3LYGA

Crystal structure of ntf2-like protein of unknown function (yp_270605.1) from colwellia psychrerythraea 34h at 1.61 a resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
120
structure length
120
Chain Sequence
GMNLANIVQRGWEALGAGDFDTLVTDYVEKMIFIMPGQADVLKGRQAFRSALDNLGEILPPGFEITGLRQLEGENEIVSIVEWKSDKMIASQLSVLFKFEGDQIYEERWFVDTEQWKSVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NTF2-like protein of unknown function
publication title Crystal structure of NTF2-like protein of unknown function (YP_270605.1) from Colwellia psychrerythraea 34H at 1.61 A resolution
rcsb
source organism Colwellia psychrerythraea
molecule tags Structural genomics, unknown function
total genus 35
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2010-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3lygA00
2A15A 4L8PA 3FGYA 1JKGA 4WWUC 2GEYA 2B1XB 2BMQB 1OF5A 3NV0B 3GRDA 3EBTA 1IDPA 2HMNB 5HGRA 3ER7A 1UUWB 3B4PA 3DMCA 4WYKB 5IG3A 3SOAA 5IEPA 3G0KA 3HK4A 4HM3B 1K41A 2XSHB 3FKAA 4L8OA 2OWPA 5AEUB 7STDA 1OHSA 5EVHA 1ULIB 3Q90A 3EBYA 4HJLB 4HZBB 5D83A 3E99A 1ASKA 2GBWB 1OGZA 4LGQA 2HMJB 1ULJB 1JB4A 2F98A 3FF0A 1OUNA 3SOYA 3VGNA 3M8CA 3STDA 4IIAA 4R9KA 1W02A 4XDWA 3EN1B 2R4IA 5AEWB 3KE7A 1JKGB 3B7CA 5FW5A 5KP3A 4HM1B 1OF5B 3DXOA 1EA2A 3LYGA 3JUMA 1Z1SA 3S5CA 2UX0A 1GY7A 4HM5B 5D82A 3JUNA 2XRXB 3CU3A 1QMAA 1A2KA 3EJVA 1NWWA 5CK6A 1EG9B 1SJWA 4OVMA 2GXFA 3KZTA 5G2GA 3RGRA 1QJGA 2F86B 1ZO2A 4HM6B 3MG2A 3DZLA 4XB5A 5DRVA 2STDA 1Q40A 2Z7AA 4XBXA 2W2CA 1TP6A 1ZX2A 3K0ZA 4ORLA 4GB5A 5IG5A 3BB9A 3F8XA 3EHCA 1NDOB 4X2HA 1OHOA 4LEHA 5TGNA 3EQQB 3FSDA 3ROBA 1ISKA 2CKFB 3KSPA 3MG1A 2QIYA 3MG3A 2INXA 4R9LA 5JPPA 3JUPA 5D81A 4FCJA 5BXQA 2YFLB 4HM7B 4L7KA 3IPTA 3FH1A 3JUQA 4XBYA 1GYBA 1DMQA 3T8UA 1JN5A 4RZMA 1AR0A 3D9RA 3H51A 1OPYA 1U5OA 1E3VA 5AIHA 4U13A 1W00A 2BMRB 1O7MB 3K7CA 3OWSA 1O7PB 3FF2A 1OHPA 2Z76A 1O7WB 3HX8A 3F7SA 3NM2A 3MYTA 4STDA 6STDA 4MJDA 2QGUA 1E3RA 2RGQA 5CF2A 4HZ9B 3B4OA 4Q53A 4X2OA 1NU3A 1OH0A 2I9WA 3GZRA 1C7HA 2F99A 4LMIA 1JB5A 2HMKB 3EC9A 1STDA 5IG4A 4N3VA 5IEOA 4FCMA 3DUKA 4PEJA 2HMMB 4XBTA 1Q42A 4CDLA 3HZPA 3F40A 5BVBA 2XR8B 4I4KA 3CNXA 3F9SA 3ECFA 3EX9A 3OV4A 4HKVB 1JN5B 3GZYB 1DMNA 3NXJA 3F14A 1JB2A 5KP4A 3MSOA 3B8LA 3G16A 3RGAA 5STDA 2RFRA 2Z77A 1UUVB 3GZXB 3A76A 5IENA 1OCVA 3WMDA 2PZVA 3MKIA 2HMOB 1W01A 3NBRA 3EF8A 5CF1A 5AIGA 1E97A 5IERA 1OGXA 5IG0A 8CHOA 4WP5A 2B24B 4OUQA 3T8NA 3H3HA 1O7HB 1CQSA 2GBXB 3OWYA 2RCDA 2BMOB 3SEDA 5JPUA 3GWRA 4J9AA 4R1KA 5AIIA 3G8ZA 3UNLA 2YFJB 2BNGA 1TUHA 3NUVA 5CLKA 5AIFA 1VZZA 3FLJA 1Q40B 1GS3A 1O7GB 1GY6A 3F8HA 4XM4A 1GY5A 4KVHA 3I0YA 2JQ5A 3CNMA 2HMLB 1S5AA 3NV0A 4HM2B 3OX9A 3EN8A 5AI1A 4HM4B 4HM0B 1W6YA 1DMMA 4WYKA 2CHCA 2YFIB 1WQLB 2XSOB 3OXAA 1O7NB 2K54A 3F7XA 3MHEA 4H3UA 1BUQA 3GZBA 4J8TA 3BLZA 4HM8B 3UJMA 3DM8A 1HKXA 3KKGA 3FZWA 3VSYA 3LZAA 3CPOA 3OWUA 2GEXA 4K1UA 4HVNA 5IF6A 5CXOA 5DREA 2IMJA 5KP1A 3JUOA 3NHXA 4K1VA 4XDVA
chains in the Genus database with same CATH superfamily
2A15A 1Q814 3CME3 1Y4KA 3SVAA 1N8QA 4RNZA 4L8PA 2KRTA 3FGYA 1N5PA 1JKGA 4WWUC 1UI8A 1LNHA 2GEYA 2B1XB 1IQ8A 2H0HA 1ROAA 3S29A 2BMQB 6RNTA 1YVSA 3DGNA 1OF5A 2FGTA 1GMQA 1IT8A 1B2XA 3SLUA 3NV0B 3WODG 3CXC2 1N9JA 1T3BA 3GRDA 1TFKA 1X1YA 3EBTA 4MMXB 2W9PA 3VF1A 3Q1CA 1IDPA 3HI7A 4FMAA 5ELUA 1RCKA 2J8XB 3ZG5A 2HMNB 3CCE3 4FR9A 3WDGB 3OW22 5HGRA 3ER7A 4J5GA 2F56A 1UUWB 3B4PA 3DMCA 4R80A 3CC23 1CH0A 1GSPA 1I2GA 4WYKB 2ML5A 1FA3A 5IG3A 2C11A 1M1K4 3BNEA 3SOAA 4CJNA 1BRGA 5IEPA 3KFQC 1HYFA 4K61A 1Q824 3G0KA 1IU7A 1DETA 1RGEA 3HK4A 3ZFZA 2CFDA 1FUSA 4HM3B 1K41A 2XSHB 3X41A 3KCHA 1RSNA 3FKAA 4L8OA 2OWPA 4H61A 5AEUB 7STDA 1OHSA 1BSCA 4FMDA 1IV9A 5EVHA 3D5IA 3LOYA 1MGRA 1B2MA 1RRHA 1SIHA 1Q864 1I0XA 1GOUA 1ULIB 3LTDA 3KSED 4G1MB 3Q90A 3EBYA 4HJLB 1A2VA 4HZBB 4I5QA 5D83A 3E99A 5GSPA 1MOLA 2MF7A 1W6CA 1KD14 1US1A 1C54A 1BNFA 3D3LA 1ASKA 1RN7A 1LVNA 2GBWB 4N6TA 1V74A 1GOVA 1OGZA 4BL3A 3DH2A 4LGQA 2HMJB 1JBRA 1ULJB 1JB4A 2AAEA 2F98A 2IUKA 1B21A 4N6UA 4N6MA 3CCR3 3FF0A 4WFOA 3AGOA 3BNBA 2QA43 1VQN3 1OUNA 3SOYA 3VGNA 3M8CA 3V92A 1GMRA 2BO9B 4NHFA 3STDA 2KXGA 1M9GA 2C4BA 4IIAA 1BRIA 3BNCA 1RGGA 1IVXA 2XFSA 1U8CB 4R9KA 1W02A 4XDWA 1IV7A 1BSBA 1FGOA 3EN1B 2R4IA 1JRQA 4N6OB 5AEWB 1LXEA 2C10A 3KE7A 1JKGB 1V57A 1ZS7A 1IVVA 2V1LA 3B7CA 4RNYA 3CCQ3 5FW5A 1QVF2 2E2TA 2GU3A 5KP3A 4EV5A 1B27A 1V58A 4HM1B 1OF5B 3DXOA 1WMPA 2OQEC 4R4KA 1EA2A 2M7OA 3LYGA 1AY7A 5BIRA 2CWTA 2CWVA 3JUMA 4FCZA 1HZ1A 3SX1A 1Z1SA 2WGOA 3S5CA 1GOYA 1GY7A 2UX0A 2W56A 4HM5B 1TRPA 5D82A 1BSAA 1UGHI 2Q07A 2XGNA 1UW1A 1UCJA 3JUNA 3CC73 2XRXB 3WA2X 2KF4A 3X3YA 1IQYA 2WO0A 8RNTA 2H0GA 1A90A 3CU3A 2W0QA 1YHQ3 1QMAA 1TU5A 3FG4A 3N54B 4AKYA 4HOHA 2PNCA 1A2KA 1LQGC 2ML6A 3EJVA 5AYRB 1B2UA 3N9HA 4LSOA 1NWWA 2XGLA 1VQ43 4KZ1A 2HOHA 3LXUX 1NB3I 1SARA 1EG9B 5CK6A 2F4YA 1I8VA 1SJWA 4TX4A 1FGQA 1FGTA 1R4YA 4OVMA 1MNLA 4BTXA 3LTCA 2WOFA 2GXFA 3KZTA 1L5GB 1UGIA 3EB8A 5G2GA 3RGRA 1YJN3 1BNEA 1QJGA 2F86B 3V98A 1ZO2A 4HM6B 1MWTA 3MG2A 4O02B 3SYUA 3DZLA 3IMAB 1JBSA 3SXXA 5G1KA 3U97A 4J5KA 2F5MA 2XF3A 4XB5A 5DRVA 2STDA 1Q40A 3LH4A 2Z7AA 3PGBA 4XBXA 5HOHA 2W2CA 1K734 3LT8A 1LOVA 1TP6A 1ZX2A 2AADA 3K0ZA 3HOHA 4ORLA 2BIRA 4MEIA 2L1SA 4EYCA 3NBBA 1MGWA 4GB5A 3A5EA 5IG5A 3BB9A 3F8XA 1BUJA 3J7Yd 3EHCA 1UDII 1NDOB 1N9EA 3GAXA 4HYZA 2XEPA 3KN4A 1IQXA 1D6ZA 1JJ22 1UUGB 3NQYA 3DY5A 3S67A 3G6E3 2H0IA 1W5ZA 3HIIA 4ILFA 2OOVC 4X2HA 1WTHA 1B3SA 1IK3A 3T0UA 1OHOA 4LEHA 5TGNA 1RLSA 1UCLA 1I0VA 1RRLA 3EQQB 2YX9A 4O2HA 3Q2PA 3FSDA 3LMLA 1BSDA 3ROBA 1BRNL 1VQ83 1ISKA 1YIJ3 3PCRA 2GSPA 4BTYA 2CW9A 2IA7A 2Y73A 3N8BA 1B2SA 4RBNA 2CKFB 2WGQA 3LT9A 4BTWA 3CCJ3 2W56B 1OACA 2CFGA 4EW5A 4EXRA 2RNTA 1TRQA 3PZWA 4BL2A 2O9UX 2OCTA 1BOXA 1IT7A 3DGOA 1BNIA 3KSPA 3MG1A 1PU4A 4GHOA 3URPA 1ZGXA 2QIYA 2OTJ3 3MG3A 1PYLA 2INXA 3D4AA 2CH9A 1Q9EA 1WMNA 2R41A 4R9LA 2W6JH 2IY2A 1JZOA 2IUJA 5A0OB 2CG0A 2KAAA 1RNTA 5JPPA 3JUPA 1PY3A 2XH9A 5D81A 3Q3FA 3GSPA 3L0RA 4FCJA 3HIGA 3D5GA 3UB1A 1YVBI 5BXQA 2GU1A 4O3VA 1G96A 3NX0A 2P0MA 2YFLB 2P09A 5EQLA 4HM7B 3FCSB 4L7KA 3IPTA 1TJDA 3FH1A 2L4VA 3JUQA 3X42A 4XBYA 1VQ93 2LQVA 1GYBA 1DMQA 3AMOA 4IPBA 1CYVA 1LOYA 3CC43 1BAOA 3T8UA 1I2EA 1JN5A 1QVG2 2ZA4A 4RZMA 4GL6A 1AR0A 4JRFA 1FYSA 3D9RA 2JDIH 2CFWA 3UL5A 1VQK3 2CX1A 1HU9A 1VQ63 1MWRA 1YGEA 1OPYA 3H51A 3K9MC 4NPBA 1GD3A 1U5OA 1E3VA 5AIHA 4U13A 1W00A 2BMRB 1O7MB 1Q7Y4 5ELJA 1VQ53 3K7CA 5M1AA 1EUIC 3BU4A 1CEWI 3OWSA 4LZIA 3CCV3 2KF5A 5I97A 1S723 3G713 1K28A 1O7PB 3FG3A 3FF2A 1QALA 1OHPA 3ALAA 2Z76A 1NJI4 1O7WB 1RHLA 3F7SA 3HX8A 3NM2A 1YIT3 4MMYB 2FNQA 3X3ZA 2UUGC 1RNBA 1KC84 2KF6A 1BGSA 3MYTA 2SARA 4STDA 1T2HA 3X3XA 1LRAA 6STDA 4MJDA 2QGUA 1E3RA 1X1WA 1VQQA 3ZG0A 2RGQA 5CF2A 1BRJA 1JBTA 2E2VA 4HZ9B 3B4OA 4IT7A 5BU4A 1N8R4 3NQZA 4Q53A 4X2OA 2P05A 1NU3A 1OH0A 2I9WA 1M904 4EBGA 1KQS2 3GZRA 2P0XA 1C7HA 1F8NA 1KWIA 5LC7A 2F99A 4LMIA 1JB5A 1GD4A 2HMKB 1BNGA 3EC9A 1STDA 1RCLA 5IG4A 1VQM3 1FUWA 4N3VA 5RNTA 3CCM3 3CCS3 4AKZA 5IEOA 4FCMA 3DUKA 1DVDA 4PEJA 3QRDA 2HMMB 1K8A4 3O8YA 1BNJA 4XBTA 5JBSA 1NNVA 4EC6A 1Q42A 4EV2A 1W2B2 4CDLA 1G0TA 2CK3H 3HZPA 7GSPA 4CCVA 3NM7A 4FMCA 3KIIA 2CWUA 3F40A 3FG1A 1W4NA 2LYXA 3DGMA 5BVBA 2XR8B 1DVCA 1FZUA 1RGAA 5M19A 3CCU3 1DE3A 4I4KA 1W6GA 3CNXA 3F9SA 3ECFA 3EX9A 3X40A 3CCL3 3OV4A 4HKVB 2UGIA 1KSIA 2Z6BA 1JV2B 1YJW3 1JN5B 3MWZA 1IVUA 1VQL3 3GZYB 3K5TA 4WHAA 2E2UA 1BIRA 1RN1A 1DMNA 3NXJA 2D42A 1RGKA 1JB2A 3F14A 5KP4A 3MSOA 1RTUA 4O8SA 3B8LA 4OK0A 3G16A 6GSPA 1EEJA 3RGAA 4NREA 3QK9A 1BNSA 3WOFB 5LC6A 5STDA 3PXMA 3WHOA 1LOXA 2RFRA 2Z77A 1AQZA 1UUVB 2ZL8A 3GZXB 1Q7HA 3A76A 2MC8A 1UI7A 1BRKA 1G02A 2BT3A 4KFFA 1ROVA 3MPHA 5IENA 1WNHA 1OCVA 1PFPA 3WMDA 2PZVA 2ZDJA 3MKIA 4KFDA 4GSPA 3U1WA 1SIIA 2HMOB 1W01A 1RGFA 2RSXA 1AVLA 1QAFA 3NBRA 2WOHA 3EF8A 5CF1A 1WMOA 4FMBA 1BU4A 5AIGA 1E97A 1CYUA 5IERA 1OGXA 1YNVX 4HBRA 5IG0A 3G4S3 1I3IA 8CHOA 1FW7A 1RDSA 3AHSA 4WP5A 2B24B 4OUQA 3V99A 1NB5I 1FGMA 1EQKA 3T8NA 4ZM8A 4N6LA 1GMPA 1X1XA 3H3HA 4KFEA 1LNIA 4DKIA 4XDVA 1O7HB 1CQSA 2GBXB 3OWYA 1EKMA 1IVWA 2RCDA 1RN4A 2BMOB 3D79A 3S28A 3SEDA 4AEQA 3WA3A 5JPUA 3RNTA 3LTBA 1UCIA 5G1LA 1FGRA 2CFLA 2O3OA 3GWRA 4J9AA 1T2IA 2CC3A 2KF3A 4R1KA 5AIIA 3G8ZA 2CX0A 3UNLA 1A2PA 3WR2A 9RNTA 2Y74A 2XFTA 1SPUA 1TFOA 2OTL3 2YFJB 5EEOA 2BNGA 4BU4A 1TUHA 3NUVA 5CLKA 5AIFA 1J2BA 3NBJA 1VZZA 3FLJA 1Q40B 1LOWA 1FUTA 1GS3A 2P38A 2W04A 1O7GB 2OOVA 3CMA3 2BHMA 1LQMB 2CG1A 1GY6A 1RGCA 1NO3A 2D1WA 3F8HA 1VQO3 1B20A 4K1VA 4KT3B 4XM4A 3PYJA 1GY5A 1BRHA 3I0YA 1AVKA 4K90B 1D6YA 4KVHA 4RNTA 3CD63 2JQ5A 2QEX3 1QAKA 3CNMA 4CPKA 2HMLB 2K3DA 3DGLA 1S5AA 3RDEA 3S27A 3AHWA 2KCDA 3NV0A 4HM2B 3IJEB 3K63A 3OX9A 1X1UA 3AGNA 1BANA 3EN8A 5AI1A 4HM4B 2W9QA 3PS8A 4HM0B 1W6YA 1DMMA 3LTAA 4MMZB 1W2ZA 3I553 1RGHA 4WYKA 2CHCA 3UL6A 1STFI 1DYUA 2F5WA 1N5HA 4BIRA 1TTOA 2YFIB 3JVCA 1BRSA 4N6V0 1WQLB 1RKYA 2XSOB 1JZDA 1A67A 2SBLA 3OXAA 2W03A 3EE1A 1BSEA 1SQWA 1RGLA 1AV4A 2CIUA 1R4CA 3BNDA 3DGYA 4HAAA 4QWTA 1BVIA 2BU4A 1O7NB 3I563 2K54A 2ZHXB 3WOEB 3TDGA 1IYYA 1B2ZA 1VQP3 1UCKA 3F7XA 1D6UA 1YJ93 1YGWA 3MHEA 4H3UA 1BUQA 1T5YA 3GZBA 3BLZA 4J8TA 4HM8B 1MWUA 1YI23 2IYJA 7RNTA 3UJMA 1RMSA 3CPW2 3DM8A 1MWSA 5FGOA 1VQ73 1K9M4 3PCSA 1HKXA 3KKGA 3FZWA 3VSYA 1I2FA 4N6NB 5M18A 3LZAA 1M1XB 3BIRA 5AYSC 1RJOA 3CPOA 5IW9A 3AMOB 1I70A 3OWUA 2GEXA 1BNRA 4K1UA 4JF8A 4HVNA 5IF6A 5CXOA 1I3FA 2RBIA 2OQEA 5DREA 2IMJA 5KP1A 2K0MA 3JUOA 3NHXA 1W7CA 4LYLB 1JNQA 1TIJA 2FXTA 2CFKA
chains in the Genus database with same CATH topology
2A15A 1Q814 3CME3 1Y4KA 3SVAA 1N8QA 4RNZA 4L8PA 2KRTA 3FGYA 1N5PA 1JKGA 4WWUC 1UI8A 1LNHA 2GEYA 2B1XB 1IQ8A 1ROAA 3S29A 2BMQB 3DGNA 1OF5A 2FGTA 1IT8A 3SLUA 3NV0B 3WODG 3CXC2 1N9JA 3GRDA 4MMXB 1TFKA 3EBTA 2W9PA 3VF1A 3Q1CA 1IDPA 3HI7A 4FMAA 5ELUA 2HMNB 3CCE3 4FR9A 3WDGB 3OW22 5HGRA 3ER7A 1UUWB 3B4PA 3DMCA 4R80A 3CC23 4WYKB 1FA3A 2ML5A 5IG3A 2C11A 1M1K4 3BNEA 3SOAA 5IEPA 3KFQC 4K61A 1Q824 3G0KA 1IU7A 3HK4A 2CFDA 4HM3B 1K41A 2XSHB 3X41A 3FKAA 4L8OA 2OWPA 4H61A 5AEUB 7STDA 1OHSA 5EVHA 4FMDA 1IV9A 3LOYA 1RRHA 1SIHA 1Q864 1ULIB 3LTDA 3KSED 4G1MB 3Q90A 3EBYA 4HJLB 1A2VA 4HZBB 5D83A 3E99A 1MOLA 2MF7A 1W6CA 1KD14 1US1A 3D3LA 1ASKA 1RN7A 1LVNA 2GBWB 4N6TA 1V74A 1OGZA 4LGQA 2HMJB 1ULJB 1JB4A 2F98A 2IUKA 4N6UA 4N6MA 3CCR3 3FF0A 4WFOA 3BNBA 2QA43 1VQN3 1OUNA 3SOYA 3VGNA 3M8CA 3V92A 5I97A 2BO9B 4NHFA 3STDA 2KXGA 1M9GA 4IIAA 3BNCA 1IVXA 2XFSA 1U8CB 4R9KA 1W02A 4XDWA 1IV7A 1FGOA 3EN1B 2R4IA 1JRQA 4N6OB 5AEWB 1LXEA 2C10A 3KE7A 1JKGB 2V1LA 1IVVA 3B7CA 3CCQ3 4RNYA 5FW5A 1QVF2 2E2TA 2GU3A 5KP3A 4EV5A 4HM1B 1OF5B 3DXOA 1WMPA 2OQEC 4R4KA 1EA2A 2M7OA 3LYGA 2CWTA 2CWVA 3JUMA 4FCZA 3SX1A 1Z1SA 2WGOA 3S5CA 2UX0A 1GY7A 2W56A 4HM5B 5D82A 2Q07A 2XGNA 1UW1A 3JUNA 3CC73 2XRXB 3WA2X 3X3YA 1IQYA 2WO0A 1A90A 3CU3A 2W0QA 1YHQ3 1QMAA 1TU5A 3FG4A 3N54B 4AKYA 2PNCA 1A2KA 3EJVA 2ML6A 5AYRB 4LSOA 3N9HA 1VQ43 1NWWA 2XGLA 4KZ1A 3LXUX 1NB3I 5CK6A 1EG9B 1SJWA 4TX4A 1FGQA 1FGTA 4OVMA 1MNLA 4BTXA 3LTCA 2WOFA 2GXFA 3KZTA 1L5GB 3EB8A 5G2GA 3RGRA 1YJN3 1QJGA 2F86B 3V98A 1ZO2A 4HM6B 3MG2A 4O02B 3DZLA 3IMAB 3SXXA 3U97A 2XF3A 4XB5A 5DRVA 2STDA 1Q40A 3LH4A 2Z7AA 3PGBA 4XBXA 1K734 2W2CA 3LT8A 1TP6A 1ZX2A 3K0ZA 4ORLA 4MEIA 4EYCA 3NBBA 4GB5A 5IG5A 3BB9A 3F8XA 3J7Yd 3EHCA 1NDOB 1N9EA 3GAXA 4HYZA 2XEPA 3KN4A 1IQXA 1D6ZA 1JJ22 3NQYA 3DY5A 3S67A 3G6E3 1W5ZA 3HIIA 2OOVC 4X2HA 1WTHA 1IK3A 3T0UA 1OHOA 4LEHA 5TGNA 1RRLA 3EQQB 2YX9A 4O2HA 3Q2PA 3FSDA 3LMLA 1VQ83 3ROBA 1ISKA 1YIJ3 3PCRA 4BTYA 2CW9A 2IA7A 2Y73A 3N8BA 4RBNA 2CKFB 2WGQA 3LT9A 4BTWA 3CCJ3 2W56B 1OACA 2CFGA 4EXRA 3PZWA 2O9UX 2OCTA 1IT7A 3DGOA 3KSPA 3MG1A 1PU4A 2QIYA 2OTJ3 3MG3A 2INXA 2CH9A 2IUJA 1WMNA 4R9LA 2W6JH 5A0OB 2CG0A 5JPPA 3JUPA 2XH9A 5D81A 3L0RA 4FCJA 3HIGA 3UB1A 1YVBI 5BXQA 2GU1A 4O3VA 1G96A 3NX0A 2P0MA 2YFLB 2P09A 5EQLA 4HM7B 3FCSB 4L7KA 3IPTA 3FH1A 2L4VA 3JUQA 3X42A 4XBYA 1VQ93 2LQVA 1GYBA 1DMQA 3AMOA 4IPBA 1CYVA 3CC43 3T8UA 1QVG2 1JN5A 4RZMA 4GL6A 1AR0A 4JRFA 3D9RA 2JDIH 2CFWA 3UL5A 1VQK3 1HU9A 1VQ63 1YGEA 1OPYA 3H51A 3K9MC 1GD3A 1U5OA 1E3VA 5AIHA 4U13A 1W00A 2BMRB 1O7MB 1Q7Y4 5ELJA 1VQ53 3K7CA 1CEWI 3OWSA 4LZIA 3CCV3 1S723 3G713 1K28A 1O7PB 3FG3A 3FF2A 1QALA 1OHPA 3ALAA 2Z76A 1NJI4 1O7WB 3HX8A 3F7SA 3NM2A 1YIT3 4MMYB 2FNQA 3X3ZA 1KC84 3MYTA 4STDA 3X3XA 6STDA 4MJDA 2QGUA 1E3RA 2RGQA 5CF2A 2E2VA 4HZ9B 3B4OA 4IT7A 1N8R4 3NQZA 4Q53A 4X2OA 2P05A 1NU3A 1OH0A 2I9WA 1M904 4EBGA 1KQS2 3GZRA 2P0XA 1C7HA 1F8NA 1KWIA 5LC7A 2F99A 4LMIA 1JB5A 1GD4A 2HMKB 1VQM3 3EC9A 1STDA 5IG4A 1FUWA 4N3VA 3CCM3 3CCS3 4AKZA 5IEOA 4FCMA 3DUKA 1DVDA 4PEJA 3QRDA 2HMMB 1K8A4 3O8YA 4XBTA 5JBSA 4EC6A 1Q42A 4EV2A 1W2B2 4CDLA 2CK3H 3HZPA 4CCVA 3NM7A 4FMCA 3KIIA 2CWUA 3F40A 3FG1A 1W4NA 2LYXA 3DGMA 5BVBA 2XR8B 1DVCA 3CCU3 4I4KA 1W6GA 3CNXA 3F9SA 3ECFA 3EX9A 3X40A 3CCL3 3OV4A 4HKVB 2Z6BA 1KSIA 1JV2B 1YJW3 1JN5B 3MWZA 1IVUA 1VQL3 3GZYB 3K5TA 4WHAA 2E2UA 1DMNA 3NXJA 2D42A 3F14A 1JB2A 5KP4A 3MSOA 4O8SA 3B8LA 4OK0A 3G16A 3RGAA 4NREA 3QK9A 3WOFB 5LC6A 5STDA 3PXMA 1LOXA 2RFRA 2Z77A 1UUVB 2ZL8A 3GZXB 3A76A 2MC8A 1UI7A 2BT3A 4KFFA 1ROVA 3MPHA 5IENA 1WNHA 1OCVA 1PFPA 3WMDA 2PZVA 2ZDJA 3MKIA 4KFDA 3U1WA 1SIIA 2HMOB 1W01A 2RSXA 1AVLA 1QAFA 3NBRA 2WOHA 3EF8A 5CF1A 1WMOA 4FMBA 5AIGA 1E97A 1CYUA 5IERA 1OGXA 4HBRA 5IG0A 3G4S3 8CHOA 4WP5A 2B24B 4OUQA 3V99A 1NB5I 1FGMA 1EQKA 3T8NA 4ZM8A 4N6LA 3H3HA 4KFEA 4XDVA 1O7HB 1CQSA 2GBXB 3OWYA 1EKMA 1IVWA 2RCDA 2BMOB 3S28A 4AEQA 3WA3A 3SEDA 5JPUA 3LTBA 1FGRA 2CFLA 2O3OA 3GWRA 4J9AA 2CC3A 4R1KA 5AIIA 3G8ZA 3UNLA 2Y74A 2XFTA 1SPUA 1TFOA 2OTL3 2YFJB 5EEOA 2BNGA 1TUHA 3NUVA 5CLKA 5AIFA 1J2BA 3NBJA 1VZZA 3FLJA 1Q40B 1GS3A 2P38A 2W04A 1O7GB 2OOVA 3CMA3 2BHMA 2CG1A 1GY6A 1NO3A 2D1WA 3F8HA 1VQO3 4K1VA 4XM4A 3PYJA 1GY5A 4K90B 3I0YA 1AVKA 4KVHA 1D6YA 3CD63 2JQ5A 2QEX3 1QAKA 3CNMA 2HMLB 3DGLA 1S5AA 3RDEA 3S27A 3NV0A 2KCDA 4HM2B 3IJEB 3K63A 3OX9A 3EN8A 5AI1A 4HM4B 2W9QA 3PS8A 4HM0B 1W6YA 1DMMA 3LTAA 4MMZB 1W2ZA 3I553 4WYKA 2CHCA 3UL6A 1STFI 1DYUA 1N5HA 2YFIB 3JVCA 4N6V0 1WQLB 1RKYA 2XSOB 1A67A 2SBLA 3OXAA 2W03A 3EE1A 1SQWA 3BNDA 1AV4A 2CIUA 1R4CA 4QWTA 1O7NB 3I563 2K54A 3WOEB 3TDGA 1VQP3 3F7XA 1D6UA 1YJ93 3MHEA 4H3UA 1BUQA 1T5YA 3GZBA 3BLZA 4J8TA 4HM8B 1YI23 3UJMA 3CPW2 3DM8A 5FGOA 1VQ73 1K9M4 3PCSA 1HKXA 3KKGA 3FZWA 3VSYA 4N6NB 3LZAA 1M1XB 5AYSC 1RJOA 3CPOA 5IW9A 3AMOB 3OWUA 2GEXA 4K1UA 4JF8A 4HVNA 5IF6A 5CXOA 2OQEA 5DREA 2IMJA 5KP1A 2K0MA 3JUOA 3NHXA 1W7CA 1JNQA 1TIJA 2FXTA 2CFKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A15 A;  4L8P A;  3FGY A;  1JKG A;  4WWU C;  2GEY A;  2B1X B;  2BMQ B;  1OF5 A;  3NV0 B;  3GRD A;  3EBT A;  1IDP A;  2HMN B;  5HGR A;  3ER7 A;  1UUW B;  3B4P A;  3DMC A;  4WYK B;  5IG3 A;  3SOA A;  5IEP A;  3G0K A;  3HK4 A;  4HM3 B;  1K41 A;  2XSH B;  3FKA A;  4L8O A;  2OWP A;  5AEU B;  7STD A;  1OHS A;  5EVH A;  1ULI B;  3Q90 A;  3EBY A;  4HJL B;  4HZB B;  5D83 A;  3E99 A;  1ASK A;  2GBW B;  1OGZ A;  4LGQ A;  2HMJ B;  1ULJ B;  1JB4 A;  2F98 A;  3FF0 A;  1OUN A;  3SOY A;  3VGN A;  3M8C A;  3STD A;  4IIA A;  4R9K A;  1W02 A;  4XDW A;  3EN1 B;  2R4I A;  5AEW B;  3KE7 A;  1JKG B;  3B7C A;  5FW5 A;  5KP3 A;  4HM1 B;  1OF5 B;  3DXO A;  1EA2 A;  3LYG A;  3JUM A;  1Z1S A;  3S5C A;  2UX0 A;  1GY7 A;  4HM5 B;  5D82 A;  3JUN A;  2XRX B;  3CU3 A;  1QMA A;  1A2K A;  3EJV A;  1NWW A;  5CK6 A;  1EG9 B;  1SJW A;  4OVM A;  2GXF A;  3KZT A;  5G2G A;  3RGR A;  1QJG A;  2F86 B;  1ZO2 A;  4HM6 B;  3MG2 A;  3DZL A;  4XB5 A;  5DRV A;  2STD A;  1Q40 A;  2Z7A A;  4XBX A;  2W2C A;  1TP6 A;  1ZX2 A;  3K0Z A;  4ORL A;  4GB5 A;  5IG5 A;  3BB9 A;  3F8X A;  3EHC A;  1NDO B;  4X2H A;  1OHO A;  4LEH A;  5TGN A;  3EQQ B;  3FSD A;  3ROB A;  1ISK A;  2CKF B;  3KSP A;  3MG1 A;  2QIY A;  3MG3 A;  2INX A;  4R9L A;  5JPP A;  3JUP A;  5D81 A;  4FCJ A;  5BXQ A;  2YFL B;  4HM7 B;  4L7K A;  3IPT A;  3FH1 A;  3JUQ A;  4XBY A;  1GYB A;  1DMQ A;  3T8U A;  1JN5 A;  4RZM A;  1AR0 A;  3D9R A;  3H51 A;  1OPY A;  1U5O A;  1E3V A;  5AIH A;  4U13 A;  1W00 A;  2BMR B;  1O7M B;  3K7C A;  3OWS A;  1O7P B;  3FF2 A;  1OHP A;  2Z76 A;  1O7W B;  3HX8 A;  3F7S A;  3NM2 A;  3MYT A;  4STD A;  6STD A;  4MJD A;  2QGU A;  1E3R A;  2RGQ A;  5CF2 A;  4HZ9 B;  3B4O A;  4Q53 A;  4X2O A;  1NU3 A;  1OH0 A;  2I9W A;  3GZR A;  1C7H A;  2F99 A;  4LMI A;  1JB5 A;  2HMK B;  3EC9 A;  1STD A;  5IG4 A;  4N3V A;  5IEO A;  4FCM A;  3DUK A;  4PEJ A;  2HMM B;  4XBT A;  1Q42 A;  4CDL A;  3HZP A;  3F40 A;  5BVB A;  2XR8 B;  4I4K A;  3CNX A;  3F9S A;  3ECF A;  3EX9 A;  3OV4 A;  4HKV B;  1JN5 B;  3GZY B;  1DMN A;  3NXJ A;  3F14 A;  1JB2 A;  5KP4 A;  3MSO A;  3B8L A;  3G16 A;  3RGA A;  5STD A;  2RFR A;  2Z77 A;  1UUV B;  3GZX B;  3A76 A;  5IEN A;  1OCV A;  3WMD A;  2PZV A;  3MKI A;  2HMO B;  1W01 A;  3NBR A;  3EF8 A;  5CF1 A;  5AIG A;  1E97 A;  5IER A;  1OGX A;  5IG0 A;  8CHO A;  4WP5 A;  2B24 B;  4OUQ A;  3T8N A;  3H3H A;  1O7H B;  1CQS A;  2GBX B;  3OWY A;  2RCD A;  2BMO B;  3SED A;  5JPU A;  3GWR A;  4J9A A;  4R1K A;  5AII A;  3G8Z A;  3UNL A;  2YFJ B;  2BNG A;  1TUH A;  3NUV A;  5CLK A;  5AIF A;  1VZZ A;  3FLJ A;  1Q40 B;  1GS3 A;  1O7G B;  1GY6 A;  3F8H A;  4XM4 A;  1GY5 A;  4KVH A;  3I0Y A;  2JQ5 A;  3CNM A;  2HML B;  1S5A A;  3NV0 A;  4HM2 B;  3OX9 A;  3EN8 A;  5AI1 A;  4HM4 B;  4HM0 B;  1W6Y A;  1DMM A;  4WYK A;  2CHC A;  2YFI B;  1WQL B;  2XSO B;  3OXA A;  1O7N B;  2K54 A;  3F7X A;  3MHE A;  4H3U A;  1BUQ A;  3GZB A;  4J8T A;  3BLZ A;  4HM8 B;  3UJM A;  3DM8 A;  1HKX A;  3KKG A;  3FZW A;  3VSY A;  3LZA A;  3CPO A;  3OWU A;  2GEX A;  4K1U A;  4HVN A;  5IF6 A;  5CXO A;  5DRE A;  2IMJ A;  5KP1 A;  3JUO A;  3NHX A;  4K1V A;  4XDV A; 
#chains in the Genus database with same CATH topology
 2A15 A;  1Q81 4;  3CME 3;  1Y4K A;  3SVA A;  1N8Q A;  4RNZ A;  4L8P A;  2KRT A;  3FGY A;  1N5P A;  1JKG A;  4WWU C;  1UI8 A;  1LNH A;  2GEY A;  2B1X B;  1IQ8 A;  2H0H A;  1ROA A;  3S29 A;  2BMQ B;  6RNT A;  1YVS A;  3DGN A;  1OF5 A;  2FGT A;  1GMQ A;  1IT8 A;  1B2X A;  3SLU A;  3NV0 B;  3WOD G;  3CXC 2;  1N9J A;  1T3B A;  3GRD A;  1TFK A;  1X1Y A;  3EBT A;  4MMX B;  2W9P A;  3VF1 A;  3Q1C A;  1IDP A;  3HI7 A;  4FMA A;  5ELU A;  1RCK A;  2J8X B;  3ZG5 A;  2HMN B;  3CCE 3;  4FR9 A;  3WDG B;  3OW2 2;  5HGR A;  3ER7 A;  4J5G A;  2F56 A;  1UUW B;  3B4P A;  3DMC A;  4R80 A;  3CC2 3;  1CH0 A;  1GSP A;  1I2G A;  4WYK B;  2ML5 A;  1FA3 A;  5IG3 A;  2C11 A;  1M1K 4;  3BNE A;  3SOA A;  4CJN A;  1BRG A;  5IEP A;  3KFQ C;  1HYF A;  4K61 A;  1Q82 4;  3G0K A;  1IU7 A;  1DET A;  1RGE A;  3HK4 A;  3ZFZ A;  2CFD A;  1FUS A;  4HM3 B;  1K41 A;  2XSH B;  3X41 A;  3KCH A;  1RSN A;  3FKA A;  4L8O A;  2OWP A;  4H61 A;  5AEU B;  7STD A;  1OHS A;  1BSC A;  4FMD A;  1IV9 A;  5EVH A;  3D5I A;  3LOY A;  1MGR A;  1B2M A;  1RRH A;  1SIH A;  1Q86 4;  1I0X A;  1GOU A;  1ULI B;  3LTD A;  3KSE D;  4G1M B;  3Q90 A;  3EBY A;  4HJL B;  1A2V A;  4HZB B;  4I5Q A;  5D83 A;  3E99 A;  5GSP A;  1MOL A;  2MF7 A;  1W6C A;  1KD1 4;  1US1 A;  1C54 A;  1BNF A;  3D3L A;  1ASK A;  1RN7 A;  1LVN A;  2GBW B;  4N6T A;  1V74 A;  1GOV A;  1OGZ A;  4BL3 A;  3DH2 A;  4LGQ A;  2HMJ B;  1JBR A;  1ULJ B;  1JB4 A;  2AAE A;  2F98 A;  2IUK A;  1B21 A;  4N6U A;  4N6M A;  3CCR 3;  3FF0 A;  4WFO A;  3AGO A;  3BNB A;  2QA4 3;  1VQN 3;  1OUN A;  3SOY A;  3VGN A;  3M8C A;  3V92 A;  1GMR A;  2BO9 B;  4NHF A;  3STD A;  2KXG A;  1M9G A;  2C4B A;  4IIA A;  1BRI A;  3BNC A;  1RGG A;  1IVX A;  2XFS A;  1U8C B;  4R9K A;  1W02 A;  4XDW A;  1IV7 A;  1BSB A;  1FGO A;  3EN1 B;  2R4I A;  1JRQ A;  4N6O B;  5AEW B;  1LXE A;  2C10 A;  3KE7 A;  1JKG B;  1V57 A;  1ZS7 A;  1IVV A;  2V1L A;  3B7C A;  4RNY A;  3CCQ 3;  5FW5 A;  1QVF 2;  2E2T A;  2GU3 A;  5KP3 A;  4EV5 A;  1B27 A;  1V58 A;  4HM1 B;  1OF5 B;  3DXO A;  1WMP A;  2OQE C;  4R4K A;  1EA2 A;  2M7O A;  3LYG A;  1AY7 A;  5BIR A;  2CWT A;  2CWV A;  3JUM A;  4FCZ A;  1HZ1 A;  3SX1 A;  1Z1S A;  2WGO A;  3S5C A;  1GOY A;  1GY7 A;  2UX0 A;  2W56 A;  4HM5 B;  1TRP A;  5D82 A;  1BSA A;  1UGH I;  2Q07 A;  2XGN A;  1UW1 A;  1UCJ A;  3JUN A;  3CC7 3;  2XRX B;  3WA2 X;  2KF4 A;  3X3Y A;  1IQY A;  2WO0 A;  8RNT A;  2H0G A;  1A90 A;  3CU3 A;  2W0Q A;  1YHQ 3;  1QMA A;  1TU5 A;  3FG4 A;  3N54 B;  4AKY A;  4HOH A;  2PNC A;  1A2K A;  1LQG C;  2ML6 A;  3EJV A;  5AYR B;  1B2U A;  3N9H A;  4LSO A;  1NWW A;  2XGL A;  1VQ4 3;  4KZ1 A;  2HOH A;  3LXU X;  1NB3 I;  1SAR A;  1EG9 B;  5CK6 A;  2F4Y A;  1I8V A;  1SJW A;  4TX4 A;  1FGQ A;  1FGT A;  1R4Y A;  4OVM A;  1MNL A;  4BTX A;  3LTC A;  2WOF A;  2GXF A;  3KZT A;  1L5G B;  1UGI A;  3EB8 A;  5G2G A;  3RGR A;  1YJN 3;  1BNE A;  1QJG A;  2F86 B;  3V98 A;  1ZO2 A;  4HM6 B;  1MWT A;  3MG2 A;  4O02 B;  3SYU A;  3DZL A;  3IMA B;  1JBS A;  3SXX A;  5G1K A;  3U97 A;  4J5K A;  2F5M A;  2XF3 A;  4XB5 A;  5DRV A;  2STD A;  1Q40 A;  3LH4 A;  2Z7A A;  3PGB A;  4XBX A;  5HOH A;  2W2C A;  1K73 4;  3LT8 A;  1LOV A;  1TP6 A;  1ZX2 A;  2AAD A;  3K0Z A;  3HOH A;  4ORL A;  2BIR A;  4MEI A;  2L1S A;  4EYC A;  3NBB A;  1MGW A;  4GB5 A;  3A5E A;  5IG5 A;  3BB9 A;  3F8X A;  1BUJ A;  3J7Y d;  3EHC A;  1UDI I;  1NDO B;  1N9E A;  3GAX A;  4HYZ A;  2XEP A;  3KN4 A;  1IQX A;  1D6Z A;  1JJ2 2;  1UUG B;  3NQY A;  3DY5 A;  3S67 A;  3G6E 3;  2H0I A;  1W5Z A;  3HII A;  4ILF A;  2OOV C;  4X2H A;  1WTH A;  1B3S A;  1IK3 A;  3T0U A;  1OHO A;  4LEH A;  5TGN A;  1RLS A;  1UCL A;  1I0V A;  1RRL A;  3EQQ B;  2YX9 A;  4O2H A;  3Q2P A;  3FSD A;  3LML A;  1BSD A;  3ROB A;  1BRN L;  1VQ8 3;  1ISK A;  1YIJ 3;  3PCR A;  2GSP A;  4BTY A;  2CW9 A;  2IA7 A;  2Y73 A;  3N8B A;  1B2S A;  4RBN A;  2CKF B;  2WGQ A;  3LT9 A;  4BTW A;  3CCJ 3;  2W56 B;  1OAC A;  2CFG A;  4EW5 A;  4EXR A;  2RNT A;  1TRQ A;  3PZW A;  4BL2 A;  2O9U X;  2OCT A;  1BOX A;  1IT7 A;  3DGO A;  1BNI A;  3KSP A;  3MG1 A;  1PU4 A;  4GHO A;  3URP A;  1ZGX A;  2QIY A;  2OTJ 3;  3MG3 A;  1PYL A;  2INX A;  3D4A A;  2CH9 A;  1Q9E A;  1WMN A;  2R41 A;  4R9L A;  2W6J H;  2IY2 A;  1JZO A;  2IUJ A;  5A0O B;  2CG0 A;  2KAA A;  1RNT A;  5JPP A;  3JUP A;  1PY3 A;  2XH9 A;  5D81 A;  3Q3F A;  3GSP A;  3L0R A;  4FCJ A;  3HIG A;  3D5G A;  3UB1 A;  1YVB I;  5BXQ A;  2GU1 A;  4O3V A;  1G96 A;  3NX0 A;  2P0M A;  2YFL B;  2P09 A;  5EQL A;  4HM7 B;  3FCS B;  4L7K A;  3IPT A;  1TJD A;  3FH1 A;  2L4V A;  3JUQ A;  3X42 A;  4XBY A;  1VQ9 3;  2LQV A;  1GYB A;  1DMQ A;  3AMO A;  4IPB A;  1CYV A;  1LOY A;  3CC4 3;  1BAO A;  3T8U A;  1I2E A;  1JN5 A;  1QVG 2;  2ZA4 A;  4RZM A;  4GL6 A;  1AR0 A;  4JRF A;  1FYS A;  3D9R A;  2JDI H;  2CFW A;  3UL5 A;  1VQK 3;  2CX1 A;  1HU9 A;  1VQ6 3;  1MWR A;  1YGE A;  1OPY A;  3H51 A;  3K9M C;  4NPB A;  1GD3 A;  1U5O A;  1E3V A;  5AIH A;  4U13 A;  1W00 A;  2BMR B;  1O7M B;  1Q7Y 4;  5ELJ A;  1VQ5 3;  3K7C A;  5M1A A;  1EUI C;  3BU4 A;  1CEW I;  3OWS A;  4LZI A;  3CCV 3;  2KF5 A;  5I97 A;  1S72 3;  3G71 3;  1K28 A;  1O7P B;  3FG3 A;  3FF2 A;  1QAL A;  1OHP A;  3ALA A;  2Z76 A;  1NJI 4;  1O7W B;  1RHL A;  3F7S A;  3HX8 A;  3NM2 A;  1YIT 3;  4MMY B;  2FNQ A;  3X3Z A;  2UUG C;  1RNB A;  1KC8 4;  2KF6 A;  1BGS A;  3MYT A;  2SAR A;  4STD A;  1T2H A;  3X3X A;  1LRA A;  6STD A;  4MJD A;  2QGU A;  1E3R A;  1X1W A;  1VQQ A;  3ZG0 A;  2RGQ A;  5CF2 A;  1BRJ A;  1JBT A;  2E2V A;  4HZ9 B;  3B4O A;  4IT7 A;  5BU4 A;  1N8R 4;  3NQZ A;  4Q53 A;  4X2O A;  2P05 A;  1NU3 A;  1OH0 A;  2I9W A;  1M90 4;  4EBG A;  1KQS 2;  3GZR A;  2P0X A;  1C7H A;  1F8N A;  1KWI A;  5LC7 A;  2F99 A;  4LMI A;  1JB5 A;  1GD4 A;  2HMK B;  1BNG A;  3EC9 A;  1STD A;  1RCL A;  5IG4 A;  1VQM 3;  1FUW A;  4N3V A;  5RNT A;  3CCM 3;  3CCS 3;  4AKZ A;  5IEO A;  4FCM A;  3DUK A;  1DVD A;  4PEJ A;  3QRD A;  2HMM B;  1K8A 4;  3O8Y A;  1BNJ A;  4XBT A;  5JBS A;  1NNV A;  4EC6 A;  1Q42 A;  4EV2 A;  1W2B 2;  4CDL A;  1G0T A;  2CK3 H;  3HZP A;  7GSP A;  4CCV A;  3NM7 A;  4FMC A;  3KII A;  2CWU A;  3F40 A;  3FG1 A;  1W4N A;  2LYX A;  3DGM A;  5BVB A;  2XR8 B;  1DVC A;  1FZU A;  1RGA A;  5M19 A;  3CCU 3;  1DE3 A;  4I4K A;  1W6G A;  3CNX A;  3F9S A;  3ECF A;  3EX9 A;  3X40 A;  3CCL 3;  3OV4 A;  4HKV B;  2UGI A;  1KSI A;  2Z6B A;  1JV2 B;  1YJW 3;  1JN5 B;  3MWZ A;  1IVU A;  1VQL 3;  3GZY B;  3K5T A;  4WHA A;  2E2U A;  1BIR A;  1RN1 A;  1DMN A;  3NXJ A;  2D42 A;  1RGK A;  1JB2 A;  3F14 A;  5KP4 A;  3MSO A;  1RTU A;  4O8S A;  3B8L A;  4OK0 A;  3G16 A;  6GSP A;  1EEJ A;  3RGA A;  4NRE A;  3QK9 A;  1BNS A;  3WOF B;  5LC6 A;  5STD A;  3PXM A;  3WHO A;  1LOX A;  2RFR A;  2Z77 A;  1AQZ A;  1UUV B;  2ZL8 A;  3GZX B;  1Q7H A;  3A76 A;  2MC8 A;  1UI7 A;  1BRK A;  1G02 A;  2BT3 A;  4KFF A;  1ROV A;  3MPH A;  5IEN A;  1WNH A;  1OCV A;  1PFP A;  3WMD A;  2PZV A;  2ZDJ A;  3MKI A;  4KFD A;  4GSP A;  3U1W A;  1SII A;  2HMO B;  1W01 A;  1RGF A;  2RSX A;  1AVL A;  1QAF A;  3NBR A;  2WOH A;  3EF8 A;  5CF1 A;  1WMO A;  4FMB A;  1BU4 A;  5AIG A;  1E97 A;  1CYU A;  5IER A;  1OGX A;  1YNV X;  4HBR A;  5IG0 A;  3G4S 3;  1I3I A;  8CHO A;  1FW7 A;  1RDS A;  3AHS A;  4WP5 A;  2B24 B;  4OUQ A;  3V99 A;  1NB5 I;  1FGM A;  1EQK A;  3T8N A;  4ZM8 A;  4N6L A;  1GMP A;  1X1X A;  3H3H A;  4KFE A;  1LNI A;  4DKI A;  4XDV A;  1O7H B;  1CQS A;  2GBX B;  3OWY A;  1EKM A;  1IVW A;  2RCD A;  1RN4 A;  2BMO B;  3D79 A;  3S28 A;  3SED A;  4AEQ A;  3WA3 A;  5JPU A;  3RNT A;  3LTB A;  1UCI A;  5G1L A;  1FGR A;  2CFL A;  2O3O A;  3GWR A;  4J9A A;  1T2I A;  2CC3 A;  2KF3 A;  4R1K A;  5AII A;  3G8Z A;  2CX0 A;  3UNL A;  1A2P A;  3WR2 A;  9RNT A;  2Y74 A;  2XFT A;  1SPU A;  1TFO A;  2OTL 3;  2YFJ B;  5EEO A;  2BNG A;  4BU4 A;  1TUH A;  3NUV A;  5CLK A;  5AIF A;  1J2B A;  3NBJ A;  1VZZ A;  3FLJ A;  1Q40 B;  1LOW A;  1FUT A;  1GS3 A;  2P38 A;  2W04 A;  1O7G B;  2OOV A;  3CMA 3;  2BHM A;  1LQM B;  2CG1 A;  1GY6 A;  1RGC A;  1NO3 A;  2D1W A;  3F8H A;  1VQO 3;  1B20 A;  4K1V A;  4KT3 B;  4XM4 A;  3PYJ A;  1GY5 A;  1BRH A;  3I0Y A;  1AVK A;  4K90 B;  1D6Y A;  4KVH A;  4RNT A;  3CD6 3;  2JQ5 A;  2QEX 3;  1QAK A;  3CNM A;  4CPK A;  2HML B;  2K3D A;  3DGL A;  1S5A A;  3RDE A;  3S27 A;  3AHW A;  2KCD A;  3NV0 A;  4HM2 B;  3IJE B;  3K63 A;  3OX9 A;  1X1U A;  3AGN A;  1BAN A;  3EN8 A;  5AI1 A;  4HM4 B;  2W9Q A;  3PS8 A;  4HM0 B;  1W6Y A;  1DMM A;  3LTA A;  4MMZ B;  1W2Z A;  3I55 3;  1RGH A;  4WYK A;  2CHC A;  3UL6 A;  1STF I;  1DYU A;  2F5W A;  1N5H A;  4BIR A;  1TTO A;  2YFI B;  3JVC A;  1BRS A;  4N6V 0;  1WQL B;  1RKY A;  2XSO B;  1JZD A;  1A67 A;  2SBL A;  3OXA A;  2W03 A;  3EE1 A;  1BSE A;  1SQW A;  1RGL A;  1AV4 A;  2CIU A;  1R4C A;  3BND A;  3DGY A;  4HAA A;  4QWT A;  1BVI A;  2BU4 A;  1O7N B;  3I56 3;  2K54 A;  2ZHX B;  3WOE B;  3TDG A;  1IYY A;  1B2Z A;  1VQP 3;  1UCK A;  3F7X A;  1D6U A;  1YJ9 3;  1YGW A;  3MHE A;  4H3U A;  1BUQ A;  1T5Y A;  3GZB A;  3BLZ A;  4J8T A;  4HM8 B;  1MWU A;  1YI2 3;  2IYJ A;  7RNT A;  3UJM A;  1RMS A;  3CPW 2;  3DM8 A;  1MWS A;  5FGO A;  1VQ7 3;  1K9M 4;  3PCS A;  1HKX A;  3KKG A;  3FZW A;  3VSY A;  1I2F A;  4N6N B;  5M18 A;  3LZA A;  1M1X B;  3BIR A;  5AYS C;  1RJO A;  3CPO A;  5IW9 A;  3AMO B;  1I70 A;  3OWU A;  2GEX A;  1BNR A;  4K1U A;  4JF8 A;  4HVN A;  5IF6 A;  5CXO A;  1I3F A;  2RBI A;  2OQE A;  5DRE A;  2IMJ A;  5KP1 A;  2K0M A;  3JUO A;  3NHX A;  1W7C A;  4LYL B;  1JNQ A;  1TIJ A;  2FXT A;  2CFK A; 
#chains in the Genus database with same CATH homology
 2A15 A;  1Q81 4;  3CME 3;  1Y4K A;  3SVA A;  1N8Q A;  4RNZ A;  4L8P A;  2KRT A;  3FGY A;  1N5P A;  1JKG A;  4WWU C;  1UI8 A;  1LNH A;  2GEY A;  2B1X B;  1IQ8 A;  1ROA A;  3S29 A;  2BMQ B;  3DGN A;  1OF5 A;  2FGT A;  1IT8 A;  3SLU A;  3NV0 B;  3WOD G;  3CXC 2;  1N9J A;  3GRD A;  4MMX B;  1TFK A;  3EBT A;  2W9P A;  3VF1 A;  3Q1C A;  1IDP A;  3HI7 A;  4FMA A;  5ELU A;  2HMN B;  3CCE 3;  4FR9 A;  3WDG B;  3OW2 2;  5HGR A;  3ER7 A;  1UUW B;  3B4P A;  3DMC A;  4R80 A;  3CC2 3;  4WYK B;  1FA3 A;  2ML5 A;  5IG3 A;  2C11 A;  1M1K 4;  3BNE A;  3SOA A;  5IEP A;  3KFQ C;  4K61 A;  1Q82 4;  3G0K A;  1IU7 A;  3HK4 A;  2CFD A;  4HM3 B;  1K41 A;  2XSH B;  3X41 A;  3FKA A;  4L8O A;  2OWP A;  4H61 A;  5AEU B;  7STD A;  1OHS A;  5EVH A;  4FMD A;  1IV9 A;  3LOY A;  1RRH A;  1SIH A;  1Q86 4;  1ULI B;  3LTD A;  3KSE D;  4G1M B;  3Q90 A;  3EBY A;  4HJL B;  1A2V A;  4HZB B;  5D83 A;  3E99 A;  1MOL A;  2MF7 A;  1W6C A;  1KD1 4;  1US1 A;  3D3L A;  1ASK A;  1RN7 A;  1LVN A;  2GBW B;  4N6T A;  1V74 A;  1OGZ A;  4LGQ A;  2HMJ B;  1ULJ B;  1JB4 A;  2F98 A;  2IUK A;  4N6U A;  4N6M A;  3CCR 3;  3FF0 A;  4WFO A;  3BNB A;  2QA4 3;  1VQN 3;  1OUN A;  3SOY A;  3VGN A;  3M8C A;  3V92 A;  5I97 A;  2BO9 B;  4NHF A;  3STD A;  2KXG A;  1M9G A;  4IIA A;  3BNC A;  1IVX A;  2XFS A;  1U8C B;  4R9K A;  1W02 A;  4XDW A;  1IV7 A;  1FGO A;  3EN1 B;  2R4I A;  1JRQ A;  4N6O B;  5AEW B;  1LXE A;  2C10 A;  3KE7 A;  1JKG B;  2V1L A;  1IVV A;  3B7C A;  3CCQ 3;  4RNY A;  5FW5 A;  1QVF 2;  2E2T A;  2GU3 A;  5KP3 A;  4EV5 A;  4HM1 B;  1OF5 B;  3DXO A;  1WMP A;  2OQE C;  4R4K A;  1EA2 A;  2M7O A;  3LYG A;  2CWT A;  2CWV A;  3JUM A;  4FCZ A;  3SX1 A;  1Z1S A;  2WGO A;  3S5C A;  2UX0 A;  1GY7 A;  2W56 A;  4HM5 B;  5D82 A;  2Q07 A;  2XGN A;  1UW1 A;  3JUN A;  3CC7 3;  2XRX B;  3WA2 X;  3X3Y A;  1IQY A;  2WO0 A;  1A90 A;  3CU3 A;  2W0Q A;  1YHQ 3;  1QMA A;  1TU5 A;  3FG4 A;  3N54 B;  4AKY A;  2PNC A;  1A2K A;  3EJV A;  2ML6 A;  5AYR B;  4LSO A;  3N9H A;  1VQ4 3;  1NWW A;  2XGL A;  4KZ1 A;  3LXU X;  1NB3 I;  5CK6 A;  1EG9 B;  1SJW A;  4TX4 A;  1FGQ A;  1FGT A;  4OVM A;  1MNL A;  4BTX A;  3LTC A;  2WOF A;  2GXF A;  3KZT A;  1L5G B;  3EB8 A;  5G2G A;  3RGR A;  1YJN 3;  1QJG A;  2F86 B;  3V98 A;  1ZO2 A;  4HM6 B;  3MG2 A;  4O02 B;  3DZL A;  3IMA B;  3SXX A;  3U97 A;  2XF3 A;  4XB5 A;  5DRV A;  2STD A;  1Q40 A;  3LH4 A;  2Z7A A;  3PGB A;  4XBX A;  1K73 4;  2W2C A;  3LT8 A;  1TP6 A;  1ZX2 A;  3K0Z A;  4ORL A;  4MEI A;  4EYC A;  3NBB A;  4GB5 A;  5IG5 A;  3BB9 A;  3F8X A;  3J7Y d;  3EHC A;  1NDO B;  1N9E A;  3GAX A;  4HYZ A;  2XEP A;  3KN4 A;  1IQX A;  1D6Z A;  1JJ2 2;  3NQY A;  3DY5 A;  3S67 A;  3G6E 3;  1W5Z A;  3HII A;  2OOV C;  4X2H A;  1WTH A;  1IK3 A;  3T0U A;  1OHO A;  4LEH A;  5TGN A;  1RRL A;  3EQQ B;  2YX9 A;  4O2H A;  3Q2P A;  3FSD A;  3LML A;  1VQ8 3;  3ROB A;  1ISK A;  1YIJ 3;  3PCR A;  4BTY A;  2CW9 A;  2IA7 A;  2Y73 A;  3N8B A;  4RBN A;  2CKF B;  2WGQ A;  3LT9 A;  4BTW A;  3CCJ 3;  2W56 B;  1OAC A;  2CFG A;  4EXR A;  3PZW A;  2O9U X;  2OCT A;  1IT7 A;  3DGO A;  3KSP A;  3MG1 A;  1PU4 A;  2QIY A;  2OTJ 3;  3MG3 A;  2INX A;  2CH9 A;  2IUJ A;  1WMN A;  4R9L A;  2W6J H;  5A0O B;  2CG0 A;  5JPP A;  3JUP A;  2XH9 A;  5D81 A;  3L0R A;  4FCJ A;  3HIG A;  3UB1 A;  1YVB I;  5BXQ A;  2GU1 A;  4O3V A;  1G96 A;  3NX0 A;  2P0M A;  2YFL B;  2P09 A;  5EQL A;  4HM7 B;  3FCS B;  4L7K A;  3IPT A;  3FH1 A;  2L4V A;  3JUQ A;  3X42 A;  4XBY A;  1VQ9 3;  2LQV A;  1GYB A;  1DMQ A;  3AMO A;  4IPB A;  1CYV A;  3CC4 3;  3T8U A;  1QVG 2;  1JN5 A;  4RZM A;  4GL6 A;  1AR0 A;  4JRF A;  3D9R A;  2JDI H;  2CFW A;  3UL5 A;  1VQK 3;  1HU9 A;  1VQ6 3;  1YGE A;  1OPY A;  3H51 A;  3K9M C;  1GD3 A;  1U5O A;  1E3V A;  5AIH A;  4U13 A;  1W00 A;  2BMR B;  1O7M B;  1Q7Y 4;  5ELJ A;  1VQ5 3;  3K7C A;  1CEW I;  3OWS A;  4LZI A;  3CCV 3;  1S72 3;  3G71 3;  1K28 A;  1O7P B;  3FG3 A;  3FF2 A;  1QAL A;  1OHP A;  3ALA A;  2Z76 A;  1NJI 4;  1O7W B;  3HX8 A;  3F7S A;  3NM2 A;  1YIT 3;  4MMY B;  2FNQ A;  3X3Z A;  1KC8 4;  3MYT A;  4STD A;  3X3X A;  6STD A;  4MJD A;  2QGU A;  1E3R A;  2RGQ A;  5CF2 A;  2E2V A;  4HZ9 B;  3B4O A;  4IT7 A;  1N8R 4;  3NQZ A;  4Q53 A;  4X2O A;  2P05 A;  1NU3 A;  1OH0 A;  2I9W A;  1M90 4;  4EBG A;  1KQS 2;  3GZR A;  2P0X A;  1C7H A;  1F8N A;  1KWI A;  5LC7 A;  2F99 A;  4LMI A;  1JB5 A;  1GD4 A;  2HMK B;  1VQM 3;  3EC9 A;  1STD A;  5IG4 A;  1FUW A;  4N3V A;  3CCM 3;  3CCS 3;  4AKZ A;  5IEO A;  4FCM A;  3DUK A;  1DVD A;  4PEJ A;  3QRD A;  2HMM B;  1K8A 4;  3O8Y A;  4XBT A;  5JBS A;  4EC6 A;  1Q42 A;  4EV2 A;  1W2B 2;  4CDL A;  2CK3 H;  3HZP A;  4CCV A;  3NM7 A;  4FMC A;  3KII A;  2CWU A;  3F40 A;  3FG1 A;  1W4N A;  2LYX A;  3DGM A;  5BVB A;  2XR8 B;  1DVC A;  3CCU 3;  4I4K A;  1W6G A;  3CNX A;  3F9S A;  3ECF A;  3EX9 A;  3X40 A;  3CCL 3;  3OV4 A;  4HKV B;  2Z6B A;  1KSI A;  1JV2 B;  1YJW 3;  1JN5 B;  3MWZ A;  1IVU A;  1VQL 3;  3GZY B;  3K5T A;  4WHA A;  2E2U A;  1DMN A;  3NXJ A;  2D42 A;  3F14 A;  1JB2 A;  5KP4 A;  3MSO A;  4O8S A;  3B8L A;  4OK0 A;  3G16 A;  3RGA A;  4NRE A;  3QK9 A;  3WOF B;  5LC6 A;  5STD A;  3PXM A;  1LOX A;  2RFR A;  2Z77 A;  1UUV B;  2ZL8 A;  3GZX B;  3A76 A;  2MC8 A;  1UI7 A;  2BT3 A;  4KFF A;  1ROV A;  3MPH A;  5IEN A;  1WNH A;  1OCV A;  1PFP A;  3WMD A;  2PZV A;  2ZDJ A;  3MKI A;  4KFD A;  3U1W A;  1SII A;  2HMO B;  1W01 A;  2RSX A;  1AVL A;  1QAF A;  3NBR A;  2WOH A;  3EF8 A;  5CF1 A;  1WMO A;  4FMB A;  5AIG A;  1E97 A;  1CYU A;  5IER A;  1OGX A;  4HBR A;  5IG0 A;  3G4S 3;  8CHO A;  4WP5 A;  2B24 B;  4OUQ A;  3V99 A;  1NB5 I;  1FGM A;  1EQK A;  3T8N A;  4ZM8 A;  4N6L A;  3H3H A;  4KFE A;  4XDV A;  1O7H B;  1CQS A;  2GBX B;  3OWY A;  1EKM A;  1IVW A;  2RCD A;  2BMO B;  3S28 A;  4AEQ A;  3WA3 A;  3SED A;  5JPU A;  3LTB A;  1FGR A;  2CFL A;  2O3O A;  3GWR A;  4J9A A;  2CC3 A;  4R1K A;  5AII A;  3G8Z A;  3UNL A;  2Y74 A;  2XFT A;  1SPU A;  1TFO A;  2OTL 3;  2YFJ B;  5EEO A;  2BNG A;  1TUH A;  3NUV A;  5CLK A;  5AIF A;  1J2B A;  3NBJ A;  1VZZ A;  3FLJ A;  1Q40 B;  1GS3 A;  2P38 A;  2W04 A;  1O7G B;  2OOV A;  3CMA 3;  2BHM A;  2CG1 A;  1GY6 A;  1NO3 A;  2D1W A;  3F8H A;  1VQO 3;  4K1V A;  4XM4 A;  3PYJ A;  1GY5 A;  4K90 B;  3I0Y A;  1AVK A;  4KVH A;  1D6Y A;  3CD6 3;  2JQ5 A;  2QEX 3;  1QAK A;  3CNM A;  2HML B;  3DGL A;  1S5A A;  3RDE A;  3S27 A;  3NV0 A;  2KCD A;  4HM2 B;  3IJE B;  3K63 A;  3OX9 A;  3EN8 A;  5AI1 A;  4HM4 B;  2W9Q A;  3PS8 A;  4HM0 B;  1W6Y A;  1DMM A;  3LTA A;  4MMZ B;  1W2Z A;  3I55 3;  4WYK A;  2CHC A;  3UL6 A;  1STF I;  1DYU A;  1N5H A;  2YFI B;  3JVC A;  4N6V 0;  1WQL B;  1RKY A;  2XSO B;  1A67 A;  2SBL A;  3OXA A;  2W03 A;  3EE1 A;  1SQW A;  3BND A;  1AV4 A;  2CIU A;  1R4C A;  4QWT A;  1O7N B;  3I56 3;  2K54 A;  3WOE B;  3TDG A;  1VQP 3;  3F7X A;  1D6U A;  1YJ9 3;  3MHE A;  4H3U A;  1BUQ A;  1T5Y A;  3GZB A;  3BLZ A;  4J8T A;  4HM8 B;  1YI2 3;  3UJM A;  3CPW 2;  3DM8 A;  5FGO A;  1VQ7 3;  1K9M 4;  3PCS A;  1HKX A;  3KKG A;  3FZW A;  3VSY A;  4N6N B;  3LZA A;  1M1X B;  5AYS C;  1RJO A;  3CPO A;  5IW9 A;  3AMO B;  3OWU A;  2GEX A;  4K1U A;  4JF8 A;  4HVN A;  5IF6 A;  5CXO A;  2OQE A;  5DRE A;  2IMJ A;  5KP1 A;  2K0M A;  3JUO A;  3NHX A;  1W7C A;  1JNQ A;  1TIJ A;  2FXT A;  2CFK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...