3CCJ3

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2534u
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 13
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ccj300
3I563 2OTL3 1K734 3CCJ3 3CPW2 1YJN3 3CCU3 3CC23 2OTJ3 1Q814 1VQN3 3CXC2 1VQP3 1Q824 3CCE3 3CCS3 1YHQ3 1S723 1KC84 3CD63 3CCV3 3CC73 1YJ93 1QVG2 1K9M4 3CME3 3CCL3 1VQK3 1JJ22 1W2B2 1VQ43 1YI23 1VQ53 1VQO3 3G4S3 2QEX3 3G6E3 1VQ93 3G713 2QA43 3CCR3 1VQ73 1KD14 1N8R4 3I553 1KQS2 1VQ83 1VQL3 1VQ63 1VQM3 1K8A4 3CCQ3 1Q864 1M1K4 1M904 3CC43 1YJW3 1NJI4 1QVF2 3OW22 3CMA3 1YIJ3 1Q7Y4 3CCM3 1YIT3
chains in the Genus database with same CATH superfamily
4KT3B 3IPTA 2D1WA 1YVBI 1QMAA 3HX8A 4LEHA 4MMYB 1C54A 4HM5B 3DM8A 1BVIA 3EB8A 2HMLB 2W9PA 3K7CA 3K9MC 4JRFA 4N6MA 4ZM8A 4FMBA 3X3ZA 2WGOA 3G0KA 4L7KA 3CCE3 3CCS3 1S723 3HOHA 3RGAA 1YJ93 1NNVA 1FGOA 3EC9A 2PNCA 3BNBA 3CPOA 4LGQA 1RGCA 1ASKA 2RCDA 3SOAA 3JVCA 4R1KA 1QALA 1RGKA 1VQ93 1VZZA 1BRHA 3G8ZA 3FG3A 5IG5A 3WA2X 4XM4A 3N54B 2BMRB 4NHFA 3X3XA 4N3VA 5AYRB 2A15A 4I4KA 2WOHA 5DRVA 2R4IA 5IG4A 2XFTA 3FSDA 1KC84 2KAAA 1VQQA 1B3SA 1W01A 4K1VA 9RNTA 1TJDA 2OTJ3 3OWUA 3LT9A 3CD63 2K0MA 5JPPA 1IVVA 1GS3A 2WOFA 3WDGB 3S28A 3CME3 3F8XA 1OPYA 3PGBA 4WYKA 2IA7A 1R4YA 1UCLA 3F8HA 5CF2A 1A90A 2CWUA 2CKFB 1ISKA 4GL6A 4NPBA 4EV2A 4N6V0 1WTHA 3N9HA 2K3DA 2UUGC 3UL5A 2CH9A 1BNEA 1RSNA 2F99A 1Y4KA 1UI7A 3WA3A 4J5KA 1T2HA 1M1XB 1N9JA 1TP6A 2B1XB 3EBYA 4O8SA 2SBLA 1BSBA 2P05A 4HYZA 1Q864 3CC43 1MGWA 1OCVA 1HU9A 2KRTA 2XGNA 3PYJA 5BXQA 1W6GA 1JN5B 2C11A 1Q7Y4 6STDA 1SIHA 3JUQA 3Q2PA 5FW5A 3U97A 3D5IA 4R9LA 1QAFA 4K61A 1JBSA 3DMCA 3ROBA 5IEPA 3DH2A 1QAKA 3PCSA 3MPHA 3X3YA 2ML6A 4WHAA 1AY7A 3DGLA 1QVG2 4PEJA 3SYUA 1EUIC 4ILFA 4STDA 1GOYA 5AIGA 1BNJA 4HM1B 2H0HA 2XSHB 1BUQA 4GHOA 3MHEA 3KZTA 3WMDA 1VQM3 2OQEC 4HBRA 1EA2A 3X40A 4ORLA 1W7CA 1IT8A 1CEWI 1A2PA 1M9GA 4KVHA 1IQ8A 1RCKA 4GB5A 1YGWA 5I97A 1BRKA 2M7OA 3GWRA 4OVMA 5HGRA 3PS8A 3LXUX 1FUSA 1UCJA 4CPKA 2CFDA 3IJEB 1RGHA 2P09A 3DUKA 1RN7A 3CXC2 1Q824 4HM7B 3EN1B 1WMPA 4H3UA 3DGNA 3CCV3 3NM2A 2LYXA 1JBTA 2H0IA 3OV4A 3I0YA 2F5MA 2QEX3 1LQGC 4QWTA 4G1MB 2QA43 2Z77A 4HM4B 1N8R4 1HKXA 2SARA 4HM2B 5RNTA 1BNSA 1GOUA 1FUWA 1AVLA 1LQMB 1JN5A 8RNTA 3NXJA 5EQLA 2O9UX 1QVF2 3EX9A 1FGRA 2FNQA 4EW5A 3CMA3 4LZIA 2RFRA 1V58A 2CX0A 2BT3A 4BIRA 3K63A 1YIT3 3MKIA 2OTL3 1STDA 3OXAA 4FR9A 5CXOA 6GSPA 4BL2A 2E2VA 1J2BA 1BIRA 4CCVA 1FGTA 2AAEA 1VQN3 1U8CB 1FGMA 3WODG 5AIHA 1A2VA 1UGIA 5FGOA 8CHOA 2GU3A 2W03A 2WO0A 3UL6A 4O2HA 1A67A 1JB5A 5BIRA 5KP4A 4HAAA 4EXRA 4LSOA 3STDA 1BU4A 3LT8A 3G713 4RZMA 2OQEA 1Q9EA 4I5QA 3PXMA 4NREA 2C4BA 3BB9A 3K5TA 4FMCA 2Q07A 1M1K4 1TTOA 2C10A 3F9SA 3K0ZA 1DMQA 3KN4A 3AHWA 3O8YA 1RGLA 4J5GA 3J7Yd 5A0OB 1NJI4 1ZO2A 3D9RA 3T8NA 2ZL8A 3T8UA 1YIJ3 3MG1A 1YNVX 3H51A 4L8OA 1B2UA 1RRLA 1K734 3AMOB 1YJN3 3EE1A 3GRDA 5D83A 3UJMA 3V99A 4R9KA 1TIJA 2E2TA 2CIUA 1JJ22 4HVNA 3NBRA 1W2B2 2ZHXB 7STDA 1CH0A 4BU4A 4CDLA 1YI23 1VQO3 2RNTA 4FMDA 3DXOA 2GBWB 2YX9A 1A2KA 3AGNA 1BRJA 1OHSA 1MWRA 1HZ1A 3HK4A 2CFLA 1SJWA 2F86B 1Q40B 3JUMA 5G1KA 1T3BA 1RN4A 2STDA 4WP5A 4HM8B 2F98A 2BO9B 4MMXB 1S5AA 3LTAA 4RNZA 1G02A 1EQKA 2W2CA 3MSOA 3QRDA 1ULIB 4RBNA 3CCJ3 1RMSA 5LC6A 3GSPA 4TX4A 3D79A 3EBTA 4RNYA 3T0UA 5CLKA 2RSXA 3F40A 3DGYA 1LRAA 1LOWA 1NO3A 3DY5A 2GSPA 5HOHA 1YGEA 1VQK3 1BRNL 1K41A 1ZS7A 4HZBB 4LYLB 3OWSA 1GD3A 1GYBA 3G4S3 4HZ9B 1RLSA 2HMJB 2HOHA 1VQL3 3VF1A 1BNGA 4FCJA 3FG1A 3Q3FA 1D6UA 1M904 1K28A 1B27A 2FGTA 1R4CA 2MF7A 1UUWB 3FZWA 3AMOA 3KFQC 3H3HA 3EF8A 3LH4A 1PU4A 3CC23 2Y74A 4HJLB 3GZBA 4HM6B 2XRXB 3AGOA 1DVDA 1L5GB 1GMPA 1KWIA 1SARA 3NHXA 4X2OA 2F4YA 1B2ZA 1MWTA 3NX0A 4KFEA 3S67A 1TFOA 1Q40A 4X2HA 3GZXB 1PYLA 3BU4A 1VQ83 2I9WA 3HIGA 2XEPA 3AHSA 4AKZA 2XSOB 2BHMA 4OK0A 4BL3A 1B2SA 1AR0A 1RGAA 3NQYA 1UUVB 1BSCA 1W5ZA 5IG0A 4EYCA 2Z6BA 1JB2A 3A5EA 2CG1A 3SLUA 5IF6A 1RGGA 2Z76A 3EJVA 2L1SA 3Q1CA 4Q53A 4AKYA 3RGRA 1UUGB 2YFIB 3SVAA 1DMNA 1LOYA 1US1A 3E99A 1IK3A 2BU4A 2IYJA 3M8CA 4XDVA 5G1LA 1BSEA 3FLJA 5M1AA 4CJNA 1YHQ3 4FMAA 1K9M4 1RHLA 5KP1A 2CW9A 2KF5A 2OOVC 5CK6A 1T5YA 5M18A 1O7WB 3EN8A 1GOVA 1SPUA 3F7XA 5IEOA 1I2EA 1VQ53 1IV9A 1SQWA 2BMQB 2CC3A 2KF3A 1IT7A 3GAXA 2Y73A 3SOYA 3X42A 3WOFB 1KD14 3LTBA 3FG4A 1KQS2 3SEDA 5AIIA 2YFJB 1JNQA 3WHOA 2H0GA 3CCQ3 3KIIA 4N6TA 1W2ZA 3ECFA 1MNLA 1IV7A 2RBIA 1NWWA 5AEWB 3TDGA 3I563 3RDEA 3CNXA 3CPW2 1O7MB 2GXFA 2YFLB 1B2MA 2WGQA 1GMQA 3L0RA 5AEUB 1RGFA 5TGNA 1O7NB 2IUKA 3BLZA 1PFPA 2W0QA 4IIAA 3LOYA 4HOHA 2FXTA 3JUNA 3G16A 3OX9A 1GSPA 1W02A 1JB4A 3GZYB 2BMOB 4DKIA 3B8LA 3FF2A 1VQ73 5D81A 1I3FA 1V57A 3NBJA 2KXGA 3V98A 1DETA 1VQ63 1BUJA 1U5OA 1GY7A 3NUVA 5AIFA 3D4AA 3EHCA 2MC8A 1N8QA 3D3LA 3U1WA 4MJDA 3NV0B 1VQP3 1B2XA 3B7CA 3JUOA 3CU3A 2W56B 3GZRA 4FCZA 5ELUA 1BGSA 1BOXA 3NQZA 4IPBA 1I2FA 1O7PB 1UCIA 2HMOB 3ZG0A 1LNHA 4O02B 1Q814 1I0XA 4HM0B 2D42A 2GBXB 1I70A 3WR2A 3SXXA 2OOVA 1GY6A 2W6JH 1ROVA 3LTCA 1RCLA 3KSPA 3CCL3 1RGEA 3S5CA 5M19A 3X41A 1D6ZA 5GSPA 4EC6A 1F8NA 2P38A 2XGLA 3BNEA 5DREA 1AVKA 1X1UA 1BNIA 2K54A 1LOXA 2CFKA 1D6YA 2KCDA 1N9EA 3VSYA 1RNTA 4FCMA 5LC7A 2CWTA 1JV2B 1LOVA 4O3VA 2CHCA 2IY2A 3OW22 4N6OB 5IG3A 1E3VA 1Q7HA 1RDSA 2W9QA 1OACA 3HI7A 4XBTA 1T2IA 3BIRA 3CCM3 2R41A 1O7HB 4N6UA 4HM3B 1JKGB 2P0XA 5IW9A 5JBSA 1IDPA 1OHPA 7GSPA 1VQ43 2UX0A 4L8PA 4BTYA 1B20A 3SX1A 1CQSA 2ZDJA 4EV5A 1FA3A 2F5WA 3MYTA 1BAOA 3BNDA 2CX1A 2HMKB 3FCSB 1CYVA 3NM7A 4U13A 1FGQA 2XF3A 4HKVB 4BTXA 5EVHA 1IYYA 1O7GB 1UW1A 2KF6A 3HZPA 3LTDA 2L4VA 3WOEB 1OF5B 3NV0A 1OH0A 1E97A 3LZAA 2W56A 4LMIA 4OUQA 3ZG5A 3ZFZA 1CYUA 5KP3A 3KKGA 3S29A 4BTWA 4GSPA 1JBRA 3CCU3 4IT7A 4WFOA 2F56A 2J8XB 1DE3A 4WWUC 3CC73 1FZUA 2B24B 1JRQA 5ELJA 1Q42A 4H61A 1HYFA 1EKMA 1MOLA 2BIRA 4KFDA 1TRPA 1UI8A 3F14A 4R80A 4JF8A 1RNBA 3OWYA 4XB5A 3G6E3 3LYGA 2XH9A 1BSAA 2PZVA 2BNGA 1NDOB 2INXA 1AQZA 1IVXA 1RRHA 5BU4A 3Q90A 1FYSA 1MWUA 1IQYA 1IU7A 1K8A4 2UGIA 1Z1SA 1W00A 1TFKA 1BRGA 1UGHI 3CNMA 1JKGA 1BNRA 2XR8B 1ROAA 2IMJA 2P0MA 5IENA 7RNTA 1TUHA 1GD4A 1EG9B 2JDIH 2CFGA 1BRIA 1I8VA 2AADA 5IERA 3IMAB 4MEIA 1OHOA 4K90B 1OGXA 4XBXA 4AEQA 2JQ5A 4N6LA 3N8BA 2E2UA 1G0TA 2CWVA 2V1LA 2XFSA 3CCR3 1W4NA 2KF4A 4KZ1A 2CG0A 1NB5I 1LXEA 2Z7AA 1OF5A 1TRQA 3B4PA 3D5GA 3FH1A 4J9AA 5STDA 1DVCA 2GEYA 1JZOA 3KSED 2W04A 2GEXA 1OGZA 1RN1A 1WNHA 3HIIA 2CFWA 4XBYA 1IVUA 1STFI 1BRSA 3F7SA 3VGNA 3S27A 3MG2A 3V92A 1I3IA 1YVSA 4R4KA 3LMLA 3JUPA 1FUTA 1E3RA 3ALAA 1B21A 2LQVA 6RNTA 5G2GA 2RGQA 1ZGXA 1OUNA 2O3OA 3UNLA 3PCRA 4EBGA 5D82A 4N6NB 4K1UA 1W6CA 3FF0A 1WQLB 1W6YA 2ML5A 1PY3A 1BANA 1BSDA 1V74A 4KFFA 2IUJA 1GMRA 1LVNA 3DZLA 1AV4A 3B4OA 4MMZB 3DGOA 1I2GA 1MGRA 1BNFA 4RNTA 2HMMB 2OCTA 3QK9A 5AYSC 2ZA4A 3PZWA 1I0VA 1DYUA 1JZDA 5BVBA 1TU5A 1UCKA 1SIIA 3RNTA 1X1YA 3ER7A 3MWZA 1IQXA 3URPA 5EEOA 1NU3A 3A76A 4J8TA 1RJOA 1N5HA 2QGUA 1WMOA 5JPUA 2QIYA 1G96A 1KSIA 1EEJA 3KCHA 3KE7A 2GU1A 3FKAA 1RKYA 3NBBA 1IVWA 1MWSA 5CF1A 1RTUA 1WMNA 4WYKB 5AI1A 2CK3H 3FGYA 1QJGA 3I553 1X1WA 2OWPA 1NB3I 1FW7A 3EQQB 4XDWA 1ZX2A 3UB1A 1DMMA 1UDII 1YJW3 3BNCA 3DGMA 3MG3A 1LNIA 2HMNB 1N5PA 1C7HA 1X1XA 1GY5A 1ULJB
chains in the Genus database with same CATH topology
3IPTA 2D1WA 1YVBI 1QMAA 3HX8A 4LEHA 4MMYB 4HM5B 3DM8A 3EB8A 3K7CA 2HMLB 2W9PA 3K9MC 4JRFA 4N6MA 4ZM8A 4FMBA 3X3ZA 2WGOA 3G0KA 4L7KA 3CCE3 3CCS3 1S723 3RGAA 1YJ93 1FGOA 3EC9A 2PNCA 3BNBA 3CPOA 4LGQA 1ASKA 2RCDA 3SOAA 3JVCA 4R1KA 1QALA 1VQ93 1VZZA 3G8ZA 3FG3A 5IG5A 3WA2X 4XM4A 3N54B 2BMRB 4NHFA 3X3XA 4N3VA 5AYRB 2A15A 4I4KA 2WOHA 5DRVA 2R4IA 5IG4A 2XFTA 3FSDA 1KC84 1W01A 4K1VA 2OTJ3 3OWUA 3LT9A 3CD63 2K0MA 5JPPA 1IVVA 1GS3A 2WOFA 3WDGB 3S28A 3CME3 3F8XA 1OPYA 3PGBA 4WYKA 2IA7A 1ISKA 3F8HA 5CF2A 1A90A 2CWUA 2CKFB 4GL6A 4EV2A 4N6V0 1WTHA 3N9HA 3UL5A 2CH9A 2F99A 3WA3A 1Y4KA 1UI7A 1M1XB 1N9JA 1TP6A 2B1XB 3EBYA 4O8SA 2SBLA 4WHAA 2P05A 4HYZA 1Q864 3CC43 1OCVA 1HU9A 2KRTA 2XGNA 3PYJA 5BXQA 1W6GA 1JN5B 2C11A 1Q7Y4 6STDA 1SIHA 3JUQA 3Q2PA 5FW5A 3U97A 4R9LA 1QAFA 4K61A 3DMCA 3ROBA 5IEPA 1QAKA 3PCSA 3MPHA 3X3YA 2ML6A 3DGLA 1QVG2 4PEJA 4STDA 5AIGA 4HM1B 2XSHB 1BUQA 3MHEA 3KZTA 3WMDA 1VQM3 2OQEC 4HBRA 1EA2A 3X40A 4ORLA 1W7CA 1IT8A 1CEWI 1M9GA 4KVHA 1IQ8A 4GB5A 5I97A 2M7OA 3GWRA 4OVMA 5HGRA 3PS8A 3LXUX 2CFDA 3IJEB 2P09A 3DUKA 1RN7A 3CXC2 1Q824 4HM7B 3EN1B 1WMPA 4H3UA 3DGNA 3CCV3 3NM2A 2LYXA 3OV4A 3I0YA 2QEX3 4QWTA 4G1MB 2QA43 2Z77A 4HM4B 1N8R4 1HKXA 4HM2B 1FUWA 1AVLA 1JN5A 3NXJA 5EQLA 2O9UX 1QVF2 3EX9A 1FGRA 2FNQA 3CMA3 4LZIA 2RFRA 2BT3A 3K63A 1YIT3 3MKIA 2OTL3 1STDA 3OXAA 4FR9A 5CXOA 1J2BA 2E2VA 4CCVA 1FGTA 1VQN3 1U8CB 1FGMA 3WODG 5AIHA 1A2VA 5FGOA 8CHOA 2GU3A 2W03A 2WO0A 3UL6A 4O2HA 1A67A 1JB5A 5KP4A 4EXRA 4LSOA 3STDA 3LT8A 3G713 4RZMA 2OQEA 4NREA 3PXMA 3BB9A 3K5TA 4FMCA 2Q07A 1M1K4 2C10A 3K0ZA 3F9SA 1DMQA 3KN4A 3O8YA 3J7Yd 1NJI4 5A0OB 1ZO2A 3D9RA 3T8NA 2ZL8A 3T8UA 1YIJ3 3MG1A 3H51A 4L8OA 1RRLA 1K734 3AMOB 1YJN3 3EE1A 3GRDA 5D83A 3UJMA 3V99A 4R9KA 1TIJA 2E2TA 2CIUA 1JJ22 4HVNA 3NBRA 1W2B2 7STDA 4CDLA 1YI23 1VQO3 4FMDA 3DXOA 2GBWB 2YX9A 1A2KA 1OHSA 3HK4A 2CFLA 1SJWA 2F86B 1Q40B 3JUMA 2STDA 4WP5A 4HM8B 2F98A 2BO9B 4MMXB 1S5AA 3LTAA 4RNZA 1EQKA 2W2CA 3MSOA 3QRDA 1ULIB 4RBNA 3CCJ3 5LC6A 4TX4A 3EBTA 4RNYA 3T0UA 5CLKA 2RSXA 3F40A 3DY5A 1NO3A 1VQK3 1YGEA 1K41A 4HZBB 3OWSA 1GD3A 1GYBA 3G4S3 4HZ9B 2HMJB 1VQL3 3VF1A 4FCJA 3FG1A 1D6UA 1M904 1K28A 2FGTA 1R4CA 2MF7A 1UUWB 3FZWA 3AMOA 3KFQC 3H3HA 3EF8A 3LH4A 1PU4A 3CC23 2Y74A 4HJLB 3GZBA 4HM6B 2XRXB 1DVDA 1L5GB 1KWIA 3NHXA 4X2OA 3NX0A 4KFEA 3S67A 1TFOA 1Q40A 4X2HA 3GZXB 1VQ83 2I9WA 3HIGA 2XEPA 4AKZA 2XSOB 2BHMA 4OK0A 1AR0A 3NQYA 1UUVB 4EYCA 1W5ZA 5IG0A 2Z6BA 1JB2A 2CG1A 3SLUA 5IF6A 2Z76A 3EJVA 3Q1CA 4Q53A 4AKYA 3RGRA 2YFIB 1DMNA 3E99A 1US1A 1IK3A 3M8CA 4XDVA 3FLJA 1YHQ3 4FMAA 1K9M4 5KP1A 2CW9A 2OOVC 5CK6A 1T5YA 1O7WB 3EN8A 3F7XA 1SPUA 5IEOA 1VQ53 1IV9A 1SQWA 2BMQB 2CC3A 3GAXA 1IT7A 3SOYA 2Y73A 3X42A 1KD14 3WOFB 3LTBA 3FG4A 1KQS2 3SEDA 5AIIA 2YFJB 1JNQA 3CCQ3 3KIIA 4N6TA 1W2ZA 3ECFA 1MNLA 1IV7A 1NWWA 5AEWB 3TDGA 3I563 3RDEA 3CNXA 3CPW2 1O7MB 2GXFA 2YFLB 2WGQA 3L0RA 5AEUB 5TGNA 1O7NB 2IUKA 3BLZA 1PFPA 2W0QA 4IIAA 3LOYA 2FXTA 3JUNA 3G16A 3OX9A 1W02A 1JB4A 3GZYB 2BMOB 3B8LA 3FF2A 1VQ73 5D81A 3NBJA 2KXGA 3V98A 1VQ63 1U5OA 1GY7A 3NUVA 5AIFA 3EHCA 2MC8A 1N8QA 3D3LA 3U1WA 4MJDA 3NV0B 1VQP3 3B7CA 3JUOA 3CU3A 2W56B 3GZRA 4FCZA 5ELUA 3NQZA 3SVAA 4IPBA 1O7PB 2HMOB 1LNHA 4O02B 1Q814 4HM0B 2D42A 2GBXB 3SXXA 2OOVA 1GY6A 2W6JH 1ROVA 3LTCA 3CCL3 3KSPA 3S5CA 3X41A 1D6ZA 4EC6A 1F8NA 2P38A 2XGLA 3BNEA 5DREA 1AVKA 2K54A 1LOXA 2CFKA 1D6YA 2KCDA 1N9EA 3VSYA 4FCMA 5LC7A 2CWTA 1JV2B 4O3VA 2CHCA 3OW22 4N6OB 5IG3A 1E3VA 3HI7A 4XBTA 2W9QA 1OACA 3CCM3 1O7HB 4N6UA 4HM3B 1JKGB 2P0XA 5IW9A 5JBSA 1IDPA 1OHPA 1VQ43 2UX0A 4L8PA 4BTYA 3SX1A 1CQSA 2ZDJA 4EV5A 1FA3A 3MYTA 3BNDA 3FCSB 2HMKB 3NM7A 1CYVA 4U13A 1FGQA 2XF3A 4HKVB 4BTXA 5EVHA 1O7GB 1UW1A 3HZPA 3LTDA 2L4VA 3WOEB 1OF5B 3NV0A 1OH0A 1E97A 3LZAA 2W56A 4LMIA 4OUQA 1CYUA 5KP3A 3KKGA 3S29A 4BTWA 3CCU3 4IT7A 4WFOA 4WWUC 3CC73 2B24B 1JRQA 5ELJA 1Q42A 4H61A 1MOLA 1EKMA 4KFDA 1UI8A 3F14A 4R80A 4JF8A 3OWYA 4XB5A 3G6E3 3LYGA 2XH9A 2PZVA 2BNGA 1NDOB 2INXA 1IVXA 1RRHA 3Q90A 1K8A4 1IQYA 1IU7A 1Z1SA 1W00A 1TFKA 3CNMA 1JKGA 2XR8B 1ROAA 2IMJA 2P0MA 5IENA 1TUHA 1GD4A 1EG9B 2JDIH 2CFGA 5IERA 3IMAB 4MEIA 1OHOA 4K90B 1OGXA 4XBXA 4AEQA 2JQ5A 4N6LA 3N8BA 2E2UA 2V1LA 2CWVA 2XFSA 3CCR3 1W4NA 4KZ1A 2CG0A 1NB5I 1LXEA 2Z7AA 1OF5A 3B4PA 3FH1A 4J9AA 5STDA 1DVCA 2GEYA 3KSED 2W04A 2GEXA 1OGZA 1WNHA 3HIIA 2CFWA 4XBYA 1IVUA 1STFI 3VGNA 3F7SA 3S27A 3MG2A 3V92A 4R4KA 3LMLA 3JUPA 1E3RA 3ALAA 2LQVA 5G2GA 2RGQA 1OUNA 2O3OA 3UNLA 3PCRA 4EBGA 5D82A 4N6NB 4K1UA 1W6CA 3FF0A 1WQLB 1W6YA 2ML5A 1V74A 4KFFA 2IUJA 1LVNA 3DZLA 1AV4A 3B4OA 4MMZB 3DGOA 2HMMB 2OCTA 3QK9A 5AYSC 3PZWA 5BVBA 1DYUA 1TU5A 1SIIA 3ER7A 3MWZA 1IQXA 5EEOA 1NU3A 3A76A 4J8TA 1RJOA 1N5HA 2QGUA 1WMOA 5JPUA 2QIYA 1G96A 1KSIA 3KE7A 2GU1A 3FKAA 1RKYA 3NBBA 1IVWA 5CF1A 1WMNA 4WYKB 5AI1A 2CK3H 3FGYA 1QJGA 3I553 2OWPA 1NB3I 3EQQB 4XDWA 1ZX2A 3UB1A 1DMMA 1YJW3 3BNCA 3DGMA 3MG3A 2HMNB 1N5PA 1C7HA 1GY5A 1ULJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I56 3;  2OTL 3;  1K73 4;  3CCJ 3;  3CPW 2;  1YJN 3;  3CCU 3;  3CC2 3;  2OTJ 3;  1Q81 4;  1VQN 3;  3CXC 2;  1VQP 3;  1Q82 4;  3CCE 3;  3CCS 3;  1YHQ 3;  1S72 3;  1KC8 4;  3CD6 3;  3CCV 3;  3CC7 3;  1YJ9 3;  1QVG 2;  1K9M 4;  3CME 3;  3CCL 3;  1VQK 3;  1JJ2 2;  1W2B 2;  1VQ4 3;  1YI2 3;  1VQ5 3;  1VQO 3;  3G4S 3;  2QEX 3;  3G6E 3;  1VQ9 3;  3G71 3;  2QA4 3;  3CCR 3;  1VQ7 3;  1KD1 4;  1N8R 4;  3I55 3;  1KQS 2;  1VQ8 3;  1VQL 3;  1VQ6 3;  1VQM 3;  1K8A 4;  3CCQ 3;  1Q86 4;  1M1K 4;  1M90 4;  3CC4 3;  1YJW 3;  1NJI 4;  1QVF 2;  3OW2 2;  3CMA 3;  1YIJ 3;  1Q7Y 4;  3CCM 3;  1YIT 3; 
#chains in the Genus database with same CATH topology
 4KT3 B;  3IPT A;  2D1W A;  1YVB I;  1QMA A;  3HX8 A;  4LEH A;  4MMY B;  1C54 A;  4HM5 B;  3DM8 A;  1BVI A;  3EB8 A;  2HML B;  2W9P A;  3K7C A;  3K9M C;  4JRF A;  4N6M A;  4ZM8 A;  4FMB A;  3X3Z A;  2WGO A;  3G0K A;  4L7K A;  3CCE 3;  3CCS 3;  1S72 3;  3HOH A;  3RGA A;  1YJ9 3;  1NNV A;  1FGO A;  3EC9 A;  2PNC A;  3BNB A;  3CPO A;  4LGQ A;  1RGC A;  1ASK A;  2RCD A;  3SOA A;  3JVC A;  4R1K A;  1QAL A;  1RGK A;  1VQ9 3;  1VZZ A;  1BRH A;  3G8Z A;  3FG3 A;  5IG5 A;  3WA2 X;  4XM4 A;  3N54 B;  2BMR B;  4NHF A;  3X3X A;  4N3V A;  5AYR B;  2A15 A;  4I4K A;  2WOH A;  5DRV A;  2R4I A;  5IG4 A;  2XFT A;  3FSD A;  1KC8 4;  2KAA A;  1VQQ A;  1B3S A;  1W01 A;  4K1V A;  9RNT A;  1TJD A;  2OTJ 3;  3OWU A;  3LT9 A;  3CD6 3;  2K0M A;  5JPP A;  1IVV A;  1GS3 A;  2WOF A;  3WDG B;  3S28 A;  3CME 3;  3F8X A;  1OPY A;  3PGB A;  4WYK A;  2IA7 A;  1R4Y A;  1UCL A;  3F8H A;  5CF2 A;  1A90 A;  2CWU A;  2CKF B;  1ISK A;  4GL6 A;  4NPB A;  4EV2 A;  4N6V 0;  1WTH A;  3N9H A;  2K3D A;  2UUG C;  3UL5 A;  2CH9 A;  1BNE A;  1RSN A;  2F99 A;  1Y4K A;  1UI7 A;  3WA3 A;  4J5K A;  1T2H A;  1M1X B;  1N9J A;  1TP6 A;  2B1X B;  3EBY A;  4O8S A;  2SBL A;  1BSB A;  2P05 A;  4HYZ A;  1Q86 4;  3CC4 3;  1MGW A;  1OCV A;  1HU9 A;  2KRT A;  2XGN A;  3PYJ A;  5BXQ A;  1W6G A;  1JN5 B;  2C11 A;  1Q7Y 4;  6STD A;  1SIH A;  3JUQ A;  3Q2P A;  5FW5 A;  3U97 A;  3D5I A;  4R9L A;  1QAF A;  4K61 A;  1JBS A;  3DMC A;  3ROB A;  5IEP A;  3DH2 A;  1QAK A;  3PCS A;  3MPH A;  3X3Y A;  2ML6 A;  4WHA A;  1AY7 A;  3DGL A;  1QVG 2;  4PEJ A;  3SYU A;  1EUI C;  4ILF A;  4STD A;  1GOY A;  5AIG A;  1BNJ A;  4HM1 B;  2H0H A;  2XSH B;  1BUQ A;  4GHO A;  3MHE A;  3KZT A;  3WMD A;  1VQM 3;  2OQE C;  4HBR A;  1EA2 A;  3X40 A;  4ORL A;  1W7C A;  1IT8 A;  1CEW I;  1A2P A;  1M9G A;  4KVH A;  1IQ8 A;  1RCK A;  4GB5 A;  1YGW A;  5I97 A;  1BRK A;  2M7O A;  3GWR A;  4OVM A;  5HGR A;  3PS8 A;  3LXU X;  1FUS A;  1UCJ A;  4CPK A;  2CFD A;  3IJE B;  1RGH A;  2P09 A;  3DUK A;  1RN7 A;  3CXC 2;  1Q82 4;  4HM7 B;  3EN1 B;  1WMP A;  4H3U A;  3DGN A;  3CCV 3;  3NM2 A;  2LYX A;  1JBT A;  2H0I A;  3OV4 A;  3I0Y A;  2F5M A;  2QEX 3;  1LQG C;  4QWT A;  4G1M B;  2QA4 3;  2Z77 A;  4HM4 B;  1N8R 4;  1HKX A;  2SAR A;  4HM2 B;  5RNT A;  1BNS A;  1GOU A;  1FUW A;  1AVL A;  1LQM B;  1JN5 A;  8RNT A;  3NXJ A;  5EQL A;  2O9U X;  1QVF 2;  3EX9 A;  1FGR A;  2FNQ A;  4EW5 A;  3CMA 3;  4LZI A;  2RFR A;  1V58 A;  2CX0 A;  2BT3 A;  4BIR A;  3K63 A;  1YIT 3;  3MKI A;  2OTL 3;  1STD A;  3OXA A;  4FR9 A;  5CXO A;  6GSP A;  4BL2 A;  2E2V A;  1J2B A;  1BIR A;  4CCV A;  1FGT A;  2AAE A;  1VQN 3;  1U8C B;  1FGM A;  3WOD G;  5AIH A;  1A2V A;  1UGI A;  5FGO A;  8CHO A;  2GU3 A;  2W03 A;  2WO0 A;  3UL6 A;  4O2H A;  1A67 A;  1JB5 A;  5BIR A;  5KP4 A;  4HAA A;  4EXR A;  4LSO A;  3STD A;  1BU4 A;  3LT8 A;  3G71 3;  4RZM A;  2OQE A;  1Q9E A;  4I5Q A;  3PXM A;  4NRE A;  2C4B A;  3BB9 A;  3K5T A;  4FMC A;  2Q07 A;  1M1K 4;  1TTO A;  2C10 A;  3F9S A;  3K0Z A;  1DMQ A;  3KN4 A;  3AHW A;  3O8Y A;  1RGL A;  4J5G A;  3J7Y d;  5A0O B;  1NJI 4;  1ZO2 A;  3D9R A;  3T8N A;  2ZL8 A;  3T8U A;  1YIJ 3;  3MG1 A;  1YNV X;  3H51 A;  4L8O A;  1B2U A;  1RRL A;  1K73 4;  3AMO B;  1YJN 3;  3EE1 A;  3GRD A;  5D83 A;  3UJM A;  3V99 A;  4R9K A;  1TIJ A;  2E2T A;  2CIU A;  1JJ2 2;  4HVN A;  3NBR A;  1W2B 2;  2ZHX B;  7STD A;  1CH0 A;  4BU4 A;  4CDL A;  1YI2 3;  1VQO 3;  2RNT A;  4FMD A;  3DXO A;  2GBW B;  2YX9 A;  1A2K A;  3AGN A;  1BRJ A;  1OHS A;  1MWR A;  1HZ1 A;  3HK4 A;  2CFL A;  1SJW A;  2F86 B;  1Q40 B;  3JUM A;  5G1K A;  1T3B A;  1RN4 A;  2STD A;  4WP5 A;  4HM8 B;  2F98 A;  2BO9 B;  4MMX B;  1S5A A;  3LTA A;  4RNZ A;  1G02 A;  1EQK A;  2W2C A;  3MSO A;  3QRD A;  1ULI B;  4RBN A;  3CCJ 3;  1RMS A;  5LC6 A;  3GSP A;  4TX4 A;  3D79 A;  3EBT A;  4RNY A;  3T0U A;  5CLK A;  2RSX A;  3F40 A;  3DGY A;  1LRA A;  1LOW A;  1NO3 A;  3DY5 A;  2GSP A;  5HOH A;  1YGE A;  1VQK 3;  1BRN L;  1K41 A;  1ZS7 A;  4HZB B;  4LYL B;  3OWS A;  1GD3 A;  1GYB A;  3G4S 3;  4HZ9 B;  1RLS A;  2HMJ B;  2HOH A;  1VQL 3;  3VF1 A;  1BNG A;  4FCJ A;  3FG1 A;  3Q3F A;  1D6U A;  1M90 4;  1K28 A;  1B27 A;  2FGT A;  1R4C A;  2MF7 A;  1UUW B;  3FZW A;  3AMO A;  3KFQ C;  3H3H A;  3EF8 A;  3LH4 A;  1PU4 A;  3CC2 3;  2Y74 A;  4HJL B;  3GZB A;  4HM6 B;  2XRX B;  3AGO A;  1DVD A;  1L5G B;  1GMP A;  1KWI A;  1SAR A;  3NHX A;  4X2O A;  2F4Y A;  1B2Z A;  1MWT A;  3NX0 A;  4KFE A;  3S67 A;  1TFO A;  1Q40 A;  4X2H A;  3GZX B;  1PYL A;  3BU4 A;  1VQ8 3;  2I9W A;  3HIG A;  2XEP A;  3AHS A;  4AKZ A;  2XSO B;  2BHM A;  4OK0 A;  4BL3 A;  1B2S A;  1AR0 A;  1RGA A;  3NQY A;  1UUV B;  1BSC A;  1W5Z A;  5IG0 A;  4EYC A;  2Z6B A;  1JB2 A;  3A5E A;  2CG1 A;  3SLU A;  5IF6 A;  1RGG A;  2Z76 A;  3EJV A;  2L1S A;  3Q1C A;  4Q53 A;  4AKY A;  3RGR A;  1UUG B;  2YFI B;  3SVA A;  1DMN A;  1LOY A;  1US1 A;  3E99 A;  1IK3 A;  2BU4 A;  2IYJ A;  3M8C A;  4XDV A;  5G1L A;  1BSE A;  3FLJ A;  5M1A A;  4CJN A;  1YHQ 3;  4FMA A;  1K9M 4;  1RHL A;  5KP1 A;  2CW9 A;  2KF5 A;  2OOV C;  5CK6 A;  1T5Y A;  5M18 A;  1O7W B;  3EN8 A;  1GOV A;  1SPU A;  3F7X A;  5IEO A;  1I2E A;  1VQ5 3;  1IV9 A;  1SQW A;  2BMQ B;  2CC3 A;  2KF3 A;  1IT7 A;  3GAX A;  2Y73 A;  3SOY A;  3X42 A;  3WOF B;  1KD1 4;  3LTB A;  3FG4 A;  1KQS 2;  3SED A;  5AII A;  2YFJ B;  1JNQ A;  3WHO A;  2H0G A;  3CCQ 3;  3KII A;  4N6T A;  1W2Z A;  3ECF A;  1MNL A;  1IV7 A;  2RBI A;  1NWW A;  5AEW B;  3TDG A;  3I56 3;  3RDE A;  3CNX A;  3CPW 2;  1O7M B;  2GXF A;  2YFL B;  1B2M A;  2WGQ A;  1GMQ A;  3L0R A;  5AEU B;  1RGF A;  5TGN A;  1O7N B;  2IUK A;  3BLZ A;  1PFP A;  2W0Q A;  4IIA A;  3LOY A;  4HOH A;  2FXT A;  3JUN A;  3G16 A;  3OX9 A;  1GSP A;  1W02 A;  1JB4 A;  3GZY B;  2BMO B;  4DKI A;  3B8L A;  3FF2 A;  1VQ7 3;  5D81 A;  1I3F A;  1V57 A;  3NBJ A;  2KXG A;  3V98 A;  1DET A;  1VQ6 3;  1BUJ A;  1U5O A;  1GY7 A;  3NUV A;  5AIF A;  3D4A A;  3EHC A;  2MC8 A;  1N8Q A;  3D3L A;  3U1W A;  4MJD A;  3NV0 B;  1VQP 3;  1B2X A;  3B7C A;  3JUO A;  3CU3 A;  2W56 B;  3GZR A;  4FCZ A;  5ELU A;  1BGS A;  1BOX A;  3NQZ A;  4IPB A;  1I2F A;  1O7P B;  1UCI A;  2HMO B;  3ZG0 A;  1LNH A;  4O02 B;  1Q81 4;  1I0X A;  4HM0 B;  2D42 A;  2GBX B;  1I70 A;  3WR2 A;  3SXX A;  2OOV A;  1GY6 A;  2W6J H;  1ROV A;  3LTC A;  1RCL A;  3KSP A;  3CCL 3;  1RGE A;  3S5C A;  5M19 A;  3X41 A;  1D6Z A;  5GSP A;  4EC6 A;  1F8N A;  2P38 A;  2XGL A;  3BNE A;  5DRE A;  1AVK A;  1X1U A;  1BNI A;  2K54 A;  1LOX A;  2CFK A;  1D6Y A;  2KCD A;  1N9E A;  3VSY A;  1RNT A;  4FCM A;  5LC7 A;  2CWT A;  1JV2 B;  1LOV A;  4O3V A;  2CHC A;  2IY2 A;  3OW2 2;  4N6O B;  5IG3 A;  1E3V A;  1Q7H A;  1RDS A;  2W9Q A;  1OAC A;  3HI7 A;  4XBT A;  1T2I A;  3BIR A;  3CCM 3;  2R41 A;  1O7H B;  4N6U A;  4HM3 B;  1JKG B;  2P0X A;  5IW9 A;  5JBS A;  1IDP A;  1OHP A;  7GSP A;  1VQ4 3;  2UX0 A;  4L8P A;  4BTY A;  1B20 A;  3SX1 A;  1CQS A;  2ZDJ A;  4EV5 A;  1FA3 A;  2F5W A;  3MYT A;  1BAO A;  3BND A;  2CX1 A;  2HMK B;  3FCS B;  1CYV A;  3NM7 A;  4U13 A;  1FGQ A;  2XF3 A;  4HKV B;  4BTX A;  5EVH A;  1IYY A;  1O7G B;  1UW1 A;  2KF6 A;  3HZP A;  3LTD A;  2L4V A;  3WOE B;  1OF5 B;  3NV0 A;  1OH0 A;  1E97 A;  3LZA A;  2W56 A;  4LMI A;  4OUQ A;  3ZG5 A;  3ZFZ A;  1CYU A;  5KP3 A;  3KKG A;  3S29 A;  4BTW A;  4GSP A;  1JBR A;  3CCU 3;  4IT7 A;  4WFO A;  2F56 A;  2J8X B;  1DE3 A;  4WWU C;  3CC7 3;  1FZU A;  2B24 B;  1JRQ A;  5ELJ A;  1Q42 A;  4H61 A;  1HYF A;  1EKM A;  1MOL A;  2BIR A;  4KFD A;  1TRP A;  1UI8 A;  3F14 A;  4R80 A;  4JF8 A;  1RNB A;  3OWY A;  4XB5 A;  3G6E 3;  3LYG A;  2XH9 A;  1BSA A;  2PZV A;  2BNG A;  1NDO B;  2INX A;  1AQZ A;  1IVX A;  1RRH A;  5BU4 A;  3Q90 A;  1FYS A;  1MWU A;  1IQY A;  1IU7 A;  1K8A 4;  2UGI A;  1Z1S A;  1W00 A;  1TFK A;  1BRG A;  1UGH I;  3CNM A;  1JKG A;  1BNR A;  2XR8 B;  1ROA A;  2IMJ A;  2P0M A;  5IEN A;  7RNT A;  1TUH A;  1GD4 A;  1EG9 B;  2JDI H;  2CFG A;  1BRI A;  1I8V A;  2AAD A;  5IER A;  3IMA B;  4MEI A;  1OHO A;  4K90 B;  1OGX A;  4XBX A;  4AEQ A;  2JQ5 A;  4N6L A;  3N8B A;  2E2U A;  1G0T A;  2CWV A;  2V1L A;  2XFS A;  3CCR 3;  1W4N A;  2KF4 A;  4KZ1 A;  2CG0 A;  1NB5 I;  1LXE A;  2Z7A A;  1OF5 A;  1TRQ A;  3B4P A;  3D5G A;  3FH1 A;  4J9A A;  5STD A;  1DVC A;  2GEY A;  1JZO A;  3KSE D;  2W04 A;  2GEX A;  1OGZ A;  1RN1 A;  1WNH A;  3HII A;  2CFW A;  4XBY A;  1IVU A;  1STF I;  1BRS A;  3F7S A;  3VGN A;  3S27 A;  3MG2 A;  3V92 A;  1I3I A;  1YVS A;  4R4K A;  3LML A;  3JUP A;  1FUT A;  1E3R A;  3ALA A;  1B21 A;  2LQV A;  6RNT A;  5G2G A;  2RGQ A;  1ZGX A;  1OUN A;  2O3O A;  3UNL A;  3PCR A;  4EBG A;  5D82 A;  4N6N B;  4K1U A;  1W6C A;  3FF0 A;  1WQL B;  1W6Y A;  2ML5 A;  1PY3 A;  1BAN A;  1BSD A;  1V74 A;  4KFF A;  2IUJ A;  1GMR A;  1LVN A;  3DZL A;  1AV4 A;  3B4O A;  4MMZ B;  3DGO A;  1I2G A;  1MGR A;  1BNF A;  4RNT A;  2HMM B;  2OCT A;  3QK9 A;  5AYS C;  2ZA4 A;  3PZW A;  1I0V A;  1DYU A;  1JZD A;  5BVB A;  1TU5 A;  1UCK A;  1SII A;  3RNT A;  1X1Y A;  3ER7 A;  3MWZ A;  1IQX A;  3URP A;  5EEO A;  1NU3 A;  3A76 A;  4J8T A;  1RJO A;  1N5H A;  2QGU A;  1WMO A;  5JPU A;  2QIY A;  1G96 A;  1KSI A;  1EEJ A;  3KCH A;  3KE7 A;  2GU1 A;  3FKA A;  1RKY A;  3NBB A;  1IVW A;  1MWS A;  5CF1 A;  1RTU A;  1WMN A;  4WYK B;  5AI1 A;  2CK3 H;  3FGY A;  1QJG A;  3I55 3;  1X1W A;  2OWP A;  1NB3 I;  1FW7 A;  3EQQ B;  4XDW A;  1ZX2 A;  3UB1 A;  1DMM A;  1UDI I;  1YJW 3;  3BNC A;  3DGM A;  3MG3 A;  1LNI A;  2HMN B;  1N5P A;  1C7H A;  1X1X A;  1GY5 A;  1ULJ B; 
#chains in the Genus database with same CATH homology
 3IPT A;  2D1W A;  1YVB I;  1QMA A;  3HX8 A;  4LEH A;  4MMY B;  4HM5 B;  3DM8 A;  3EB8 A;  3K7C A;  2HML B;  2W9P A;  3K9M C;  4JRF A;  4N6M A;  4ZM8 A;  4FMB A;  3X3Z A;  2WGO A;  3G0K A;  4L7K A;  3CCE 3;  3CCS 3;  1S72 3;  3RGA A;  1YJ9 3;  1FGO A;  3EC9 A;  2PNC A;  3BNB A;  3CPO A;  4LGQ A;  1ASK A;  2RCD A;  3SOA A;  3JVC A;  4R1K A;  1QAL A;  1VQ9 3;  1VZZ A;  3G8Z A;  3FG3 A;  5IG5 A;  3WA2 X;  4XM4 A;  3N54 B;  2BMR B;  4NHF A;  3X3X A;  4N3V A;  5AYR B;  2A15 A;  4I4K A;  2WOH A;  5DRV A;  2R4I A;  5IG4 A;  2XFT A;  3FSD A;  1KC8 4;  1W01 A;  4K1V A;  2OTJ 3;  3OWU A;  3LT9 A;  3CD6 3;  2K0M A;  5JPP A;  1IVV A;  1GS3 A;  2WOF A;  3WDG B;  3S28 A;  3CME 3;  3F8X A;  1OPY A;  3PGB A;  4WYK A;  2IA7 A;  1ISK A;  3F8H A;  5CF2 A;  1A90 A;  2CWU A;  2CKF B;  4GL6 A;  4EV2 A;  4N6V 0;  1WTH A;  3N9H A;  3UL5 A;  2CH9 A;  2F99 A;  3WA3 A;  1Y4K A;  1UI7 A;  1M1X B;  1N9J A;  1TP6 A;  2B1X B;  3EBY A;  4O8S A;  2SBL A;  4WHA A;  2P05 A;  4HYZ A;  1Q86 4;  3CC4 3;  1OCV A;  1HU9 A;  2KRT A;  2XGN A;  3PYJ A;  5BXQ A;  1W6G A;  1JN5 B;  2C11 A;  1Q7Y 4;  6STD A;  1SIH A;  3JUQ A;  3Q2P A;  5FW5 A;  3U97 A;  4R9L A;  1QAF A;  4K61 A;  3DMC A;  3ROB A;  5IEP A;  1QAK A;  3PCS A;  3MPH A;  3X3Y A;  2ML6 A;  3DGL A;  1QVG 2;  4PEJ A;  4STD A;  5AIG A;  4HM1 B;  2XSH B;  1BUQ A;  3MHE A;  3KZT A;  3WMD A;  1VQM 3;  2OQE C;  4HBR A;  1EA2 A;  3X40 A;  4ORL A;  1W7C A;  1IT8 A;  1CEW I;  1M9G A;  4KVH A;  1IQ8 A;  4GB5 A;  5I97 A;  2M7O A;  3GWR A;  4OVM A;  5HGR A;  3PS8 A;  3LXU X;  2CFD A;  3IJE B;  2P09 A;  3DUK A;  1RN7 A;  3CXC 2;  1Q82 4;  4HM7 B;  3EN1 B;  1WMP A;  4H3U A;  3DGN A;  3CCV 3;  3NM2 A;  2LYX A;  3OV4 A;  3I0Y A;  2QEX 3;  4QWT A;  4G1M B;  2QA4 3;  2Z77 A;  4HM4 B;  1N8R 4;  1HKX A;  4HM2 B;  1FUW A;  1AVL A;  1JN5 A;  3NXJ A;  5EQL A;  2O9U X;  1QVF 2;  3EX9 A;  1FGR A;  2FNQ A;  3CMA 3;  4LZI A;  2RFR A;  2BT3 A;  3K63 A;  1YIT 3;  3MKI A;  2OTL 3;  1STD A;  3OXA A;  4FR9 A;  5CXO A;  1J2B A;  2E2V A;  4CCV A;  1FGT A;  1VQN 3;  1U8C B;  1FGM A;  3WOD G;  5AIH A;  1A2V A;  5FGO A;  8CHO A;  2GU3 A;  2W03 A;  2WO0 A;  3UL6 A;  4O2H A;  1A67 A;  1JB5 A;  5KP4 A;  4EXR A;  4LSO A;  3STD A;  3LT8 A;  3G71 3;  4RZM A;  2OQE A;  4NRE A;  3PXM A;  3BB9 A;  3K5T A;  4FMC A;  2Q07 A;  1M1K 4;  2C10 A;  3K0Z A;  3F9S A;  1DMQ A;  3KN4 A;  3O8Y A;  3J7Y d;  1NJI 4;  5A0O B;  1ZO2 A;  3D9R A;  3T8N A;  2ZL8 A;  3T8U A;  1YIJ 3;  3MG1 A;  3H51 A;  4L8O A;  1RRL A;  1K73 4;  3AMO B;  1YJN 3;  3EE1 A;  3GRD A;  5D83 A;  3UJM A;  3V99 A;  4R9K A;  1TIJ A;  2E2T A;  2CIU A;  1JJ2 2;  4HVN A;  3NBR A;  1W2B 2;  7STD A;  4CDL A;  1YI2 3;  1VQO 3;  4FMD A;  3DXO A;  2GBW B;  2YX9 A;  1A2K A;  1OHS A;  3HK4 A;  2CFL A;  1SJW A;  2F86 B;  1Q40 B;  3JUM A;  2STD A;  4WP5 A;  4HM8 B;  2F98 A;  2BO9 B;  4MMX B;  1S5A A;  3LTA A;  4RNZ A;  1EQK A;  2W2C A;  3MSO A;  3QRD A;  1ULI B;  4RBN A;  3CCJ 3;  5LC6 A;  4TX4 A;  3EBT A;  4RNY A;  3T0U A;  5CLK A;  2RSX A;  3F40 A;  3DY5 A;  1NO3 A;  1VQK 3;  1YGE A;  1K41 A;  4HZB B;  3OWS A;  1GD3 A;  1GYB A;  3G4S 3;  4HZ9 B;  2HMJ B;  1VQL 3;  3VF1 A;  4FCJ A;  3FG1 A;  1D6U A;  1M90 4;  1K28 A;  2FGT A;  1R4C A;  2MF7 A;  1UUW B;  3FZW A;  3AMO A;  3KFQ C;  3H3H A;  3EF8 A;  3LH4 A;  1PU4 A;  3CC2 3;  2Y74 A;  4HJL B;  3GZB A;  4HM6 B;  2XRX B;  1DVD A;  1L5G B;  1KWI A;  3NHX A;  4X2O A;  3NX0 A;  4KFE A;  3S67 A;  1TFO A;  1Q40 A;  4X2H A;  3GZX B;  1VQ8 3;  2I9W A;  3HIG A;  2XEP A;  4AKZ A;  2XSO B;  2BHM A;  4OK0 A;  1AR0 A;  3NQY A;  1UUV B;  4EYC A;  1W5Z A;  5IG0 A;  2Z6B A;  1JB2 A;  2CG1 A;  3SLU A;  5IF6 A;  2Z76 A;  3EJV A;  3Q1C A;  4Q53 A;  4AKY A;  3RGR A;  2YFI B;  1DMN A;  3E99 A;  1US1 A;  1IK3 A;  3M8C A;  4XDV A;  3FLJ A;  1YHQ 3;  4FMA A;  1K9M 4;  5KP1 A;  2CW9 A;  2OOV C;  5CK6 A;  1T5Y A;  1O7W B;  3EN8 A;  3F7X A;  1SPU A;  5IEO A;  1VQ5 3;  1IV9 A;  1SQW A;  2BMQ B;  2CC3 A;  3GAX A;  1IT7 A;  3SOY A;  2Y73 A;  3X42 A;  1KD1 4;  3WOF B;  3LTB A;  3FG4 A;  1KQS 2;  3SED A;  5AII A;  2YFJ B;  1JNQ A;  3CCQ 3;  3KII A;  4N6T A;  1W2Z A;  3ECF A;  1MNL A;  1IV7 A;  1NWW A;  5AEW B;  3TDG A;  3I56 3;  3RDE A;  3CNX A;  3CPW 2;  1O7M B;  2GXF A;  2YFL B;  2WGQ A;  3L0R A;  5AEU B;  5TGN A;  1O7N B;  2IUK A;  3BLZ A;  1PFP A;  2W0Q A;  4IIA A;  3LOY A;  2FXT A;  3JUN A;  3G16 A;  3OX9 A;  1W02 A;  1JB4 A;  3GZY B;  2BMO B;  3B8L A;  3FF2 A;  1VQ7 3;  5D81 A;  3NBJ A;  2KXG A;  3V98 A;  1VQ6 3;  1U5O A;  1GY7 A;  3NUV A;  5AIF A;  3EHC A;  2MC8 A;  1N8Q A;  3D3L A;  3U1W A;  4MJD A;  3NV0 B;  1VQP 3;  3B7C A;  3JUO A;  3CU3 A;  2W56 B;  3GZR A;  4FCZ A;  5ELU A;  3NQZ A;  3SVA A;  4IPB A;  1O7P B;  2HMO B;  1LNH A;  4O02 B;  1Q81 4;  4HM0 B;  2D42 A;  2GBX B;  3SXX A;  2OOV A;  1GY6 A;  2W6J H;  1ROV A;  3LTC A;  3CCL 3;  3KSP A;  3S5C A;  3X41 A;  1D6Z A;  4EC6 A;  1F8N A;  2P38 A;  2XGL A;  3BNE A;  5DRE A;  1AVK A;  2K54 A;  1LOX A;  2CFK A;  1D6Y A;  2KCD A;  1N9E A;  3VSY A;  4FCM A;  5LC7 A;  2CWT A;  1JV2 B;  4O3V A;  2CHC A;  3OW2 2;  4N6O B;  5IG3 A;  1E3V A;  3HI7 A;  4XBT A;  2W9Q A;  1OAC A;  3CCM 3;  1O7H B;  4N6U A;  4HM3 B;  1JKG B;  2P0X A;  5IW9 A;  5JBS A;  1IDP A;  1OHP A;  1VQ4 3;  2UX0 A;  4L8P A;  4BTY A;  3SX1 A;  1CQS A;  2ZDJ A;  4EV5 A;  1FA3 A;  3MYT A;  3BND A;  3FCS B;  2HMK B;  3NM7 A;  1CYV A;  4U13 A;  1FGQ A;  2XF3 A;  4HKV B;  4BTX A;  5EVH A;  1O7G B;  1UW1 A;  3HZP A;  3LTD A;  2L4V A;  3WOE B;  1OF5 B;  3NV0 A;  1OH0 A;  1E97 A;  3LZA A;  2W56 A;  4LMI A;  4OUQ A;  1CYU A;  5KP3 A;  3KKG A;  3S29 A;  4BTW A;  3CCU 3;  4IT7 A;  4WFO A;  4WWU C;  3CC7 3;  2B24 B;  1JRQ A;  5ELJ A;  1Q42 A;  4H61 A;  1MOL A;  1EKM A;  4KFD A;  1UI8 A;  3F14 A;  4R80 A;  4JF8 A;  3OWY A;  4XB5 A;  3G6E 3;  3LYG A;  2XH9 A;  2PZV A;  2BNG A;  1NDO B;  2INX A;  1IVX A;  1RRH A;  3Q90 A;  1K8A 4;  1IQY A;  1IU7 A;  1Z1S A;  1W00 A;  1TFK A;  3CNM A;  1JKG A;  2XR8 B;  1ROA A;  2IMJ A;  2P0M A;  5IEN A;  1TUH A;  1GD4 A;  1EG9 B;  2JDI H;  2CFG A;  5IER A;  3IMA B;  4MEI A;  1OHO A;  4K90 B;  1OGX A;  4XBX A;  4AEQ A;  2JQ5 A;  4N6L A;  3N8B A;  2E2U A;  2V1L A;  2CWV A;  2XFS A;  3CCR 3;  1W4N A;  4KZ1 A;  2CG0 A;  1NB5 I;  1LXE A;  2Z7A A;  1OF5 A;  3B4P A;  3FH1 A;  4J9A A;  5STD A;  1DVC A;  2GEY A;  3KSE D;  2W04 A;  2GEX A;  1OGZ A;  1WNH A;  3HII A;  2CFW A;  4XBY A;  1IVU A;  1STF I;  3VGN A;  3F7S A;  3S27 A;  3MG2 A;  3V92 A;  4R4K A;  3LML A;  3JUP A;  1E3R A;  3ALA A;  2LQV A;  5G2G A;  2RGQ A;  1OUN A;  2O3O A;  3UNL A;  3PCR A;  4EBG A;  5D82 A;  4N6N B;  4K1U A;  1W6C A;  3FF0 A;  1WQL B;  1W6Y A;  2ML5 A;  1V74 A;  4KFF A;  2IUJ A;  1LVN A;  3DZL A;  1AV4 A;  3B4O A;  4MMZ B;  3DGO A;  2HMM B;  2OCT A;  3QK9 A;  5AYS C;  3PZW A;  5BVB A;  1DYU A;  1TU5 A;  1SII A;  3ER7 A;  3MWZ A;  1IQX A;  5EEO A;  1NU3 A;  3A76 A;  4J8T A;  1RJO A;  1N5H A;  2QGU A;  1WMO A;  5JPU A;  2QIY A;  1G96 A;  1KSI A;  3KE7 A;  2GU1 A;  3FKA A;  1RKY A;  3NBB A;  1IVW A;  5CF1 A;  1WMN A;  4WYK B;  5AI1 A;  2CK3 H;  3FGY A;  1QJG A;  3I55 3;  2OWP A;  1NB3 I;  3EQQ B;  4XDW A;  1ZX2 A;  3UB1 A;  1DMM A;  1YJW 3;  3BNC A;  3DGM A;  3MG3 A;  2HMN B;  1N5P A;  1C7H A;  1GY5 A;  1ULJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...