3LYGA

Crystal structure of ntf2-like protein of unknown function (yp_270605.1) from colwellia psychrerythraea 34h at 1.61 a resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
120
structure length
120
Chain Sequence
GMNLANIVQRGWEALGAGDFDTLVTDYVEKMIFIMPGQADVLKGRQAFRSALDNLGEILPPGFEITGLRQLEGENEIVSIVEWKSDKMIASQLSVLFKFEGDQIYEERWFVDTEQWKSVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of NTF2-like protein of unknown function (YP_270605.1) from Colwellia psychrerythraea 34H at 1.61 A resolution
rcsb
source organism Colwellia psychrerythraea
molecule tags Structural genomics, unknown function
molecule keywords NTF2-like protein of unknown function
total genus 35
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2010-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3lygA00
3HX8A 3F7SA 5AIGA 3DXOA 2GEXA 3EC9A 1O7GB 2YFLB 4HM1B 3FKAA 1WQLB 3T8NA 3NBRA 1EG9B 3JUOA 5HGRA 1ISKA 1E3VA 1OGZA 4I4KA 3B7CA 3MSOA 4RZMA 2BMRB 1JKGB 1QJGA 2F86B 2RFRA 3K7CA 3NXJA 4HM5B 2BMQB 3GZBA 4K1UA 1BUQA 3LYGA 3KZTA 1OCVA 2XSOB 3MYTA 3SEDA 4HVNA 1GS3A 2STDA 4HZBB 4XM4A 2A15A 3EHCA 1OH0A 1A2KA 3MHEA 2F99A 4L8PA 5IERA 2HMKB 3I0YA 2CHCA 3G0KA 4XB5A 1K41A 1GY5A 1Z1SA 4XBTA 3STDA 1ZX2A 1Q40B 3JUPA 5EVHA 3FF2A 3D9RA 4HM3B 1JB2A 1OPYA 4WYKB 1O7MB 2W2CA 5IEOA 3OWYA 3GZYB 1NWWA 3ECFA 3OWUA 3NV0A 1QMAA 1ASKA 3NHXA 2GBXB 1DMNA 4J8TA 4XDVA 4XDWA 5IG3A 2HMNB 4HKVB 2XRXB 2B1XB 5G2GA 4HM6B 4X2HA 1JN5A 1OHOA 2BNGA 3EN8A 4J9AA 4LEHA 8CHOA 5BXQA 3DM8A 2BMOB 3EBYA 2RCDA 1AR0A 2IMJA 3LZAA 1Q40A 4N3VA 4Q53A 3EJVA 1SJWA 4U13A 3B4OA 2UX0A 4XBYA 3VGNA 5BVBA 5IG4A 1GY7A 3M8CA 3MG1A 4LGQA 2HMJB 3B4PA 5FW5A 5IG0A 1E3RA 5TGNA 1DMMA 3FZWA 1GY6A 3KKGA 2QGUA 3FH1A 5AIHA 5D81A 2R4IA 4R9KA 4OUQA 2PZVA 5AI1A 3EF8A 3DMCA 3G8ZA 4HJLB 3SOAA 1UUWB 3DUKA 5AEUB 3CU3A 4ORLA 5DREA 3FSDA 3H51A 3F8HA 3MKIA 4HM0B 1UUVB 3SOYA 3MG3A 5D83A 3MG2A 3F9SA 4LMIA 3VSYA 4K1VA 1OF5B 1TUHA 3NM2A 2QIYA 3Q90A 3B8LA 2Z77A 3G16A 4L7KA 4STDA 1OUNA 3A76A 3HZPA 4KVHA 1EA2A 3GZXB 4X2OA 1C7HA 3KE7A 4IIAA 1O7HB 2INXA 5CF2A 2B24B 5IENA 5IG5A 1NDOB 4R9LA 3GWRA 3HK4A 3T8UA 5JPUA 5STDA 1ULJB 5CLKA 3BLZA 4FCMA 2CKFB 4H3UA 1STDA 1W6YA 3CNXA 4HM2B 4PEJA 4L8OA 3RGRA 3F7XA 3IPTA 3NV0B 2JQ5A 2GEYA 2K54A 4HM4B 5AEWB 3ROBA 3OWSA 6STDA 5KP4A 3UJMA 1OHPA 2GBWB 5KP3A 3KSPA 5AIIA 3NUVA 1U5OA 2XSHB 5CF1A 1JKGA 3CPOA 3EX9A 4WYKA 5D82A 3JUNA 3GRDA 1W00A 5IF6A 4CDLA 3OX9A 2HMLB 1W01A 3CNMA 5JPPA 3EN1B 1TP6A 3E99A 1W02A 3K0ZA 1JB4A 3DZLA 3EQQB 3OXAA 1OHSA 4GB5A 4OVMA 5DRVA 1NU3A 2RGQA 3ER7A 1HKXA 3JUMA 2Z76A 1E97A 3FGYA 4HM7B 4MJDA 3RGAA 1CQSA 2YFIB 4R1KA 4WP5A 3H3HA 4FCJA 1IDPA 2Z7AA 4WWUC 2YFJB 1JB5A 1ULIB 2HMOB 3UNLA 3OV4A 1DMQA 1JN5B 3JUQA 1GYBA 4HZ9B 1OF5A 3S5CA 3WMDA 1ZO2A 3F40A 3F8XA 1Q42A 1O7NB 3EBTA 3GZRA 4HM8B 5IEPA 3F14A 3BB9A 1O7PB 2I9WA 4XBXA 7STDA 5KP1A 5AIFA 5CXOA 2XR8B 1O7WB 2GXFA 1OGXA 3FF0A 5CK6A 3FLJA 2OWPA 1S5AA 2F98A 2HMMB 1VZZA
chains in the Genus database with same CATH superfamily
1LOXA 1I2GA 3HX8A 1L5GB 3DXOA 1RN7A 2CW9A 3WOEB 4HM1B 3FKAA 1C54A 1D6YA 3DGMA 1FGTA 1B2UA 2RBIA 1OGZA 5GSPA 5AEUB 1Q864 6GSPA 1MWUA 2F86B 4HM5B 2WOFA 3SEDA 3KZTA 3MYTA 4GSPA 4LYLB 4EBGA 2BHMA 4HZBB 3D79A 3FG3A 3EHCA 1RGKA 4XM4A 2W0QA 3I0YA 1UDII 2D42A 3KN4A 4J5GA 7GSPA 2P05A 2QEX3 1GOUA 1RCLA 1Z1SA 2CFLA 4CPKA 1ZX2A 4N6OB 5EVHA 3FF2A 3RNTA 1OPYA 1N8R4 1O7MB 3X3XA 1FUTA 3MWZA 1M904 1X1UA 1NWWA 3ECFA 4N6TA 3JVCA 3NV0A 2CFDA 1ASKA 3OWUA 3CCU3 1B27A 4XDVA 1IVVA 1K734 1U8CB 3QRDA 1AVLA 1V74A 3AHSA 3PGBA 3CMA3 3FG4A 1N5PA 1JN5A 2BNGA 2XGLA 3DGYA 3LTAA 1N9EA 4LZIA 5BXQA 3BNDA 3DM8A 3LZAA 4AKZA 2BO9B 1D6ZA 2IUKA 4RNZA 3Q1CA 1VQ43 1B3SA 3VGNA 4EW5A 5BVBA 1UGHI 1GY7A 2C11A 3BIRA 3M8CA 1E3RA 2V1LA 1DMMA 1BSDA 1R4CA 4BTWA 2D1WA 2QGUA 3FH1A 2E2TA 2R4IA 4OUQA 1RLSA 4NHFA 1CYUA 2OQEC 4FMBA 4HYZA 1ZS7A 1VQM3 1W5ZA 2IA7A 1HU9A 1UUVB 1W6GA 3MG3A 3Q2PA 4R4KA 1TUHA 1UGIA 3WA2X 4BIRA 1DETA 1UI7A 2C4BA 3B8LA 3BNEA 3LOYA 5I97A 4L7KA 1UUGB 3S29A 1YJ93 4KVHA 3GZXB 1AQZA 1SPUA 3D3LA 1BRGA 5CF2A 4O3VA 5IENA 3CCE3 1NDOB 3X41A 1VQ63 1W6CA 1G96A 4HM2B 4N6MA 2BT3A 4L8OA 3NV0B 4JF8A 2GEYA 5KP4A 1YI23 4QWTA 6STDA 3OWSA 1IQXA 1OHPA 2KF5A 1FGRA 1RGFA 5CF1A 1JKGA 1UI8A 2J8XB 2P38A 3GRDA 4O2HA 5IF6A 4BTYA 1BSCA 1TP6A 3NX0A 1JB4A 3EQQB 3HIGA 1SARA 1K8A4 2MF7A 3JUMA 1FUWA 2K3DA 1KC84 1E97A 4BL2A 1UCLA 1TFOA 2YFIB 1GD3A 4R1KA 4WP5A 1VQ83 3H3HA 4FCJA 1IDPA 2Z7AA 1T3BA 3DY5A 2YFJB 4R80A 3VF1A 1BNFA 1QVG2 1X1YA 1DMQA 1JZOA 1BNGA 2OCTA 1I2EA 1O7NB 1V57A 3EBTA 4EV2A 2KF4A 3GSPA 4HM8B 1EUIC 1MNLA 5M1AA 1O7PB 1CH0A 2M7OA 4IT7A 1W2ZA 1RSNA 3OW22 1LNHA 1BVIA 1V58A 1S5AA 1G02A 3OXAA 5FW5A 2AADA 1T2IA 1Q824 2HOHA 2IY2A 4FCZA 5AIGA 1JBRA 2YFLB 1CEWI 1RGHA 3D5GA 2H0HA 3T8NA 1EG9B 3G4S3 3D5IA 3JUOA 5HGRA 1ISKA 1E3VA 1B20A 2BMRB 1JKGB 1QJGA 3K7CA 3NXJA 4NREA 2CIUA 4K1UA 3GZBA 2CG1A 1BUQA 2XSOB 1UCJA 2STDA 3N8BA 3Q3FA 2P0XA 5LC6A 3X3YA 1RRLA 5IERA 2YX9A 2HMKB 1NB3I 3DH2A 2F5WA 4NPBA 4I5QA 1GY5A 4XBTA 2ML5A 3S28A 1I0XA 5A0OB 1JB2A 1PY3A 2W2CA 1GOYA 2UUGC 2OTL3 1UCKA 1EQKA 1LVNA 1QMAA 3A5EA 4KFDA 2HMNB 1WMNA 5G2GA 1A67A 2KF3A 4HM6B 1OHOA 3FG1A 3LT8A 3EBYA 4N3VA 2RCDA 3AGOA 2IMJA 4Q53A 1I8VA 5AYSC 3SYUA 1S723 3HI7A 3L0RA 3CC73 2KF6A 1YJW3 4XBYA 1KWIA 2Y73A 5IG4A 1X1WA 2F56A 1BANA 1UCIA 1BRNL 1QAKA 4KT3B 3FZWA 4AEQA 4R9KA 1TJDA 5M19A 4HAAA 3GAXA 3DUKA 1LOWA 1T5YA 2W04A 4TX4A 3LT9A 1BRSA 1TRQA 1A2VA 1NO3A 2H0GA 3KIIA 2QIYA 2CX0A 3Q90A 4EC6A 3ZG5A 3AMOA 3PS8A 2W03A 1OUNA 1LOVA 3A76A 2ML6A 2CH9A 1IVWA 2XEPA 3HZPA 1C7HA 1B21A 3KE7A 3QK9A 4IIAA 4X2OA 2B24B 2CK3H 5IG5A 1GMQA 4IPBA 2SBLA 3T8UA 5JPUA 5STDA 1M1XB 1EEJA 5EEOA 4H3UA 1RJOA 1STDA 1W6YA 2CG0A 1RGLA 5ELJA 1BOXA 3STDA 3LH4A 4HM4B 3HIIA 3N9HA 1GMPA 1FA3A 1RHLA 1RDSA 3EE1A 1B2MA 3KSPA 4KFFA 1W7CA 3WOFB 3CPOA 1YGEA 1Q7HA 3LXUX 1BSAA 3ALAA 3E99A 3DGOA 1FYSA 1W02A 3K0ZA 4FMAA 3DZLA 5DRVA 2OOVA 4OVMA 2W6JH 2BIRA 1TFKA 4GB5A 2RGQA 4MJDA 1HKXA 2LYXA 4HM7B 4OK0A 2K0MA 2IYJA 3RGAA 3N54B 3U97A 3TDGA 1NNVA 2GSPA 2P0MA 9RNTA 1M1K4 1BSBA 1JB5A 2CWTA 2LQVA 3OV4A 4MMYB 1NJI4 5EQLA 1GYBA 1IT8A 4HZ9B 3F40A 5RNTA 1Q42A 2Y74A 3GZRA 1BUJA 3UB1A 3BB9A 1LQGC 3NBJA 1KD14 2SARA 3HOHA 5CXOA 1G0TA 1QVF2 1O7WB 3S67A 1RCKA 4O02B 3FLJA 4MMXB 3WR2A 1RRHA 2F98A 2BU4A 4WHAA 1VZZA 4J5KA 4O8SA 2GEXA 4N6V0 1O7GB 2ZA4A 2KAAA 1IK3A 2XF3A 4I4KA 1Q814 3LTCA 3MSOA 4KZ1A 1VQ93 2RFRA 5FGOA 1FGMA 3G6E3 1AY7A 1OCVA 2XH9A 4N6LA 4HVNA 3X40A 3MHEA 1OH0A 1A2KA 2F99A 4LSOA 2RSXA 3SLUA 3O8YA 3V99A 4CCVA 3CPW2 3JUPA 1I2FA 1VQL3 2GU1A 3D9RA 2GU3A 5IEOA 1B2XA 3OWYA 1GOVA 5BIRA 5M18A 1K9M4 3CD63 4XDWA 2IUJA 1DMNA 1N9JA 3PCRA 3CC23 1RNTA 4FR9A 1YIJ3 2B1XB 3NQZA 4X2HA 5IEPA 3EN8A 4J9AA 1JBSA 1GD4A 3AGNA 2BMOB 5AI1A 3CCS3 1B2ZA 1TTOA 2O3OA 3ZFZA 1KQS2 3EJVA 1SIHA 1VQN3 1LNIA 1SJWA 1YVSA 1IQ8A 4FMCA 4U13A 3B4OA 1PU4A 3MG1A 2KRTA 2XGNA 5IG0A 1WMOA 1GY6A 3KKGA 5D81A 3EF8A 3DMCA 3PZWA 1UW1A 3UL6A 2O9UX 3SOAA 1UUWB 2W56B 4ORLA 1STFI 5D83A 1BAOA 3MG2A 3F9SA 2L1SA 3X42A 1N5HA 1OF5B 4BL3A 1YHQ3 1HZ1A 1MGWA 2Z77A 2CWUA 5LC7A 1US1A 4EXRA 1JV2B 2ZDJA 3G713 1VQP3 1EA2A 1MWSA 3WA3A 4MEIA 3HK4A 1I0VA 1ULJB 1LOYA 4K90B 3BLZA 4ZM8A 2CKFB 4K61A 2FNQA 3CNXA 3RGRA 5AEWB 3F7XA 1ZGXA 3CCJ3 2JDIH 3KCHA 1FGQA 3PCSA 1YGWA 3URPA 1VQ73 2P09A 3I563 5KP3A 3V92A 5AIIA 3NUVA 2XSHB 1I3FA 1KSIA 3JUNA 1YIT3 3IMAB 1LRAA 1MGRA 2HMLB 3OX9A 2CFGA 1A90A 3EN1B 1MWRA 3SX1A 2CC3A 4EYCA 4HBRA 4GL6A 5G1LA 5AYRB 3ER7A 2OTJ3 2Z76A 6RNTA 8RNTA 1JRQA 3BU4A 1OACA 1BNEA 1PFPA 4GHOA 1BRIA 1GSPA 1ULIB 1BNJA 3JUQA 1VQK3 3S5CA 1WMPA 1OF5A 1JBTA 1BSEA 3WMDA 3F8XA 3RDEA 1SIIA 5G1KA 4RBNA 3CME3 3U1WA 1QAFA 1W4NA 2I9WA 2W56A 4XBXA 1IQYA 2UGIA 3D4AA 7STDA 4JRFA 2GXFA 1OGXA 3FF0A 1BNRA 1RN4A 2E2UA 3AHWA 1I70A 1RGAA 1IV7A 4MMZB 3F7SA 1GMRA 3S27A 2KCDA 3EC9A 4BTXA 1Y4KA 1EKMA 1LXEA 1WQLB 3IJEB 3NBRA 3B7CA 4RZMA 2BMQB 1YNVX 1BRJA 1BNSA 1BRKA 1RGCA 2RNTA 3LYGA 3NBBA 3FCSB 1Q9EA 4G1MB 1GS3A 3ZG0A 3BNCA 2A15A 4L8PA 4ILFA 1VQO3 1K28A 2XFTA 2CHCA 1IU7A 1FGOA 1M9GA 1WNHA 3G0KA 4XB5A 1K41A 3PYJA 1FW7A 2KXGA 2CWVA 1Q40B 1SQWA 4HM3B 1N8QA 4WYKB 4EV5A 3BNBA 1VQ53 3GZYB 2OQEA 1AV4A 3V98A 4RNYA 4N6NB 3NHXA 2GBXB 4J8TA 5IG3A 1MOLA 4HKVB 2XRXB 4LEHA 1CYVA 8CHOA 1W2B2 2WGOA 1AR0A 3WODG 2FXTA 1Q40A 3DGLA 1ROVA 1FZUA 3MPHA 2QA43 1JNQA 2UX0A 3WHOA 3EB8A 5HOHA 2Q07A 4LGQA 4RNTA 5ELUA 1B2SA 1AVKA 2HMJB 3B4PA 1BRHA 4HOHA 4FMDA 3K63A 5TGNA 2MC8A 4BU4A 7RNTA 1PYLA 3DGNA 5AIHA 3T0UA 2PZVA 3G8ZA 4HJLB 4WFOA 2F5MA 1BGSA 1R4YA 1RN1A 4N6UA 1I3IA 1RGEA 1DVDA 4CJNA 1TIJA 1VQQA 3CU3A 5DREA 1T2HA 3FSDA 3F8HA 3H51A 3K9MC 3MKIA 4HM0B 3SOYA 3AMOB 4H61A 4LMIA 2R41A 3VSYA 4K1VA 1LQMB 3CCL3 3LTBA 2WGQA 3NM2A 3KSED 1RNBA 1DVCA 1IVUA 2Z6BA 1F8NA 1QALA 1RGGA 3G16A 4STDA 1Q7Y4 3NQYA 3CCR3 1JJ22 5BU4A 1BNIA 1IYYA 1YVBI 1O7HB 2INXA 2OOVC 3LTDA 4R9LA 1ROAA 3GWRA 2H0IA 5IW9A 3CCM3 3J7Yd 5CLKA 4FCMA 2F4YA 4PEJA 3LMLA 1NB5I 2CFKA 3IPTA 2JQ5A 2K54A 3SVAA 3ROBA 3UJMA 2PNCA 2GBWB 1U5OA 3EX9A 4WYKA 1IV9A 2FGTA 2WOHA 5D82A 2E2VA 1WTHA 1W00A 2CFWA 4CDLA 3CNMA 1W01A 1YJN3 5JPPA 3KFQC 1OHSA 3I553 1NU3A 1TRPA 3FGYA 1TU5A 1DE3A 1JZDA 1RTUA 1CQSA 2ZL8A 2W9QA 4AKYA 4WWUC 2L4VA 2ZHXB 2HMOB 1BIRA 4KFEA 2W9PA 2CX1A 3UNLA 3CCV3 3WDGB 3CC43 1JN5B 5JBSA 4DKIA 1MWTA 1IT7A 1RMSA 1ZO2A 2AAEA 1RKYA 3CXC2 1HYFA 1IVXA 3K5TA 1J2BA 3F14A 1BU4A 2XFSA 3UL5A 1FUSA 2WO0A 3X3ZA 5KP1A 5AIFA 1D6UA 2XR8B 2C10A 1X1XA 5CK6A 1DYUA 1A2PA 3NM7A 2OWPA 3PXMA 3SXXA 2HMMB 3CCQ3
chains in the Genus database with same CATH topology
1LOXA 3HX8A 1L5GB 3DXOA 1RN7A 2CW9A 3WOEB 4HM1B 3FKAA 1D6YA 3DGMA 1FGTA 1OGZA 5AEUB 1Q864 2F86B 4HM5B 2WOFA 3SEDA 3KZTA 3MYTA 4EBGA 2BHMA 4HZBB 3FG3A 4XM4A 3EHCA 2W0QA 3I0YA 2D42A 3KN4A 2P05A 2QEX3 1Z1SA 2CFLA 1ZX2A 4N6OB 5EVHA 3FF2A 1OPYA 1N8R4 1O7MB 3X3XA 3MWZA 1M904 4N6TA 1NWWA 3ECFA 3CCU3 3JVCA 3NV0A 2CFDA 1ASKA 3OWUA 4XDVA 1IVVA 1K734 1U8CB 3QRDA 1AVLA 1V74A 3PGBA 3CMA3 3FG4A 1N5PA 1JN5A 2BNGA 2XGLA 3LTAA 1FUWA 1N9EA 4LZIA 5BXQA 3BNDA 3DM8A 3LZAA 4AKZA 2BO9B 1D6ZA 2IUKA 4RNZA 3Q1CA 1VQ43 3VGNA 5BVBA 2C11A 1GY7A 3M8CA 1E3RA 2V1LA 1DMMA 4BTWA 1R4CA 2D1WA 2QGUA 3FH1A 2E2TA 2R4IA 4OUQA 4NHFA 1CYUA 2OQEC 4FMBA 4HYZA 1VQM3 1W5ZA 2IA7A 1HU9A 1UUVB 1W6GA 3MG3A 3Q2PA 4R4KA 1TUHA 3WA2X 1UI7A 3B8LA 3BNEA 3LOYA 5I97A 4L7KA 3S29A 1YJ93 4KVHA 3GZXB 1SPUA 3D3LA 5CF2A 4O3VA 5IENA 3CCE3 1NDOB 3X41A 1VQ63 1W6CA 1G96A 4HM2B 4N6MA 2BT3A 4L8OA 3NV0B 4JF8A 2GEYA 5KP4A 1YI23 4QWTA 6STDA 3OWSA 1IQXA 1OHPA 1FGRA 5CF1A 1JKGA 1UI8A 2P38A 3GRDA 4O2HA 5IF6A 4BTYA 1TP6A 3NX0A 1JB4A 3EQQB 3HIGA 1K8A4 2MF7A 3JUMA 1KC84 1E97A 1TFOA 2YFIB 1GD3A 4R1KA 4WP5A 1VQ83 3H3HA 4FCJA 1IDPA 2Z7AA 3DY5A 2YFJB 4R80A 3VF1A 1QVG2 1DMQA 2OCTA 1O7NB 3EBTA 4EV2A 4HM8B 1MNLA 1O7PB 2M7OA 4IT7A 1W2ZA 3OW22 1LNHA 1S5AA 3OXAA 5FW5A 1Q824 4FCZA 5AIGA 2YFLB 1CEWI 3T8NA 1EG9B 3G4S3 3JUOA 5HGRA 1ISKA 1E3VA 2BMRB 1JKGB 1QJGA 3K7CA 3NXJA 4NREA 2CIUA 4K1UA 3GZBA 2CG1A 1BUQA 2XSOB 2STDA 3N8BA 3X3YA 2P0XA 5LC6A 1RRLA 5IERA 2YX9A 2HMKB 1NB3I 1GY5A 4XBTA 2ML5A 3S28A 5A0OB 1JB2A 2W2CA 2OTL3 1EQKA 1LVNA 1QMAA 4KFDA 2HMNB 1WMNA 5G2GA 1A67A 4HM6B 1OHOA 3FG1A 3LT8A 3EBYA 4N3VA 2RCDA 4Q53A 2IMJA 5AYSC 1S723 3HI7A 3L0RA 3CC73 1YJW3 4XBYA 1KWIA 2Y73A 5IG4A 1QAKA 3FZWA 4AEQA 4R9KA 3GAXA 3DUKA 1T5YA 2W04A 4TX4A 3LT9A 1A2VA 1NO3A 3KIIA 2QIYA 3Q90A 4EC6A 3AMOA 3PS8A 2W03A 1OUNA 3A76A 3HZPA 2ML6A 2CH9A 1IVWA 2XEPA 3QK9A 1C7HA 3KE7A 4IIAA 4X2OA 3J7Yd 2B24B 2CK3H 5IG5A 4IPBA 2SBLA 3T8UA 5JPUA 5STDA 1M1XB 5EEOA 4H3UA 1RJOA 1STDA 1W6YA 2CG0A 5ELJA 3STDA 3LH4A 4HM4B 3HIIA 3N9HA 1FA3A 3EE1A 3KSPA 4KFFA 1W7CA 3WOFB 3CPOA 1YGEA 3LXUX 3ALAA 3E99A 3DGOA 1W02A 4FMAA 3K0ZA 2OOVA 3DZLA 5DRVA 1JJ22 4OVMA 2W6JH 4GB5A 1TFKA 2RGQA 4MJDA 1HKXA 2LYXA 4HM7B 4OK0A 2K0MA 3RGAA 3N54B 3U97A 3TDGA 2P0MA 1M1K4 1JB5A 2CWTA 2LQVA 3OV4A 4MMYB 1NJI4 5EQLA 1GYBA 1IT8A 4HZ9B 3F40A 1Q42A 2Y74A 3GZRA 3UB1A 3BB9A 3NBJA 1KD14 5CXOA 1QVF2 1O7WB 3S67A 4O02B 3FLJA 4MMXB 2F98A 1RRHA 4WHAA 1VZZA 4O8SA 2GEXA 4N6V0 1O7GB 1IK3A 2XF3A 4I4KA 1Q814 3LTCA 3MSOA 4KZ1A 1VQ93 2RFRA 5FGOA 1FGMA 3G6E3 2XH9A 1OCVA 4N6LA 4HVNA 3X40A 3MHEA 1OH0A 1A2KA 2F99A 4LSOA 2RSXA 3SLUA 3O8YA 3V99A 4CCVA 3CPW2 3JUPA 1VQL3 2GU1A 3D9RA 2GU3A 5IEOA 3OWYA 1K9M4 3CD63 4XDWA 2IUJA 1DMNA 1N9JA 3PCRA 3CC23 4FR9A 1YIJ3 2B1XB 3NQZA 4X2HA 5IEPA 3EN8A 4J9AA 1GD4A 2BMOB 5AI1A 3CCS3 1KQS2 2O3OA 3EJVA 1SIHA 1VQN3 1SJWA 4U13A 1IQ8A 4FMCA 3B4OA 1PU4A 3MG1A 2KRTA 2XGNA 5IG0A 1WMOA 1GY6A 3KKGA 5D81A 3EF8A 3DMCA 3PZWA 1UW1A 3UL6A 2O9UX 3SOAA 1UUWB 2W56B 4ORLA 1STFI 5D83A 3MG2A 3X42A 3F9SA 1N5HA 1OF5B 1YHQ3 2Z77A 2CWUA 5LC7A 1US1A 4EXRA 1JV2B 2ZDJA 3G713 1VQP3 1EA2A 3WA3A 4MEIA 3HK4A 1ULJB 4ZM8A 4K90B 3BLZA 2CKFB 4K61A 2FNQA 3CNXA 3RGRA 5AEWB 3F7XA 3CCJ3 2JDIH 3PCSA 1FGQA 1VQ73 2P09A 3I563 5KP3A 3V92A 5AIIA 3NUVA 2XSHB 1KSIA 3JUNA 1YIT3 3IMAB 3OX9A 2HMLB 1A90A 2CFGA 3EN1B 3SX1A 2CC3A 4EYCA 4HBRA 4GL6A 5AYRB 2OTJ3 3ER7A 2Z76A 1JRQA 1OACA 1PFPA 1ULIB 3JUQA 1VQK3 3S5CA 1WMPA 1OF5A 3WMDA 3F8XA 3RDEA 1SIIA 4RBNA 3CME3 3U1WA 1QAFA 1W4NA 2I9WA 2W56A 4XBXA 1IQYA 7STDA 4JRFA 2GXFA 1OGXA 3FF0A 2E2UA 1IV7A 4MMZB 3F7SA 3S27A 2KCDA 3EC9A 4BTXA 1Y4KA 1EKMA 1LXEA 1WQLB 3IJEB 3NBRA 3B7CA 4RZMA 2BMQB 3LYGA 4G1MB 3NBBA 3FCSB 1GS3A 3BNCA 2A15A 4L8PA 1VQO3 1K28A 2XFTA 2CHCA 1IU7A 1FGOA 1M9GA 1WNHA 3G0KA 4XB5A 1K41A 3PYJA 2KXGA 2CWVA 1Q40B 1SQWA 4HM3B 1N8QA 4WYKB 4EV5A 3BNBA 1VQ53 3GZYB 2OQEA 1AV4A 3V98A 4RNYA 4N6NB 3NHXA 2GBXB 4J8TA 5IG3A 1MOLA 4HKVB 2XRXB 4LEHA 1CYVA 8CHOA 1W2B2 2WGOA 1AR0A 3WODG 2FXTA 1Q40A 3DGLA 1ROVA 3MPHA 2QA43 1JNQA 2UX0A 3EB8A 2Q07A 4LGQA 5ELUA 1AVKA 2HMJB 3B4PA 2MC8A 5TGNA 4FMDA 3K63A 3DGNA 5AIHA 3T0UA 2PZVA 3G8ZA 4HJLB 4WFOA 1DVDA 4N6UA 1TIJA 3CU3A 5DREA 3FSDA 3H51A 3F8HA 3K9MC 3MKIA 4HM0B 3SOYA 3AMOB 4H61A 4LMIA 3VSYA 4K1VA 3CCL3 3LTBA 2WGQA 3NM2A 3KSED 1DVCA 1IVUA 2Z6BA 1F8NA 1QALA 3G16A 4STDA 1Q7Y4 3NQYA 3CCR3 1YVBI 1O7HB 2INXA 2OOVC 3LTDA 4R9LA 1ROAA 3GWRA 5IW9A 3CCM3 5CLKA 4FCMA 4PEJA 3LMLA 1NB5I 2CFKA 3IPTA 2JQ5A 2K54A 3SVAA 3ROBA 3UJMA 2PNCA 2GBWB 1U5OA 3EX9A 4WYKA 1IV9A 2FGTA 2WOHA 5D82A 2E2VA 1WTHA 1W00A 2CFWA 4CDLA 3CNMA 1W01A 1YJN3 5JPPA 3KFQC 1OHSA 3I553 1NU3A 3FGYA 1TU5A 1CQSA 2ZL8A 2W9QA 4AKYA 4WWUC 2L4VA 2HMOB 4KFEA 3UNLA 2W9PA 3CCV3 3WDGB 3CC43 1JN5B 5JBSA 1IT7A 1ZO2A 3CXC2 1RKYA 1IVXA 3K5TA 1J2BA 3F14A 2XFSA 3UL5A 2WO0A 3X3ZA 5KP1A 5AIFA 1D6UA 2XR8B 2C10A 5CK6A 1DYUA 3NM7A 2OWPA 3PXMA 3SXXA 2HMMB 3CCQ3
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HX8 A;  3F7S A;  5AIG A;  3DXO A;  2GEX A;  3EC9 A;  1O7G B;  2YFL B;  4HM1 B;  3FKA A;  1WQL B;  3T8N A;  3NBR A;  1EG9 B;  3JUO A;  5HGR A;  1ISK A;  1E3V A;  1OGZ A;  4I4K A;  3B7C A;  3MSO A;  4RZM A;  2BMR B;  1JKG B;  1QJG A;  2F86 B;  2RFR A;  3K7C A;  3NXJ A;  4HM5 B;  2BMQ B;  3GZB A;  4K1U A;  1BUQ A;  3LYG A;  3KZT A;  1OCV A;  2XSO B;  3MYT A;  3SED A;  4HVN A;  1GS3 A;  2STD A;  4HZB B;  4XM4 A;  2A15 A;  3EHC A;  1OH0 A;  1A2K A;  3MHE A;  2F99 A;  4L8P A;  5IER A;  2HMK B;  3I0Y A;  2CHC A;  3G0K A;  4XB5 A;  1K41 A;  1GY5 A;  1Z1S A;  4XBT A;  3STD A;  1ZX2 A;  1Q40 B;  3JUP A;  5EVH A;  3FF2 A;  3D9R A;  4HM3 B;  1JB2 A;  1OPY A;  4WYK B;  1O7M B;  2W2C A;  5IEO A;  3OWY A;  3GZY B;  1NWW A;  3ECF A;  3OWU A;  3NV0 A;  1QMA A;  1ASK A;  3NHX A;  2GBX B;  1DMN A;  4J8T A;  4XDV A;  4XDW A;  5IG3 A;  2HMN B;  4HKV B;  2XRX B;  2B1X B;  5G2G A;  4HM6 B;  4X2H A;  1JN5 A;  1OHO A;  2BNG A;  3EN8 A;  4J9A A;  4LEH A;  8CHO A;  5BXQ A;  3DM8 A;  2BMO B;  3EBY A;  2RCD A;  1AR0 A;  2IMJ A;  3LZA A;  1Q40 A;  4N3V A;  4Q53 A;  3EJV A;  1SJW A;  4U13 A;  3B4O A;  2UX0 A;  4XBY A;  3VGN A;  5BVB A;  5IG4 A;  1GY7 A;  3M8C A;  3MG1 A;  4LGQ A;  2HMJ B;  3B4P A;  5FW5 A;  5IG0 A;  1E3R A;  5TGN A;  1DMM A;  3FZW A;  1GY6 A;  3KKG A;  2QGU A;  3FH1 A;  5AIH A;  5D81 A;  2R4I A;  4R9K A;  4OUQ A;  2PZV A;  5AI1 A;  3EF8 A;  3DMC A;  3G8Z A;  4HJL B;  3SOA A;  1UUW B;  3DUK A;  5AEU B;  3CU3 A;  4ORL A;  5DRE A;  3FSD A;  3H51 A;  3F8H A;  3MKI A;  4HM0 B;  1UUV B;  3SOY A;  3MG3 A;  5D83 A;  3MG2 A;  3F9S A;  4LMI A;  3VSY A;  4K1V A;  1OF5 B;  1TUH A;  3NM2 A;  2QIY A;  3Q90 A;  3B8L A;  2Z77 A;  3G16 A;  4L7K A;  4STD A;  1OUN A;  3A76 A;  3HZP A;  4KVH A;  1EA2 A;  3GZX B;  4X2O A;  1C7H A;  3KE7 A;  4IIA A;  1O7H B;  2INX A;  5CF2 A;  2B24 B;  5IEN A;  5IG5 A;  1NDO B;  4R9L A;  3GWR A;  3HK4 A;  3T8U A;  5JPU A;  5STD A;  1ULJ B;  5CLK A;  3BLZ A;  4FCM A;  2CKF B;  4H3U A;  1STD A;  1W6Y A;  3CNX A;  4HM2 B;  4PEJ A;  4L8O A;  3RGR A;  3F7X A;  3IPT A;  3NV0 B;  2JQ5 A;  2GEY A;  2K54 A;  4HM4 B;  5AEW B;  3ROB A;  3OWS A;  6STD A;  5KP4 A;  3UJM A;  1OHP A;  2GBW B;  5KP3 A;  3KSP A;  5AII A;  3NUV A;  1U5O A;  2XSH B;  5CF1 A;  1JKG A;  3CPO A;  3EX9 A;  4WYK A;  5D82 A;  3JUN A;  3GRD A;  1W00 A;  5IF6 A;  4CDL A;  3OX9 A;  2HML B;  1W01 A;  3CNM A;  5JPP A;  3EN1 B;  1TP6 A;  3E99 A;  1W02 A;  3K0Z A;  1JB4 A;  3DZL A;  3EQQ B;  3OXA A;  1OHS A;  4GB5 A;  4OVM A;  5DRV A;  1NU3 A;  2RGQ A;  3ER7 A;  1HKX A;  3JUM A;  2Z76 A;  1E97 A;  3FGY A;  4HM7 B;  4MJD A;  3RGA A;  1CQS A;  2YFI B;  4R1K A;  4WP5 A;  3H3H A;  4FCJ A;  1IDP A;  2Z7A A;  4WWU C;  2YFJ B;  1JB5 A;  1ULI B;  2HMO B;  3UNL A;  3OV4 A;  1DMQ A;  1JN5 B;  3JUQ A;  1GYB A;  4HZ9 B;  1OF5 A;  3S5C A;  3WMD A;  1ZO2 A;  3F40 A;  3F8X A;  1Q42 A;  1O7N B;  3EBT A;  3GZR A;  4HM8 B;  5IEP A;  3F14 A;  3BB9 A;  1O7P B;  2I9W A;  4XBX A;  7STD A;  5KP1 A;  5AIF A;  5CXO A;  2XR8 B;  1O7W B;  2GXF A;  1OGX A;  3FF0 A;  5CK6 A;  3FLJ A;  2OWP A;  1S5A A;  2F98 A;  2HMM B;  1VZZ A; 
#chains in the Genus database with same CATH topology
 1LOX A;  1I2G A;  3HX8 A;  1L5G B;  3DXO A;  1RN7 A;  2CW9 A;  3WOE B;  4HM1 B;  3FKA A;  1C54 A;  1D6Y A;  3DGM A;  1FGT A;  1B2U A;  2RBI A;  1OGZ A;  5GSP A;  5AEU B;  1Q86 4;  6GSP A;  1MWU A;  2F86 B;  4HM5 B;  2WOF A;  3SED A;  3KZT A;  3MYT A;  4GSP A;  4LYL B;  4EBG A;  2BHM A;  4HZB B;  3D79 A;  3FG3 A;  3EHC A;  1RGK A;  4XM4 A;  2W0Q A;  3I0Y A;  1UDI I;  2D42 A;  3KN4 A;  4J5G A;  7GSP A;  2P05 A;  2QEX 3;  1GOU A;  1RCL A;  1Z1S A;  2CFL A;  4CPK A;  1ZX2 A;  4N6O B;  5EVH A;  3FF2 A;  3RNT A;  1OPY A;  1N8R 4;  1O7M B;  3X3X A;  1FUT A;  3MWZ A;  1M90 4;  1X1U A;  1NWW A;  3ECF A;  4N6T A;  3JVC A;  3NV0 A;  2CFD A;  1ASK A;  3OWU A;  3CCU 3;  1B27 A;  4XDV A;  1IVV A;  1K73 4;  1U8C B;  3QRD A;  1AVL A;  1V74 A;  3AHS A;  3PGB A;  3CMA 3;  3FG4 A;  1N5P A;  1JN5 A;  2BNG A;  2XGL A;  3DGY A;  3LTA A;  1N9E A;  4LZI A;  5BXQ A;  3BND A;  3DM8 A;  3LZA A;  4AKZ A;  2BO9 B;  1D6Z A;  2IUK A;  4RNZ A;  3Q1C A;  1VQ4 3;  1B3S A;  3VGN A;  4EW5 A;  5BVB A;  1UGH I;  1GY7 A;  2C11 A;  3BIR A;  3M8C A;  1E3R A;  2V1L A;  1DMM A;  1BSD A;  1R4C A;  4BTW A;  2D1W A;  2QGU A;  3FH1 A;  2E2T A;  2R4I A;  4OUQ A;  1RLS A;  4NHF A;  1CYU A;  2OQE C;  4FMB A;  4HYZ A;  1ZS7 A;  1VQM 3;  1W5Z A;  2IA7 A;  1HU9 A;  1UUV B;  1W6G A;  3MG3 A;  3Q2P A;  4R4K A;  1TUH A;  1UGI A;  3WA2 X;  4BIR A;  1DET A;  1UI7 A;  2C4B A;  3B8L A;  3BNE A;  3LOY A;  5I97 A;  4L7K A;  1UUG B;  3S29 A;  1YJ9 3;  4KVH A;  3GZX B;  1AQZ A;  1SPU A;  3D3L A;  1BRG A;  5CF2 A;  4O3V A;  5IEN A;  3CCE 3;  1NDO B;  3X41 A;  1VQ6 3;  1W6C A;  1G96 A;  4HM2 B;  4N6M A;  2BT3 A;  4L8O A;  3NV0 B;  4JF8 A;  2GEY A;  5KP4 A;  1YI2 3;  4QWT A;  6STD A;  3OWS A;  1IQX A;  1OHP A;  2KF5 A;  1FGR A;  1RGF A;  5CF1 A;  1JKG A;  1UI8 A;  2J8X B;  2P38 A;  3GRD A;  4O2H A;  5IF6 A;  4BTY A;  1BSC A;  1TP6 A;  3NX0 A;  1JB4 A;  3EQQ B;  3HIG A;  1SAR A;  1K8A 4;  2MF7 A;  3JUM A;  1FUW A;  2K3D A;  1KC8 4;  1E97 A;  4BL2 A;  1UCL A;  1TFO A;  2YFI B;  1GD3 A;  4R1K A;  4WP5 A;  1VQ8 3;  3H3H A;  4FCJ A;  1IDP A;  2Z7A A;  1T3B A;  3DY5 A;  2YFJ B;  4R80 A;  3VF1 A;  1BNF A;  1QVG 2;  1X1Y A;  1DMQ A;  1JZO A;  1BNG A;  2OCT A;  1I2E A;  1O7N B;  1V57 A;  3EBT A;  4EV2 A;  2KF4 A;  3GSP A;  4HM8 B;  1EUI C;  1MNL A;  5M1A A;  1O7P B;  1CH0 A;  2M7O A;  4IT7 A;  1W2Z A;  1RSN A;  3OW2 2;  1LNH A;  1BVI A;  1V58 A;  1S5A A;  1G02 A;  3OXA A;  5FW5 A;  2AAD A;  1T2I A;  1Q82 4;  2HOH A;  2IY2 A;  4FCZ A;  5AIG A;  1JBR A;  2YFL B;  1CEW I;  1RGH A;  3D5G A;  2H0H A;  3T8N A;  1EG9 B;  3G4S 3;  3D5I A;  3JUO A;  5HGR A;  1ISK A;  1E3V A;  1B20 A;  2BMR B;  1JKG B;  1QJG A;  3K7C A;  3NXJ A;  4NRE A;  2CIU A;  4K1U A;  3GZB A;  2CG1 A;  1BUQ A;  2XSO B;  1UCJ A;  2STD A;  3N8B A;  3Q3F A;  2P0X A;  5LC6 A;  3X3Y A;  1RRL A;  5IER A;  2YX9 A;  2HMK B;  1NB3 I;  3DH2 A;  2F5W A;  4NPB A;  4I5Q A;  1GY5 A;  4XBT A;  2ML5 A;  3S28 A;  1I0X A;  5A0O B;  1JB2 A;  1PY3 A;  2W2C A;  1GOY A;  2UUG C;  2OTL 3;  1UCK A;  1EQK A;  1LVN A;  1QMA A;  3A5E A;  4KFD A;  2HMN B;  1WMN A;  5G2G A;  1A67 A;  2KF3 A;  4HM6 B;  1OHO A;  3FG1 A;  3LT8 A;  3EBY A;  4N3V A;  2RCD A;  3AGO A;  2IMJ A;  4Q53 A;  1I8V A;  5AYS C;  3SYU A;  1S72 3;  3HI7 A;  3L0R A;  3CC7 3;  2KF6 A;  1YJW 3;  4XBY A;  1KWI A;  2Y73 A;  5IG4 A;  1X1W A;  2F56 A;  1BAN A;  1UCI A;  1BRN L;  1QAK A;  4KT3 B;  3FZW A;  4AEQ A;  4R9K A;  1TJD A;  5M19 A;  4HAA A;  3GAX A;  3DUK A;  1LOW A;  1T5Y A;  2W04 A;  4TX4 A;  3LT9 A;  1BRS A;  1TRQ A;  1A2V A;  1NO3 A;  2H0G A;  3KII A;  2QIY A;  2CX0 A;  3Q90 A;  4EC6 A;  3ZG5 A;  3AMO A;  3PS8 A;  2W03 A;  1OUN A;  1LOV A;  3A76 A;  2ML6 A;  2CH9 A;  1IVW A;  2XEP A;  3HZP A;  1C7H A;  1B21 A;  3KE7 A;  3QK9 A;  4IIA A;  4X2O A;  2B24 B;  2CK3 H;  5IG5 A;  1GMQ A;  4IPB A;  2SBL A;  3T8U A;  5JPU A;  5STD A;  1M1X B;  1EEJ A;  5EEO A;  4H3U A;  1RJO A;  1STD A;  1W6Y A;  2CG0 A;  1RGL A;  5ELJ A;  1BOX A;  3STD A;  3LH4 A;  4HM4 B;  3HII A;  3N9H A;  1GMP A;  1FA3 A;  1RHL A;  1RDS A;  3EE1 A;  1B2M A;  3KSP A;  4KFF A;  1W7C A;  3WOF B;  3CPO A;  1YGE A;  1Q7H A;  3LXU X;  1BSA A;  3ALA A;  3E99 A;  3DGO A;  1FYS A;  1W02 A;  3K0Z A;  4FMA A;  3DZL A;  5DRV A;  2OOV A;  4OVM A;  2W6J H;  2BIR A;  1TFK A;  4GB5 A;  2RGQ A;  4MJD A;  1HKX A;  2LYX A;  4HM7 B;  4OK0 A;  2K0M A;  2IYJ A;  3RGA A;  3N54 B;  3U97 A;  3TDG A;  1NNV A;  2GSP A;  2P0M A;  9RNT A;  1M1K 4;  1BSB A;  1JB5 A;  2CWT A;  2LQV A;  3OV4 A;  4MMY B;  1NJI 4;  5EQL A;  1GYB A;  1IT8 A;  4HZ9 B;  3F40 A;  5RNT A;  1Q42 A;  2Y74 A;  3GZR A;  1BUJ A;  3UB1 A;  3BB9 A;  1LQG C;  3NBJ A;  1KD1 4;  2SAR A;  3HOH A;  5CXO A;  1G0T A;  1QVF 2;  1O7W B;  3S67 A;  1RCK A;  4O02 B;  3FLJ A;  4MMX B;  3WR2 A;  1RRH A;  2F98 A;  2BU4 A;  4WHA A;  1VZZ A;  4J5K A;  4O8S A;  2GEX A;  4N6V 0;  1O7G B;  2ZA4 A;  2KAA A;  1IK3 A;  2XF3 A;  4I4K A;  1Q81 4;  3LTC A;  3MSO A;  4KZ1 A;  1VQ9 3;  2RFR A;  5FGO A;  1FGM A;  3G6E 3;  1AY7 A;  1OCV A;  2XH9 A;  4N6L A;  4HVN A;  3X40 A;  3MHE A;  1OH0 A;  1A2K A;  2F99 A;  4LSO A;  2RSX A;  3SLU A;  3O8Y A;  3V99 A;  4CCV A;  3CPW 2;  3JUP A;  1I2F A;  1VQL 3;  2GU1 A;  3D9R A;  2GU3 A;  5IEO A;  1B2X A;  3OWY A;  1GOV A;  5BIR A;  5M18 A;  1K9M 4;  3CD6 3;  4XDW A;  2IUJ A;  1DMN A;  1N9J A;  3PCR A;  3CC2 3;  1RNT A;  4FR9 A;  1YIJ 3;  2B1X B;  3NQZ A;  4X2H A;  5IEP A;  3EN8 A;  4J9A A;  1JBS A;  1GD4 A;  3AGN A;  2BMO B;  5AI1 A;  3CCS 3;  1B2Z A;  1TTO A;  2O3O A;  3ZFZ A;  1KQS 2;  3EJV A;  1SIH A;  1VQN 3;  1LNI A;  1SJW A;  1YVS A;  1IQ8 A;  4FMC A;  4U13 A;  3B4O A;  1PU4 A;  3MG1 A;  2KRT A;  2XGN A;  5IG0 A;  1WMO A;  1GY6 A;  3KKG A;  5D81 A;  3EF8 A;  3DMC A;  3PZW A;  1UW1 A;  3UL6 A;  2O9U X;  3SOA A;  1UUW B;  2W56 B;  4ORL A;  1STF I;  5D83 A;  1BAO A;  3MG2 A;  3F9S A;  2L1S A;  3X42 A;  1N5H A;  1OF5 B;  4BL3 A;  1YHQ 3;  1HZ1 A;  1MGW A;  2Z77 A;  2CWU A;  5LC7 A;  1US1 A;  4EXR A;  1JV2 B;  2ZDJ A;  3G71 3;  1VQP 3;  1EA2 A;  1MWS A;  3WA3 A;  4MEI A;  3HK4 A;  1I0V A;  1ULJ B;  1LOY A;  4K90 B;  3BLZ A;  4ZM8 A;  2CKF B;  4K61 A;  2FNQ A;  3CNX A;  3RGR A;  5AEW B;  3F7X A;  1ZGX A;  3CCJ 3;  2JDI H;  3KCH A;  1FGQ A;  3PCS A;  1YGW A;  3URP A;  1VQ7 3;  2P09 A;  3I56 3;  5KP3 A;  3V92 A;  5AII A;  3NUV A;  2XSH B;  1I3F A;  1KSI A;  3JUN A;  1YIT 3;  3IMA B;  1LRA A;  1MGR A;  2HML B;  3OX9 A;  2CFG A;  1A90 A;  3EN1 B;  1MWR A;  3SX1 A;  2CC3 A;  4EYC A;  4HBR A;  4GL6 A;  5G1L A;  5AYR B;  3ER7 A;  2OTJ 3;  2Z76 A;  6RNT A;  8RNT A;  1JRQ A;  3BU4 A;  1OAC A;  1BNE A;  1PFP A;  4GHO A;  1BRI A;  1GSP A;  1ULI B;  1BNJ A;  3JUQ A;  1VQK 3;  3S5C A;  1WMP A;  1OF5 A;  1JBT A;  1BSE A;  3WMD A;  3F8X A;  3RDE A;  1SII A;  5G1K A;  4RBN A;  3CME 3;  3U1W A;  1QAF A;  1W4N A;  2I9W A;  2W56 A;  4XBX A;  1IQY A;  2UGI A;  3D4A A;  7STD A;  4JRF A;  2GXF A;  1OGX A;  3FF0 A;  1BNR A;  1RN4 A;  2E2U A;  3AHW A;  1I70 A;  1RGA A;  1IV7 A;  4MMZ B;  3F7S A;  1GMR A;  3S27 A;  2KCD A;  3EC9 A;  4BTX A;  1Y4K A;  1EKM A;  1LXE A;  1WQL B;  3IJE B;  3NBR A;  3B7C A;  4RZM A;  2BMQ B;  1YNV X;  1BRJ A;  1BNS A;  1BRK A;  1RGC A;  2RNT A;  3LYG A;  3NBB A;  3FCS B;  1Q9E A;  4G1M B;  1GS3 A;  3ZG0 A;  3BNC A;  2A15 A;  4L8P A;  4ILF A;  1VQO 3;  1K28 A;  2XFT A;  2CHC A;  1IU7 A;  1FGO A;  1M9G A;  1WNH A;  3G0K A;  4XB5 A;  1K41 A;  3PYJ A;  1FW7 A;  2KXG A;  2CWV A;  1Q40 B;  1SQW A;  4HM3 B;  1N8Q A;  4WYK B;  4EV5 A;  3BNB A;  1VQ5 3;  3GZY B;  2OQE A;  1AV4 A;  3V98 A;  4RNY A;  4N6N B;  3NHX A;  2GBX B;  4J8T A;  5IG3 A;  1MOL A;  4HKV B;  2XRX B;  4LEH A;  1CYV A;  8CHO A;  1W2B 2;  2WGO A;  1AR0 A;  3WOD G;  2FXT A;  1Q40 A;  3DGL A;  1ROV A;  1FZU A;  3MPH A;  2QA4 3;  1JNQ A;  2UX0 A;  3WHO A;  3EB8 A;  5HOH A;  2Q07 A;  4LGQ A;  4RNT A;  5ELU A;  1B2S A;  1AVK A;  2HMJ B;  3B4P A;  1BRH A;  4HOH A;  4FMD A;  3K63 A;  5TGN A;  2MC8 A;  4BU4 A;  7RNT A;  1PYL A;  3DGN A;  5AIH A;  3T0U A;  2PZV A;  3G8Z A;  4HJL B;  4WFO A;  2F5M A;  1BGS A;  1R4Y A;  1RN1 A;  4N6U A;  1I3I A;  1RGE A;  1DVD A;  4CJN A;  1TIJ A;  1VQQ A;  3CU3 A;  5DRE A;  1T2H A;  3FSD A;  3F8H A;  3H51 A;  3K9M C;  3MKI A;  4HM0 B;  3SOY A;  3AMO B;  4H61 A;  4LMI A;  2R41 A;  3VSY A;  4K1V A;  1LQM B;  3CCL 3;  3LTB A;  2WGQ A;  3NM2 A;  3KSE D;  1RNB A;  1DVC A;  1IVU A;  2Z6B A;  1F8N A;  1QAL A;  1RGG A;  3G16 A;  4STD A;  1Q7Y 4;  3NQY A;  3CCR 3;  1JJ2 2;  5BU4 A;  1BNI A;  1IYY A;  1YVB I;  1O7H B;  2INX A;  2OOV C;  3LTD A;  4R9L A;  1ROA A;  3GWR A;  2H0I A;  5IW9 A;  3CCM 3;  3J7Y d;  5CLK A;  4FCM A;  2F4Y A;  4PEJ A;  3LML A;  1NB5 I;  2CFK A;  3IPT A;  2JQ5 A;  2K54 A;  3SVA A;  3ROB A;  3UJM A;  2PNC A;  2GBW B;  1U5O A;  3EX9 A;  4WYK A;  1IV9 A;  2FGT A;  2WOH A;  5D82 A;  2E2V A;  1WTH A;  1W00 A;  2CFW A;  4CDL A;  3CNM A;  1W01 A;  1YJN 3;  5JPP A;  3KFQ C;  1OHS A;  3I55 3;  1NU3 A;  1TRP A;  3FGY A;  1TU5 A;  1DE3 A;  1JZD A;  1RTU A;  1CQS A;  2ZL8 A;  2W9Q A;  4AKY A;  4WWU C;  2L4V A;  2ZHX B;  2HMO B;  1BIR A;  4KFE A;  2W9P A;  2CX1 A;  3UNL A;  3CCV 3;  3WDG B;  3CC4 3;  1JN5 B;  5JBS A;  4DKI A;  1MWT A;  1IT7 A;  1RMS A;  1ZO2 A;  2AAE A;  1RKY A;  3CXC 2;  1HYF A;  1IVX A;  3K5T A;  1J2B A;  3F14 A;  1BU4 A;  2XFS A;  3UL5 A;  1FUS A;  2WO0 A;  3X3Z A;  5KP1 A;  5AIF A;  1D6U A;  2XR8 B;  2C10 A;  1X1X A;  5CK6 A;  1DYU A;  1A2P A;  3NM7 A;  2OWP A;  3PXM A;  3SXX A;  2HMM B;  3CCQ 3; 
#chains in the Genus database with same CATH homology
 1LOX A;  3HX8 A;  1L5G B;  3DXO A;  1RN7 A;  2CW9 A;  3WOE B;  4HM1 B;  3FKA A;  1D6Y A;  3DGM A;  1FGT A;  1OGZ A;  5AEU B;  1Q86 4;  2F86 B;  4HM5 B;  2WOF A;  3SED A;  3KZT A;  3MYT A;  4EBG A;  2BHM A;  4HZB B;  3FG3 A;  4XM4 A;  3EHC A;  2W0Q A;  3I0Y A;  2D42 A;  3KN4 A;  2P05 A;  2QEX 3;  1Z1S A;  2CFL A;  1ZX2 A;  4N6O B;  5EVH A;  3FF2 A;  1OPY A;  1N8R 4;  1O7M B;  3X3X A;  3MWZ A;  1M90 4;  4N6T A;  1NWW A;  3ECF A;  3CCU 3;  3JVC A;  3NV0 A;  2CFD A;  1ASK A;  3OWU A;  4XDV A;  1IVV A;  1K73 4;  1U8C B;  3QRD A;  1AVL A;  1V74 A;  3PGB A;  3CMA 3;  3FG4 A;  1N5P A;  1JN5 A;  2BNG A;  2XGL A;  3LTA A;  1FUW A;  1N9E A;  4LZI A;  5BXQ A;  3BND A;  3DM8 A;  3LZA A;  4AKZ A;  2BO9 B;  1D6Z A;  2IUK A;  4RNZ A;  3Q1C A;  1VQ4 3;  3VGN A;  5BVB A;  2C11 A;  1GY7 A;  3M8C A;  1E3R A;  2V1L A;  1DMM A;  4BTW A;  1R4C A;  2D1W A;  2QGU A;  3FH1 A;  2E2T A;  2R4I A;  4OUQ A;  4NHF A;  1CYU A;  2OQE C;  4FMB A;  4HYZ A;  1VQM 3;  1W5Z A;  2IA7 A;  1HU9 A;  1UUV B;  1W6G A;  3MG3 A;  3Q2P A;  4R4K A;  1TUH A;  3WA2 X;  1UI7 A;  3B8L A;  3BNE A;  3LOY A;  5I97 A;  4L7K A;  3S29 A;  1YJ9 3;  4KVH A;  3GZX B;  1SPU A;  3D3L A;  5CF2 A;  4O3V A;  5IEN A;  3CCE 3;  1NDO B;  3X41 A;  1VQ6 3;  1W6C A;  1G96 A;  4HM2 B;  4N6M A;  2BT3 A;  4L8O A;  3NV0 B;  4JF8 A;  2GEY A;  5KP4 A;  1YI2 3;  4QWT A;  6STD A;  3OWS A;  1IQX A;  1OHP A;  1FGR A;  5CF1 A;  1JKG A;  1UI8 A;  2P38 A;  3GRD A;  4O2H A;  5IF6 A;  4BTY A;  1TP6 A;  3NX0 A;  1JB4 A;  3EQQ B;  3HIG A;  1K8A 4;  2MF7 A;  3JUM A;  1KC8 4;  1E97 A;  1TFO A;  2YFI B;  1GD3 A;  4R1K A;  4WP5 A;  1VQ8 3;  3H3H A;  4FCJ A;  1IDP A;  2Z7A A;  3DY5 A;  2YFJ B;  4R80 A;  3VF1 A;  1QVG 2;  1DMQ A;  2OCT A;  1O7N B;  3EBT A;  4EV2 A;  4HM8 B;  1MNL A;  1O7P B;  2M7O A;  4IT7 A;  1W2Z A;  3OW2 2;  1LNH A;  1S5A A;  3OXA A;  5FW5 A;  1Q82 4;  4FCZ A;  5AIG A;  2YFL B;  1CEW I;  3T8N A;  1EG9 B;  3G4S 3;  3JUO A;  5HGR A;  1ISK A;  1E3V A;  2BMR B;  1JKG B;  1QJG A;  3K7C A;  3NXJ A;  4NRE A;  2CIU A;  4K1U A;  3GZB A;  2CG1 A;  1BUQ A;  2XSO B;  2STD A;  3N8B A;  3X3Y A;  2P0X A;  5LC6 A;  1RRL A;  5IER A;  2YX9 A;  2HMK B;  1NB3 I;  1GY5 A;  4XBT A;  2ML5 A;  3S28 A;  5A0O B;  1JB2 A;  2W2C A;  2OTL 3;  1EQK A;  1LVN A;  1QMA A;  4KFD A;  2HMN B;  1WMN A;  5G2G A;  1A67 A;  4HM6 B;  1OHO A;  3FG1 A;  3LT8 A;  3EBY A;  4N3V A;  2RCD A;  4Q53 A;  2IMJ A;  5AYS C;  1S72 3;  3HI7 A;  3L0R A;  3CC7 3;  1YJW 3;  4XBY A;  1KWI A;  2Y73 A;  5IG4 A;  1QAK A;  3FZW A;  4AEQ A;  4R9K A;  3GAX A;  3DUK A;  1T5Y A;  2W04 A;  4TX4 A;  3LT9 A;  1A2V A;  1NO3 A;  3KII A;  2QIY A;  3Q90 A;  4EC6 A;  3AMO A;  3PS8 A;  2W03 A;  1OUN A;  3A76 A;  3HZP A;  2ML6 A;  2CH9 A;  1IVW A;  2XEP A;  3QK9 A;  1C7H A;  3KE7 A;  4IIA A;  4X2O A;  3J7Y d;  2B24 B;  2CK3 H;  5IG5 A;  4IPB A;  2SBL A;  3T8U A;  5JPU A;  5STD A;  1M1X B;  5EEO A;  4H3U A;  1RJO A;  1STD A;  1W6Y A;  2CG0 A;  5ELJ A;  3STD A;  3LH4 A;  4HM4 B;  3HII A;  3N9H A;  1FA3 A;  3EE1 A;  3KSP A;  4KFF A;  1W7C A;  3WOF B;  3CPO A;  1YGE A;  3LXU X;  3ALA A;  3E99 A;  3DGO A;  1W02 A;  4FMA A;  3K0Z A;  2OOV A;  3DZL A;  5DRV A;  1JJ2 2;  4OVM A;  2W6J H;  4GB5 A;  1TFK A;  2RGQ A;  4MJD A;  1HKX A;  2LYX A;  4HM7 B;  4OK0 A;  2K0M A;  3RGA A;  3N54 B;  3U97 A;  3TDG A;  2P0M A;  1M1K 4;  1JB5 A;  2CWT A;  2LQV A;  3OV4 A;  4MMY B;  1NJI 4;  5EQL A;  1GYB A;  1IT8 A;  4HZ9 B;  3F40 A;  1Q42 A;  2Y74 A;  3GZR A;  3UB1 A;  3BB9 A;  3NBJ A;  1KD1 4;  5CXO A;  1QVF 2;  1O7W B;  3S67 A;  4O02 B;  3FLJ A;  4MMX B;  2F98 A;  1RRH A;  4WHA A;  1VZZ A;  4O8S A;  2GEX A;  4N6V 0;  1O7G B;  1IK3 A;  2XF3 A;  4I4K A;  1Q81 4;  3LTC A;  3MSO A;  4KZ1 A;  1VQ9 3;  2RFR A;  5FGO A;  1FGM A;  3G6E 3;  2XH9 A;  1OCV A;  4N6L A;  4HVN A;  3X40 A;  3MHE A;  1OH0 A;  1A2K A;  2F99 A;  4LSO A;  2RSX A;  3SLU A;  3O8Y A;  3V99 A;  4CCV A;  3CPW 2;  3JUP A;  1VQL 3;  2GU1 A;  3D9R A;  2GU3 A;  5IEO A;  3OWY A;  1K9M 4;  3CD6 3;  4XDW A;  2IUJ A;  1DMN A;  1N9J A;  3PCR A;  3CC2 3;  4FR9 A;  1YIJ 3;  2B1X B;  3NQZ A;  4X2H A;  5IEP A;  3EN8 A;  4J9A A;  1GD4 A;  2BMO B;  5AI1 A;  3CCS 3;  1KQS 2;  2O3O A;  3EJV A;  1SIH A;  1VQN 3;  1SJW A;  4U13 A;  1IQ8 A;  4FMC A;  3B4O A;  1PU4 A;  3MG1 A;  2KRT A;  2XGN A;  5IG0 A;  1WMO A;  1GY6 A;  3KKG A;  5D81 A;  3EF8 A;  3DMC A;  3PZW A;  1UW1 A;  3UL6 A;  2O9U X;  3SOA A;  1UUW B;  2W56 B;  4ORL A;  1STF I;  5D83 A;  3MG2 A;  3X42 A;  3F9S A;  1N5H A;  1OF5 B;  1YHQ 3;  2Z77 A;  2CWU A;  5LC7 A;  1US1 A;  4EXR A;  1JV2 B;  2ZDJ A;  3G71 3;  1VQP 3;  1EA2 A;  3WA3 A;  4MEI A;  3HK4 A;  1ULJ B;  4ZM8 A;  4K90 B;  3BLZ A;  2CKF B;  4K61 A;  2FNQ A;  3CNX A;  3RGR A;  5AEW B;  3F7X A;  3CCJ 3;  2JDI H;  3PCS A;  1FGQ A;  1VQ7 3;  2P09 A;  3I56 3;  5KP3 A;  3V92 A;  5AII A;  3NUV A;  2XSH B;  1KSI A;  3JUN A;  1YIT 3;  3IMA B;  3OX9 A;  2HML B;  1A90 A;  2CFG A;  3EN1 B;  3SX1 A;  2CC3 A;  4EYC A;  4HBR A;  4GL6 A;  5AYR B;  2OTJ 3;  3ER7 A;  2Z76 A;  1JRQ A;  1OAC A;  1PFP A;  1ULI B;  3JUQ A;  1VQK 3;  3S5C A;  1WMP A;  1OF5 A;  3WMD A;  3F8X A;  3RDE A;  1SII A;  4RBN A;  3CME 3;  3U1W A;  1QAF A;  1W4N A;  2I9W A;  2W56 A;  4XBX A;  1IQY A;  7STD A;  4JRF A;  2GXF A;  1OGX A;  3FF0 A;  2E2U A;  1IV7 A;  4MMZ B;  3F7S A;  3S27 A;  2KCD A;  3EC9 A;  4BTX A;  1Y4K A;  1EKM A;  1LXE A;  1WQL B;  3IJE B;  3NBR A;  3B7C A;  4RZM A;  2BMQ B;  3LYG A;  4G1M B;  3NBB A;  3FCS B;  1GS3 A;  3BNC A;  2A15 A;  4L8P A;  1VQO 3;  1K28 A;  2XFT A;  2CHC A;  1IU7 A;  1FGO A;  1M9G A;  1WNH A;  3G0K A;  4XB5 A;  1K41 A;  3PYJ A;  2KXG A;  2CWV A;  1Q40 B;  1SQW A;  4HM3 B;  1N8Q A;  4WYK B;  4EV5 A;  3BNB A;  1VQ5 3;  3GZY B;  2OQE A;  1AV4 A;  3V98 A;  4RNY A;  4N6N B;  3NHX A;  2GBX B;  4J8T A;  5IG3 A;  1MOL A;  4HKV B;  2XRX B;  4LEH A;  1CYV A;  8CHO A;  1W2B 2;  2WGO A;  1AR0 A;  3WOD G;  2FXT A;  1Q40 A;  3DGL A;  1ROV A;  3MPH A;  2QA4 3;  1JNQ A;  2UX0 A;  3EB8 A;  2Q07 A;  4LGQ A;  5ELU A;  1AVK A;  2HMJ B;  3B4P A;  2MC8 A;  5TGN A;  4FMD A;  3K63 A;  3DGN A;  5AIH A;  3T0U A;  2PZV A;  3G8Z A;  4HJL B;  4WFO A;  1DVD A;  4N6U A;  1TIJ A;  3CU3 A;  5DRE A;  3FSD A;  3H51 A;  3F8H A;  3K9M C;  3MKI A;  4HM0 B;  3SOY A;  3AMO B;  4H61 A;  4LMI A;  3VSY A;  4K1V A;  3CCL 3;  3LTB A;  2WGQ A;  3NM2 A;  3KSE D;  1DVC A;  1IVU A;  2Z6B A;  1F8N A;  1QAL A;  3G16 A;  4STD A;  1Q7Y 4;  3NQY A;  3CCR 3;  1YVB I;  1O7H B;  2INX A;  2OOV C;  3LTD A;  4R9L A;  1ROA A;  3GWR A;  5IW9 A;  3CCM 3;  5CLK A;  4FCM A;  4PEJ A;  3LML A;  1NB5 I;  2CFK A;  3IPT A;  2JQ5 A;  2K54 A;  3SVA A;  3ROB A;  3UJM A;  2PNC A;  2GBW B;  1U5O A;  3EX9 A;  4WYK A;  1IV9 A;  2FGT A;  2WOH A;  5D82 A;  2E2V A;  1WTH A;  1W00 A;  2CFW A;  4CDL A;  3CNM A;  1W01 A;  1YJN 3;  5JPP A;  3KFQ C;  1OHS A;  3I55 3;  1NU3 A;  3FGY A;  1TU5 A;  1CQS A;  2ZL8 A;  2W9Q A;  4AKY A;  4WWU C;  2L4V A;  2HMO B;  4KFE A;  3UNL A;  2W9P A;  3CCV 3;  3WDG B;  3CC4 3;  1JN5 B;  5JBS A;  1IT7 A;  1ZO2 A;  3CXC 2;  1RKY A;  1IVX A;  3K5T A;  1J2B A;  3F14 A;  2XFS A;  3UL5 A;  2WO0 A;  3X3Z A;  5KP1 A;  5AIF A;  1D6U A;  2XR8 B;  2C10 A;  5CK6 A;  1DYU A;  3NM7 A;  2OWP A;  3PXM A;  3SXX A;  2HMM B;  3CCQ 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...