3CCJ3

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2534u
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 13
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ccj300
1YIJ3 3CCQ3 2OTJ3 1YIT3 3CC73 1VQP3 1K9M4 3CCL3 1YI23 3CC23 3G6E3 1Q814 3CCU3 3OW22 1S723 1NJI4 1QVG2 1VQM3 1Q864 1M1K4 1VQ53 1VQL3 3CC43 1VQ63 3CCS3 1M904 3CCV3 1W2B2 1VQK3 1VQN3 3CCR3 1K734 1YJ93 3G4S3 3CXC2 3G713 1YJN3 1JJ22 1Q824 3CD63 2OTL3 1YHQ3 1VQO3 1YJW3 1QVF2 3CCJ3 1Q7Y4 1N8R4 2QEX3 1K8A4 1VQ43 1KQS2 1VQ93 3CCM3 3I553 3CCE3 1KD14 3CMA3 3CPW2 3I563 1VQ83 3CME3 2QA43 1KC84 1VQ73
chains in the Genus database with same CATH superfamily
4DKIA 5JPPA 1JBRA 3HI7A 1MNLA 3ER7A 4I5QA 3X3YA 3Q3FA 2OQEC 1OHPA 3JUOA 2KF5A 3Q2PA 6RNTA 1MWRA 4HM8B 2F5MA 3L0RA 2O3OA 1ASKA 2F4YA 3G4S3 1W02A 1W6GA 1OHSA 3MSOA 3V99A 3K7CA 1QAKA 5AEWB 5KP1A 1BNEA 1D6UA 5G1KA 3X3XA 2IYJA 5BVBA 3N8BA 4FMCA 3S5CA 1N8R4 1G0TA 1GMPA 1LQGC 5G1LA 3CCM3 3CMA3 3CPW2 3SYUA 2IUKA 1DE3A 4EV5A 5M18A 2HMJB 1RKYA 2CFWA 1JZOA 2OTJ3 5DREA 1JZDA 4H61A 1FGOA 3RGAA 3PXMA 1A90A 3Q1CA 3RDEA 1DETA 4LGQA 1TFOA 4QWTA 2K0MA 5GSPA 3OW22 2XGNA 4XBTA 1MWTA 1NDOB 1BSBA 3K0ZA 1RGFA 4MMZB 2I9WA 4CPKA 3CD63 4L8OA 4MMXB 1Q7HA 2P0XA 3JUNA 1NB5I 3OXAA 1BNIA 1X1XA 4BTXA 1X1WA 2CG0A 7RNTA 4KFDA 1IQYA 5STDA 1Q7Y4 2IY2A 5AIFA 2K3DA 4IT7A 5CXOA 5A0OB 2F98A 3SOYA 1D6YA 3ROBA 4EV2A 1US1A 4EYCA 2STDA 3G8ZA 2BIRA 2XH9A 1JBSA 3M8CA 1FYSA 1RLSA 3LZAA 1ULIB 2WOHA 3CU3A 3PCSA 1G02A 2HMNB 4NPBA 2H0GA 4HZBB 1VQL3 3D9RA 4JRFA 2CG1A 3URPA 4WHAA 3DY5A 3EC9A 4ZM8A 2CHCA 2OOVC 5D82A 5AYRB 1YJ93 1BAOA 1N5HA 2E2TA 3D5GA 3UL6A 1RTUA 1CEWI 3O8YA 3GZRA 1BGSA 4KFEA 1B20A 2KRTA 2IMJA 2P38A 8RNTA 1RGLA 1R4YA 4HOHA 1A2PA 3EBYA 1R4CA 1W2ZA 2GBWB 2QEX3 3HOHA 4LEHA 2RCDA 2BO9B 2MF7A 2Z6BA 3UJMA 1VQ83 4AKYA 1RN4A 2F56A 2XFSA 6STDA 3F9SA 3A5EA 1GOUA 3DZLA 1YIT3 2UGIA 3MG2A 1YVSA 1GSPA 2XRXB 4LMIA 3CCL3 2B24B 1B2SA 5HOHA 1BSAA 3DUKA 3EN1B 1NJI4 1GS3A 4TX4A 1VQ63 4GHOA 3EN8A 4BL2A 1NNVA 4KVHA 1RGHA 3SVAA 1I3FA 3CXC2 3DGYA 1IV9A 1QAFA 3D3LA 1T2HA 1UGHI 5ELUA 1OUNA 1VQO3 1UI7A 1A2KA 4O02B 1BSEA 2BMQB 3EQQB 3AGOA 1STDA 3PZWA 1BRKA 2IUJA 4K1VA 4XM4A 1OF5B 1AVLA 2GSPA 2YFLB 4FCJA 3WA3A 3OX9A 3JUPA 2P05A 5JBSA 2XSOB 3GRDA 1SQWA 3KFQC 3OV4A 1IDPA 5BIRA 4L8PA 3G16A 2ZDJA 2J8XB 4STDA 4R80A 1SJWA 3IJEB 1SIHA 2W56B 1UCIA 2ML5A 1FGRA 2BMRB 2FGTA 1IVUA 2GEYA 5FW5A 4Q53A 1GOYA 3GSPA 1T3BA 1I2GA 3UNLA 1OF5A 1GD4A 3EB8A 5LC7A 2QGUA 4JF8A 2CWTA 2F99A 1OPYA 1V74A 2XGLA 3EX9A 3KE7A 1STFI 3G0KA 9RNTA 4J5KA 1IVVA 1HKXA 2W9PA 3MHEA 3VSYA 4J5GA 3GZBA 1W00A 1OGZA 1UUWB 1U5OA 1JB4A 4BTYA 1BRNL 2CFGA 1VQ43 3NM7A 4N6NB 1B2ZA 5IG5A 2D42A 3X40A 1OCVA 2UUGC 3OWUA 5IEPA 1GY5A 3F8HA 1PY3A 2KXGA 3FG1A 4HM7B 4FR9A 1OHOA 2K54A 1IVXA 1BRJA 1RNBA 4K61A 4H3UA 3SLUA 1M1K4 1DVCA 3KIIA 3DM8A 3GAXA 4RNTA 3BU4A 3JUMA 1BSCA 3G713 1D6ZA 3NBJA 4RBNA 3RGRA 1N5PA 2W9QA 4XBXA 1YHQ3 3NUVA 4HM1B 1U8CB 2BNGA 1CH0A 1EUIC 4BL3A 1EEJA 1UW1A 2WO0A 2BMOB 3AHWA 3PGBA 1BVIA 4U13A 1ROAA 3FF2A 3HIIA 1C7HA 1LNHA 1IQ8A 3LMLA 4N6TA 1F8NA 1RGKA 2KCDA 5G2GA 1YI23 8CHOA 3G6E3 2ZA4A 4MEIA 1RHLA 3LTDA 1CYVA 4O3VA 3DGLA 5CF2A 3DGNA 3FCSB 2V1LA 1I8VA 1JN5B 4KFFA 2O9UX 1RSNA 1BRIA 2RSXA 5AIIA 3CCR3 1K734 1CQSA 1DVDA 1Q824 1GY7A 3WMDA 1LRAA 1RN7A 1BNFA 5IW9A 4O8SA 1WMOA 1W5ZA 5D81A 1Q9EA 3AHSA 4FMBA 5HGRA 3SOAA 7STDA 1I2FA 5ELJA 1I70A 4WWUC 3PCRA 4FCZA 2L1SA 2JDIH 1I2EA 3KN4A 5EEOA 3IMAB 2QA43 1JN5A 1T2IA 3BLZA 3F7SA 1LOVA 1TTOA 1UDII 3F7XA 1FGQA 1Q814 4MMYB 3STDA 5M1AA 4HKVB 3EHCA 2CC3A 2FNQA 2PZVA 4CDLA 2HMLB 6GSPA 3ZG5A 3GZYB 1RN1A 4XDWA 3CCV3 1IU7A 2Y74A 1DMQA 1N9EA 1YJN3 3BNEA 1JNQA 5CF1A 4EW5A 1ISKA 4XBYA 4EBGA 2R41A 2BT3A 1YJW3 4HM5B 1RGAA 3MG3A 4HZ9B 4X2OA 3S67A 1JRQA 1IVWA 1JB2A 1MGRA 2Z77A 1G96A 1QJGA 2LQVA 3FG4A 1BU4A 2HMMB 3UB1A 1EG9B 5AYSC 1K8A4 3NV0B 1Q40B 3A76A 5IG0A 1PU4A 1HU9A 2CWVA 2IA7A 2Z7AA 2INXA 2E2UA 3N9HA 4ILFA 1EA2A 1SIIA 3EF8A 1LVNA 3NQYA 4KT3B 3KZTA 1TUHA 4N3VA 4XB5A 3CC43 1BANA 3CCS3 3DGMA 2W6JH 1M904 1N8QA 3LYGA 2WGQA 3NV0A 1W2B2 1Q40A 1RMSA 2AADA 4HM0B 1UCJA 4HJLB 3GWRA 1O7PB 2WOFA 2H0IA 3D5IA 3MWZA 3X42A 2HMKB 1NWWA 4R9KA 1W4NA 1ROVA 1CYUA 3F8XA 1BIRA 1WTHA 3OWYA 1O7WB 3J7Yd 5EQLA 3CCE3 2SBLA 1GY6A 3FGYA 4G1MB 1NU3A 1WMPA 4WFOA 2P0MA 1IK3A 3E99A 2RFRA 3PYJA 3H3HA 1LOYA 2OWPA 1M9GA 1A2VA 1YNVX 3WHOA 4I4KA 2OCTA 5IG3A 4AKZA 2FXTA 1GMQA 4RZMA 3MG1A 3BIRA 2CWUA 1M1XB 1TU5A 1PYLA 2KF6A 1UCLA 3SX1A 1ULJB 4R9LA 1BNRA 1LXEA 1I0XA 1JV2B 3ZG0A 3FZWA 5EVHA 1BNGA 1SPUA 2YFIB 1K41A 3GZXB 4N6UA 3CCJ3 1MOLA 3NM2A 1Y4KA 4N6OB 3BNCA 2YX9A 3WODG 3I553 3TDGA 3LTBA 2OQEA 2RNTA 3LOYA 3CME3 2CKFB 3QK9A 4ORLA 2W0QA 4WP5A 2CX1A 3MKIA 2Q07A 3V98A 5BXQA 1O7NB 3CCQ3 4CCVA 3T8UA 3KKGA 1AY7A 3CC73 1EQKA 1HZ1A 1VQP3 1K9M4 4EC6A 2F5WA 2GEXA 1AR0A 3CNMA 3FLJA 4LSOA 1B2UA 5TGNA 4N6MA 1IV7A 1B2MA 3Q90A 4L7KA 4LYLB 3HIGA 1MWUA 1VZZA 3LXUX 1W6YA 3HK4A 7GSPA 4N6LA 1VQN3 4CJNA 3LH4A 1K28A 3S28A 1DMNA 2R4IA 1WMNA 1LOWA 2MC8A 3OWSA 4GL6A 4RNYA 5KP4A 5AIHA 1JBTA 2RGQA 1N9JA 2CH9A 3I0YA 1FUSA 2QIYA 1Q42A 5BU4A 1QVF2 5RNTA 1IYYA 3WR2A 1X1YA 2GBXB 1B3SA 1RJOA 1V57A 1JKGB 1RCKA 3U1WA 1S723 1VQ53 1Q864 1FA3A 1GOVA 1UUVB 2L4VA 3LT8A 5LC6A 4BIRA 1I3IA 1B2XA 3QRDA 2UX0A 2GU1A 3EE1A 4K90B 2KF3A 1E97A 2CW9A 3KSED 5CK6A 4J8TA 4X2HA 3SEDA 1TRQA 3DXOA 1OACA 1FGTA 1VQQA 3DH2A 2GXFA 1TRPA 3BNBA 1JKGA 3EJVA 3V92A 4BTWA 1KD14 1KQS2 3KCHA 1BOXA 1RCLA 1YGEA 2E2VA 1B21A 2BU4A 4LZIA 1VQ73 2AAEA 1KC84 2OOVA 5IF6A 2LYXA 2YFJB 3VGNA 1C54A 3MPHA 3CC23 4MJDA 3ALAA 2XR8B 3H51A 4WYKB 3ZFZA 3SXXA 2C4BA 4IIAA 3X41A 2C10A 2GU3A 4HM2B 1TP6A 3X3ZA 1BSDA 1IT7A 2Z76A 3AMOB 3N54B 1VQK3 1BUQA 1E3VA 4OUQA 3D79A 5IERA 4J9AA 2B1XB 3S29A 1B27A 1RGEA 2CK3H 2OTL3 4KZ1A 3CNXA 3RNTA 3ECFA 1WNHA 4HM3B 1FZUA 1WQLB 4WYKA 1AVKA 1LNIA 4OVMA 3FH1A 4R4KA 1BRGA 3AMOA 3MYTA 1FUWA 3T0UA 4HBRA 4EXRA 2KAAA 4GSPA 2HOHA 1ZO2A 1I0VA 3S27A 5I97A 1LOXA 1FUTA 3B4OA 1VQM3 2A15A 1PFPA 3NBRA 5AI1A 4AEQA 3FKAA 1RRLA 3NBBA 3T8NA 1EKMA 1DYUA 1IQXA 1T5YA 5IEOA 2W04A 3WA2X 1NB3I 4HVNA 1AV4A 4FMDA 3BB9A 3NHXA 1A67A 3BNDA 1RDSA 1VQ93 2SARA 3D4AA 2P09A 3F14A 3I563 4FMAA 4IPBA 3JVCA 3WOEB 1ZGXA 1J2BA 5DRVA 4BU4A 2CFKA 4K1UA 3CPOA 5AIGA 1KSIA 2C11A 1GYBA 2F86B 4HM6B 3NQZA 1UGIA 1ZS7A 1HYFA 1LQMB 1RNTA 4OK0A 1W6CA 5KP3A 3UL5A 2W2CA 3WOFB 5IG4A 5IENA 4HAAA 2ZHXB 2W03A 3FF0A 3HX8A 1TJDA 1BNJA 5JPUA 1RGGA 3B8LA 3IPTA 3JUQA 1DMMA 1TIJA 1UCKA 2Y73A 4RNZA 5FGOA 1O7HB 1YVBI 3LTCA 1JB5A 2CX0A 2XFTA 2CFDA 4HM4B 5M19A 1KWIA 2XSHB 1SARA 3NXJA 1TFKA 1MWSA 3F40A 3FG3A 4XDVA 1FGMA 1S5AA 2CFLA 3K63A 4NHFA 1UUGB 1O7MB 3AGNA 2PNCA 3DGOA 3HZPA 3NX0A 2JQ5A 4R1KA 1YGWA 1AQZA 4HYZA 1YIJ3 1V58A 1OH0A 5CLKA 2CIUA 4PEJA 1BRHA 1O7GB 3DMCA 4FCMA 1BRSA 2XF3A 3B4PA 3FSDA 5AEUB 2HMOB 3CCU3 1QVG2 1RGCA 1OGXA 4O2HA 2D1WA 1MGWA 1BUJA 1W7CA 3K9MC 3VF1A 1IT8A 2KF4A 3B7CA 1L5GB 1JJ22 1BNSA 1QALA 1RRHA 1Z1SA 4N6V0 3WDGB 1W01A 3EBTA 3U97A 2W56A 3K5TA 1ZX2A 1GMRA 5D83A 2ZL8A 1NO3A 3PS8A 1UI8A 3LTAA 1FW7A 2WGOA 1GD3A 4GB5A 2BHMA 1QMAA 2ML6A 3KSPA 1X1UA 2RBIA 2M7OA 1E3RA 3LT9A 4NREA 2H0HA 2XEPA
chains in the Genus database with same CATH topology
5JPPA 3HI7A 1MNLA 3ER7A 3X3YA 2OQEC 1OHPA 3JUOA 3Q2PA 4HM8B 3L0RA 2O3OA 1ASKA 3G4S3 1W02A 1W6GA 1OHSA 3MSOA 3V99A 3K7CA 1QAKA 5AEWB 5KP1A 1D6UA 3X3XA 5BVBA 3N8BA 4FMCA 3S5CA 1N8R4 3CCM3 3CMA3 3CPW2 2IUKA 4EV5A 2HMJB 1RKYA 2CFWA 2OTJ3 5DREA 4H61A 1FGOA 3RGAA 3PXMA 1A90A 3Q1CA 3RDEA 4QWTA 4LGQA 1TFOA 3OW22 2K0MA 2XGNA 4XBTA 1NDOB 3K0ZA 4MMZB 2I9WA 3CD63 4L8OA 4MMXB 2P0XA 3JUNA 1NB5I 3OXAA 4BTXA 2CG0A 4KFDA 1IQYA 5STDA 1Q7Y4 5AIFA 4IT7A 5CXOA 5A0OB 2F98A 3SOYA 1D6YA 3ROBA 4EV2A 1US1A 4EYCA 2STDA 3G8ZA 2XH9A 3M8CA 3LZAA 1ULIB 2WOHA 3CU3A 3PCSA 2HMNB 4HZBB 1VQL3 3D9RA 4JRFA 2CG1A 4WHAA 3DY5A 3EC9A 4ZM8A 2CHCA 2OOVC 5D82A 5AYRB 1YJ93 1N5HA 2E2TA 3UL6A 1CEWI 3O8YA 3GZRA 4KFEA 2KRTA 2IMJA 2P38A 3EBYA 1R4CA 1W2ZA 2GBWB 2QEX3 4LEHA 2RCDA 2BO9B 2MF7A 2Z6BA 3UJMA 1VQ83 4AKYA 2XFSA 6STDA 3F9SA 3DZLA 1YIT3 3MG2A 2XRXB 4LMIA 3CCL3 2B24B 3DUKA 3EN1B 1NJI4 1GS3A 4TX4A 1VQ63 3EN8A 4KVHA 3SVAA 3CXC2 1IV9A 1QAFA 3D3LA 5ELUA 1VQO3 1OUNA 1UI7A 1A2KA 4O02B 2BMQB 3EQQB 1STDA 3PZWA 2IUJA 4K1VA 4XM4A 1OF5B 1AVLA 2YFLB 4FCJA 3WA3A 3OX9A 3JUPA 2P05A 5JBSA 2XSOB 3GRDA 1SQWA 3KFQC 3OV4A 1IDPA 4L8PA 3G16A 2ZDJA 4STDA 4R80A 1SJWA 3IJEB 1SIHA 2W56B 2ML5A 1FGRA 2BMRB 2FGTA 1IVUA 2GEYA 5FW5A 4Q53A 3UNLA 1OF5A 1GD4A 3EB8A 5LC7A 2QGUA 4JF8A 2CWTA 2F99A 1OPYA 1V74A 2XGLA 3EX9A 3KE7A 1STFI 3G0KA 1IVVA 1HKXA 2W9PA 3MHEA 3VSYA 3GZBA 1W00A 1OGZA 1UUWB 1U5OA 1JB4A 4BTYA 1VQ43 2CFGA 3NM7A 4N6NB 5IG5A 2D42A 3X40A 1OCVA 3OWUA 5IEPA 1GY5A 3F8HA 2KXGA 3FG1A 4HM7B 4FR9A 1OHOA 2K54A 1IVXA 4K61A 4H3UA 3SLUA 1M1K4 1DVCA 3KIIA 3DM8A 3GAXA 3JUMA 3G713 1D6ZA 3NBJA 4RBNA 3RGRA 1N5PA 2W9QA 4XBXA 1YHQ3 3NUVA 4HM1B 1U8CB 2BNGA 2WO0A 1UW1A 2BMOB 3PGBA 4U13A 1ROAA 3FF2A 3HIIA 1C7HA 1LNHA 1IQ8A 3LMLA 4N6TA 1F8NA 2KCDA 5G2GA 1YI23 8CHOA 3G6E3 4MEIA 3LTDA 1CYVA 4O3VA 3DGLA 5CF2A 3DGNA 3FCSB 2V1LA 1JN5B 4KFFA 2O9UX 2RSXA 3CCR3 1K734 5AIIA 1DVDA 1CQSA 1Q824 1GY7A 3WMDA 1RN7A 5IW9A 4O8SA 1WMOA 1W5ZA 5D81A 4FMBA 5HGRA 3SOAA 7STDA 5ELJA 4WWUC 3PCRA 4FCZA 2JDIH 3KN4A 5EEOA 3IMAB 2QA43 1JN5A 3BLZA 3F7SA 3F7XA 1FGQA 1Q814 4MMYB 3STDA 4HKVB 3EHCA 2CC3A 2FNQA 2PZVA 4CDLA 2HMLB 3GZYB 4XDWA 3CCV3 1IU7A 2Y74A 1DMQA 1N9EA 1YJN3 3BNEA 1JNQA 5CF1A 1ISKA 4XBYA 4EBGA 2BT3A 1YJW3 4HM5B 3MG3A 4HZ9B 4X2OA 3S67A 1JRQA 1IVWA 1JB2A 2Z77A 1G96A 1QJGA 2LQVA 3FG4A 2HMMB 3UB1A 1K8A4 1EG9B 5AYSC 3NV0B 1Q40B 3A76A 5IG0A 1PU4A 1HU9A 2IA7A 2CWVA 2Z7AA 2INXA 2E2UA 3N9HA 1EA2A 1SIIA 3EF8A 1LVNA 3NQYA 3KZTA 1TUHA 4N3VA 4XB5A 3CC43 3CCS3 3DGMA 2W6JH 1M904 1N8QA 3LYGA 2WGQA 3NV0A 1W2B2 1Q40A 4HM0B 4HJLB 3GWRA 1O7PB 2WOFA 3X42A 3MWZA 2HMKB 1NWWA 4R9KA 1W4NA 1ROVA 1CYUA 3F8XA 1WTHA 3OWYA 1O7WB 3J7Yd 5EQLA 3CCE3 2SBLA 1GY6A 3FGYA 4G1MB 1NU3A 1WMPA 4WFOA 2P0MA 1IK3A 3E99A 2RFRA 3PYJA 3H3HA 2OWPA 1M9GA 1A2VA 4I4KA 2OCTA 5IG3A 4AKZA 2FXTA 4RZMA 3MG1A 2CWUA 1M1XB 1TU5A 3SX1A 1ULJB 4R9LA 1LXEA 1JV2B 3FZWA 5EVHA 1SPUA 2YFIB 1K41A 3GZXB 4N6UA 3CCJ3 1MOLA 3NM2A 1Y4KA 4N6OB 3BNCA 2YX9A 3WODG 3I553 3TDGA 3LTBA 2OQEA 3CME3 3LOYA 2CKFB 3QK9A 4ORLA 2W0QA 4WP5A 3MKIA 3V98A 2Q07A 5BXQA 3CCQ3 1O7NB 4CCVA 3T8UA 3KKGA 3CC73 1EQKA 1VQP3 1K9M4 4EC6A 2GEXA 1AR0A 3CNMA 3FLJA 4LSOA 5TGNA 4N6MA 1IV7A 3Q90A 4L7KA 3HIGA 1VZZA 3LXUX 1VQN3 1W6YA 3HK4A 4N6LA 3LH4A 1K28A 3S28A 1DMNA 2R4IA 1WMNA 2MC8A 3OWSA 4GL6A 4RNYA 5KP4A 5AIHA 2RGQA 1N9JA 2CH9A 3I0YA 1QVF2 2QIYA 1Q42A 2GBXB 1RJOA 1JKGB 1S723 3U1WA 1FA3A 1VQ53 1Q864 1UUVB 2L4VA 3LT8A 5LC6A 3QRDA 2UX0A 2GU1A 3EE1A 4K90B 1E97A 2CW9A 3KSED 5CK6A 4J8TA 4X2HA 3SEDA 3DXOA 1OACA 1FGTA 3EJVA 2GXFA 3BNBA 1JKGA 3V92A 1KQS2 4BTWA 1KD14 1YGEA 2E2VA 4LZIA 1KC84 1VQ73 2OOVA 5IF6A 2LYXA 2YFJB 3VGNA 3MPHA 3CC23 4MJDA 3ALAA 2XR8B 3H51A 4WYKB 3SXXA 4IIAA 3X41A 2C10A 2GU3A 4HM2B 1TP6A 3X3ZA 3AMOB 1IT7A 2Z76A 3N54B 1VQK3 1BUQA 1E3VA 4OUQA 5IERA 4J9AA 2B1XB 3S29A 2CK3H 2OTL3 4KZ1A 3CNXA 3ECFA 1WNHA 4HM3B 1WQLB 4WYKA 1AVKA 4R4KA 4OVMA 3FH1A 3AMOA 3MYTA 1FUWA 3T0UA 4HBRA 4EXRA 1ZO2A 3S27A 5I97A 1LOXA 3B4OA 1VQM3 2A15A 1PFPA 3NBRA 5AI1A 4AEQA 3FKAA 1RRLA 3NBBA 3T8NA 1EKMA 1DYUA 1IQXA 1T5YA 5IEOA 2W04A 3WA2X 1NB3I 4HVNA 1AV4A 4FMDA 3BB9A 3NHXA 1A67A 3BNDA 1VQ93 2P09A 3F14A 3I563 4FMAA 4IPBA 3JVCA 3WOEB 1J2BA 5DRVA 2CFKA 4K1UA 3CPOA 5AIGA 1KSIA 2C11A 1GYBA 2F86B 4HM6B 3NQZA 4OK0A 1W6CA 5KP3A 3UL5A 2W2CA 3WOFB 5IG4A 5IENA 3HX8A 2W03A 3FF0A 5JPUA 3B8LA 3IPTA 3JUQA 4RNZA 1DMMA 1TIJA 2Y73A 5FGOA 1O7HB 1YVBI 3LTCA 1JB5A 2XFTA 2CFDA 4HM4B 1KWIA 2XSHB 3NXJA 1TFKA 3F40A 3FG3A 4XDVA 1FGMA 1S5AA 2CFLA 3K63A 4NHFA 1O7MB 2PNCA 3DGOA 3HZPA 3NX0A 2JQ5A 4R1KA 1YIJ3 4HYZA 1OH0A 5CLKA 2CIUA 4PEJA 1O7GB 3DMCA 4FCMA 2XF3A 3B4PA 3FSDA 5AEUB 2HMOB 3CCU3 1QVG2 1OGXA 4O2HA 2D1WA 1W7CA 3K9MC 3VF1A 1IT8A 3B7CA 1L5GB 1JJ22 1QALA 1RRHA 1Z1SA 4N6V0 3WDGB 1W01A 3EBTA 3U97A 2W56A 3K5TA 1ZX2A 5D83A 2ZL8A 1NO3A 3PS8A 1UI8A 3LTAA 2WGOA 1GD3A 4GB5A 2BHMA 1QMAA 2ML6A 3KSPA 2M7OA 1E3RA 3LT9A 4NREA 2XEPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIJ 3;  3CCQ 3;  2OTJ 3;  1YIT 3;  3CC7 3;  1VQP 3;  1K9M 4;  3CCL 3;  1YI2 3;  3CC2 3;  3G6E 3;  1Q81 4;  3CCU 3;  3OW2 2;  1S72 3;  1NJI 4;  1QVG 2;  1VQM 3;  1Q86 4;  1M1K 4;  1VQ5 3;  1VQL 3;  3CC4 3;  1VQ6 3;  3CCS 3;  1M90 4;  3CCV 3;  1W2B 2;  1VQK 3;  1VQN 3;  3CCR 3;  1K73 4;  1YJ9 3;  3G4S 3;  3CXC 2;  3G71 3;  1YJN 3;  1JJ2 2;  1Q82 4;  3CD6 3;  2OTL 3;  1YHQ 3;  1VQO 3;  1YJW 3;  1QVF 2;  3CCJ 3;  1Q7Y 4;  1N8R 4;  2QEX 3;  1K8A 4;  1VQ4 3;  1KQS 2;  1VQ9 3;  3CCM 3;  3I55 3;  3CCE 3;  1KD1 4;  3CMA 3;  3CPW 2;  3I56 3;  1VQ8 3;  3CME 3;  2QA4 3;  1KC8 4;  1VQ7 3; 
#chains in the Genus database with same CATH topology
 4DKI A;  5JPP A;  1JBR A;  3HI7 A;  1MNL A;  3ER7 A;  4I5Q A;  3X3Y A;  3Q3F A;  2OQE C;  1OHP A;  3JUO A;  2KF5 A;  3Q2P A;  6RNT A;  1MWR A;  4HM8 B;  2F5M A;  3L0R A;  2O3O A;  1ASK A;  2F4Y A;  3G4S 3;  1W02 A;  1W6G A;  1OHS A;  3MSO A;  3V99 A;  3K7C A;  1QAK A;  5AEW B;  5KP1 A;  1BNE A;  1D6U A;  5G1K A;  3X3X A;  2IYJ A;  5BVB A;  3N8B A;  4FMC A;  3S5C A;  1N8R 4;  1G0T A;  1GMP A;  1LQG C;  5G1L A;  3CCM 3;  3CMA 3;  3CPW 2;  3SYU A;  2IUK A;  1DE3 A;  4EV5 A;  5M18 A;  2HMJ B;  1RKY A;  2CFW A;  1JZO A;  2OTJ 3;  5DRE A;  1JZD A;  4H61 A;  1FGO A;  3RGA A;  3PXM A;  1A90 A;  3Q1C A;  3RDE A;  1DET A;  4LGQ A;  1TFO A;  4QWT A;  2K0M A;  5GSP A;  3OW2 2;  2XGN A;  4XBT A;  1MWT A;  1NDO B;  1BSB A;  3K0Z A;  1RGF A;  4MMZ B;  2I9W A;  4CPK A;  3CD6 3;  4L8O A;  4MMX B;  1Q7H A;  2P0X A;  3JUN A;  1NB5 I;  3OXA A;  1BNI A;  1X1X A;  4BTX A;  1X1W A;  2CG0 A;  7RNT A;  4KFD A;  1IQY A;  5STD A;  1Q7Y 4;  2IY2 A;  5AIF A;  2K3D A;  4IT7 A;  5CXO A;  5A0O B;  2F98 A;  3SOY A;  1D6Y A;  3ROB A;  4EV2 A;  1US1 A;  4EYC A;  2STD A;  3G8Z A;  2BIR A;  2XH9 A;  1JBS A;  3M8C A;  1FYS A;  1RLS A;  3LZA A;  1ULI B;  2WOH A;  3CU3 A;  3PCS A;  1G02 A;  2HMN B;  4NPB A;  2H0G A;  4HZB B;  1VQL 3;  3D9R A;  4JRF A;  2CG1 A;  3URP A;  4WHA A;  3DY5 A;  3EC9 A;  4ZM8 A;  2CHC A;  2OOV C;  5D82 A;  5AYR B;  1YJ9 3;  1BAO A;  1N5H A;  2E2T A;  3D5G A;  3UL6 A;  1RTU A;  1CEW I;  3O8Y A;  3GZR A;  1BGS A;  4KFE A;  1B20 A;  2KRT A;  2IMJ A;  2P38 A;  8RNT A;  1RGL A;  1R4Y A;  4HOH A;  1A2P A;  3EBY A;  1R4C A;  1W2Z A;  2GBW B;  2QEX 3;  3HOH A;  4LEH A;  2RCD A;  2BO9 B;  2MF7 A;  2Z6B A;  3UJM A;  1VQ8 3;  4AKY A;  1RN4 A;  2F56 A;  2XFS A;  6STD A;  3F9S A;  3A5E A;  1GOU A;  3DZL A;  1YIT 3;  2UGI A;  3MG2 A;  1YVS A;  1GSP A;  2XRX B;  4LMI A;  3CCL 3;  2B24 B;  1B2S A;  5HOH A;  1BSA A;  3DUK A;  3EN1 B;  1NJI 4;  1GS3 A;  4TX4 A;  1VQ6 3;  4GHO A;  3EN8 A;  4BL2 A;  1NNV A;  4KVH A;  1RGH A;  3SVA A;  1I3F A;  3CXC 2;  3DGY A;  1IV9 A;  1QAF A;  3D3L A;  1T2H A;  1UGH I;  5ELU A;  1OUN A;  1VQO 3;  1UI7 A;  1A2K A;  4O02 B;  1BSE A;  2BMQ B;  3EQQ B;  3AGO A;  1STD A;  3PZW A;  1BRK A;  2IUJ A;  4K1V A;  4XM4 A;  1OF5 B;  1AVL A;  2GSP A;  2YFL B;  4FCJ A;  3WA3 A;  3OX9 A;  3JUP A;  2P05 A;  5JBS A;  2XSO B;  3GRD A;  1SQW A;  3KFQ C;  3OV4 A;  1IDP A;  5BIR A;  4L8P A;  3G16 A;  2ZDJ A;  2J8X B;  4STD A;  4R80 A;  1SJW A;  3IJE B;  1SIH A;  2W56 B;  1UCI A;  2ML5 A;  1FGR A;  2BMR B;  2FGT A;  1IVU A;  2GEY A;  5FW5 A;  4Q53 A;  1GOY A;  3GSP A;  1T3B A;  1I2G A;  3UNL A;  1OF5 A;  1GD4 A;  3EB8 A;  5LC7 A;  2QGU A;  4JF8 A;  2CWT A;  2F99 A;  1OPY A;  1V74 A;  2XGL A;  3EX9 A;  3KE7 A;  1STF I;  3G0K A;  9RNT A;  4J5K A;  1IVV A;  1HKX A;  2W9P A;  3MHE A;  3VSY A;  4J5G A;  3GZB A;  1W00 A;  1OGZ A;  1UUW B;  1U5O A;  1JB4 A;  4BTY A;  1BRN L;  2CFG A;  1VQ4 3;  3NM7 A;  4N6N B;  1B2Z A;  5IG5 A;  2D42 A;  3X40 A;  1OCV A;  2UUG C;  3OWU A;  5IEP A;  1GY5 A;  3F8H A;  1PY3 A;  2KXG A;  3FG1 A;  4HM7 B;  4FR9 A;  1OHO A;  2K54 A;  1IVX A;  1BRJ A;  1RNB A;  4K61 A;  4H3U A;  3SLU A;  1M1K 4;  1DVC A;  3KII A;  3DM8 A;  3GAX A;  4RNT A;  3BU4 A;  3JUM A;  1BSC A;  3G71 3;  1D6Z A;  3NBJ A;  4RBN A;  3RGR A;  1N5P A;  2W9Q A;  4XBX A;  1YHQ 3;  3NUV A;  4HM1 B;  1U8C B;  2BNG A;  1CH0 A;  1EUI C;  4BL3 A;  1EEJ A;  1UW1 A;  2WO0 A;  2BMO B;  3AHW A;  3PGB A;  1BVI A;  4U13 A;  1ROA A;  3FF2 A;  3HII A;  1C7H A;  1LNH A;  1IQ8 A;  3LML A;  4N6T A;  1F8N A;  1RGK A;  2KCD A;  5G2G A;  1YI2 3;  8CHO A;  3G6E 3;  2ZA4 A;  4MEI A;  1RHL A;  3LTD A;  1CYV A;  4O3V A;  3DGL A;  5CF2 A;  3DGN A;  3FCS B;  2V1L A;  1I8V A;  1JN5 B;  4KFF A;  2O9U X;  1RSN A;  1BRI A;  2RSX A;  5AII A;  3CCR 3;  1K73 4;  1CQS A;  1DVD A;  1Q82 4;  1GY7 A;  3WMD A;  1LRA A;  1RN7 A;  1BNF A;  5IW9 A;  4O8S A;  1WMO A;  1W5Z A;  5D81 A;  1Q9E A;  3AHS A;  4FMB A;  5HGR A;  3SOA A;  7STD A;  1I2F A;  5ELJ A;  1I70 A;  4WWU C;  3PCR A;  4FCZ A;  2L1S A;  2JDI H;  1I2E A;  3KN4 A;  5EEO A;  3IMA B;  2QA4 3;  1JN5 A;  1T2I A;  3BLZ A;  3F7S A;  1LOV A;  1TTO A;  1UDI I;  3F7X A;  1FGQ A;  1Q81 4;  4MMY B;  3STD A;  5M1A A;  4HKV B;  3EHC A;  2CC3 A;  2FNQ A;  2PZV A;  4CDL A;  2HML B;  6GSP A;  3ZG5 A;  3GZY B;  1RN1 A;  4XDW A;  3CCV 3;  1IU7 A;  2Y74 A;  1DMQ A;  1N9E A;  1YJN 3;  3BNE A;  1JNQ A;  5CF1 A;  4EW5 A;  1ISK A;  4XBY A;  4EBG A;  2R41 A;  2BT3 A;  1YJW 3;  4HM5 B;  1RGA A;  3MG3 A;  4HZ9 B;  4X2O A;  3S67 A;  1JRQ A;  1IVW A;  1JB2 A;  1MGR A;  2Z77 A;  1G96 A;  1QJG A;  2LQV A;  3FG4 A;  1BU4 A;  2HMM B;  3UB1 A;  1EG9 B;  5AYS C;  1K8A 4;  3NV0 B;  1Q40 B;  3A76 A;  5IG0 A;  1PU4 A;  1HU9 A;  2CWV A;  2IA7 A;  2Z7A A;  2INX A;  2E2U A;  3N9H A;  4ILF A;  1EA2 A;  1SII A;  3EF8 A;  1LVN A;  3NQY A;  4KT3 B;  3KZT A;  1TUH A;  4N3V A;  4XB5 A;  3CC4 3;  1BAN A;  3CCS 3;  3DGM A;  2W6J H;  1M90 4;  1N8Q A;  3LYG A;  2WGQ A;  3NV0 A;  1W2B 2;  1Q40 A;  1RMS A;  2AAD A;  4HM0 B;  1UCJ A;  4HJL B;  3GWR A;  1O7P B;  2WOF A;  2H0I A;  3D5I A;  3MWZ A;  3X42 A;  2HMK B;  1NWW A;  4R9K A;  1W4N A;  1ROV A;  1CYU A;  3F8X A;  1BIR A;  1WTH A;  3OWY A;  1O7W B;  3J7Y d;  5EQL A;  3CCE 3;  2SBL A;  1GY6 A;  3FGY A;  4G1M B;  1NU3 A;  1WMP A;  4WFO A;  2P0M A;  1IK3 A;  3E99 A;  2RFR A;  3PYJ A;  3H3H A;  1LOY A;  2OWP A;  1M9G A;  1A2V A;  1YNV X;  3WHO A;  4I4K A;  2OCT A;  5IG3 A;  4AKZ A;  2FXT A;  1GMQ A;  4RZM A;  3MG1 A;  3BIR A;  2CWU A;  1M1X B;  1TU5 A;  1PYL A;  2KF6 A;  1UCL A;  3SX1 A;  1ULJ B;  4R9L A;  1BNR A;  1LXE A;  1I0X A;  1JV2 B;  3ZG0 A;  3FZW A;  5EVH A;  1BNG A;  1SPU A;  2YFI B;  1K41 A;  3GZX B;  4N6U A;  3CCJ 3;  1MOL A;  3NM2 A;  1Y4K A;  4N6O B;  3BNC A;  2YX9 A;  3WOD G;  3I55 3;  3TDG A;  3LTB A;  2OQE A;  2RNT A;  3LOY A;  3CME 3;  2CKF B;  3QK9 A;  4ORL A;  2W0Q A;  4WP5 A;  2CX1 A;  3MKI A;  2Q07 A;  3V98 A;  5BXQ A;  1O7N B;  3CCQ 3;  4CCV A;  3T8U A;  3KKG A;  1AY7 A;  3CC7 3;  1EQK A;  1HZ1 A;  1VQP 3;  1K9M 4;  4EC6 A;  2F5W A;  2GEX A;  1AR0 A;  3CNM A;  3FLJ A;  4LSO A;  1B2U A;  5TGN A;  4N6M A;  1IV7 A;  1B2M A;  3Q90 A;  4L7K A;  4LYL B;  3HIG A;  1MWU A;  1VZZ A;  3LXU X;  1W6Y A;  3HK4 A;  7GSP A;  4N6L A;  1VQN 3;  4CJN A;  3LH4 A;  1K28 A;  3S28 A;  1DMN A;  2R4I A;  1WMN A;  1LOW A;  2MC8 A;  3OWS A;  4GL6 A;  4RNY A;  5KP4 A;  5AIH A;  1JBT A;  2RGQ A;  1N9J A;  2CH9 A;  3I0Y A;  1FUS A;  2QIY A;  1Q42 A;  5BU4 A;  1QVF 2;  5RNT A;  1IYY A;  3WR2 A;  1X1Y A;  2GBX B;  1B3S A;  1RJO A;  1V57 A;  1JKG B;  1RCK A;  3U1W A;  1S72 3;  1VQ5 3;  1Q86 4;  1FA3 A;  1GOV A;  1UUV B;  2L4V A;  3LT8 A;  5LC6 A;  4BIR A;  1I3I A;  1B2X A;  3QRD A;  2UX0 A;  2GU1 A;  3EE1 A;  4K90 B;  2KF3 A;  1E97 A;  2CW9 A;  3KSE D;  5CK6 A;  4J8T A;  4X2H A;  3SED A;  1TRQ A;  3DXO A;  1OAC A;  1FGT A;  1VQQ A;  3DH2 A;  2GXF A;  1TRP A;  3BNB A;  1JKG A;  3EJV A;  3V92 A;  4BTW A;  1KD1 4;  1KQS 2;  3KCH A;  1BOX A;  1RCL A;  1YGE A;  2E2V A;  1B21 A;  2BU4 A;  4LZI A;  1VQ7 3;  2AAE A;  1KC8 4;  2OOV A;  5IF6 A;  2LYX A;  2YFJ B;  3VGN A;  1C54 A;  3MPH A;  3CC2 3;  4MJD A;  3ALA A;  2XR8 B;  3H51 A;  4WYK B;  3ZFZ A;  3SXX A;  2C4B A;  4IIA A;  3X41 A;  2C10 A;  2GU3 A;  4HM2 B;  1TP6 A;  3X3Z A;  1BSD A;  1IT7 A;  2Z76 A;  3AMO B;  3N54 B;  1VQK 3;  1BUQ A;  1E3V A;  4OUQ A;  3D79 A;  5IER A;  4J9A A;  2B1X B;  3S29 A;  1B27 A;  1RGE A;  2CK3 H;  2OTL 3;  4KZ1 A;  3CNX A;  3RNT A;  3ECF A;  1WNH A;  4HM3 B;  1FZU A;  1WQL B;  4WYK A;  1AVK A;  1LNI A;  4OVM A;  3FH1 A;  4R4K A;  1BRG A;  3AMO A;  3MYT A;  1FUW A;  3T0U A;  4HBR A;  4EXR A;  2KAA A;  4GSP A;  2HOH A;  1ZO2 A;  1I0V A;  3S27 A;  5I97 A;  1LOX A;  1FUT A;  3B4O A;  1VQM 3;  2A15 A;  1PFP A;  3NBR A;  5AI1 A;  4AEQ A;  3FKA A;  1RRL A;  3NBB A;  3T8N A;  1EKM A;  1DYU A;  1IQX A;  1T5Y A;  5IEO A;  2W04 A;  3WA2 X;  1NB3 I;  4HVN A;  1AV4 A;  4FMD A;  3BB9 A;  3NHX A;  1A67 A;  3BND A;  1RDS A;  1VQ9 3;  2SAR A;  3D4A A;  2P09 A;  3F14 A;  3I56 3;  4FMA A;  4IPB A;  3JVC A;  3WOE B;  1ZGX A;  1J2B A;  5DRV A;  4BU4 A;  2CFK A;  4K1U A;  3CPO A;  5AIG A;  1KSI A;  2C11 A;  1GYB A;  2F86 B;  4HM6 B;  3NQZ A;  1UGI A;  1ZS7 A;  1HYF A;  1LQM B;  1RNT A;  4OK0 A;  1W6C A;  5KP3 A;  3UL5 A;  2W2C A;  3WOF B;  5IG4 A;  5IEN A;  4HAA A;  2ZHX B;  2W03 A;  3FF0 A;  3HX8 A;  1TJD A;  1BNJ A;  5JPU A;  1RGG A;  3B8L A;  3IPT A;  3JUQ A;  1DMM A;  1TIJ A;  1UCK A;  2Y73 A;  4RNZ A;  5FGO A;  1O7H B;  1YVB I;  3LTC A;  1JB5 A;  2CX0 A;  2XFT A;  2CFD A;  4HM4 B;  5M19 A;  1KWI A;  2XSH B;  1SAR A;  3NXJ A;  1TFK A;  1MWS A;  3F40 A;  3FG3 A;  4XDV A;  1FGM A;  1S5A A;  2CFL A;  3K63 A;  4NHF A;  1UUG B;  1O7M B;  3AGN A;  2PNC A;  3DGO A;  3HZP A;  3NX0 A;  2JQ5 A;  4R1K A;  1YGW A;  1AQZ A;  4HYZ A;  1YIJ 3;  1V58 A;  1OH0 A;  5CLK A;  2CIU A;  4PEJ A;  1BRH A;  1O7G B;  3DMC A;  4FCM A;  1BRS A;  2XF3 A;  3B4P A;  3FSD A;  5AEU B;  2HMO B;  3CCU 3;  1QVG 2;  1RGC A;  1OGX A;  4O2H A;  2D1W A;  1MGW A;  1BUJ A;  1W7C A;  3K9M C;  3VF1 A;  1IT8 A;  2KF4 A;  3B7C A;  1L5G B;  1JJ2 2;  1BNS A;  1QAL A;  1RRH A;  1Z1S A;  4N6V 0;  3WDG B;  1W01 A;  3EBT A;  3U97 A;  2W56 A;  3K5T A;  1ZX2 A;  1GMR A;  5D83 A;  2ZL8 A;  1NO3 A;  3PS8 A;  1UI8 A;  3LTA A;  1FW7 A;  2WGO A;  1GD3 A;  4GB5 A;  2BHM A;  1QMA A;  2ML6 A;  3KSP A;  1X1U A;  2RBI A;  2M7O A;  1E3R A;  3LT9 A;  4NRE A;  2H0H A;  2XEP A; 
#chains in the Genus database with same CATH homology
 5JPP A;  3HI7 A;  1MNL A;  3ER7 A;  3X3Y A;  2OQE C;  1OHP A;  3JUO A;  3Q2P A;  4HM8 B;  3L0R A;  2O3O A;  1ASK A;  3G4S 3;  1W02 A;  1W6G A;  1OHS A;  3MSO A;  3V99 A;  3K7C A;  1QAK A;  5AEW B;  5KP1 A;  1D6U A;  3X3X A;  5BVB A;  3N8B A;  4FMC A;  3S5C A;  1N8R 4;  3CCM 3;  3CMA 3;  3CPW 2;  2IUK A;  4EV5 A;  2HMJ B;  1RKY A;  2CFW A;  2OTJ 3;  5DRE A;  4H61 A;  1FGO A;  3RGA A;  3PXM A;  1A90 A;  3Q1C A;  3RDE A;  4QWT A;  4LGQ A;  1TFO A;  3OW2 2;  2K0M A;  2XGN A;  4XBT A;  1NDO B;  3K0Z A;  4MMZ B;  2I9W A;  3CD6 3;  4L8O A;  4MMX B;  2P0X A;  3JUN A;  1NB5 I;  3OXA A;  4BTX A;  2CG0 A;  4KFD A;  1IQY A;  5STD A;  1Q7Y 4;  5AIF A;  4IT7 A;  5CXO A;  5A0O B;  2F98 A;  3SOY A;  1D6Y A;  3ROB A;  4EV2 A;  1US1 A;  4EYC A;  2STD A;  3G8Z A;  2XH9 A;  3M8C A;  3LZA A;  1ULI B;  2WOH A;  3CU3 A;  3PCS A;  2HMN B;  4HZB B;  1VQL 3;  3D9R A;  4JRF A;  2CG1 A;  4WHA A;  3DY5 A;  3EC9 A;  4ZM8 A;  2CHC A;  2OOV C;  5D82 A;  5AYR B;  1YJ9 3;  1N5H A;  2E2T A;  3UL6 A;  1CEW I;  3O8Y A;  3GZR A;  4KFE A;  2KRT A;  2IMJ A;  2P38 A;  3EBY A;  1R4C A;  1W2Z A;  2GBW B;  2QEX 3;  4LEH A;  2RCD A;  2BO9 B;  2MF7 A;  2Z6B A;  3UJM A;  1VQ8 3;  4AKY A;  2XFS A;  6STD A;  3F9S A;  3DZL A;  1YIT 3;  3MG2 A;  2XRX B;  4LMI A;  3CCL 3;  2B24 B;  3DUK A;  3EN1 B;  1NJI 4;  1GS3 A;  4TX4 A;  1VQ6 3;  3EN8 A;  4KVH A;  3SVA A;  3CXC 2;  1IV9 A;  1QAF A;  3D3L A;  5ELU A;  1VQO 3;  1OUN A;  1UI7 A;  1A2K A;  4O02 B;  2BMQ B;  3EQQ B;  1STD A;  3PZW A;  2IUJ A;  4K1V A;  4XM4 A;  1OF5 B;  1AVL A;  2YFL B;  4FCJ A;  3WA3 A;  3OX9 A;  3JUP A;  2P05 A;  5JBS A;  2XSO B;  3GRD A;  1SQW A;  3KFQ C;  3OV4 A;  1IDP A;  4L8P A;  3G16 A;  2ZDJ A;  4STD A;  4R80 A;  1SJW A;  3IJE B;  1SIH A;  2W56 B;  2ML5 A;  1FGR A;  2BMR B;  2FGT A;  1IVU A;  2GEY A;  5FW5 A;  4Q53 A;  3UNL A;  1OF5 A;  1GD4 A;  3EB8 A;  5LC7 A;  2QGU A;  4JF8 A;  2CWT A;  2F99 A;  1OPY A;  1V74 A;  2XGL A;  3EX9 A;  3KE7 A;  1STF I;  3G0K A;  1IVV A;  1HKX A;  2W9P A;  3MHE A;  3VSY A;  3GZB A;  1W00 A;  1OGZ A;  1UUW B;  1U5O A;  1JB4 A;  4BTY A;  1VQ4 3;  2CFG A;  3NM7 A;  4N6N B;  5IG5 A;  2D42 A;  3X40 A;  1OCV A;  3OWU A;  5IEP A;  1GY5 A;  3F8H A;  2KXG A;  3FG1 A;  4HM7 B;  4FR9 A;  1OHO A;  2K54 A;  1IVX A;  4K61 A;  4H3U A;  3SLU A;  1M1K 4;  1DVC A;  3KII A;  3DM8 A;  3GAX A;  3JUM A;  3G71 3;  1D6Z A;  3NBJ A;  4RBN A;  3RGR A;  1N5P A;  2W9Q A;  4XBX A;  1YHQ 3;  3NUV A;  4HM1 B;  1U8C B;  2BNG A;  2WO0 A;  1UW1 A;  2BMO B;  3PGB A;  4U13 A;  1ROA A;  3FF2 A;  3HII A;  1C7H A;  1LNH A;  1IQ8 A;  3LML A;  4N6T A;  1F8N A;  2KCD A;  5G2G A;  1YI2 3;  8CHO A;  3G6E 3;  4MEI A;  3LTD A;  1CYV A;  4O3V A;  3DGL A;  5CF2 A;  3DGN A;  3FCS B;  2V1L A;  1JN5 B;  4KFF A;  2O9U X;  2RSX A;  3CCR 3;  1K73 4;  5AII A;  1DVD A;  1CQS A;  1Q82 4;  1GY7 A;  3WMD A;  1RN7 A;  5IW9 A;  4O8S A;  1WMO A;  1W5Z A;  5D81 A;  4FMB A;  5HGR A;  3SOA A;  7STD A;  5ELJ A;  4WWU C;  3PCR A;  4FCZ A;  2JDI H;  3KN4 A;  5EEO A;  3IMA B;  2QA4 3;  1JN5 A;  3BLZ A;  3F7S A;  3F7X A;  1FGQ A;  1Q81 4;  4MMY B;  3STD A;  4HKV B;  3EHC A;  2CC3 A;  2FNQ A;  2PZV A;  4CDL A;  2HML B;  3GZY B;  4XDW A;  3CCV 3;  1IU7 A;  2Y74 A;  1DMQ A;  1N9E A;  1YJN 3;  3BNE A;  1JNQ A;  5CF1 A;  1ISK A;  4XBY A;  4EBG A;  2BT3 A;  1YJW 3;  4HM5 B;  3MG3 A;  4HZ9 B;  4X2O A;  3S67 A;  1JRQ A;  1IVW A;  1JB2 A;  2Z77 A;  1G96 A;  1QJG A;  2LQV A;  3FG4 A;  2HMM B;  3UB1 A;  1K8A 4;  1EG9 B;  5AYS C;  3NV0 B;  1Q40 B;  3A76 A;  5IG0 A;  1PU4 A;  1HU9 A;  2IA7 A;  2CWV A;  2Z7A A;  2INX A;  2E2U A;  3N9H A;  1EA2 A;  1SII A;  3EF8 A;  1LVN A;  3NQY A;  3KZT A;  1TUH A;  4N3V A;  4XB5 A;  3CC4 3;  3CCS 3;  3DGM A;  2W6J H;  1M90 4;  1N8Q A;  3LYG A;  2WGQ A;  3NV0 A;  1W2B 2;  1Q40 A;  4HM0 B;  4HJL B;  3GWR A;  1O7P B;  2WOF A;  3X42 A;  3MWZ A;  2HMK B;  1NWW A;  4R9K A;  1W4N A;  1ROV A;  1CYU A;  3F8X A;  1WTH A;  3OWY A;  1O7W B;  3J7Y d;  5EQL A;  3CCE 3;  2SBL A;  1GY6 A;  3FGY A;  4G1M B;  1NU3 A;  1WMP A;  4WFO A;  2P0M A;  1IK3 A;  3E99 A;  2RFR A;  3PYJ A;  3H3H A;  2OWP A;  1M9G A;  1A2V A;  4I4K A;  2OCT A;  5IG3 A;  4AKZ A;  2FXT A;  4RZM A;  3MG1 A;  2CWU A;  1M1X B;  1TU5 A;  3SX1 A;  1ULJ B;  4R9L A;  1LXE A;  1JV2 B;  3FZW A;  5EVH A;  1SPU A;  2YFI B;  1K41 A;  3GZX B;  4N6U A;  3CCJ 3;  1MOL A;  3NM2 A;  1Y4K A;  4N6O B;  3BNC A;  2YX9 A;  3WOD G;  3I55 3;  3TDG A;  3LTB A;  2OQE A;  3CME 3;  3LOY A;  2CKF B;  3QK9 A;  4ORL A;  2W0Q A;  4WP5 A;  3MKI A;  3V98 A;  2Q07 A;  5BXQ A;  3CCQ 3;  1O7N B;  4CCV A;  3T8U A;  3KKG A;  3CC7 3;  1EQK A;  1VQP 3;  1K9M 4;  4EC6 A;  2GEX A;  1AR0 A;  3CNM A;  3FLJ A;  4LSO A;  5TGN A;  4N6M A;  1IV7 A;  3Q90 A;  4L7K A;  3HIG A;  1VZZ A;  3LXU X;  1VQN 3;  1W6Y A;  3HK4 A;  4N6L A;  3LH4 A;  1K28 A;  3S28 A;  1DMN A;  2R4I A;  1WMN A;  2MC8 A;  3OWS A;  4GL6 A;  4RNY A;  5KP4 A;  5AIH A;  2RGQ A;  1N9J A;  2CH9 A;  3I0Y A;  1QVF 2;  2QIY A;  1Q42 A;  2GBX B;  1RJO A;  1JKG B;  1S72 3;  3U1W A;  1FA3 A;  1VQ5 3;  1Q86 4;  1UUV B;  2L4V A;  3LT8 A;  5LC6 A;  3QRD A;  2UX0 A;  2GU1 A;  3EE1 A;  4K90 B;  1E97 A;  2CW9 A;  3KSE D;  5CK6 A;  4J8T A;  4X2H A;  3SED A;  3DXO A;  1OAC A;  1FGT A;  3EJV A;  2GXF A;  3BNB A;  1JKG A;  3V92 A;  1KQS 2;  4BTW A;  1KD1 4;  1YGE A;  2E2V A;  4LZI A;  1KC8 4;  1VQ7 3;  2OOV A;  5IF6 A;  2LYX A;  2YFJ B;  3VGN A;  3MPH A;  3CC2 3;  4MJD A;  3ALA A;  2XR8 B;  3H51 A;  4WYK B;  3SXX A;  4IIA A;  3X41 A;  2C10 A;  2GU3 A;  4HM2 B;  1TP6 A;  3X3Z A;  3AMO B;  1IT7 A;  2Z76 A;  3N54 B;  1VQK 3;  1BUQ A;  1E3V A;  4OUQ A;  5IER A;  4J9A A;  2B1X B;  3S29 A;  2CK3 H;  2OTL 3;  4KZ1 A;  3CNX A;  3ECF A;  1WNH A;  4HM3 B;  1WQL B;  4WYK A;  1AVK A;  4R4K A;  4OVM A;  3FH1 A;  3AMO A;  3MYT A;  1FUW A;  3T0U A;  4HBR A;  4EXR A;  1ZO2 A;  3S27 A;  5I97 A;  1LOX A;  3B4O A;  1VQM 3;  2A15 A;  1PFP A;  3NBR A;  5AI1 A;  4AEQ A;  3FKA A;  1RRL A;  3NBB A;  3T8N A;  1EKM A;  1DYU A;  1IQX A;  1T5Y A;  5IEO A;  2W04 A;  3WA2 X;  1NB3 I;  4HVN A;  1AV4 A;  4FMD A;  3BB9 A;  3NHX A;  1A67 A;  3BND A;  1VQ9 3;  2P09 A;  3F14 A;  3I56 3;  4FMA A;  4IPB A;  3JVC A;  3WOE B;  1J2B A;  5DRV A;  2CFK A;  4K1U A;  3CPO A;  5AIG A;  1KSI A;  2C11 A;  1GYB A;  2F86 B;  4HM6 B;  3NQZ A;  4OK0 A;  1W6C A;  5KP3 A;  3UL5 A;  2W2C A;  3WOF B;  5IG4 A;  5IEN A;  3HX8 A;  2W03 A;  3FF0 A;  5JPU A;  3B8L A;  3IPT A;  3JUQ A;  4RNZ A;  1DMM A;  1TIJ A;  2Y73 A;  5FGO A;  1O7H B;  1YVB I;  3LTC A;  1JB5 A;  2XFT A;  2CFD A;  4HM4 B;  1KWI A;  2XSH B;  3NXJ A;  1TFK A;  3F40 A;  3FG3 A;  4XDV A;  1FGM A;  1S5A A;  2CFL A;  3K63 A;  4NHF A;  1O7M B;  2PNC A;  3DGO A;  3HZP A;  3NX0 A;  2JQ5 A;  4R1K A;  1YIJ 3;  4HYZ A;  1OH0 A;  5CLK A;  2CIU A;  4PEJ A;  1O7G B;  3DMC A;  4FCM A;  2XF3 A;  3B4P A;  3FSD A;  5AEU B;  2HMO B;  3CCU 3;  1QVG 2;  1OGX A;  4O2H A;  2D1W A;  1W7C A;  3K9M C;  3VF1 A;  1IT8 A;  3B7C A;  1L5G B;  1JJ2 2;  1QAL A;  1RRH A;  1Z1S A;  4N6V 0;  3WDG B;  1W01 A;  3EBT A;  3U97 A;  2W56 A;  3K5T A;  1ZX2 A;  5D83 A;  2ZL8 A;  1NO3 A;  3PS8 A;  1UI8 A;  3LTA A;  2WGO A;  1GD3 A;  4GB5 A;  2BHM A;  1QMA A;  2ML6 A;  3KSP A;  2M7O A;  1E3R A;  3LT9 A;  4NRE A;  2XEP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...