N B;  4HJL B;  3EQQ B;  2HMO B;  1WQL B;  1GY5 A;  1E97 A;  3NBR A;  4HZB B;  4L8O A;  1OGX A;  1EG9 B;  2F86 B;  1EA2 A;  4HM5 B;  1OH0 A;  2STD A;  2HMJ B;  2QGU A;  4R1K A;  3GRD A;  5KP4 A;  4X2H A;  2RCD A;  5HGR A;  4Q53 A;  2CHC A;  5IEN A;  5IG3 A;  3NV0 B;  2OWP A;  3FKA A;  1GY7 A;  1VZZ A;  3FSD A;  4IIA A;  2B24 B;  1OF5 B;  5CLK A;  2Z76 A;  5AI1 A;  4K1U A;  1W02 A;  3FF0 A;  3Q90 A;  1NWW A;  3MHE A;  2IMJ A;  2F98 A;  3RGR A;  3OWS A;  4RZM A;  3VGN A;  1NDO B;  1ASK A;  3FF2 A;  4WYK A;  1O7H B;  4GB5 A;  4STD A;  1Q40 B;  5IEO A;  4PEJ A;  3G8Z A;  5D82 A;  3M8C A;  3MG1 A;  1ULI B;  1JN5 A;  4R9L A;  2CKF B;  3JUO A;  4XM4 A;  1TUH A;  1Q42 A;  2HMM B;  3CNX A;  2B1X B;  1ZO2 A;  2GEX A;  2GBX B;  3CU3 A;  3KZT A;  1UUW B;  3STD A;  3S5C A;  3F7S A;  5IEP A;  4WYK B;  3JUQ A;  3F8X A;  3E99 A;  4HZ9 B;  5TGN A;  2XSO B;  3H3H A;  1S5A A;  3MYT A;  1JN5 B;  2I9W A;  3ROB A;  4KVH A;  6STD A;  3B8L A;  3EF8 A;  3RGA A;  3CPO A;  2INX A;  4XDW A;  1JB2 A;  2QIY A;  1OCV A;  4HM1 B;  1ULJ B;  3EN8 A;  5EVH A;  5AEU B;  3NV0 A;  4CDL A;  5AIG A;  5CK6 A;  8CHO A;  1DMQ A;  3KE7 A;  4H3U A;  2HMN B;  5CF2 A;  5AIH A;  1OF5 A;  4FCJ A;  3ER7 A;  1GS3 A;  3F14 A;  3DUK A;  3EHC A;  5KP1 A;  5CF1 A;  3LZA A;  3MG3 A;  4HM2 B;  1Q40 A;  1Z1S A;  1JKG B;  2YFI B;  4HM4 B;  4LGQ A;  1SJW A;  1DMM A;  2F99 A;  5IG0 A;  3JUM A;  1HKX A;  1DMN A;  3FZW A;  3IPT A;  1E3V A;  3K0Z A;  3LYG A;  2BNG A;  5STD A;  1UUV B;  1E3R A;  3B4P A;  2GEY A;  7STD A;  2XR8 B;  3DZL A;  4HM3 B;  3NXJ A;  2PZV A;  3VSY A;  4HM6 B;  4X2O A;  3K7C A;  3OX9 A;  2XSH B;  3EX9 A;  3FLJ A;  4HKV B;  1O7P B;  1O7G B;  3BLZ A;  4J8T A;  4L8P A;  5JPU A;  3G0K A;  4FCM A;  3ECF A;  4MJD A;  2GBW B;  3F40 A;  2Z77 A;  3D9R A;  3NHX A;  1OUN A;  2HML B;  3JUP A;  1CQS A;  3T8N A;  3G16 A; 
#chains in the Genus database with same CATH topology
 1A2K A;  1ZX2 A;  4XBY A;  2GU3 A;  3CPW 2;  2C4B A;  1I0X A;  5IW9 A;  1NJI 4;  4HM7 B;  3V92 A;  1BUQ A;  2CX0 A;  1YJW 3;  3LTC A;  3GZX B;  1BU4 A;  3JVC A;  1TRP A;  1W4N A;  3CCQ 3;  1JKG A;  1GOV A;  2KF3 A;  4RNZ A;  1VQM 3;  1QVG 2;  1LNI A;  4WWU C;  1QVF 2;  2XRX B;  1BRH A;  1BRS A;  1QJG A;  1RTU A;  2OQE C;  6RNT A;  1MWR A;  3EJV A;  5IF6 A;  3CCU 3;  1GMR A;  1LRA A;  4R80 A;  3UNL A;  2A15 A;  2CG0 A;  3CCL 3;  3SVA A;  3LTA A;  1OHP A;  1AQZ A;  3NX0 A;  3D79 A;  1UGH I;  5AYS C;  4EYC A;  4TX4 A;  1FGO A;  3DGN A;  4N3V A;  5GSP A;  3SOY A;  1FGR A;  1SAR A;  2PNC A;  3GZY B;  3MSO A;  5DRE A;  5KP3 A;  3FH1 A;  1I70 A;  3FG3 A;  3WOE B;  3CD6 3;  4FR9 A;  1NO3 A;  4XBX A;  4KZ1 A;  3GAX A;  3WOD G;  3X41 A;  4N6M A;  3NUV A;  1GY6 A;  4XB5 A;  1FGM A;  5D83 A;  3UB1 A;  2QEX 3;  3GZB A;  2UGI A;  5D81 A;  3NQY A;  5M19 A;  3KKG A;  3SYU A;  2AAD A;  4O02 B;  1CYU A;  3ALA A;  3CME 3;  1BSA A;  1TTO A;  2KF4 A;  3DGM A;  2XF3 A;  1UUG B;  4KFF A;  3RNT A;  1RNT A;  1JNQ A;  1K41 A;  2R4I A;  1SII A;  1SIH A;  1LNH A;  2IA7 A;  4N6V 0;  4XBT A;  2RFR A;  4IT7 A;  1VQL 3;  2FGT A;  2W6J H;  4BIR A;  2CH9 A;  1NU3 A;  5AEW B;  3HZP A;  1Q82 4;  1JJ2 2;  1ISK A;  5CXO A;  2HMK B;  2BMQ B;  1BAN A;  1W6C A;  2WOF A;  1W2B 2;  2ZDJ A;  3I56 3;  3OV4 A;  3WA3 A;  5AIF A;  3WDG B;  1AR0 A;  4J5K A;  3F8H A;  1JB4 A;  4N6T A;  1UGI A;  3HK4 A;  1UI7 A;  4N6U A;  1RGK A;  4BTX A;  2ZA4 A;  3CC7 3;  4OUQ A;  4AKZ A;  3DGO A;  1B21 A;  2XGL A;  1PYL A;  2Z6B A;  1I8V A;  2KF5 A;  3GZR A;  3KFQ C;  2Q07 A;  4K1V A;  5JPP A;  1UCK A;  2WO0 A;  1RMS A;  2KCD A;  2YFL B;  3IMA B;  3OXA A;  4EC6 A;  1I0V A;  1N8R 4;  2W56 A;  4GHO A;  3BB9 A;  1X1W A;  3K9M C;  1GOY A;  4I5Q A;  4FMB A;  2CFK A;  4J9A A;  3DGY A;  4XDV A;  1W00 A;  5EEO A;  3VF1 A;  1LOV A;  1D6Z A;  1TJD A;  3DMC A;  2UUG C;  5ELU A;  1BRI A;  3A76 A;  1BOX A;  3AGN A;  1NNV A;  5AYR B;  2OTJ 3;  1FW7 A;  2CX1 A;  5DRV A;  2UX0 A;  1J2B A;  1GSP A;  1U5O A;  5ELJ A;  3MPH A;  1D6U A;  1GYB A;  1C7H A;  3GWR A;  4WP5 A;  1RGE A;  2OTL 3;  1AY7 A;  1PFP A;  2QA4 3;  4DKI A;  4EXR A;  4I4K A;  2CWT A;  1UDI I;  1N5P A;  1IVU A;  2WGQ A;  4HM8 B;  7RNT A;  1JB5 A;  5IG5 A;  3LH4 A;  4LMI A;  2BMR B;  3KSE D;  3V99 A;  1WNH A;  1RKY A;  1OHS A;  3T8U A;  1YVS A;  2YX9 A;  1QMA A;  3CNM A;  2JQ5 A;  1W01 A;  4HBR A;  4EV5 A;  4ORL A;  2K54 A;  1R4Y A;  1BNS A;  4HM0 B;  2IYJ A;  3SX1 A;  1VQO 3;  2W2C A;  1KD1 4;  1RHL A;  1IT7 A;  3CCR 3;  1RNB A;  4AKY A;  1VQ9 3;  3JUN A;  4HVN A;  1TP6 A;  2Z7A A;  1I2E A;  1TIJ A;  1I2G A;  2RGQ A;  4LEH A;  2LQV A;  3KSP A;  2P09 A;  3OWU A;  1O7W B;  3DM8 A;  3EN1 B;  4N6N B;  3HIG A;  3SED A;  3WHO A;  3G4S 3;  1RRH A;  1B2U A;  1RRL A;  3LML A;  1W6Y A;  1HYF A;  3EC9 A;  2GXF A;  3OWY A;  3I0Y A;  4OVM A;  3BIR A;  3NM2 A;  2RBI A;  3MWZ A;  1VQ6 3;  1VQQ A;  1GOU A;  1G96 A;  1G02 A;  1A2P A;  1BIR A;  1FUS A;  1JBR A;  1K9M 4;  1FGQ A;  3LOY A;  3KII A;  3NBB A;  3UJM A;  1A90 A;  1GD4 A;  3B7C A;  1IDP A;  1O7M B;  3MKI A;  3PCR A;  2BMO B;  3RDE A;  2MC8 A;  4O8S A;  3V98 A;  5LC6 A;  3FGY A;  4L7K A;  3X42 A;  1VQN 3;  2WOH A;  1YI2 3;  1RGH A;  3SOA A;  5G2G A;  4RNT A;  5AII A;  1CYV A;  1SQW A;  3B4O A;  1RSN A;  5BVB A;  3MG2 A;  3CCV 3;  1F8N A;  3H51 A;  1STD A;  2CW9 A;  3PCS A;  3CXC 2;  5IG4 A;  4U13 A;  4R9K A;  1VQP 3;  2GU1 A;  1OPY A;  3EBY A;  3WR2 A;  2D1W A;  1BNJ A;  3LTD A;  3U97 A;  4K61 A;  1K8A 4;  3F9S A;  2FXT A;  2W03 A;  2YFJ B;  3GSP A;  5LC7 A;  2L4V A;  3EBT A;  1B20 A;  3N8B A;  1OHO A;  5FW5 A;  2CFG A;  1I3F A;  3WA2 X;  1OGZ A;  1B2M A;  3F7X A;  2ML5 A;  1X1Y A;  3OW2 2;  5IER A;  2E2V A;  3HX8 A;  1I2F A;  3BNE A;  3KN4 A;  3WMD A;  5M18 A;  1U8C B;  1BNI A;  2L1S A;  2IUK A;  5BXQ A;  1LOY A;  3DXO A;  1O7N B;  2CFL A;  4HJL B;  1PU4 A;  2MF7 A;  1IQ8 A;  3EQQ B;  1JBS A;  2HMO B;  2XGN A;  1YVB I;  1BRG A;  1DYU A;  1GD3 A;  1QAK A;  1WQL B;  4NRE A;  1WMO A;  4EBG A;  4JRF A;  1GY5 A;  1E97 A;  1RGC A;  2IY2 A;  2LYX A;  1WMP A;  2XEP A;  3NBR A;  4HZB B;  5BIR A;  4L8O A;  4N6L A;  8RNT A;  2XH9 A;  1V57 A;  2P0M A;  1Q7Y 4;  1VQ7 3;  1BVI A;  1OGX A;  1GMP A;  4LYL B;  1EG9 B;  1YHQ 3;  2F86 B;  2OCT A;  3S67 A;  1QAL A;  1EA2 A;  1N8Q A;  1N9E A;  1MGW A;  1IK3 A;  9RNT A;  4HM5 B;  1W2Z A;  4HAA A;  3ZG0 A;  1OH0 A;  1Q81 4;  2STD A;  1L5G B;  2HMJ B;  2QGU A;  4R1K A;  3GRD A;  2CFD A;  4MMY B;  5A0O B;  2P38 A;  1Y4K A;  3LT9 A;  1YGW A;  5KP4 A;  3D5G A;  3FG1 A;  4X2H A;  3X3X A;  2RCD A;  5HGR A;  4H61 A;  1UCL A;  3QRD A;  4Q53 A;  1KC8 4;  2RSX A;  1YNV X;  3QK9 A;  2CHC A;  4MEI A;  5IEN A;  2O3O A;  5IG3 A;  3Q2P A;  5G1K A;  3NV0 B;  2OWP A;  2W0Q A;  3FKA A;  1OAC A;  1GY7 A;  1BSD A;  1VZZ A;  3FSD A;  2BU4 A;  3KCH A;  3K5T A;  3NM7 A;  2CC3 A;  4IIA A;  3AMO B;  2E2T A;  2B24 B;  2W04 A;  1DET A;  4MMZ B;  4O3V A;  4FMC A;  1OF5 B;  5CLK A;  2Z76 A;  5AI1 A;  4NHF A;  3AGO A;  1AVL A;  2OOV C;  4K1U A;  1W02 A;  1UI8 A;  1RN7 A;  1UCJ A;  1EEJ A;  1ZGX A;  3FF0 A;  1D6Y A;  3Q90 A;  4K90 B;  1NWW A;  3MHE A;  2IMJ A;  2RNT A;  2F98 A;  3RGR A;  3UL6 A;  1B2Z A;  4BL2 A;  1JRQ A;  1KSI A;  1VQ8 3;  3HI7 A;  3OWS A;  1VQK 3;  3PS8 A;  4EW5 A;  1W7C A;  4RZM A;  3VGN A;  1RGG A;  1MWU A;  1FZU A;  1NDO B;  1ASK A;  1NB3 I;  3FF2 A;  4WYK A;  3PGB A;  2K0M A;  3CCS 3;  1O7H B;  4GB5 A;  1IV9 A;  1ROV A;  1HU9 A;  4STD A;  1YIJ 3;  2P0X A;  2BO9 B;  1Q40 B;  1B3S A;  1LXE A;  3EE1 A;  5IEO A;  4PEJ A;  5RNT A;  3G8Z A;  5D82 A;  3M8C A;  1LOW A;  2Y73 A;  2F56 A;  1IYY A;  3MG1 A;  2BT3 A;  1ULI B;  1S72 3;  1JN5 A;  2XFS A;  4R9L A;  1CH0 A;  2CKF B;  3JUO A;  4GSP A;  4XM4 A;  1TUH A;  1WTH A;  1Q42 A;  4KT3 B;  3SXX A;  4CJN A;  3U1W A;  4CPK A;  1W5Z A;  1SPU A;  2HMM B;  4BU4 A;  1BNF A;  3CNX A;  2B1X B;  1IVV A;  2XFT A;  1JBT A;  4WFO A;  2E2U A;  1RGF A;  1ZO2 A;  1FYS A;  1X1X A;  2J8X B;  2GEX A;  3Q3F A;  6GSP A;  2GBX B;  3CU3 A;  3KZT A;  3ZFZ A;  1UUW B;  1V74 A;  5EQL A;  3STD A;  1RGL A;  1JV2 B;  3S5C A;  3F7S A;  2ZHX B;  5IEP A;  2KF6 A;  2P05 A;  2H0G A;  4WYK B;  1KWI A;  4CCV A;  3JUQ A;  1AV4 A;  3F8X A;  2KXG A;  3CMA 3;  3E99 A;  3PZW A;  4HOH A;  4HZ9 B;  5TGN A;  4RBN A;  4G1M B;  2XSO B;  1T3B A;  4FMA A;  1VQ4 3;  2V1L A;  3HOH A;  1RGA A;  1RN1 A;  1RLS A;  1WMN A;  4BTW A;  2W9P A;  1YJN 3;  3H3H A;  1S5A A;  3MYT A;  4BL3 A;  1JN5 B;  2I9W A;  1EKM A;  4LZI A;  3ROB A;  4KVH A;  4NPB A;  1RDS A;  6STD A;  3TDG A;  3B8L A;  1LOX A;  2M7O A;  3X3Y A;  4ZM8 A;  3X40 A;  1MOL A;  1TRQ A;  2W9Q A;  2H0I A;  3EF8 A;  3CC4 3;  1STF I;  4R4K A;  3RGA A;  5BU4 A;  1B2X A;  3CPO A;  3D3L A;  3N54 B;  2INX A;  1N9J A;  1LQM B;  2WGO A;  4XDW A;  3X3Z A;  2KAA A;  3AHW A;  1JB2 A;  1EUI C;  1QAF A;  2QIY A;  3CCE 3;  1DVC A;  1A67 A;  2IUJ A;  2FNQ A;  1OCV A;  3CCM 3;  1BRJ A;  3SLU A;  7GSP A;  1BRK A;  4HM1 B;  3CCJ 3;  1ULJ B;  3EN8 A;  1K28 A;  4IPB A;  5EVH A;  4LSO A;  5AEU B;  3LT8 A;  3NV0 A;  2OOV A;  4CDL A;  5AIG A;  1IT8 A;  1VQ5 3;  1G0T A;  5FGO A;  1DE3 A;  5CK6 A;  8CHO A;  1HZ1 A;  1DMQ A;  3KE7 A;  3BNC A;  1M1X B;  2HMN B;  1IU7 A;  1MNL A;  2Y74 A;  1N5H A;  3AMO A;  3K63 A;  4H3U A;  5AIH A;  5CF2 A;  1OF5 A;  1IQY A;  1MWS A;  4FCZ A;  1RN4 A;  4FCJ A;  1JZD A;  1TU5 A;  3UL5 A;  1R4C A;  4O2H A;  1BRN L;  1PY3 A;  3ER7 A;  1MGR A;  1GS3 A;  3DY5 A;  3F14 A;  3DUK A;  3EHC A;  5M1A A;  5KP1 A;  1CEW I;  1FUW A;  2SAR A;  2K3D A;  3NBJ A;  5CF1 A;  1IVX A;  1US1 A;  1TFK A;  1IVW A;  3LZA A;  1EQK A;  3D4A A;  3DH2 A;  4KFD A;  4AEQ A;  3MG3 A;  4HM2 B;  1NB5 I;  1Q40 A;  1Z1S A;  3DGL A;  3G6E 3;  1JKG B;  1B2S A;  3I55 3;  4RNY A;  5I97 A;  2KRT A;  2YFI B;  1ROA A;  2C11 A;  2BIR A;  4HM4 B;  3PXM A;  4LGQ A;  2H0H A;  1UW1 A;  3D5I A;  4FMD A;  5JBS A;  1TFO A;  1SJW A;  1T5Y A;  1DMM A;  1MWT A;  1RCL A;  2JDI H;  2F99 A;  5IG0 A;  3PYJ A;  1YJ9 3;  1Q9E A;  1V58 A;  3JUM A;  1BUJ A;  1HKX A;  1DMN A;  3FZW A;  4MMX B;  3IPT A;  4KFE A;  4ILF A;  3FG4 A;  1E3V A;  3K0Z A;  1Q86 4;  3J7Y d;  3LYG A;  3NQZ A;  2BHM A;  2BNG A;  5STD A;  1UUV B;  1E3R A;  1AVK A;  3B4P A;  2GEY A;  3IJE B;  7STD A;  2F5W A;  1W6G A;  2XR8 B;  3DZL A;  4EV2 A;  3EB8 A;  4HM3 B;  3G71 3;  3S27 A;  3NXJ A;  2CFW A;  1JZO A;  1X1U A;  2R41 A;  2PZV A;  3N9H A;  2GSP A;  2ML6 A;  3VSY A;  3WOF B;  1BAO A;  4HM6 B;  1A2V A;  1K73 4;  1IQX A;  4X2O A;  3K7C A;  3OX9 A;  2SBL A;  2XSH B;  1LQG C;  4N6O B;  3EX9 A;  3FCS B;  3BNB A;  3FLJ A;  2F5M A;  4GL6 A;  1FUT A;  1LVN A;  1T2I A;  4HKV B;  1O7P B;  1O7G B;  3BLZ A;  4BTY A;  4J8T A;  1FGT A;  4L8P A;  1BNE A;  1BSE A;  3BND A;  3HII A;  1RCK A;  2HOH A;  5JPU A;  2OQE A;  1FA3 A;  2ZL8 A;  3G0K A;  3S29 A;  2C10 A;  4FCM A;  3AHS A;  1RJO A;  1BNG A;  1IV7 A;  3BU4 A;  3ECF A;  4MJD A;  3URP A;  1GMQ A;  1BGS A;  4HYZ A;  2GBW B;  3F40 A;  1BSC A;  3L0R A;  3CC2 3;  2CWV A;  2Z77 A;  1C54 A;  5G1L A;  3D9R A;  2W56 B;  1M90 4;  3NHX A;  1OUN A;  3S28 A;  1BSB A;  2HML B;  4J5G A;  4OK0 A;  1I3I A;  3T0U A;  3JUP A;  1YIT 3;  1M9G A;  4JF8 A;  1T2H A;  1CQS A;  1B27 A;  2O9U X;  1Q7H A;  2CK3 H;  1UCI A;  4WHA A;  2D42 A;  3A5E A;  1ZS7 A;  2CG1 A;  4QWT A;  1BNR A;  1DVD A;  3O8Y A;  2CWU A;  3ZG5 A;  1M1K 4;  3LTB A;  3Q1C A;  3LXU X;  3T8N A;  2CIU A;  1KQS 2;  1YGE A;  3G16 A;  5HOH A;  2F4Y A;  2AAE A; 
#chains in the Genus database with same CATH homology
 1A2K A;  1ZX2 A;  4XBY A;  2GU3 A;  3CPW 2;  5IW9 A;  1NJI 4;  4HM7 B;  3V92 A;  1BUQ A;  1YJW 3;  3LTC A;  3GZX B;  3JVC A;  1W4N A;  3CCQ 3;  1JKG A;  4RNZ A;  1VQM 3;  1QVG 2;  4WWU C;  1QVF 2;  2XRX B;  1QJG A;  2OQE C;  3EJV A;  5IF6 A;  3CCU 3;  4R80 A;  3UNL A;  2A15 A;  2CG0 A;  3CCL 3;  3SVA A;  3LTA A;  1OHP A;  3NX0 A;  5AYS C;  4EYC A;  4TX4 A;  1FGO A;  3DGN A;  4N3V A;  3SOY A;  1FGR A;  2PNC A;  3GZY B;  3MSO A;  5DRE A;  5KP3 A;  3FH1 A;  3FG3 A;  3WOE B;  3CD6 3;  4FR9 A;  1NO3 A;  4XBX A;  4KZ1 A;  3GAX A;  3WOD G;  3X41 A;  4N6M A;  3NUV A;  1GY6 A;  4XB5 A;  1FGM A;  5D83 A;  3UB1 A;  2QEX 3;  3GZB A;  5D81 A;  3NQY A;  3KKG A;  4O02 B;  1CYU A;  3ALA A;  3CME 3;  3DGM A;  4KFF A;  2XF3 A;  1JNQ A;  1K41 A;  2R4I A;  1SII A;  1SIH A;  1LNH A;  2IA7 A;  4N6V 0;  4XBT A;  2RFR A;  4IT7 A;  1VQL 3;  2FGT A;  2W6J H;  2CH9 A;  1NU3 A;  5AEW B;  3HZP A;  1Q82 4;  1JJ2 2;  1ISK A;  5CXO A;  2HMK B;  2BMQ B;  1W6C A;  1W2B 2;  2WOF A;  2ZDJ A;  3I56 3;  3OV4 A;  3WA3 A;  5AIF A;  3WDG B;  1AR0 A;  3F8H A;  1JB4 A;  4N6T A;  3HK4 A;  1UI7 A;  4N6U A;  4BTX A;  3CC7 3;  4OUQ A;  4AKZ A;  3DGO A;  2XGL A;  2Z6B A;  3GZR A;  3KFQ C;  4K1V A;  2Q07 A;  5JPP A;  2WO0 A;  2YFL B;  2KCD A;  3IMA B;  3OXA A;  4EC6 A;  1N8R 4;  2W56 A;  3BB9 A;  3K9M C;  4FMB A;  2CFK A;  4J9A A;  4XDV A;  5EEO A;  1W00 A;  3VF1 A;  1D6Z A;  3DMC A;  5ELU A;  3A76 A;  5AYR B;  2OTJ 3;  5DRV A;  2UX0 A;  1J2B A;  1U5O A;  5ELJ A;  3MPH A;  1D6U A;  1GYB A;  1C7H A;  3GWR A;  4WP5 A;  2OTL 3;  1PFP A;  2QA4 3;  4EXR A;  4I4K A;  2CWT A;  1N5P A;  1IVU A;  2WGQ A;  4HM8 B;  1JB5 A;  5IG5 A;  3LH4 A;  4LMI A;  2BMR B;  3KSE D;  3V99 A;  1WNH A;  1RKY A;  1OHS A;  3T8U A;  2YX9 A;  1QMA A;  3CNM A;  2JQ5 A;  1W01 A;  4HBR A;  4EV5 A;  4ORL A;  2K54 A;  4HM0 B;  3SX1 A;  1VQO 3;  2W2C A;  1KD1 4;  1IT7 A;  3CCR 3;  4AKY A;  1VQ9 3;  3JUN A;  4HVN A;  1TP6 A;  2Z7A A;  1TIJ A;  2RGQ A;  4LEH A;  2LQV A;  3KSP A;  2P09 A;  3OWU A;  1O7W B;  3DM8 A;  3EN1 B;  4N6N B;  3HIG A;  3SED A;  3G4S 3;  1RRH A;  1RRL A;  3LML A;  1W6Y A;  3EC9 A;  2GXF A;  3OWY A;  3I0Y A;  4OVM A;  3NM2 A;  1VQ6 3;  3MWZ A;  1G96 A;  1K9M 4;  1FGQ A;  3LOY A;  3KII A;  3NBB A;  3UJM A;  1A90 A;  1GD4 A;  3B7C A;  1IDP A;  1O7M B;  3MKI A;  3PCR A;  2BMO B;  3RDE A;  2MC8 A;  4O8S A;  3V98 A;  5LC6 A;  3FGY A;  4L7K A;  3X42 A;  1VQN 3;  2WOH A;  1YI2 3;  3SOA A;  5G2G A;  5AII A;  1CYV A;  1SQW A;  3B4O A;  5BVB A;  3CCV 3;  3MG2 A;  1F8N A;  3H51 A;  1STD A;  2CW9 A;  3PCS A;  3CXC 2;  5IG4 A;  4U13 A;  4R9K A;  1VQP 3;  2GU1 A;  1OPY A;  3EBY A;  2D1W A;  3LTD A;  3U97 A;  4K61 A;  1K8A 4;  3F9S A;  2FXT A;  2W03 A;  2YFJ B;  5LC7 A;  1YJN 3;  2L4V A;  3EBT A;  3N8B A;  5FW5 A;  1OHO A;  3WA2 X;  2CFG A;  1OGZ A;  3F7X A;  2ML5 A;  3OW2 2;  5IER A;  2E2V A;  3HX8 A;  3BNE A;  3KN4 A;  3WMD A;  1U8C B;  2IUK A;  5BXQ A;  1PU4 A;  3DXO A;  1O7N B;  2CFL A;  4HJL B;  2MF7 A;  1IQ8 A;  3EQQ B;  2HMO B;  2XGN A;  1YVB I;  1DYU A;  1GD3 A;  1QAK A;  1WQL B;  4NRE A;  1WMO A;  4EBG A;  4JRF A;  1GY5 A;  1E97 A;  2LYX A;  3NBR A;  1WMP A;  2XEP A;  4HZB B;  4L8O A;  4N6L A;  2XH9 A;  2P0M A;  1Q7Y 4;  1VQ7 3;  1OGX A;  1EG9 B;  1YHQ 3;  2F86 B;  2OCT A;  3S67 A;  1QAL A;  1EA2 A;  1N8Q A;  1N9E A;  1IK3 A;  4HM5 B;  1W2Z A;  1Q81 4;  1OH0 A;  2STD A;  1L5G B;  2HMJ B;  2QGU A;  4R1K A;  3GRD A;  2CFD A;  4MMY B;  5A0O B;  2P38 A;  1Y4K A;  3LT9 A;  5KP4 A;  3FG1 A;  4X2H A;  3X3X A;  2RCD A;  5HGR A;  4H61 A;  3QRD A;  4Q53 A;  1KC8 4;  2RSX A;  3QK9 A;  2CHC A;  4MEI A;  5IEN A;  2O3O A;  5IG3 A;  3Q2P A;  3NV0 B;  2OWP A;  2W0Q A;  3FKA A;  1OAC A;  1GY7 A;  1VZZ A;  3FSD A;  3NM7 A;  3K5T A;  2CC3 A;  4IIA A;  3AMO B;  2E2T A;  2B24 B;  2W04 A;  4MMZ B;  4O3V A;  4FMC A;  1OF5 B;  5CLK A;  2Z76 A;  5AI1 A;  4NHF A;  1AVL A;  2OOV C;  4K1U A;  1W02 A;  1UI8 A;  1RN7 A;  3FF0 A;  3Q90 A;  4K90 B;  1D6Y A;  1NWW A;  3MHE A;  2IMJ A;  2F98 A;  3RGR A;  3UL6 A;  1JRQ A;  1KSI A;  1VQ8 3;  3HI7 A;  3OWS A;  1VQK 3;  3PS8 A;  1W7C A;  4RZM A;  3VGN A;  1NDO B;  1ASK A;  1NB3 I;  3FF2 A;  4WYK A;  3PGB A;  2K0M A;  3CCS 3;  1O7H B;  4GB5 A;  1IV9 A;  1ROV A;  1HU9 A;  4STD A;  1YIJ 3;  2P0X A;  2BO9 B;  1Q40 B;  1LXE A;  3EE1 A;  5IEO A;  4PEJ A;  3G8Z A;  5D82 A;  3M8C A;  2Y73 A;  3MG1 A;  2BT3 A;  1ULI B;  1S72 3;  1JN5 A;  2XFS A;  4R9L A;  2CKF B;  3JUO A;  4XM4 A;  3SXX A;  1TUH A;  1WTH A;  1Q42 A;  3U1W A;  1W5Z A;  1SPU A;  2HMM B;  3CNX A;  2B1X B;  1IVV A;  2XFT A;  4WFO A;  2E2U A;  1ZO2 A;  2GEX A;  2GBX B;  3CU3 A;  3KZT A;  1UUW B;  1V74 A;  5EQL A;  3STD A;  1JV2 B;  3S5C A;  3F7S A;  5IEP A;  2P05 A;  4WYK B;  1KWI A;  4CCV A;  3JUQ A;  1AV4 A;  3F8X A;  2KXG A;  3CMA 3;  3E99 A;  3PZW A;  4HZ9 B;  5TGN A;  4RBN A;  4G1M B;  2XSO B;  4FMA A;  1VQ4 3;  2V1L A;  1WMN A;  4BTW A;  2W9P A;  3H3H A;  1S5A A;  3MYT A;  1JN5 B;  2I9W A;  1EKM A;  4LZI A;  3ROB A;  4KVH A;  6STD A;  3TDG A;  3B8L A;  1LOX A;  2M7O A;  3X3Y A;  4ZM8 A;  3X40 A;  1MOL A;  2W9Q A;  3EF8 A;  3CC4 3;  1STF I;  4R4K A;  3RGA A;  3CPO A;  3D3L A;  3N54 B;  2INX A;  1N9J A;  2WGO A;  4XDW A;  3X3Z A;  3CCE 3;  1JB2 A;  1QAF A;  2QIY A;  1DVC A;  1A67 A;  2IUJ A;  2FNQ A;  1OCV A;  3CCM 3;  3SLU A;  4HM1 B;  3CCJ 3;  1ULJ B;  3EN8 A;  1K28 A;  4IPB A;  5EVH A;  4LSO A;  5AEU B;  3LT8 A;  3NV0 A;  2OOV A;  4CDL A;  5AIG A;  1IT8 A;  1VQ5 3;  5FGO A;  5CK6 A;  8CHO A;  1DMQ A;  3KE7 A;  3BNC A;  1M1X B;  2HMN B;  1IU7 A;  1MNL A;  2Y74 A;  1N5H A;  3AMO A;  3K63 A;  4H3U A;  5AIH A;  5CF2 A;  1OF5 A;  1IQY A;  4FCZ A;  4FCJ A;  1TU5 A;  3UL5 A;  1R4C A;  4O2H A;  3ER7 A;  1GS3 A;  3DY5 A;  3F14 A;  3DUK A;  3EHC A;  5KP1 A;  1CEW I;  1FUW A;  3NBJ A;  5CF1 A;  1IVX A;  1US1 A;  1TFK A;  1IVW A;  3LZA A;  1EQK A;  4KFD A;  4AEQ A;  3MG3 A;  4HM2 B;  1NB5 I;  1Q40 A;  1Z1S A;  3DGL A;  3G6E 3;  1JKG B;  3I55 3;  4RNY A;  5I97 A;  2KRT A;  2YFI B;  1ROA A;  2C11 A;  4HM4 B;  3PXM A;  4LGQ A;  1UW1 A;  5JBS A;  4FMD A;  1TFO A;  1SJW A;  1T5Y A;  1DMM A;  2JDI H;  2F99 A;  5IG0 A;  3PYJ A;  1YJ9 3;  3JUM A;  1HKX A;  1DMN A;  3FZW A;  4MMX B;  3IPT A;  4KFE A;  3FG4 A;  1E3V A;  3K0Z A;  1Q86 4;  3J7Y d;  3LYG A;  3NQZ A;  2BHM A;  2BNG A;  5STD A;  1UUV B;  1E3R A;  1AVK A;  3B4P A;  2GEY A;  3IJE B;  7STD A;  1W6G A;  2XR8 B;  3DZL A;  4EV2 A;  3EB8 A;  4HM3 B;  3G71 3;  3S27 A;  3NXJ A;  2CFW A;  2PZV A;  3N9H A;  2ML6 A;  3VSY A;  3WOF B;  4HM6 B;  1A2V A;  1K73 4;  1IQX A;  4X2O A;  3K7C A;  3OX9 A;  2SBL A;  2XSH B;  4N6O B;  3EX9 A;  3FCS B;  3BNB A;  3FLJ A;  4GL6 A;  1LVN A;  4HKV B;  1O7P B;  1O7G B;  3BLZ A;  4BTY A;  4J8T A;  1FGT A;  4L8P A;  3BND A;  3HII A;  5JPU A;  2OQE A;  1FA3 A;  2ZL8 A;  3G0K A;  3S29 A;  2C10 A;  4FCM A;  1RJO A;  1IV7 A;  3ECF A;  4MJD A;  4HYZ A;  2GBW B;  3F40 A;  3L0R A;  3CC2 3;  2CWV A;  2Z77 A;  3D9R A;  2W56 B;  1M90 4;  3NHX A;  1OUN A;  3S28 A;  2HML B;  4OK0 A;  3T0U A;  3JUP A;  1YIT 3;  1M9G A;  4JF8 A;  1CQS A;  2O9U X;  4WHA A;  2CK3 H;  2D42 A;  1DVD A;  2CG1 A;  4QWT A;  3O8Y A;  2CWU A;  1M1K 4;  3LTB A;  3Q1C A;  3LXU X;  3T8N A;  2CIU A;  1KQS 2;  1YGE A;  3G16 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...