3CCJ3

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2534u
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 13
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ccj300
1YIT3 3CCJ3 3G6E3 3CCE3 1VQ53 2OTJ3 1YIJ3 3CCQ3 3CXC2 2QA43 1VQP3 3CPW2 3CC43 1K734 1JJ22 3CCS3 3G713 2QEX3 3CME3 3CCV3 1VQK3 1Q864 1N8R4 2OTL3 1YJN3 1YJ93 1YJW3 1QVF2 3CCL3 1VQO3 1VQ43 3CC73 3I553 1KD14 1VQ73 3CMA3 3CCR3 1Q824 1VQM3 1YHQ3 1VQL3 1YI23 1KQS2 1Q7Y4 3G4S3 1S723 1NJI4 1VQ63 3CC23 1W2B2 1K9M4 1VQ83 3OW22 1KC84 1VQN3 1M904 1Q814 1K8A4 3CD63 1VQ93 3I563 3CCM3 1M1K4 3CCU3 1QVG2
chains in the Genus database with same CATH superfamily
1BSDA 3D5GA 3NV0B 3G6E3 2XFSA 4KT3B 1OHPA 1NDOB 4HM5B 1RKYA 1SIIA 1D6UA 1LQMB 1NNVA 2F98A 1FUWA 1RN1A 1WQLB 3JVCA 1SQWA 1DVDA 2Q07A 5AIFA 2BO9B 3JUMA 4KVHA 3CCV3 3FG3A 3FSDA 1BRIA 4I4KA 5AIHA 2P0MA 1B21A 3DUKA 3OWUA 3TDGA 1CH0A 4MMYB 1UUWB 1LRAA 1GY6A 3LYGA 4FMCA 2UX0A 1FGOA 4WYKA 3S28A 1Q7Y4 4U13A 3A76A 2L1SA 1DMNA 1I3IA 1OF5B 3BB9A 1BRKA 3CD63 3Q2PA 1N5HA 1UCKA 1EA2A 4BL2A 2QGUA 4HOHA 3GZYB 1OH0A 3HZPA 1MWUA 4HM3B 3VF1A 4RBNA 3CXC2 2BHMA 2CG0A 3CCQ3 3GWRA 1CYUA 1W6YA 4GHOA 4EV5A 3PXMA 3ZG0A 3DGNA 3EC9A 3F7SA 1RGHA 2F99A 3RDEA 1A2VA 4CPKA 1AV4A 5AIIA 4J9AA 3F8XA 3G0KA 3EJVA 1BSCA 2H0GA 2INXA 1BIRA 3ER7A 4BTXA 1C7HA 1Q824 4R80A 1ROAA 4X2HA 1S5AA 1IU7A 1BUJA 1KC84 1W6GA 2B24B 1Q814 3LTAA 3CCM3 3SOYA 3RGAA 5BU4A 3CCU3 2LQVA 3KSED 5IG5A 3CCE3 4MMXB 5D82A 3NBJA 1UCJA 1RNTA 3SVAA 1EKMA 1OGZA 2LYXA 1A90A 3RNTA 5AEUB 4FMAA 3NQYA 1GMQA 1RJOA 3X40A 1HKXA 3U97A 1IVUA 3F40A 1QALA 3LT8A 1GY5A 1Q864 8CHOA 1YGWA 4LGQA 3LTBA 2C10A 1R4YA 3HX8A 2KCDA 1B2ZA 1N9JA 1ROVA 3DGOA 3FLJA 1RN7A 2GU1A 5AYRB 3UL6A 3DZLA 1D6ZA 2GBWB 4HVNA 1S723 3KKGA 1W2B2 1W00A 4GB5A 3WOFB 1JB5A 3NBRA 5CLKA 3GRDA 3AGNA 4NPBA 3UL5A 3GZBA 1GD4A 3D5IA 1M1XB 2H0HA 1CEWI 2IMJA 1JRQA 1RCLA 2KAAA 1LXEA 4FCJA 4EBGA 3PCSA 1LNHA 1TFKA 5EQLA 1NWWA 2ZDJA 5DREA 5G2GA 3EQQB 2OQEA 1WMNA 2M7OA 2WGQA 1BAOA 2OTL3 5CF2A 2KF6A 3NUVA 4AKZA 1IQYA 1U5OA 3ZFZA 3CCL3 1JKGA 1D6YA 3K63A 4IPBA 4EW5A 1BNRA 1KD14 4WFOA 3CMA3 4BU4A 2YFJB 2WOHA 1VQL3 2YX9A 2F5MA 2D42A 1UGHI 1IQ8A 2CK3H 3OX9A 1BRJA 4FR9A 3BIRA 1NO3A 1QAFA 1TUHA 3AHWA 1YGEA 4ILFA 1VQ93 2RGQA 4RNTA 1M1K4 1BVIA 3KIIA 3IPTA 4IT7A 5HOHA 8RNTA 4FCZA 1SIHA 2JQ5A 2CFKA 1HU9A 2BNGA 3X3XA 1IVXA 1QJGA 2IUJA 2F56A 1E3VA 1BNSA 1FGQA 3KFQC 4OVMA 2H0IA 1RNBA 4RNZA 4K90B 1BU4A 4K1UA 1VQK3 4H61A 1YJW3 3IMAB 3OWSA 3WA3A 1Q40B 4CCVA 2W56A 1IT7A 2FGTA 1TTOA 2CFLA 2JDIH 2Z7AA 2C11A 1YVBI 4OK0A 4MMZB 3T0UA 1JBRA 1UI7A 1VQM3 1EG9B 2F5WA 1FZUA 2KF4A 3FKAA 3PZWA 1VQ63 2IA7A 3WA2X 1Y4KA 3X42A 5IEPA 2IY2A 1PU4A 4HAAA 2HMLB 2KF3A 3EE1A 4GL6A 5KP1A 4WWUC 3UJMA 1A2PA 1YNVX 3AHSA 5M18A 1VQ53 2GU3A 2GXFA 1I2EA 2XEPA 1WNHA 1X1XA 1TRPA 1R4CA 3DM8A 3J7Yd 2Z77A 5HGRA 3PGBA 1JBTA 1FA3A 2OOVC 3MKIA 1VQQA 1G02A 1LOVA 1N8QA 1RMSA 4KFFA 3PYJA 1IYYA 1O7WB 1W4NA 1VQ43 1NB5I 3FZWA 2CWVA 2HMNB 3EBYA 4NREA 1VQ73 4KFEA 3EF8A 3CNMA 1YHQ3 1DE3A 1W7CA 3LTDA 3STDA 1IVWA 1MWTA 1I2FA 2IUKA 1JN5B 3SOAA 1RRLA 2CX0A 2BMOB 3NBBA 2B1XB 3AMOB 1G0TA 1M904 1RGGA 2W6JH 1QVG2 1ZS7A 1O7MB 1LQGC 2KRTA 1FYSA 3K9MC 4CJNA 4HJLB 1I0XA 1WTHA 4GSPA 1IV7A 5IG4A 1K734 2CIUA 2MF7A 1T2IA 2P05A 3URPA 2HMOB 4Q53A 2GSPA 1N9EA 1YJ93 3NV0A 1GMRA 2OOVA 4CDLA 1QVF2 2CG1A 1B20A 3K7CA 3I553 3EN1B 1ZX2A 4G1MB 3CCR3 3MWZA 5GSPA 3DH2A 5AEWB 1RLSA 2WGOA 3OV4A 3WODG 1BNGA 1RGAA 4FMBA 1ISKA 1SPUA 1YVSA 3VGNA 5KP3A 1PY3A 3F14A 1JNQA 3S5CA 3SXXA 1US1A 1IV9A 3NM7A 3ZG5A 3BLZA 3Q3FA 3UB1A 1LVNA 5M1AA 1JN5A 1RGKA 2OQEC 2W03A 3JUPA 2CX1A 2O3OA 2IYJA 3LOYA 3AMOA 3N8BA 4FCMA 4HBRA 5AYSC 4OUQA 1OF5A 3NX0A 1GD3A 5AI1A 2Z76A 3JUQA 3UNLA 3MHEA 3X3ZA 1BOXA 3G16A 1GOVA 3H3HA 4KFDA 3GAXA 3CPOA 2CFGA 4HZ9B 4J5GA 1FGTA 1GOUA 1MNLA 4HKVB 3T8UA 2AADA 2STDA 2W0QA 4N3VA 4XB5A 1L5GB 3U1WA 1UI8A 3HIGA 3D9RA 2SBLA 3DY5A 1YJN3 5JPUA 1K41A 4X2OA 3DGLA 1TP6A 3D3LA 1UGIA 1AQZA 3X41A 1AR0A 3NM2A 5BVBA 2XSHB 5I97A 1DYUA 2CKFB 1EQKA 1B2XA 3WMDA 2XR8B 3NXJA 3IJEB 3AGOA 4O2HA 1Q42A 3DGYA 2YFLB 1FW7A 1BRHA 1W2ZA 3N9HA 3OXAA 4HM1B 2BU4A 1ULJB 2R4IA 4L8OA 1M9GA 2O9UX 1K28A 1SARA 2PZVA 4N6UA 2RNTA 4O3VA 4HZBB 2FNQA 3PCRA 1AY7A 1OUNA 3K0ZA 4R9KA 2ZA4A 7GSPA 3F7XA 4LMIA 1JV2B 1JB2A 1X1UA 1I8VA 1B2SA 2R41A 1RSNA 4HM4B 2XGLA 2Y73A 2SARA 3FF2A 3LH4A 1OGXA 4STDA 3MG1A 1YIJ3 1BGSA 2XFTA 1BNJA 3QRDA 3GZRA 5CF1A 2E2TA 4PEJA 4I5QA 1U8CB 2BIRA 3CME3 3PS8A 4EXRA 2XSOB 2WOFA 3SYUA 1ASKA 1B2MA 1JBSA 3FG1A 3JUOA 3CC73 3WHOA 3B4OA 1MOLA 5IEOA 4WHAA 3QK9A 3G4S3 1TRQA 1GOYA 1Q9EA 1LOYA 1IQXA 3O8YA 1BNIA 4L7KA 4MEIA 4AEQA 3HI7A 1OPYA 2FXTA 4BTWA 1E97A 3SX1A 4XBXA 4R1KA 1B27A 1UUGB 1LNIA 5BXQA 3V92A 2QA43 2OCTA 1IK3A 4FMDA 5EEOA 3Q90A 4HM8B 4RNYA 5TGNA 1BUQA 5ELJA 4HM6B 3G713 1OHSA 2W9PA 1BSAA 4XM4A 2HMMB 3HIIA 2QIYA 2UGIA 2C4BA 2HMJB 5KP4A 5A0OB 4HM2B 2Y74A 4EV2A 7STDA 5IW9A 2GEYA 2F4YA 3K5TA 4XBYA 3SEDA 1FGMA 1STFI 5M19A 1E3RA 2K3DA 2CHCA 3LMLA 4J8TA 1K9M4 4JRFA 5JBSA 1VQN3 3CU3A 1OHOA 1I70A 3DXOA 1TFOA 1BRSA 4R9LA 2CW9A 2ZL8A 3KZTA 1Q40A 2RFRA 4N6MA 3CCJ3 1NU3A 2D1WA 2KXGA 2CH9A 2Z6BA 4O02B 3E99A 1CYVA 2ML5A 1GYBA 1RRHA 2AAEA 2KF5A 1JJ22 1GS3A 5IG3A 2K0MA 1W5ZA 1ULIB 2BMRB 2QEX3 4K1VA 3WDGB 1RCKA 1N8R4 3MPHA 1LOXA 4LZIA 1BRNL 4N6LA 1LOWA 1F8NA 1W01A 2P0XA 1T5YA 3FF0A 4JF8A 1AVLA 4RZMA 5D81A 1TJDA 1A2KA 1OACA 3BNDA 2P38A 2F86B 1PFPA 1NJI4 3FG4A 3V99A 4N6NB 6RNTA 4ZM8A 3OW22 2RSXA 2BMQB 3HK4A 1NB3I 3B4PA 3ECFA 1ZO2A 1Z1SA 1FGRA 1KSIA 1TU5A 1JZDA 1BNEA 1GMPA 4N6TA 1VZZA 2OWPA 1G96A 1BNFA 1RTUA 1B3SA 1MWSA 1V57A 1UW1A 9RNTA 1MWRA 2PNCA 1UUVB 4BL3A 3OWYA 1IVVA 3EX9A 3CPW2 3EN8A 4K61A 2A15A 3KSPA 4HYZA 3D79A 5DRVA 2MC8A 3S67A 1AVKA 1I0VA 2GBXB 3FH1A 1SJWA 1VQO3 3H51A 1HYFA 2E2VA 1EEJA 3N54B 1QMAA 4XBTA 1X1YA 2XF3A 3DGMA 2CWUA 3B8LA 3BU4A 1A67A 5G1KA 2ZHXB 1KWIA 1B2UA 2UUGC 1BSBA 2W9QA 2XRXB 3NHXA 3DMCA 1C54A 3Q1CA 3M8CA 1YIT3 1FUTA 5AIGA 2J8XB 4R4KA 1DMMA 1JKGB 1FUSA 1PYLA 3LXUX 3EHCA 5FW5A 4BIRA 1WMOA 1TIJA 2ML6A 4XDWA 1I3FA 1MGWA 1DMQA 4N6OB 5D83A 5LC6A 1JZOA 1Q7HA 3GSPA 4L8PA 3F9SA 2K54A 3CCS3 4XDVA 5IENA 2XH9A 4QWTA 1OCVA 1IDPA 1IT8A 2RBIA 4O8SA 3ALAA 3I0YA 1W02A 4WP5A 1DETA 5JPPA 2CFDA 3MG2A 1RGEA 5CXOA 4HM0B 1RDSA 2V1LA 3KE7A 1I2GA 3CC23 3LTCA 3ROBA 1O7PB 1RGLA 1X1WA 3BNBA 1BSEA 1K8A4 1STDA 7RNTA 3EBTA 1QAKA 1EUIC 2OTJ3 2W56B 3FCSB 2P09A 3LT9A 2L4VA 2WO0A 1JB4A 1RGCA 3FGYA 1N5PA 2XGNA 1O7GB 4IIAA 1UCIA 5G1LA 6STDA 4J5KA 1WMPA 1RN4A 4HM7B 1UCLA 2RCDA 1T2HA 4N6V0 5RNTA 2BT3A 3MYTA 4BTYA 4DKIA 4LSOA 5IG0A 2W04A 3S27A 3G8ZA 3V98A 2W2CA 3B7CA 3L0RA 2YFIB 1MGRA 3BNCA 1YI23 1KQS2 3GZXB 4MJDA 5EVHA 2CWTA 1VQ83 1O7NB 4TX4A 1BRGA 1RHLA 5IF6A 2GEXA 3MSOA 4AKYA 2HMKB 5LC7A 4LYLB 4EYCA 5STDA 3A5EA 1HZ1A 4ORLA 1CQSA 3D4AA 3SLUA 5IERA 4LEHA 3HOHA 2CC3A 2HOHA 3JUNA 1VQP3 3RGRA 1V58A 3CC43 5BIRA 1BANA 1DVCA 3X3YA 4WYKB 1T3BA 3VSYA 3MG3A 2CFWA 2I9WA 6GSPA 3S29A 5CK6A 3T8NA 1RGFA 1O7HB 2E2UA 3WOEB 1J2BA 1GY7A 1V74A 3KCHA 4NHFA 4KZ1A 1ZGXA 5ELUA 3BNEA 1GSPA 3NQZA 3CNXA 3EB8A 1W6CA 3LZAA 1UDII 4EC6A 3F8HA 5FGOA 3WR2A 4H3UA 3I563 3KN4A
chains in the Genus database with same CATH topology
3NV0B 3G6E3 2XFSA 1OHPA 1NDOB 4HM5B 1RKYA 1SIIA 1D6UA 2F98A 1FUWA 1WQLB 3JVCA 1SQWA 1DVDA 2Q07A 5AIFA 2BO9B 3JUMA 4KVHA 3CCV3 3FG3A 3FSDA 4I4KA 5AIHA 2P0MA 3DUKA 3OWUA 3TDGA 4MMYB 1UUWB 4FMCA 1GY6A 3LYGA 2UX0A 1FGOA 4WYKA 3S28A 1Q7Y4 4U13A 3A76A 1DMNA 1OF5B 3BB9A 3CD63 3Q2PA 1N5HA 1EA2A 2QGUA 3GZYB 1OH0A 3HZPA 4HM3B 3VF1A 4RBNA 3CXC2 2BHMA 2CG0A 3CCQ3 3GWRA 1CYUA 1W6YA 4EV5A 3PXMA 3DGNA 3EC9A 3F7SA 2F99A 3RDEA 1A2VA 1AV4A 5AIIA 4J9AA 3F8XA 3G0KA 3EJVA 2INXA 3ER7A 4BTXA 1C7HA 1Q824 4R80A 1ROAA 4X2HA 1S5AA 1IU7A 1KC84 1W6GA 2B24B 1Q814 3LTAA 3CCM3 3SOYA 3RGAA 3CCU3 2LQVA 3KSED 5IG5A 3CCE3 4MMXB 5D82A 3NBJA 3SVAA 1EKMA 1OGZA 2LYXA 1A90A 5AEUB 4FMAA 3NQYA 1RJOA 3X40A 1HKXA 3U97A 1IVUA 3F40A 1QALA 3LT8A 1GY5A 1Q864 8CHOA 4LGQA 3LTBA 2C10A 3HX8A 2KCDA 1N9JA 1ROVA 3DGOA 3FLJA 1RN7A 2GU1A 5AYRB 3UL6A 3DZLA 1D6ZA 2GBWB 4HVNA 1S723 3KKGA 1W2B2 1W00A 4GB5A 3WOFB 1JB5A 3NBRA 5CLKA 3GRDA 3UL5A 3GZBA 1GD4A 1M1XB 1CEWI 2IMJA 1JRQA 4FCJA 4EBGA 1LXEA 3PCSA 1LNHA 1TFKA 5EQLA 1NWWA 2ZDJA 5DREA 5G2GA 3EQQB 2OQEA 1WMNA 2M7OA 2WGQA 2OTL3 5CF2A 3NUVA 4AKZA 1IQYA 1U5OA 3CCL3 1JKGA 1D6YA 3K63A 4IPBA 1KD14 4WFOA 3CMA3 2YFJB 2WOHA 1VQL3 2YX9A 2D42A 2CK3H 1IQ8A 3OX9A 4FR9A 1NO3A 1QAFA 1TUHA 1YGEA 1VQ93 2RGQA 1M1K4 3KIIA 3IPTA 4IT7A 4FCZA 1SIHA 2JQ5A 2CFKA 1HU9A 2BNGA 3X3XA 1IVXA 1QJGA 2IUJA 1E3VA 1FGQA 3KFQC 4OVMA 4RNZA 4K90B 1VQK3 4K1UA 4H61A 1YJW3 3IMAB 3OWSA 3WA3A 1Q40B 4CCVA 2W56A 1IT7A 2FGTA 2CFLA 2JDIH 2Z7AA 2C11A 1YVBI 4OK0A 4MMZB 3T0UA 1UI7A 1VQM3 1EG9B 1VQ63 3FKAA 3PZWA 2IA7A 3WA2X 1Y4KA 3X42A 5IEPA 1PU4A 2HMLB 3EE1A 4GL6A 5KP1A 4WWUC 3UJMA 1VQ53 2GU3A 2GXFA 2XEPA 1WNHA 3DM8A 1R4CA 3J7Yd 2Z77A 5HGRA 3PGBA 1FA3A 2OOVC 3MKIA 1N8QA 4KFFA 3PYJA 1O7WB 1W4NA 1VQ43 1NB5I 3FZWA 2CWVA 2HMNB 3EBYA 4NREA 1VQ73 4KFEA 3EF8A 3CNMA 1YHQ3 1W7CA 3LTDA 3STDA 1IVWA 2IUKA 1JN5B 3SOAA 1RRLA 2BMOB 3NBBA 2B1XB 3AMOB 1M904 2W6JH 1QVG2 1O7MB 2KRTA 3K9MC 4HJLB 1WTHA 1IV7A 5IG4A 1K734 2CIUA 2MF7A 2P05A 2HMOB 4Q53A 1N9EA 1YJ93 3NV0A 2OOVA 4CDLA 1QVF2 2CG1A 3K7CA 3I553 3EN1B 1ZX2A 4G1MB 3CCR3 3MWZA 5AEWB 2WGOA 3OV4A 3WODG 4FMBA 1ISKA 1SPUA 3VGNA 5KP3A 3F14A 1JNQA 3S5CA 3SXXA 1US1A 1IV9A 3NM7A 3BLZA 3UB1A 1LVNA 3CPW2 1JN5A 2OQEC 2W03A 3JUPA 3N8BA 4HBRA 2O3OA 3LOYA 4ORLA 3AMOA 5BVBA 4FCMA 5AYSC 4OUQA 1OF5A 3NX0A 1GD3A 5AI1A 2Z76A 3JUQA 3UNLA 3MHEA 3X3ZA 3G16A 3H3HA 4KFDA 3GAXA 3CPOA 2CFGA 4HZ9B 1FGTA 1MNLA 4HKVB 3T8UA 2STDA 2W0QA 4N3VA 4XB5A 1L5GB 3U1WA 1UI8A 3HIGA 3D9RA 2SBLA 3DY5A 1YJN3 5JPUA 1K41A 4X2OA 3DGLA 1TP6A 3D3LA 3X41A 1AR0A 3NM2A 2XSHB 5I97A 1DYUA 2CKFB 1EQKA 3WMDA 2XR8B 3NXJA 3IJEB 4O2HA 1Q42A 2YFLB 1W2ZA 3N9HA 3OXAA 4HM1B 4L8OA 1ULJB 2R4IA 1M9GA 2O9UX 1K28A 2PZVA 4N6UA 4O3VA 4HZBB 2FNQA 3PCRA 1OUNA 4R9KA 3K0ZA 3F7XA 4LMIA 1JV2B 1JB2A 4HM4B 2XGLA 2Y73A 3FF2A 3LH4A 1OGXA 4STDA 3MG1A 1YIJ3 2XFTA 3QRDA 3GZRA 5CF1A 2E2TA 4PEJA 1U8CB 3CME3 3PS8A 4EXRA 2XSOB 2WOFA 1ASKA 3FG1A 3JUOA 3CC73 3B4OA 1MOLA 5IEOA 4WHAA 3QK9A 3G4S3 1IQXA 3O8YA 4L7KA 4MEIA 4AEQA 3HI7A 1OPYA 2FXTA 4BTWA 1E97A 3SX1A 4XBXA 4R1KA 2QA43 5BXQA 3V92A 2OCTA 1IK3A 4FMDA 5EEOA 3Q90A 4HM8B 4RNYA 5TGNA 1BUQA 5ELJA 4HM6B 3G713 1OHSA 2W9PA 4XM4A 2HMMB 3HIIA 2QIYA 2HMJB 5KP4A 5A0OB 4HM2B 2Y74A 4EV2A 7STDA 5IW9A 2GEYA 3K5TA 4XBYA 3SEDA 1FGMA 1STFI 1E3RA 2CHCA 3LMLA 4J8TA 1K9M4 4JRFA 5JBSA 1VQN3 3CU3A 1OHOA 3DXOA 4R9LA 1TFOA 2CW9A 2ZL8A 3KZTA 1Q40A 2RFRA 4N6MA 3CCJ3 1NU3A 2D1WA 2KXGA 2CH9A 2Z6BA 4O02B 3E99A 1CYVA 2ML5A 1GYBA 1RRHA 1JJ22 1GS3A 5IG3A 2K0MA 1W5ZA 1ULIB 2BMRB 2QEX3 4K1VA 3WDGB 1N8R4 3MPHA 1LOXA 4LZIA 4N6LA 1F8NA 1W01A 2P0XA 1T5YA 3FF0A 4JF8A 1AVLA 4RZMA 5D81A 1A2KA 1OACA 3BNDA 2P38A 2F86B 1PFPA 1NJI4 3FG4A 3V99A 4N6NB 4ZM8A 3OW22 2RSXA 2BMQB 3HK4A 1NB3I 3B4PA 3ECFA 1ZO2A 1Z1SA 1FGRA 1KSIA 1TU5A 4N6TA 1VZZA 2OWPA 1G96A 1UW1A 2PNCA 1UUVB 3OWYA 1IVVA 3EX9A 3EN8A 4K61A 2A15A 3KSPA 4HYZA 5DRVA 2MC8A 3S67A 1AVKA 2GBXB 3FH1A 1SJWA 1VQO3 3H51A 2E2VA 3N54B 1QMAA 4XBTA 2XF3A 3DGMA 2CWUA 3B8LA 1A67A 1KWIA 2W9QA 2XRXB 3NHXA 3DMCA 3Q1CA 3M8CA 1YIT3 5AIGA 4R4KA 1DMMA 1JKGB 5FW5A 3LXUX 3EHCA 1WMOA 1TIJA 2ML6A 4XDWA 5D83A 4N6OB 1DMQA 5LC6A 4L8PA 3F9SA 2K54A 3CCS3 4XDVA 5IENA 2XH9A 4QWTA 1OCVA 1IDPA 1IT8A 4O8SA 3ALAA 3I0YA 1W02A 4WP5A 5JPPA 2CFDA 3MG2A 5CXOA 4HM0B 2V1LA 3KE7A 3CC23 3LTCA 3ROBA 1O7PB 3BNBA 1K8A4 1STDA 3EBTA 1QAKA 2OTJ3 2W56B 3FCSB 2P09A 3LT9A 2L4VA 2WO0A 1JB4A 3FGYA 1N5PA 2XGNA 1O7GB 4IIAA 6STDA 1WMPA 4HM7B 2RCDA 4N6V0 2BT3A 3MYTA 4BTYA 4LSOA 5IG0A 2W04A 3S27A 3G8ZA 3V98A 2W2CA 3B7CA 3L0RA 2YFIB 3BNCA 1YI23 1KQS2 3GZXB 4MJDA 5EVHA 2CWTA 1VQ83 1O7NB 4TX4A 5IF6A 2GEXA 3MSOA 4AKYA 2HMKB 5LC7A 4EYCA 5STDA 1CQSA 3SLUA 5IERA 4LEHA 2CC3A 3JUNA 1VQP3 3RGRA 3CC43 1DVCA 3X3YA 4WYKB 3VSYA 3MG3A 2CFWA 2I9WA 3S29A 5CK6A 3T8NA 1O7HB 2E2UA 3WOEB 1J2BA 1GY7A 1V74A 4NHFA 4KZ1A 5ELUA 3BNEA 3NQZA 3CNXA 3EB8A 1W6CA 3LZAA 4EC6A 3F8HA 5FGOA 4H3UA 3I563 3KN4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIT 3;  3CCJ 3;  3G6E 3;  3CCE 3;  1VQ5 3;  2OTJ 3;  1YIJ 3;  3CCQ 3;  3CXC 2;  2QA4 3;  1VQP 3;  3CPW 2;  3CC4 3;  1K73 4;  1JJ2 2;  3CCS 3;  3G71 3;  2QEX 3;  3CME 3;  3CCV 3;  1VQK 3;  1Q86 4;  1N8R 4;  2OTL 3;  1YJN 3;  1YJ9 3;  1YJW 3;  1QVF 2;  3CCL 3;  1VQO 3;  1VQ4 3;  3CC7 3;  3I55 3;  1KD1 4;  1VQ7 3;  3CMA 3;  3CCR 3;  1Q82 4;  1VQM 3;  1YHQ 3;  1VQL 3;  1YI2 3;  1KQS 2;  1Q7Y 4;  3G4S 3;  1S72 3;  1NJI 4;  1VQ6 3;  3CC2 3;  1W2B 2;  1K9M 4;  1VQ8 3;  3OW2 2;  1KC8 4;  1VQN 3;  1M90 4;  1Q81 4;  1K8A 4;  3CD6 3;  1VQ9 3;  3I56 3;  3CCM 3;  1M1K 4;  3CCU 3;  1QVG 2; 
#chains in the Genus database with same CATH topology
 1BSD A;  3D5G A;  3NV0 B;  3G6E 3;  2XFS A;  4KT3 B;  1OHP A;  1NDO B;  4HM5 B;  1RKY A;  1SII A;  1D6U A;  1LQM B;  1NNV A;  2F98 A;  1FUW A;  1RN1 A;  1WQL B;  3JVC A;  1SQW A;  1DVD A;  2Q07 A;  5AIF A;  2BO9 B;  3JUM A;  4KVH A;  3CCV 3;  3FG3 A;  3FSD A;  1BRI A;  4I4K A;  5AIH A;  2P0M A;  1B21 A;  3DUK A;  3OWU A;  3TDG A;  1CH0 A;  4MMY B;  1UUW B;  1LRA A;  1GY6 A;  3LYG A;  4FMC A;  2UX0 A;  1FGO A;  4WYK A;  3S28 A;  1Q7Y 4;  4U13 A;  3A76 A;  2L1S A;  1DMN A;  1I3I A;  1OF5 B;  3BB9 A;  1BRK A;  3CD6 3;  3Q2P A;  1N5H A;  1UCK A;  1EA2 A;  4BL2 A;  2QGU A;  4HOH A;  3GZY B;  1OH0 A;  3HZP A;  1MWU A;  4HM3 B;  3VF1 A;  4RBN A;  3CXC 2;  2BHM A;  2CG0 A;  3CCQ 3;  3GWR A;  1CYU A;  1W6Y A;  4GHO A;  4EV5 A;  3PXM A;  3ZG0 A;  3DGN A;  3EC9 A;  3F7S A;  1RGH A;  2F99 A;  3RDE A;  1A2V A;  4CPK A;  1AV4 A;  5AII A;  4J9A A;  3F8X A;  3G0K A;  3EJV A;  1BSC A;  2H0G A;  2INX A;  1BIR A;  3ER7 A;  4BTX A;  1C7H A;  1Q82 4;  4R80 A;  1ROA A;  4X2H A;  1S5A A;  1IU7 A;  1BUJ A;  1KC8 4;  1W6G A;  2B24 B;  1Q81 4;  3LTA A;  3CCM 3;  3SOY A;  3RGA A;  5BU4 A;  3CCU 3;  2LQV A;  3KSE D;  5IG5 A;  3CCE 3;  4MMX B;  5D82 A;  3NBJ A;  1UCJ A;  1RNT A;  3SVA A;  1EKM A;  1OGZ A;  2LYX A;  1A90 A;  3RNT A;  5AEU B;  4FMA A;  3NQY A;  1GMQ A;  1RJO A;  3X40 A;  1HKX A;  3U97 A;  1IVU A;  3F40 A;  1QAL A;  3LT8 A;  1GY5 A;  1Q86 4;  8CHO A;  1YGW A;  4LGQ A;  3LTB A;  2C10 A;  1R4Y A;  3HX8 A;  2KCD A;  1B2Z A;  1N9J A;  1ROV A;  3DGO A;  3FLJ A;  1RN7 A;  2GU1 A;  5AYR B;  3UL6 A;  3DZL A;  1D6Z A;  2GBW B;  4HVN A;  1S72 3;  3KKG A;  1W2B 2;  1W00 A;  4GB5 A;  3WOF B;  1JB5 A;  3NBR A;  5CLK A;  3GRD A;  3AGN A;  4NPB A;  3UL5 A;  3GZB A;  1GD4 A;  3D5I A;  1M1X B;  2H0H A;  1CEW I;  2IMJ A;  1JRQ A;  1RCL A;  2KAA A;  1LXE A;  4FCJ A;  4EBG A;  3PCS A;  1LNH A;  1TFK A;  5EQL A;  1NWW A;  2ZDJ A;  5DRE A;  5G2G A;  3EQQ B;  2OQE A;  1WMN A;  2M7O A;  2WGQ A;  1BAO A;  2OTL 3;  5CF2 A;  2KF6 A;  3NUV A;  4AKZ A;  1IQY A;  1U5O A;  3ZFZ A;  3CCL 3;  1JKG A;  1D6Y A;  3K63 A;  4IPB A;  4EW5 A;  1BNR A;  1KD1 4;  4WFO A;  3CMA 3;  4BU4 A;  2YFJ B;  2WOH A;  1VQL 3;  2YX9 A;  2F5M A;  2D42 A;  1UGH I;  1IQ8 A;  2CK3 H;  3OX9 A;  1BRJ A;  4FR9 A;  3BIR A;  1NO3 A;  1QAF A;  1TUH A;  3AHW A;  1YGE A;  4ILF A;  1VQ9 3;  2RGQ A;  4RNT A;  1M1K 4;  1BVI A;  3KII A;  3IPT A;  4IT7 A;  5HOH A;  8RNT A;  4FCZ A;  1SIH A;  2JQ5 A;  2CFK A;  1HU9 A;  2BNG A;  3X3X A;  1IVX A;  1QJG A;  2IUJ A;  2F56 A;  1E3V A;  1BNS A;  1FGQ A;  3KFQ C;  4OVM A;  2H0I A;  1RNB A;  4RNZ A;  4K90 B;  1BU4 A;  4K1U A;  1VQK 3;  4H61 A;  1YJW 3;  3IMA B;  3OWS A;  3WA3 A;  1Q40 B;  4CCV A;  2W56 A;  1IT7 A;  2FGT A;  1TTO A;  2CFL A;  2JDI H;  2Z7A A;  2C11 A;  1YVB I;  4OK0 A;  4MMZ B;  3T0U A;  1JBR A;  1UI7 A;  1VQM 3;  1EG9 B;  2F5W A;  1FZU A;  2KF4 A;  3FKA A;  3PZW A;  1VQ6 3;  2IA7 A;  3WA2 X;  1Y4K A;  3X42 A;  5IEP A;  2IY2 A;  1PU4 A;  4HAA A;  2HML B;  2KF3 A;  3EE1 A;  4GL6 A;  5KP1 A;  4WWU C;  3UJM A;  1A2P A;  1YNV X;  3AHS A;  5M18 A;  1VQ5 3;  2GU3 A;  2GXF A;  1I2E A;  2XEP A;  1WNH A;  1X1X A;  1TRP A;  1R4C A;  3DM8 A;  3J7Y d;  2Z77 A;  5HGR A;  3PGB A;  1JBT A;  1FA3 A;  2OOV C;  3MKI A;  1VQQ A;  1G02 A;  1LOV A;  1N8Q A;  1RMS A;  4KFF A;  3PYJ A;  1IYY A;  1O7W B;  1W4N A;  1VQ4 3;  1NB5 I;  3FZW A;  2CWV A;  2HMN B;  3EBY A;  4NRE A;  1VQ7 3;  4KFE A;  3EF8 A;  3CNM A;  1YHQ 3;  1DE3 A;  1W7C A;  3LTD A;  3STD A;  1IVW A;  1MWT A;  1I2F A;  2IUK A;  1JN5 B;  3SOA A;  1RRL A;  2CX0 A;  2BMO B;  3NBB A;  2B1X B;  3AMO B;  1G0T A;  1M90 4;  1RGG A;  2W6J H;  1QVG 2;  1ZS7 A;  1O7M B;  1LQG C;  2KRT A;  1FYS A;  3K9M C;  4CJN A;  4HJL B;  1I0X A;  1WTH A;  4GSP A;  1IV7 A;  5IG4 A;  1K73 4;  2CIU A;  2MF7 A;  1T2I A;  2P05 A;  3URP A;  2HMO B;  4Q53 A;  2GSP A;  1N9E A;  1YJ9 3;  3NV0 A;  1GMR A;  2OOV A;  4CDL A;  1QVF 2;  2CG1 A;  1B20 A;  3K7C A;  3I55 3;  3EN1 B;  1ZX2 A;  4G1M B;  3CCR 3;  3MWZ A;  5GSP A;  3DH2 A;  5AEW B;  1RLS A;  2WGO A;  3OV4 A;  3WOD G;  1BNG A;  1RGA A;  4FMB A;  1ISK A;  1SPU A;  1YVS A;  3VGN A;  5KP3 A;  1PY3 A;  3F14 A;  1JNQ A;  3S5C A;  3SXX A;  1US1 A;  1IV9 A;  3NM7 A;  3ZG5 A;  3BLZ A;  3Q3F A;  3UB1 A;  1LVN A;  5M1A A;  1JN5 A;  1RGK A;  2OQE C;  2W03 A;  3JUP A;  2CX1 A;  2O3O A;  2IYJ A;  3LOY A;  3AMO A;  3N8B A;  4FCM A;  4HBR A;  5AYS C;  4OUQ A;  1OF5 A;  3NX0 A;  1GD3 A;  5AI1 A;  2Z76 A;  3JUQ A;  3UNL A;  3MHE A;  3X3Z A;  1BOX A;  3G16 A;  1GOV A;  3H3H A;  4KFD A;  3GAX A;  3CPO A;  2CFG A;  4HZ9 B;  4J5G A;  1FGT A;  1GOU A;  1MNL A;  4HKV B;  3T8U A;  2AAD A;  2STD A;  2W0Q A;  4N3V A;  4XB5 A;  1L5G B;  3U1W A;  1UI8 A;  3HIG A;  3D9R A;  2SBL A;  3DY5 A;  1YJN 3;  5JPU A;  1K41 A;  4X2O A;  3DGL A;  1TP6 A;  3D3L A;  1UGI A;  1AQZ A;  3X41 A;  1AR0 A;  3NM2 A;  5BVB A;  2XSH B;  5I97 A;  1DYU A;  2CKF B;  1EQK A;  1B2X A;  3WMD A;  2XR8 B;  3NXJ A;  3IJE B;  3AGO A;  4O2H A;  1Q42 A;  3DGY A;  2YFL B;  1FW7 A;  1BRH A;  1W2Z A;  3N9H A;  3OXA A;  4HM1 B;  2BU4 A;  1ULJ B;  2R4I A;  4L8O A;  1M9G A;  2O9U X;  1K28 A;  1SAR A;  2PZV A;  4N6U A;  2RNT A;  4O3V A;  4HZB B;  2FNQ A;  3PCR A;  1AY7 A;  1OUN A;  3K0Z A;  4R9K A;  2ZA4 A;  7GSP A;  3F7X A;  4LMI A;  1JV2 B;  1JB2 A;  1X1U A;  1I8V A;  1B2S A;  2R41 A;  1RSN A;  4HM4 B;  2XGL A;  2Y73 A;  2SAR A;  3FF2 A;  3LH4 A;  1OGX A;  4STD A;  3MG1 A;  1YIJ 3;  1BGS A;  2XFT A;  1BNJ A;  3QRD A;  3GZR A;  5CF1 A;  2E2T A;  4PEJ A;  4I5Q A;  1U8C B;  2BIR A;  3CME 3;  3PS8 A;  4EXR A;  2XSO B;  2WOF A;  3SYU A;  1ASK A;  1B2M A;  1JBS A;  3FG1 A;  3JUO A;  3CC7 3;  3WHO A;  3B4O A;  1MOL A;  5IEO A;  4WHA A;  3QK9 A;  3G4S 3;  1TRQ A;  1GOY A;  1Q9E A;  1LOY A;  1IQX A;  3O8Y A;  1BNI A;  4L7K A;  4MEI A;  4AEQ A;  3HI7 A;  1OPY A;  2FXT A;  4BTW A;  1E97 A;  3SX1 A;  4XBX A;  4R1K A;  1B27 A;  1UUG B;  1LNI A;  5BXQ A;  3V92 A;  2QA4 3;  2OCT A;  1IK3 A;  4FMD A;  5EEO A;  3Q90 A;  4HM8 B;  4RNY A;  5TGN A;  1BUQ A;  5ELJ A;  4HM6 B;  3G71 3;  1OHS A;  2W9P A;  1BSA A;  4XM4 A;  2HMM B;  3HII A;  2QIY A;  2UGI A;  2C4B A;  2HMJ B;  5KP4 A;  5A0O B;  4HM2 B;  2Y74 A;  4EV2 A;  7STD A;  5IW9 A;  2GEY A;  2F4Y A;  3K5T A;  4XBY A;  3SED A;  1FGM A;  1STF I;  5M19 A;  1E3R A;  2K3D A;  2CHC A;  3LML A;  4J8T A;  1K9M 4;  4JRF A;  5JBS A;  1VQN 3;  3CU3 A;  1OHO A;  1I70 A;  3DXO A;  1TFO A;  1BRS A;  4R9L A;  2CW9 A;  2ZL8 A;  3KZT A;  1Q40 A;  2RFR A;  4N6M A;  3CCJ 3;  1NU3 A;  2D1W A;  2KXG A;  2CH9 A;  2Z6B A;  4O02 B;  3E99 A;  1CYV A;  2ML5 A;  1GYB A;  1RRH A;  2AAE A;  2KF5 A;  1JJ2 2;  1GS3 A;  5IG3 A;  2K0M A;  1W5Z A;  1ULI B;  2BMR B;  2QEX 3;  4K1V A;  3WDG B;  1RCK A;  1N8R 4;  3MPH A;  1LOX A;  4LZI A;  1BRN L;  4N6L A;  1LOW A;  1F8N A;  1W01 A;  2P0X A;  1T5Y A;  3FF0 A;  4JF8 A;  1AVL A;  4RZM A;  5D81 A;  1TJD A;  1A2K A;  1OAC A;  3BND A;  2P38 A;  2F86 B;  1PFP A;  1NJI 4;  3FG4 A;  3V99 A;  4N6N B;  6RNT A;  4ZM8 A;  3OW2 2;  2RSX A;  2BMQ B;  3HK4 A;  1NB3 I;  3B4P A;  3ECF A;  1ZO2 A;  1Z1S A;  1FGR A;  1KSI A;  1TU5 A;  1JZD A;  1BNE A;  1GMP A;  4N6T A;  1VZZ A;  2OWP A;  1G96 A;  1BNF A;  1RTU A;  1B3S A;  1MWS A;  1V57 A;  1UW1 A;  9RNT A;  1MWR A;  2PNC A;  1UUV B;  4BL3 A;  3OWY A;  1IVV A;  3EX9 A;  3CPW 2;  3EN8 A;  4K61 A;  2A15 A;  3KSP A;  4HYZ A;  3D79 A;  5DRV A;  2MC8 A;  3S67 A;  1AVK A;  1I0V A;  2GBX B;  3FH1 A;  1SJW A;  1VQO 3;  3H51 A;  1HYF A;  2E2V A;  1EEJ A;  3N54 B;  1QMA A;  4XBT A;  1X1Y A;  2XF3 A;  3DGM A;  2CWU A;  3B8L A;  3BU4 A;  1A67 A;  5G1K A;  2ZHX B;  1KWI A;  1B2U A;  2UUG C;  1BSB A;  2W9Q A;  2XRX B;  3NHX A;  3DMC A;  1C54 A;  3Q1C A;  3M8C A;  1YIT 3;  1FUT A;  5AIG A;  2J8X B;  4R4K A;  1DMM A;  1JKG B;  1FUS A;  1PYL A;  3LXU X;  3EHC A;  5FW5 A;  4BIR A;  1WMO A;  1TIJ A;  2ML6 A;  4XDW A;  1I3F A;  1MGW A;  1DMQ A;  4N6O B;  5D83 A;  5LC6 A;  1JZO A;  1Q7H A;  3GSP A;  4L8P A;  3F9S A;  2K54 A;  3CCS 3;  4XDV A;  5IEN A;  2XH9 A;  4QWT A;  1OCV A;  1IDP A;  1IT8 A;  2RBI A;  4O8S A;  3ALA A;  3I0Y A;  1W02 A;  4WP5 A;  1DET A;  5JPP A;  2CFD A;  3MG2 A;  1RGE A;  5CXO A;  4HM0 B;  1RDS A;  2V1L A;  3KE7 A;  1I2G A;  3CC2 3;  3LTC A;  3ROB A;  1O7P B;  1RGL A;  1X1W A;  3BNB A;  1BSE A;  1K8A 4;  1STD A;  7RNT A;  3EBT A;  1QAK A;  1EUI C;  2OTJ 3;  2W56 B;  3FCS B;  2P09 A;  3LT9 A;  2L4V A;  2WO0 A;  1JB4 A;  1RGC A;  3FGY A;  1N5P A;  2XGN A;  1O7G B;  4IIA A;  1UCI A;  5G1L A;  6STD A;  4J5K A;  1WMP A;  1RN4 A;  4HM7 B;  1UCL A;  2RCD A;  1T2H A;  4N6V 0;  5RNT A;  2BT3 A;  3MYT A;  4BTY A;  4DKI A;  4LSO A;  5IG0 A;  2W04 A;  3S27 A;  3G8Z A;  3V98 A;  2W2C A;  3B7C A;  3L0R A;  2YFI B;  1MGR A;  3BNC A;  1YI2 3;  1KQS 2;  3GZX B;  4MJD A;  5EVH A;  2CWT A;  1VQ8 3;  1O7N B;  4TX4 A;  1BRG A;  1RHL A;  5IF6 A;  2GEX A;  3MSO A;  4AKY A;  2HMK B;  5LC7 A;  4LYL B;  4EYC A;  5STD A;  3A5E A;  1HZ1 A;  4ORL A;  1CQS A;  3D4A A;  3SLU A;  5IER A;  4LEH A;  3HOH A;  2CC3 A;  2HOH A;  3JUN A;  1VQP 3;  3RGR A;  1V58 A;  3CC4 3;  5BIR A;  1BAN A;  1DVC A;  3X3Y A;  4WYK B;  1T3B A;  3VSY A;  3MG3 A;  2CFW A;  2I9W A;  6GSP A;  3S29 A;  5CK6 A;  3T8N A;  1RGF A;  1O7H B;  2E2U A;  3WOE B;  1J2B A;  1GY7 A;  1V74 A;  3KCH A;  4NHF A;  4KZ1 A;  1ZGX A;  5ELU A;  3BNE A;  1GSP A;  3NQZ A;  3CNX A;  3EB8 A;  1W6C A;  3LZA A;  1UDI I;  4EC6 A;  3F8H A;  5FGO A;  3WR2 A;  4H3U A;  3I56 3;  3KN4 A; 
#chains in the Genus database with same CATH homology
 3NV0 B;  3G6E 3;  2XFS A;  1OHP A;  1NDO B;  4HM5 B;  1RKY A;  1SII A;  1D6U A;  2F98 A;  1FUW A;  1WQL B;  3JVC A;  1SQW A;  1DVD A;  2Q07 A;  5AIF A;  2BO9 B;  3JUM A;  4KVH A;  3CCV 3;  3FG3 A;  3FSD A;  4I4K A;  5AIH A;  2P0M A;  3DUK A;  3OWU A;  3TDG A;  4MMY B;  1UUW B;  4FMC A;  1GY6 A;  3LYG A;  2UX0 A;  1FGO A;  4WYK A;  3S28 A;  1Q7Y 4;  4U13 A;  3A76 A;  1DMN A;  1OF5 B;  3BB9 A;  3CD6 3;  3Q2P A;  1N5H A;  1EA2 A;  2QGU A;  3GZY B;  1OH0 A;  3HZP A;  4HM3 B;  3VF1 A;  4RBN A;  3CXC 2;  2BHM A;  2CG0 A;  3CCQ 3;  3GWR A;  1CYU A;  1W6Y A;  4EV5 A;  3PXM A;  3DGN A;  3EC9 A;  3F7S A;  2F99 A;  3RDE A;  1A2V A;  1AV4 A;  5AII A;  4J9A A;  3F8X A;  3G0K A;  3EJV A;  2INX A;  3ER7 A;  4BTX A;  1C7H A;  1Q82 4;  4R80 A;  1ROA A;  4X2H A;  1S5A A;  1IU7 A;  1KC8 4;  1W6G A;  2B24 B;  1Q81 4;  3LTA A;  3CCM 3;  3SOY A;  3RGA A;  3CCU 3;  2LQV A;  3KSE D;  5IG5 A;  3CCE 3;  4MMX B;  5D82 A;  3NBJ A;  3SVA A;  1EKM A;  1OGZ A;  2LYX A;  1A90 A;  5AEU B;  4FMA A;  3NQY A;  1RJO A;  3X40 A;  1HKX A;  3U97 A;  1IVU A;  3F40 A;  1QAL A;  3LT8 A;  1GY5 A;  1Q86 4;  8CHO A;  4LGQ A;  3LTB A;  2C10 A;  3HX8 A;  2KCD A;  1N9J A;  1ROV A;  3DGO A;  3FLJ A;  1RN7 A;  2GU1 A;  5AYR B;  3UL6 A;  3DZL A;  1D6Z A;  2GBW B;  4HVN A;  1S72 3;  3KKG A;  1W2B 2;  1W00 A;  4GB5 A;  3WOF B;  1JB5 A;  3NBR A;  5CLK A;  3GRD A;  3UL5 A;  3GZB A;  1GD4 A;  1M1X B;  1CEW I;  2IMJ A;  1JRQ A;  4FCJ A;  4EBG A;  1LXE A;  3PCS A;  1LNH A;  1TFK A;  5EQL A;  1NWW A;  2ZDJ A;  5DRE A;  5G2G A;  3EQQ B;  2OQE A;  1WMN A;  2M7O A;  2WGQ A;  2OTL 3;  5CF2 A;  3NUV A;  4AKZ A;  1IQY A;  1U5O A;  3CCL 3;  1JKG A;  1D6Y A;  3K63 A;  4IPB A;  1KD1 4;  4WFO A;  3CMA 3;  2YFJ B;  2WOH A;  1VQL 3;  2YX9 A;  2D42 A;  2CK3 H;  1IQ8 A;  3OX9 A;  4FR9 A;  1NO3 A;  1QAF A;  1TUH A;  1YGE A;  1VQ9 3;  2RGQ A;  1M1K 4;  3KII A;  3IPT A;  4IT7 A;  4FCZ A;  1SIH A;  2JQ5 A;  2CFK A;  1HU9 A;  2BNG A;  3X3X A;  1IVX A;  1QJG A;  2IUJ A;  1E3V A;  1FGQ A;  3KFQ C;  4OVM A;  4RNZ A;  4K90 B;  1VQK 3;  4K1U A;  4H61 A;  1YJW 3;  3IMA B;  3OWS A;  3WA3 A;  1Q40 B;  4CCV A;  2W56 A;  1IT7 A;  2FGT A;  2CFL A;  2JDI H;  2Z7A A;  2C11 A;  1YVB I;  4OK0 A;  4MMZ B;  3T0U A;  1UI7 A;  1VQM 3;  1EG9 B;  1VQ6 3;  3FKA A;  3PZW A;  2IA7 A;  3WA2 X;  1Y4K A;  3X42 A;  5IEP A;  1PU4 A;  2HML B;  3EE1 A;  4GL6 A;  5KP1 A;  4WWU C;  3UJM A;  1VQ5 3;  2GU3 A;  2GXF A;  2XEP A;  1WNH A;  3DM8 A;  1R4C A;  3J7Y d;  2Z77 A;  5HGR A;  3PGB A;  1FA3 A;  2OOV C;  3MKI A;  1N8Q A;  4KFF A;  3PYJ A;  1O7W B;  1W4N A;  1VQ4 3;  1NB5 I;  3FZW A;  2CWV A;  2HMN B;  3EBY A;  4NRE A;  1VQ7 3;  4KFE A;  3EF8 A;  3CNM A;  1YHQ 3;  1W7C A;  3LTD A;  3STD A;  1IVW A;  2IUK A;  1JN5 B;  3SOA A;  1RRL A;  2BMO B;  3NBB A;  2B1X B;  3AMO B;  1M90 4;  2W6J H;  1QVG 2;  1O7M B;  2KRT A;  3K9M C;  4HJL B;  1WTH A;  1IV7 A;  5IG4 A;  1K73 4;  2CIU A;  2MF7 A;  2P05 A;  2HMO B;  4Q53 A;  1N9E A;  1YJ9 3;  3NV0 A;  2OOV A;  4CDL A;  1QVF 2;  2CG1 A;  3K7C A;  3I55 3;  3EN1 B;  1ZX2 A;  4G1M B;  3CCR 3;  3MWZ A;  5AEW B;  2WGO A;  3OV4 A;  3WOD G;  4FMB A;  1ISK A;  1SPU A;  3VGN A;  5KP3 A;  3F14 A;  1JNQ A;  3S5C A;  3SXX A;  1US1 A;  1IV9 A;  3NM7 A;  3BLZ A;  3UB1 A;  1LVN A;  3CPW 2;  1JN5 A;  2OQE C;  2W03 A;  3JUP A;  3N8B A;  4HBR A;  2O3O A;  3LOY A;  4ORL A;  3AMO A;  5BVB A;  4FCM A;  5AYS C;  4OUQ A;  1OF5 A;  3NX0 A;  1GD3 A;  5AI1 A;  2Z76 A;  3JUQ A;  3UNL A;  3MHE A;  3X3Z A;  3G16 A;  3H3H A;  4KFD A;  3GAX A;  3CPO A;  2CFG A;  4HZ9 B;  1FGT A;  1MNL A;  4HKV B;  3T8U A;  2STD A;  2W0Q A;  4N3V A;  4XB5 A;  1L5G B;  3U1W A;  1UI8 A;  3HIG A;  3D9R A;  2SBL A;  3DY5 A;  1YJN 3;  5JPU A;  1K41 A;  4X2O A;  3DGL A;  1TP6 A;  3D3L A;  3X41 A;  1AR0 A;  3NM2 A;  2XSH B;  5I97 A;  1DYU A;  2CKF B;  1EQK A;  3WMD A;  2XR8 B;  3NXJ A;  3IJE B;  4O2H A;  1Q42 A;  2YFL B;  1W2Z A;  3N9H A;  3OXA A;  4HM1 B;  4L8O A;  1ULJ B;  2R4I A;  1M9G A;  2O9U X;  1K28 A;  2PZV A;  4N6U A;  4O3V A;  4HZB B;  2FNQ A;  3PCR A;  1OUN A;  4R9K A;  3K0Z A;  3F7X A;  4LMI A;  1JV2 B;  1JB2 A;  4HM4 B;  2XGL A;  2Y73 A;  3FF2 A;  3LH4 A;  1OGX A;  4STD A;  3MG1 A;  1YIJ 3;  2XFT A;  3QRD A;  3GZR A;  5CF1 A;  2E2T A;  4PEJ A;  1U8C B;  3CME 3;  3PS8 A;  4EXR A;  2XSO B;  2WOF A;  1ASK A;  3FG1 A;  3JUO A;  3CC7 3;  3B4O A;  1MOL A;  5IEO A;  4WHA A;  3QK9 A;  3G4S 3;  1IQX A;  3O8Y A;  4L7K A;  4MEI A;  4AEQ A;  3HI7 A;  1OPY A;  2FXT A;  4BTW A;  1E97 A;  3SX1 A;  4XBX A;  4R1K A;  2QA4 3;  5BXQ A;  3V92 A;  2OCT A;  1IK3 A;  4FMD A;  5EEO A;  3Q90 A;  4HM8 B;  4RNY A;  5TGN A;  1BUQ A;  5ELJ A;  4HM6 B;  3G71 3;  1OHS A;  2W9P A;  4XM4 A;  2HMM B;  3HII A;  2QIY A;  2HMJ B;  5KP4 A;  5A0O B;  4HM2 B;  2Y74 A;  4EV2 A;  7STD A;  5IW9 A;  2GEY A;  3K5T A;  4XBY A;  3SED A;  1FGM A;  1STF I;  1E3R A;  2CHC A;  3LML A;  4J8T A;  1K9M 4;  4JRF A;  5JBS A;  1VQN 3;  3CU3 A;  1OHO A;  3DXO A;  4R9L A;  1TFO A;  2CW9 A;  2ZL8 A;  3KZT A;  1Q40 A;  2RFR A;  4N6M A;  3CCJ 3;  1NU3 A;  2D1W A;  2KXG A;  2CH9 A;  2Z6B A;  4O02 B;  3E99 A;  1CYV A;  2ML5 A;  1GYB A;  1RRH A;  1JJ2 2;  1GS3 A;  5IG3 A;  2K0M A;  1W5Z A;  1ULI B;  2BMR B;  2QEX 3;  4K1V A;  3WDG B;  1N8R 4;  3MPH A;  1LOX A;  4LZI A;  4N6L A;  1F8N A;  1W01 A;  2P0X A;  1T5Y A;  3FF0 A;  4JF8 A;  1AVL A;  4RZM A;  5D81 A;  1A2K A;  1OAC A;  3BND A;  2P38 A;  2F86 B;  1PFP A;  1NJI 4;  3FG4 A;  3V99 A;  4N6N B;  4ZM8 A;  3OW2 2;  2RSX A;  2BMQ B;  3HK4 A;  1NB3 I;  3B4P A;  3ECF A;  1ZO2 A;  1Z1S A;  1FGR A;  1KSI A;  1TU5 A;  4N6T A;  1VZZ A;  2OWP A;  1G96 A;  1UW1 A;  2PNC A;  1UUV B;  3OWY A;  1IVV A;  3EX9 A;  3EN8 A;  4K61 A;  2A15 A;  3KSP A;  4HYZ A;  5DRV A;  2MC8 A;  3S67 A;  1AVK A;  2GBX B;  3FH1 A;  1SJW A;  1VQO 3;  3H51 A;  2E2V A;  3N54 B;  1QMA A;  4XBT A;  2XF3 A;  3DGM A;  2CWU A;  3B8L A;  1A67 A;  1KWI A;  2W9Q A;  2XRX B;  3NHX A;  3DMC A;  3Q1C A;  3M8C A;  1YIT 3;  5AIG A;  4R4K A;  1DMM A;  1JKG B;  5FW5 A;  3LXU X;  3EHC A;  1WMO A;  1TIJ A;  2ML6 A;  4XDW A;  5D83 A;  4N6O B;  1DMQ A;  5LC6 A;  4L8P A;  3F9S A;  2K54 A;  3CCS 3;  4XDV A;  5IEN A;  2XH9 A;  4QWT A;  1OCV A;  1IDP A;  1IT8 A;  4O8S A;  3ALA A;  3I0Y A;  1W02 A;  4WP5 A;  5JPP A;  2CFD A;  3MG2 A;  5CXO A;  4HM0 B;  2V1L A;  3KE7 A;  3CC2 3;  3LTC A;  3ROB A;  1O7P B;  3BNB A;  1K8A 4;  1STD A;  3EBT A;  1QAK A;  2OTJ 3;  2W56 B;  3FCS B;  2P09 A;  3LT9 A;  2L4V A;  2WO0 A;  1JB4 A;  3FGY A;  1N5P A;  2XGN A;  1O7G B;  4IIA A;  6STD A;  1WMP A;  4HM7 B;  2RCD A;  4N6V 0;  2BT3 A;  3MYT A;  4BTY A;  4LSO A;  5IG0 A;  2W04 A;  3S27 A;  3G8Z A;  3V98 A;  2W2C A;  3B7C A;  3L0R A;  2YFI B;  3BNC A;  1YI2 3;  1KQS 2;  3GZX B;  4MJD A;  5EVH A;  2CWT A;  1VQ8 3;  1O7N B;  4TX4 A;  5IF6 A;  2GEX A;  3MSO A;  4AKY A;  2HMK B;  5LC7 A;  4EYC A;  5STD A;  1CQS A;  3SLU A;  5IER A;  4LEH A;  2CC3 A;  3JUN A;  1VQP 3;  3RGR A;  3CC4 3;  1DVC A;  3X3Y A;  4WYK B;  3VSY A;  3MG3 A;  2CFW A;  2I9W A;  3S29 A;  5CK6 A;  3T8N A;  1O7H B;  2E2U A;  3WOE B;  1J2B A;  1GY7 A;  1V74 A;  4NHF A;  4KZ1 A;  5ELU A;  3BNE A;  3NQZ A;  3CNX A;  3EB8 A;  1W6C A;  3LZA A;  4EC6 A;  3F8H A;  5FGO A;  4H3U A;  3I56 3;  3KN4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...