2UX0A

Structure of the oligomerisation domain of calcium-calmodulin dependent protein kinase ii gamma
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
137
structure length
137
Chain Sequence
SMTEDEDLKVRKQEIIKITEQLIEAINNGDFEAYTKICDPGLTSFEPEALGNLVEGMDFHKFYFENLLSKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWLNVHYHCSGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords CALCIUM-CALMODULIN DEPENDENT PROTEIN KINASE (CAM KINASE) II
publication title Structure of the Camkiidelta/Calmodulin Complex Reveals the Molecular Mechanism of Camkii Kinase Activation.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 137
sequence length 137
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.11.17: Calcium/calmodulin-dependent protein kinase.
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08332 CaMKII_AD Calcium/calmodulin dependent protein kinase II association domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2ux0A00
1GY7A 2IMJA 4HJLB 1NWWA 2RFRA 2STDA 1OF5B 3GZXB 1S5AA 1E97A 3LYGA 3ER7A 1GY5A 2HMJB 1O7PB 5BXQA 4HM1B 1JKGA 3STDA 3S5CA 3FH1A 3G0KA 3KZTA 1OUNA 5D83A 3B4PA 3EF8A 3ROBA 1OCVA 2F98A 4XM4A 1ULIB 2GBWB 3GWRA 3RGAA 5AIFA 5IG3A 1Q40A 5IF6A 2HMMB 7STDA 1NU3A 2B24B 1WQLB 1E3VA 3JUQA 4XDWA 3LZAA 4HKVB 1HKXA 3NV0A 2CKFB 3EBYA 5AEWB 1W00A 4L8OA 5KP3A 3EN8A 3MKIA 4I4KA 3Q90A 5AIGA 1OHSA 4WYKB 1W02A 3GRDA 3MG1A 3CU3A 1C7HA 3F7XA 2INXA 4PEJA 4L7KA 2XR8B 3EQQB 4LGQA 1JKGB 1SJWA 5JPUA 2K54A 2HMNB 3G8ZA 5AIHA 5IG5A 4OUQA 2I9WA 3OX9A 3NXJA 3SEDA 1DMMA 1Q40B 4LEHA 4XB5A 4HZBB 1O7WB 2YFLB 1JB4A 3MG2A 4Q53A 1TUHA 3MSOA 4IIAA 3SOAA 5TGNA 4U13A 4XBXA 1OGXA 4R1KA 2GEXA 3NV0B 4N3VA 5CLKA 3FKAA 3DXOA 3FF2A 4WYKA 2XSHB 5IENA 6STDA 3JUOA 1O7GB 1K41A 3DUKA 5KP1A 5AIIA 4K1UA 1JB5A 1BUQA 1Q42A 2Z77A 2BMQB 3EHCA 2HMLB 4FCMA 4J9AA 3JUMA 1O7NB 3GZRA 1QMAA 3SOYA 1DMQA 4R9KA 1O7MB 1NDOB 1IDPA 1OHPA 4HM6B 8CHOA 3MG3A 1E3RA 4LMIA 3HX8A 4RZMA 5EVHA 2CHCA 3CNMA 1AR0A 3FSDA 4MJDA 5IG4A 5IG0A 2OWPA 5IEOA 4OVMA 5D82A 3A76A 5JPPA 5AI1A 1GY6A 1Z1SA 3T8NA 3KKGA 5AEUB 3VGNA 3F14A 4J8TA 1ULJB 4KVHA 3EC9A 2QIYA 3GZYB 2A15A 3K0ZA 4STDA 5D81A 3UNLA 3F9SA 3OWSA 3RGRA 4R9LA 2HMKB 3NBRA 3OV4A 3HZPA 2GBXB 4GB5A 1UUWB 3MHEA 2W2CA 4H3UA 1OPYA 3B8LA 5IEPA 3FGYA 3F8HA 4HM3B 3CNXA 1QJGA 4X2HA 1W6YA 3E99A 1JN5B 3IPTA 4X2OA 3OWYA 3NUVA 2RCDA 2R4IA 3EN1B 3EX9A 2F86B 3VSYA 3D9RA 4CDLA 4HM5B 1JB2A 4XBTA 4HM7B 2B1XB 3OXAA 1UUVB 3DMCA 4K1VA 4WP5A 4FCJA 2BNGA 3DZLA 3KSPA 1ZX2A 3ECFA 3M8CA 3EBTA 1ZO2A 1ISKA 2JQ5A 3GZBA 3JUPA 3F8XA 5IERA 4WWUC 5CK6A 3G16A 3B4OA 3H51A 2GXFA 4HM4B 3WMDA 3BB9A 3F40A 1W01A 3K7CA 3MYTA 1JN5A 2YFJB 1OHOA 2YFIB 1GYBA 5G2GA 1EG9B 4XBYA 4HZ9B 5CF2A 2F99A 2PZVA 2XSOB 5HGRA 3T8UA 1EA2A 4HM8B 3FZWA 1U5OA 5KP4A 3CPOA 3H3HA 5CXOA 3B7CA 1O7HB 1CQSA 1VZZA 4XDVA 1STDA 4HM0B 1OF5A 2RGQA 1ASKA 3KE7A 3UJMA 3DM8A 2BMOB 2Z76A 3NHXA 4HVNA 4ORLA 1OH0A 2HMOB 2Z7AA 2BMRB 5CF1A 4HM2B 3BLZA 4L8PA 3OWUA 5DRVA 3HK4A 5BVBA 3I0YA 2UX0A 1DMNA 5DREA 2QGUA 2GEYA 3FLJA 5FW5A 3JUNA 3NM2A 2XRXB 3EJVA 3F7SA 5STDA 1A2KA 1GS3A 1OGZA 3FF0A 1TP6A
chains in the Genus database with same CATH superfamily
1GY7A 1BSDA 2K0MA 2OQEC 2IY2A 2CW9A 2ZDJA 5RNTA 1KC84 1Q864 2R41A 2IMJA 4HJLB 4QWTA 1NWWA 2RFRA 1BRSA 1UGIA 1MWSA 2STDA 1OF5B 3GZXB 1GOVA 1S5AA 1E97A 3LYGA 1CEWI 3KIIA 2E2VA 1RGAA 1GY5A 2CWTA 3ER7A 3WA3A 1T5YA 1LRAA 1YJ93 2Z6BA 4WFOA 2HMJB 1G02A 1O7PB 5A0OB 5BXQA 4HM1B 1IU7A 1LQGC 3V99A 1STFI 1BNGA 1JKGA 1MGRA 2Q07A 3NBBA 3STDA 3S5CA 3CC73 1JZDA 3CCJ3 3FH1A 4TX4A 1FGRA 1B3SA 2BO9B 2W56A 3G0KA 3KZTA 3Q2PA 3RNTA 1OUNA 5D83A 4FMCA 4RNZA 1VQO3 2PNCA 4N6LA 1V57A 3B4PA 3HOHA 3FG4A 2CWVA 1DE3A 1EKMA 2H0HA 3EF8A 4LZIA 3LH4A 3K9MC 6GSPA 3CC43 3X40A 3ROBA 2OCTA 3Q1CA 1OCVA 2F98A 2OOVA 2ZHXB 2XGNA 4XM4A 4BTXA 1LOVA 1ULIB 2GBWB 3LTBA 3GWRA 4RNYA 3RGAA 1TRPA 5AIFA 2BT3A 5IG3A 4RBNA 1AVLA 1KWIA 1Q40A 3WODG 5IF6A 1LNHA 2HMMB 7STDA 1NU3A 1MNLA 2C11A 3PXMA 1QALA 3DY5A 3DH2A 2B24B 1WQLB 1YIT3 1E3VA 1M1XB 2Y73A 3JUQA 1IT8A 1RMSA 5JBSA 4XDWA 1KD14 2C4BA 1EEJA 4NREA 1GD3A 5ELJA 1RGLA 1GSPA 3LZAA 1LNIA 1NJI4 4HKVB 1ZS7A 1HKXA 1BSBA 1Q7HA 2CKFB 3EBYA 3NV0A 3SLUA 5AEWB 1W00A 4L8OA 5KP3A 5FGOA 1K8A4 3EN8A 3MKIA 7GSPA 4I4KA 2OOVC 1RLSA 3LTAA 3Q90A 5AIGA 3D4AA 1W2B2 4ILFA 1OHSA 1DETA 5AYSC 4KT3B 3ZFZA 5HOHA 2CK3H 4WYKB 1W02A 3T0UA 3GRDA 2CH9A 4HOHA 3MG1A 3CU3A 1C7HA 1GMRA 2INXA 2M7OA 3F7XA 1UCJA 4PEJA 4L7KA 2XR8B 3EQQB 4H61A 5ELUA 1VQQA 4LGQA 1X1WA 5BIRA 2WOHA 1HYFA 1B2UA 1JKGB 2P0XA 1X1XA 2E2UA 1CYUA 2ML6A 1SJWA 3I563 2WGOA 5JPUA 2W56B 2K54A 1I3IA 1BRHA 1RGFA 2HMNB 3G8ZA 5AYRB 3KCHA 5AIHA 2XH9A 6RNTA 1LQMB 1MGWA 2BIRA 1JBSA 1A90A 4FMDA 3TDGA 1TU5A 2KF4A 1WMPA 2XFTA 1BSEA 3FCSB 5IG5A 4OUQA 2I9WA 1N8QA 1YNVX 3OX9A 1UCIA 1ROAA 4O3VA 3MPHA 3NXJA 2IA7A 1RNTA 2F5MA 3PYJA 3V98A 3SEDA 1HZ1A 1V58A 3X41A 1SIIA 1GMPA 1DMMA 1Q40B 1MWTA 4IPBA 2MC8A 3X3ZA 1LXEA 4LEHA 4XB5A 4BTWA 4AKZA 1UCLA 2SARA 4HZBB 3FG3A 2HOHA 2FXTA 1I0XA 1O7WB 1R4YA 1I70A 1W2ZA 2K3DA 3JVCA 1TFKA 3UB1A 3CME3 2YFLB 1JB4A 1BUJA 3MG2A 3LOYA 4BIRA 4Q53A 1EQKA 1TUHA 3MSOA 4IIAA 3SOAA 5TGNA 1RNBA 4U13A 4XBXA 5G1LA 1FGOA 1LOXA 1AQZA 3AMOA 1OGXA 2P0MA 1RHLA 4N6OB 4R1KA 3S29A 2LYXA 2GEXA 3NV0B 4FR9A 4ZM8A 4N3VA 1MWRA 5CLKA 3SVAA 1WMOA 2UGIA 3AGNA 3DXOA 3FKAA 3GAXA 1QVF2 2KF6A 3CCM3 3FF2A 1A2VA 1YIJ3 1FA3A 4WYKA 2XSHB 1K9M4 1KQS2 1BRKA 5IENA 1SARA 1DYUA 1UGHI 3CPW2 4HAAA 1JRQA 3JUOA 2XFSA 6STDA 1O7GB 1K41A 3X3XA 1A2PA 1B21A 3DUKA 4CJNA 5KP1A 3N8BA 1UI7A 1CYVA 1IYYA 5AIIA 4BU4A 1GOYA 1IK3A 2KRTA 3LT9A 4GSPA 4K1UA 4N6UA 4R80A 3DGOA 3SYUA 4EBGA 8RNTA 1C54A 1JB5A 1N8R4 1BUQA 2L4VA 3AHWA 1Q42A 3DGLA 2Z77A 2BMQB 3EHCA 3OW22 2OTL3 3I553 3DGNA 1FUTA 2HMLB 4FCMA 3D5IA 1BOXA 4J9AA 1F8NA 2W6JH 2O9UX 1R4CA 2W9PA 3JUMA 1L5GB 1O7NB 4OK0A 3GZRA 1QMAA 3SOYA 4HYZA 1DMQA 3DGMA 4R9KA 1O7MB 1S723 2ZA4A 1UUGB 5LC7A 1D6ZA 1NDOB 2L1SA 1IDPA 3S27A 1OHPA 1IVXA 3D3LA 5I97A 4HM6B 4EC6A 3BIRA 4J5GA 4MMZB 3SXXA 3VF1A 2YX9A 8CHOA 1RN7A 3MG3A 3HIGA 1E3RA 1YVSA 2W0QA 5EQLA 3PCRA 2OTJ3 1WNHA 4LMIA 3HX8A 3CD63 4RZMA 1BNFA 5EVHA 9RNTA 2CHCA 2GU1A 3SX1A 3KSED 1YGWA 1PY3A 1AR0A 3CNMA 1Q824 3FSDA 4MJDA 2J8XB 5IG4A 5IG0A 2KCDA 2OWPA 2ZL8A 1US1A 1G0TA 3PS8A 1I0VA 1N9JA 4JF8A 5IEOA 3LXUX 2CFGA 3ZG0A 4EYCA 3AMOB 1TRQA 4BL3A 2KF3A 4OVMA 1B2SA 5D82A 3S67A 3A76A 5JPPA 5AI1A 1NNVA 3IMAB 1GY6A 1SPUA 2JDIH 1Z1SA 1BRGA 5G1KA 3T8NA 3AGOA 3KKGA 1RN4A 3KFQC 5AEUB 2D1WA 4R4KA 3VGNA 3F14A 4FMBA 1BNEA 1A67A 1VQN3 1IVUA 3U97A 1SQWA 4J8TA 3URPA 1RGEA 4AEQA 3EE1A 1ULJB 1DVDA 4NHFA 3LTCA 4KVHA 1JNQA 2H0GA 2IYJA 1M1K4 1VQP3 2LQVA 2QIYA 3EC9A 2A15A 3GZYB 1K28A 3K0ZA 1G96A 1Q7Y4 3CMA3 4N6V0 2F4YA 4STDA 5D81A 2CIUA 3BNCA 3UNLA 1BVIA 2SBLA 4MEIA 3G4S3 3F9SA 1BGSA 1FYSA 3OWSA 3RGRA 1NB5I 3K5TA 4N6TA 1RSNA 4O02B 4R9LA 2FNQA 1N9EA 3D5GA 2HMKB 3NBRA 3OV4A 1U8CB 2ML5A 3FG1A 1BRNL 1GMQA 2AADA 2WO0A 1RKYA 3HZPA 2GBXB 4GB5A 1UUWB 3MHEA 2W03A 2W2CA 4H3UA 3LMLA 2CFDA 2CC3A 1B2MA 1OPYA 2OQEA 1JBRA 3Q3FA 1UDII 3B8LA 5IEPA 1BANA 3FGYA 5M1AA 1BNSA 1JZOA 1T2IA 3F8HA 4HM3B 4DKIA 3CNXA 1VQL3 1QJGA 3N9HA 1NB3I 3IJEB 1MOLA 2F56A 3CCL3 2IUKA 4X2HA 2XGLA 3NQYA 4CCVA 1YJW3 1BAOA 1IQXA 3NBJA 1W6YA 1I2GA 3X42A 1T2HA 3WOFB 3E99A 3NM7A 3CC23 1BSCA 1BU4A 1JN5B 1I2EA 1UCKA 3HIIA 3HI7A 1RRLA 1X1UA 3IPTA 3L0RA 4X2OA 3ZG5A 4K61A 1DVCA 1IQYA 1FUSA 3OWYA 1FGQA 1HU9A 1Q9EA 2CG0A 4GL6A 4RNTA 3NUVA 1RRHA 1D6UA 2GU3A 1Y4KA 2H0IA 2R4IA 2RCDA 1FZUA 2WGQA 2F86B 3DGYA 3EN1B 3EX9A 4I5QA 3VSYA 2V1LA 3D9RA 4EW5A 3BNEA 4CDLA 1AY7A 4HM5B 3U1WA 1IV9A 1JB2A 2C10A 2RSXA 4XBTA 4HM7B 4BTYA 1YJN3 1I8VA 2B1XB 3OXAA 4GHOA 1VQ73 1UUVB 1BNIA 1LOYA 3DMCA 3ALAA 3CCU3 1RGGA 4K1VA 4FMAA 4WP5A 4FCJA 2BNGA 1W4NA 2CFLA 1VQK3 2UUGC 4N6MA 5EEOA 1PFPA 1AVKA 1TFOA 3DZLA 4KZ1A 2W9QA 1QAFA 3KSPA 1GOUA 3N54B 1ZX2A 2O3OA 1GD4A 1VQ53 3O8YA 3CCE3 1X1YA 4O8SA 1W7CA 3ECFA 3M8CA 3EBTA 1ZO2A 1QVG2 1ISKA 1QAKA 2JQ5A 1FUWA 2W04A 3GZBA 4J5KA 3CCV3 3QRDA 3G6E3 1TJDA 3JUPA 2CFWA 3BNDA 3F8XA 1BRJA 2MF7A 3RDEA 1TTOA 5IERA 4WWUC 5CK6A 1K734 2BU4A 3G16A 1FGMA 1RTUA 1BNJA 3V92A 3B4OA 1RGHA 2BHMA 3H51A 3CCQ3 2GXFA 4HM4B 3WMDA 3BB9A 4WHAA 3F40A 2AAEA 1B20A 3CXC2 1W01A 1B2XA 1SIHA 3K7CA 2RBIA 3MYTA 1JN5A 1MWUA 2YFJB 1OHOA 2YFIB 1GYBA 5G2GA 1EG9B 3CCR3 1FW7A 1V74A 3BNBA 4XBYA 4EV5A 3AHSA 1N5PA 4JRFA 1BNRA 1ROVA 4HZ9B 2QA43 2F5WA 2P05A 2XF3A 1RN1A 3PZWA 5LC6A 1I2FA 5CF2A 2F99A 2PZVA 2CG1A 2XSOB 5HGRA 3T8UA 2KF5A 4AKYA 1EA2A 4HM8B 3FZWA 2QEX3 1M9GA 1U5OA 4EV2A 1TIJA 1B2ZA 3WHOA 5KP4A 1PYLA 1WTHA 1N5HA 3CPOA 3NX0A 3H3HA 1RGKA 3NQZA 1BIRA 3B7CA 5CXOA 1IVWA 1O7HB 1CQSA 4LYLB 1IT7A 1VZZA 1LOWA 4XDVA 1FGTA 1STDA 4HM0B 1OF5A 2RGQA 1ASKA 1RDSA 3KE7A 3PGBA 3UJMA 1IQ8A 1B27A 3DM8A 3A5EA 3G713 2RNTA 1NO3A 2BMOB 2KXGA 4HBRA 3UL6A 4BL2A 1VQM3 4IT7A 5M19A 5IW9A 2FGTA 1IV7A 2IUJA 3J7Yd 2XEPA 2Z76A 1RCKA 2CX0A 1JBTA 3NHXA 4HVNA 2CFKA 4ORLA 1WMNA 1Q814 2D42A 3S28A 1PU4A 1OH0A 1VQ43 2E2TA 3KN4A 1VQ83 1RCLA 1YGEA 4NPBA 2HMOB 1D6YA 3K63A 1EUIC 2P38A 2Z7AA 5M18A 2BMRB 1UI8A 5CF1A 3LTDA 4HM2B 1KSIA 1T3BA 2GSPA 3BLZA 2CWUA 4K90B 3X3YA 1ZGXA 4MMYB 4L8PA 3D79A 2Y74A 1VQ63 3LT8A 1J2BA 3QK9A 3OWUA 5DRVA 3HK4A 4CPKA 2KAAA 4N6NB 3PCSA 4KFFA 2P09A 5BVBA 1LVNA 3I0YA 1VQ93 1RJOA 1YI23 2UX0A 1DMNA 5DREA 3WR2A 1W6GA 1IVVA 2QGUA 3BU4A 2GEYA 4G1MB 4EXRA 2WOFA 1I3FA 3FLJA 3GSPA 1RGCA 4O2HA 3JUNA 3NM2A 5FW5A 4KFDA 3MWZA 3UL5A 2XRXB 1M904 3EJVA 3CCS3 3F7SA 3WA2X 3WOEB 5STDA 1A2KA 1AV4A 1YVBI 1CH0A 4MMXB 1JJ22 1W6CA 1UW1A 1GS3A 1JV2B 4FCZA 3WDGB 1W5ZA 5GSPA 5BU4A 1OGZA 7RNTA 1BRIA 4KFEA 3FF0A 2CX1A 3EB8A 1OACA 1BSAA 1TP6A 4LSOA 1YHQ3
chains in the Genus database with same CATH topology
1GY7A 2K0MA 2OQEC 2CW9A 2ZDJA 1KC84 1Q864 2IMJA 4HJLB 4QWTA 1NWWA 2RFRA 2STDA 1OF5B 3GZXB 1S5AA 1E97A 3LYGA 1CEWI 3KIIA 2E2VA 3ER7A 1GY5A 2CWTA 3WA3A 1T5YA 1YJ93 2Z6BA 4WFOA 2HMJB 1O7PB 5A0OB 5BXQA 4HM1B 1IU7A 3V99A 1STFI 1JKGA 2Q07A 3NBBA 3STDA 3S5CA 3CC73 3FH1A 4TX4A 1FGRA 2BO9B 3G0KA 2W56A 3KZTA 3Q2PA 1OUNA 5D83A 4FMCA 4RNZA 1VQO3 2PNCA 4N6LA 3B4PA 3FG4A 2CWVA 1EKMA 3EF8A 4LZIA 3LH4A 3K9MC 3CC43 3X40A 3ROBA 2OCTA 3Q1CA 1OCVA 2F98A 2OOVA 4XM4A 2XGNA 4BTXA 1ULIB 3LTBA 2GBWB 4RNYA 3GWRA 3RGAA 5AIFA 2BT3A 5IG3A 4RBNA 1AVLA 1KWIA 1Q40A 3WODG 5IF6A 1LNHA 2HMMB 7STDA 1NU3A 1MNLA 2C11A 3PXMA 1QALA 3DY5A 2B24B 1WQLB 1YIT3 1E3VA 1M1XB 2Y73A 3JUQA 1IT8A 5JBSA 4XDWA 1KD14 4NREA 1GD3A 5ELJA 3LZAA 1NJI4 4HKVB 1HKXA 3NV0A 2CKFB 3EBYA 3SLUA 5AEWB 1W00A 4L8OA 5KP3A 5FGOA 1K8A4 3EN8A 3MKIA 4I4KA 2OOVC 3LTAA 3Q90A 5AIGA 1W2B2 1OHSA 5AYSC 2CK3H 4WYKB 1W02A 3T0UA 3GRDA 2CH9A 3MG1A 3CU3A 1C7HA 3F7XA 2INXA 2M7OA 4PEJA 4L7KA 2XR8B 3EQQB 4H61A 5ELUA 4LGQA 2WOHA 2P0XA 1JKGB 2E2UA 1CYUA 2ML6A 1SJWA 3I563 2WGOA 5JPUA 2W56B 2K54A 2HMNB 3G8ZA 5AYRB 5AIHA 2XH9A 1A90A 4FMDA 3TDGA 1TU5A 1WMPA 2XFTA 3FCSB 5IG5A 4OUQA 2I9WA 1N8QA 3OX9A 4O3VA 1ROAA 3MPHA 3NXJA 2IA7A 3PYJA 3V98A 3SEDA 3X41A 1SIIA 1DMMA 1Q40B 4IPBA 2MC8A 3X3ZA 1LXEA 4LEHA 4XB5A 4BTWA 4AKZA 4HZBB 3FG3A 2FXTA 1W2ZA 1O7WB 3JVCA 1TFKA 3UB1A 3CME3 2YFLB 1JB4A 3MG2A 3LOYA 4Q53A 1EQKA 1TUHA 3MSOA 4IIAA 3SOAA 5TGNA 4U13A 4XBXA 1FGOA 1LOXA 3AMOA 1OGXA 2P0MA 4N6OB 4R1KA 3S29A 2LYXA 2GEXA 3NV0B 4FR9A 4ZM8A 4N3VA 5CLKA 3SVAA 1WMOA 3FKAA 3DXOA 3GAXA 1QVF2 3CCM3 3FF2A 1A2VA 1YIJ3 1FA3A 4WYKA 2XSHB 1K9M4 1KQS2 5IENA 1DYUA 3CPW2 6STDA 1JRQA 3JUOA 2XFSA 1O7GB 1K41A 3X3XA 3DUKA 5KP1A 3N8BA 1UI7A 1CYVA 5AIIA 1IK3A 2KRTA 3LT9A 4K1UA 4N6UA 4R80A 4EBGA 3DGOA 1JB5A 1N8R4 1BUQA 2L4VA 1Q42A 3DGLA 2Z77A 2BMQB 3EHCA 3OW22 2OTL3 3I553 3DGNA 2HMLB 4FCMA 4J9AA 1F8NA 2W6JH 2O9UX 1R4CA 2W9PA 3JUMA 1L5GB 1O7NB 4OK0A 3GZRA 1QMAA 3SOYA 4HYZA 1DMQA 3DGMA 4R9KA 1O7MB 1S723 5LC7A 1D6ZA 1NDOB 1IDPA 3S27A 1OHPA 1IVXA 3D3LA 5I97A 4HM6B 4EC6A 4MMZB 3SXXA 3VF1A 2YX9A 8CHOA 1RN7A 3MG3A 3HIGA 1E3RA 2W0QA 5EQLA 3PCRA 2OTJ3 1WNHA 4LMIA 3HX8A 3CD63 4RZMA 5EVHA 2CHCA 2GU1A 3SX1A 3KSED 3CNMA 1AR0A 1Q824 3FSDA 4MJDA 5IG4A 5IG0A 2KCDA 2OWPA 2ZL8A 1US1A 3PS8A 4JF8A 5IEOA 1N9JA 1VQ53 4EYCA 3LXUX 2CFGA 3AMOB 4OVMA 5D82A 3S67A 3A76A 5JPPA 5AI1A 3IMAB 1GY6A 1SPUA 2JDIH 1Z1SA 3T8NA 3KKGA 5AEUB 3KFQC 2D1WA 4R4KA 3VGNA 3F14A 4FMBA 1A67A 1VQN3 1IVUA 3U97A 1SQWA 4J8TA 4AEQA 3EE1A 1ULJB 1DVDA 4NHFA 3LTCA 4KVHA 1JNQA 1M1K4 1VQP3 2LQVA 2QIYA 3EC9A 2A15A 3GZYB 1K28A 3K0ZA 1G96A 1Q7Y4 3CMA3 4N6V0 4STDA 5D81A 2CIUA 3BNCA 3UNLA 4MEIA 2SBLA 3G4S3 3F9SA 3OWSA 3RGRA 1NB5I 3K5TA 4N6TA 4O02B 4R9LA 2FNQA 1N9EA 2HMKB 3NBRA 3OV4A 1U8CB 2ML5A 3FG1A 2WO0A 1RKYA 3HZPA 2GBXB 4GB5A 1UUWB 3MHEA 2W03A 2W2CA 4H3UA 3LMLA 2CFDA 2CC3A 1OPYA 2OQEA 3B8LA 5IEPA 3FGYA 3F8HA 4HM3B 3CNXA 1VQL3 1QJGA 3N9HA 1NB3I 3IJEB 1MOLA 3CCL3 2IUKA 4X2HA 2XGLA 3NQYA 4CCVA 1YJW3 3NBJA 1IQXA 1W6YA 3X42A 3WOFB 3E99A 3NM7A 3CC23 1JN5B 3HIIA 3HI7A 3IPTA 1RRLA 3L0RA 4X2OA 4K61A 1DVCA 1IQYA 3OWYA 1FGQA 1HU9A 2CG0A 4GL6A 3NUVA 1RRHA 1D6UA 2GU3A 1Y4KA 2R4IA 2RCDA 2WGQA 3EN1B 3EX9A 2F86B 3CCJ3 3VSYA 2V1LA 3D9RA 3BNEA 4CDLA 4HM5B 3U1WA 1IV9A 1JB2A 2C10A 2RSXA 4XBTA 4HM7B 4BTYA 1YJN3 2B1XB 3OXAA 1VQ73 1UUVB 3CCU3 3DMCA 3ALAA 4K1VA 4FMAA 4WP5A 4FCJA 2BNGA 1W4NA 2CFLA 1VQK3 4N6MA 5EEOA 1PFPA 1AVKA 1TFOA 3DZLA 4KZ1A 2W9QA 1QAFA 3KSPA 3N54B 1ZX2A 2O3OA 1GD4A 3O8YA 3CCE3 4O8SA 1W7CA 3ECFA 3M8CA 3EBTA 1ZO2A 1QVG2 1ISKA 1QAKA 2JQ5A 1FUWA 2W04A 3GZBA 3CCV3 3QRDA 3G6E3 3JUPA 3RDEA 2CFWA 3BNDA 3F8XA 2MF7A 5IERA 4WWUC 5CK6A 1K734 3G16A 1FGMA 3V92A 3B4OA 2BHMA 3H51A 3CCQ3 2GXFA 4HM4B 3WMDA 3BB9A 4WHAA 3F40A 3CXC2 1W01A 1SIHA 3K7CA 3MYTA 1JN5A 2YFJB 1OHOA 2YFIB 1GYBA 5G2GA 1EG9B 3CCR3 1V74A 3BNBA 4XBYA 4EV5A 1N5PA 4JRFA 1ROVA 4HZ9B 2QA43 2P05A 2XF3A 3PZWA 5LC6A 5CF2A 2F99A 2PZVA 2CG1A 2XSOB 5HGRA 3T8UA 4AKYA 1EA2A 4HM8B 3FZWA 2QEX3 1M9GA 1U5OA 4EV2A 1TIJA 5KP4A 1WTHA 1N5HA 3CPOA 3NX0A 3H3HA 3NQZA 5CXOA 3B7CA 1IVWA 1O7HB 1CQSA 1IT7A 1VZZA 4XDVA 1FGTA 1STDA 4HM0B 1OF5A 2RGQA 1ASKA 3KE7A 3PGBA 3UJMA 1IQ8A 3DM8A 3G713 1NO3A 2BMOB 2KXGA 4HBRA 3UL6A 1VQM3 4IT7A 5IW9A 2FGTA 1IV7A 2IUJA 3J7Yd 2XEPA 2Z76A 3NHXA 4HVNA 2CFKA 4ORLA 1WMNA 1Q814 2D42A 3S28A 1PU4A 1OH0A 1VQ43 2E2TA 3KN4A 1VQ83 1YGEA 2HMOB 1D6YA 3K63A 2P38A 2Z7AA 2BMRB 1UI8A 5CF1A 3LTDA 4HM2B 1KSIA 3BLZA 2CWUA 4K90B 3X3YA 4MMYB 4L8PA 1VQ63 2Y74A 3LT8A 1J2BA 3QK9A 3OWUA 5DRVA 3HK4A 4N6NB 3PCSA 4KFFA 2P09A 5BVBA 1LVNA 3I0YA 1VQ93 1RJOA 1YI23 2UX0A 1DMNA 5DREA 4EXRA 1W6GA 1IVVA 2QGUA 2GEYA 4G1MB 2WOFA 4O2HA 3FLJA 5FW5A 3JUNA 3NM2A 3UL5A 4KFDA 3MWZA 2XRXB 1M904 3EJVA 3CCS3 3F7SA 3WA2X 3WOEB 5STDA 1A2KA 1AV4A 1YVBI 4MMXB 1JJ22 1W6CA 1UW1A 1GS3A 1JV2B 4FCZA 3WDGB 1W5ZA 1OGZA 4KFEA 3FF0A 3EB8A 1OACA 1TP6A 4LSOA 1YHQ3
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GY7 A;  2IMJ A;  4HJL B;  1NWW A;  2RFR A;  2STD A;  1OF5 B;  3GZX B;  1S5A A;  1E97 A;  3LYG A;  3ER7 A;  1GY5 A;  2HMJ B;  1O7P B;  5BXQ A;  4HM1 B;  1JKG A;  3STD A;  3S5C A;  3FH1 A;  3G0K A;  3KZT A;  1OUN A;  5D83 A;  3B4P A;  3EF8 A;  3ROB A;  1OCV A;  2F98 A;  4XM4 A;  1ULI B;  2GBW B;  3GWR A;  3RGA A;  5AIF A;  5IG3 A;  1Q40 A;  5IF6 A;  2HMM B;  7STD A;  1NU3 A;  2B24 B;  1WQL B;  1E3V A;  3JUQ A;  4XDW A;  3LZA A;  4HKV B;  1HKX A;  3NV0 A;  2CKF B;  3EBY A;  5AEW B;  1W00 A;  4L8O A;  5KP3 A;  3EN8 A;  3MKI A;  4I4K A;  3Q90 A;  5AIG A;  1OHS A;  4WYK B;  1W02 A;  3GRD A;  3MG1 A;  3CU3 A;  1C7H A;  3F7X A;  2INX A;  4PEJ A;  4L7K A;  2XR8 B;  3EQQ B;  4LGQ A;  1JKG B;  1SJW A;  5JPU A;  2K54 A;  2HMN B;  3G8Z A;  5AIH A;  5IG5 A;  4OUQ A;  2I9W A;  3OX9 A;  3NXJ A;  3SED A;  1DMM A;  1Q40 B;  4LEH A;  4XB5 A;  4HZB B;  1O7W B;  2YFL B;  1JB4 A;  3MG2 A;  4Q53 A;  1TUH A;  3MSO A;  4IIA A;  3SOA A;  5TGN A;  4U13 A;  4XBX A;  1OGX A;  4R1K A;  2GEX A;  3NV0 B;  4N3V A;  5CLK A;  3FKA A;  3DXO A;  3FF2 A;  4WYK A;  2XSH B;  5IEN A;  6STD A;  3JUO A;  1O7G B;  1K41 A;  3DUK A;  5KP1 A;  5AII A;  4K1U A;  1JB5 A;  1BUQ A;  1Q42 A;  2Z77 A;  2BMQ B;  3EHC A;  2HML B;  4FCM A;  4J9A A;  3JUM A;  1O7N B;  3GZR A;  1QMA A;  3SOY A;  1DMQ A;  4R9K A;  1O7M B;  1NDO B;  1IDP A;  1OHP A;  4HM6 B;  8CHO A;  3MG3 A;  1E3R A;  4LMI A;  3HX8 A;  4RZM A;  5EVH A;  2CHC A;  3CNM A;  1AR0 A;  3FSD A;  4MJD A;  5IG4 A;  5IG0 A;  2OWP A;  5IEO A;  4OVM A;  5D82 A;  3A76 A;  5JPP A;  5AI1 A;  1GY6 A;  1Z1S A;  3T8N A;  3KKG A;  5AEU B;  3VGN A;  3F14 A;  4J8T A;  1ULJ B;  4KVH A;  3EC9 A;  2QIY A;  3GZY B;  2A15 A;  3K0Z A;  4STD A;  5D81 A;  3UNL A;  3F9S A;  3OWS A;  3RGR A;  4R9L A;  2HMK B;  3NBR A;  3OV4 A;  3HZP A;  2GBX B;  4GB5 A;  1UUW B;  3MHE A;  2W2C A;  4H3U A;  1OPY A;  3B8L A;  5IEP A;  3FGY A;  3F8H A;  4HM3 B;  3CNX A;  1QJG A;  4X2H A;  1W6Y A;  3E99 A;  1JN5 B;  3IPT A;  4X2O A;  3OWY A;  3NUV A;  2RCD A;  2R4I A;  3EN1 B;  3EX9 A;  2F86 B;  3VSY A;  3D9R A;  4CDL A;  4HM5 B;  1JB2 A;  4XBT A;  4HM7 B;  2B1X B;  3OXA A;  1UUV B;  3DMC A;  4K1V A;  4WP5 A;  4FCJ A;  2BNG A;  3DZL A;  3KSP A;  1ZX2 A;  3ECF A;  3M8C A;  3EBT A;  1ZO2 A;  1ISK A;  2JQ5 A;  3GZB A;  3JUP A;  3F8X A;  5IER A;  4WWU C;  5CK6 A;  3G16 A;  3B4O A;  3H51 A;  2GXF A;  4HM4 B;  3WMD A;  3BB9 A;  3F40 A;  1W01 A;  3K7C A;  3MYT A;  1JN5 A;  2YFJ B;  1OHO A;  2YFI B;  1GYB A;  5G2G A;  1EG9 B;  4XBY A;  4HZ9 B;  5CF2 A;  2F99 A;  2PZV A;  2XSO B;  5HGR A;  3T8U A;  1EA2 A;  4HM8 B;  3FZW A;  1U5O A;  5KP4 A;  3CPO A;  3H3H A;  5CXO A;  3B7C A;  1O7H B;  1CQS A;  1VZZ A;  4XDV A;  1STD A;  4HM0 B;  1OF5 A;  2RGQ A;  1ASK A;  3KE7 A;  3UJM A;  3DM8 A;  2BMO B;  2Z76 A;  3NHX A;  4HVN A;  4ORL A;  1OH0 A;  2HMO B;  2Z7A A;  2BMR B;  5CF1 A;  4HM2 B;  3BLZ A;  4L8P A;  3OWU A;  5DRV A;  3HK4 A;  5BVB A;  3I0Y A;  2UX0 A;  1DMN A;  5DRE A;  2QGU A;  2GEY A;  3FLJ A;  5FW5 A;  3JUN A;  3NM2 A;  2XRX B;  3EJV A;  3F7S A;  5STD A;  1A2K A;  1GS3 A;  1OGZ A;  3FF0 A;  1TP6 A; 
#chains in the Genus database with same CATH topology
 1GY7 A;  1BSD A;  2K0M A;  2OQE C;  2IY2 A;  2CW9 A;  2ZDJ A;  5RNT A;  1KC8 4;  1Q86 4;  2R41 A;  2IMJ A;  4HJL B;  4QWT A;  1NWW A;  2RFR A;  1BRS A;  1UGI A;  1MWS A;  2STD A;  1OF5 B;  3GZX B;  1GOV A;  1S5A A;  1E97 A;  3LYG A;  1CEW I;  3KII A;  2E2V A;  1RGA A;  1GY5 A;  2CWT A;  3ER7 A;  3WA3 A;  1T5Y A;  1LRA A;  1YJ9 3;  2Z6B A;  4WFO A;  2HMJ B;  1G02 A;  1O7P B;  5A0O B;  5BXQ A;  4HM1 B;  1IU7 A;  1LQG C;  3V99 A;  1STF I;  1BNG A;  1JKG A;  1MGR A;  2Q07 A;  3NBB A;  3STD A;  3S5C A;  3CC7 3;  1JZD A;  3CCJ 3;  3FH1 A;  4TX4 A;  1FGR A;  1B3S A;  2BO9 B;  2W56 A;  3G0K A;  3KZT A;  3Q2P A;  3RNT A;  1OUN A;  5D83 A;  4FMC A;  4RNZ A;  1VQO 3;  2PNC A;  4N6L A;  1V57 A;  3B4P A;  3HOH A;  3FG4 A;  2CWV A;  1DE3 A;  1EKM A;  2H0H A;  3EF8 A;  4LZI A;  3LH4 A;  3K9M C;  6GSP A;  3CC4 3;  3X40 A;  3ROB A;  2OCT A;  3Q1C A;  1OCV A;  2F98 A;  2OOV A;  2ZHX B;  2XGN A;  4XM4 A;  4BTX A;  1LOV A;  1ULI B;  2GBW B;  3LTB A;  3GWR A;  4RNY A;  3RGA A;  1TRP A;  5AIF A;  2BT3 A;  5IG3 A;  4RBN A;  1AVL A;  1KWI A;  1Q40 A;  3WOD G;  5IF6 A;  1LNH A;  2HMM B;  7STD A;  1NU3 A;  1MNL A;  2C11 A;  3PXM A;  1QAL A;  3DY5 A;  3DH2 A;  2B24 B;  1WQL B;  1YIT 3;  1E3V A;  1M1X B;  2Y73 A;  3JUQ A;  1IT8 A;  1RMS A;  5JBS A;  4XDW A;  1KD1 4;  2C4B A;  1EEJ A;  4NRE A;  1GD3 A;  5ELJ A;  1RGL A;  1GSP A;  3LZA A;  1LNI A;  1NJI 4;  4HKV B;  1ZS7 A;  1HKX A;  1BSB A;  1Q7H A;  2CKF B;  3EBY A;  3NV0 A;  3SLU A;  5AEW B;  1W00 A;  4L8O A;  5KP3 A;  5FGO A;  1K8A 4;  3EN8 A;  3MKI A;  7GSP A;  4I4K A;  2OOV C;  1RLS A;  3LTA A;  3Q90 A;  5AIG A;  3D4A A;  1W2B 2;  4ILF A;  1OHS A;  1DET A;  5AYS C;  4KT3 B;  3ZFZ A;  5HOH A;  2CK3 H;  4WYK B;  1W02 A;  3T0U A;  3GRD A;  2CH9 A;  4HOH A;  3MG1 A;  3CU3 A;  1C7H A;  1GMR A;  2INX A;  2M7O A;  3F7X A;  1UCJ A;  4PEJ A;  4L7K A;  2XR8 B;  3EQQ B;  4H61 A;  5ELU A;  1VQQ A;  4LGQ A;  1X1W A;  5BIR A;  2WOH A;  1HYF A;  1B2U A;  1JKG B;  2P0X A;  1X1X A;  2E2U A;  1CYU A;  2ML6 A;  1SJW A;  3I56 3;  2WGO A;  5JPU A;  2W56 B;  2K54 A;  1I3I A;  1BRH A;  1RGF A;  2HMN B;  3G8Z A;  5AYR B;  3KCH A;  5AIH A;  2XH9 A;  6RNT A;  1LQM B;  1MGW A;  2BIR A;  1JBS A;  1A90 A;  4FMD A;  3TDG A;  1TU5 A;  2KF4 A;  1WMP A;  2XFT A;  1BSE A;  3FCS B;  5IG5 A;  4OUQ A;  2I9W A;  1N8Q A;  1YNV X;  3OX9 A;  1UCI A;  1ROA A;  4O3V A;  3MPH A;  3NXJ A;  2IA7 A;  1RNT A;  2F5M A;  3PYJ A;  3V98 A;  3SED A;  1HZ1 A;  1V58 A;  3X41 A;  1SII A;  1GMP A;  1DMM A;  1Q40 B;  1MWT A;  4IPB A;  2MC8 A;  3X3Z A;  1LXE A;  4LEH A;  4XB5 A;  4BTW A;  4AKZ A;  1UCL A;  2SAR A;  4HZB B;  3FG3 A;  2HOH A;  2FXT A;  1I0X A;  1O7W B;  1R4Y A;  1I70 A;  1W2Z A;  2K3D A;  3JVC A;  1TFK A;  3UB1 A;  3CME 3;  2YFL B;  1JB4 A;  1BUJ A;  3MG2 A;  3LOY A;  4BIR A;  4Q53 A;  1EQK A;  1TUH A;  3MSO A;  4IIA A;  3SOA A;  5TGN A;  1RNB A;  4U13 A;  4XBX A;  5G1L A;  1FGO A;  1LOX A;  1AQZ A;  3AMO A;  1OGX A;  2P0M A;  1RHL A;  4N6O B;  4R1K A;  3S29 A;  2LYX A;  2GEX A;  3NV0 B;  4FR9 A;  4ZM8 A;  4N3V A;  1MWR A;  5CLK A;  3SVA A;  1WMO A;  2UGI A;  3AGN A;  3DXO A;  3FKA A;  3GAX A;  1QVF 2;  2KF6 A;  3CCM 3;  3FF2 A;  1A2V A;  1YIJ 3;  1FA3 A;  4WYK A;  2XSH B;  1K9M 4;  1KQS 2;  1BRK A;  5IEN A;  1SAR A;  1DYU A;  1UGH I;  3CPW 2;  4HAA A;  1JRQ A;  3JUO A;  2XFS A;  6STD A;  1O7G B;  1K41 A;  3X3X A;  1A2P A;  1B21 A;  3DUK A;  4CJN A;  5KP1 A;  3N8B A;  1UI7 A;  1CYV A;  1IYY A;  5AII A;  4BU4 A;  1GOY A;  1IK3 A;  2KRT A;  3LT9 A;  4GSP A;  4K1U A;  4N6U A;  4R80 A;  3DGO A;  3SYU A;  4EBG A;  8RNT A;  1C54 A;  1JB5 A;  1N8R 4;  1BUQ A;  2L4V A;  3AHW A;  1Q42 A;  3DGL A;  2Z77 A;  2BMQ B;  3EHC A;  3OW2 2;  2OTL 3;  3I55 3;  3DGN A;  1FUT A;  2HML B;  4FCM A;  3D5I A;  1BOX A;  4J9A A;  1F8N A;  2W6J H;  2O9U X;  1R4C A;  2W9P A;  3JUM A;  1L5G B;  1O7N B;  4OK0 A;  3GZR A;  1QMA A;  3SOY A;  4HYZ A;  1DMQ A;  3DGM A;  4R9K A;  1O7M B;  1S72 3;  2ZA4 A;  1UUG B;  5LC7 A;  1D6Z A;  1NDO B;  2L1S A;  1IDP A;  3S27 A;  1OHP A;  1IVX A;  3D3L A;  5I97 A;  4HM6 B;  4EC6 A;  3BIR A;  4J5G A;  4MMZ B;  3SXX A;  3VF1 A;  2YX9 A;  8CHO A;  1RN7 A;  3MG3 A;  3HIG A;  1E3R A;  1YVS A;  2W0Q A;  5EQL A;  3PCR A;  2OTJ 3;  1WNH A;  4LMI A;  3HX8 A;  3CD6 3;  4RZM A;  1BNF A;  5EVH A;  9RNT A;  2CHC A;  2GU1 A;  3SX1 A;  3KSE D;  1YGW A;  1PY3 A;  1AR0 A;  3CNM A;  1Q82 4;  3FSD A;  4MJD A;  2J8X B;  5IG4 A;  5IG0 A;  2KCD A;  2OWP A;  2ZL8 A;  1US1 A;  1G0T A;  3PS8 A;  1I0V A;  1N9J A;  4JF8 A;  5IEO A;  3LXU X;  2CFG A;  3ZG0 A;  4EYC A;  3AMO B;  1TRQ A;  4BL3 A;  2KF3 A;  4OVM A;  1B2S A;  5D82 A;  3S67 A;  3A76 A;  5JPP A;  5AI1 A;  1NNV A;  3IMA B;  1GY6 A;  1SPU A;  2JDI H;  1Z1S A;  1BRG A;  5G1K A;  3T8N A;  3AGO A;  3KKG A;  1RN4 A;  3KFQ C;  5AEU B;  2D1W A;  4R4K A;  3VGN A;  3F14 A;  4FMB A;  1BNE A;  1A67 A;  1VQN 3;  1IVU A;  3U97 A;  1SQW A;  4J8T A;  3URP A;  1RGE A;  4AEQ A;  3EE1 A;  1ULJ B;  1DVD A;  4NHF A;  3LTC A;  4KVH A;  1JNQ A;  2H0G A;  2IYJ A;  1M1K 4;  1VQP 3;  2LQV A;  2QIY A;  3EC9 A;  2A15 A;  3GZY B;  1K28 A;  3K0Z A;  1G96 A;  1Q7Y 4;  3CMA 3;  4N6V 0;  2F4Y A;  4STD A;  5D81 A;  2CIU A;  3BNC A;  3UNL A;  1BVI A;  2SBL A;  4MEI A;  3G4S 3;  3F9S A;  1BGS A;  1FYS A;  3OWS A;  3RGR A;  1NB5 I;  3K5T A;  4N6T A;  1RSN A;  4O02 B;  4R9L A;  2FNQ A;  1N9E A;  3D5G A;  2HMK B;  3NBR A;  3OV4 A;  1U8C B;  2ML5 A;  3FG1 A;  1BRN L;  1GMQ A;  2AAD A;  2WO0 A;  1RKY A;  3HZP A;  2GBX B;  4GB5 A;  1UUW B;  3MHE A;  2W03 A;  2W2C A;  4H3U A;  3LML A;  2CFD A;  2CC3 A;  1B2M A;  1OPY A;  2OQE A;  1JBR A;  3Q3F A;  1UDI I;  3B8L A;  5IEP A;  1BAN A;  3FGY A;  5M1A A;  1BNS A;  1JZO A;  1T2I A;  3F8H A;  4HM3 B;  4DKI A;  3CNX A;  1VQL 3;  1QJG A;  3N9H A;  1NB3 I;  3IJE B;  1MOL A;  2F56 A;  3CCL 3;  2IUK A;  4X2H A;  2XGL A;  3NQY A;  4CCV A;  1YJW 3;  1BAO A;  1IQX A;  3NBJ A;  1W6Y A;  1I2G A;  3X42 A;  1T2H A;  3WOF B;  3E99 A;  3NM7 A;  3CC2 3;  1BSC A;  1BU4 A;  1JN5 B;  1I2E A;  1UCK A;  3HII A;  3HI7 A;  1RRL A;  1X1U A;  3IPT A;  3L0R A;  4X2O A;  3ZG5 A;  4K61 A;  1DVC A;  1IQY A;  1FUS A;  3OWY A;  1FGQ A;  1HU9 A;  1Q9E A;  2CG0 A;  4GL6 A;  4RNT A;  3NUV A;  1RRH A;  1D6U A;  2GU3 A;  1Y4K A;  2H0I A;  2R4I A;  2RCD A;  1FZU A;  2WGQ A;  2F86 B;  3DGY A;  3EN1 B;  3EX9 A;  4I5Q A;  3VSY A;  2V1L A;  3D9R A;  4EW5 A;  3BNE A;  4CDL A;  1AY7 A;  4HM5 B;  3U1W A;  1IV9 A;  1JB2 A;  2C10 A;  2RSX A;  4XBT A;  4HM7 B;  4BTY A;  1YJN 3;  1I8V A;  2B1X B;  3OXA A;  4GHO A;  1VQ7 3;  1UUV B;  1BNI A;  1LOY A;  3DMC A;  3ALA A;  3CCU 3;  1RGG A;  4K1V A;  4FMA A;  4WP5 A;  4FCJ A;  2BNG A;  1W4N A;  2CFL A;  1VQK 3;  2UUG C;  4N6M A;  5EEO A;  1PFP A;  1AVK A;  1TFO A;  3DZL A;  4KZ1 A;  2W9Q A;  1QAF A;  3KSP A;  1GOU A;  3N54 B;  1ZX2 A;  2O3O A;  1GD4 A;  1VQ5 3;  3O8Y A;  3CCE 3;  1X1Y A;  4O8S A;  1W7C A;  3ECF A;  3M8C A;  3EBT A;  1ZO2 A;  1QVG 2;  1ISK A;  1QAK A;  2JQ5 A;  1FUW A;  2W04 A;  3GZB A;  4J5K A;  3CCV 3;  3QRD A;  3G6E 3;  1TJD A;  3JUP A;  2CFW A;  3BND A;  3F8X A;  1BRJ A;  2MF7 A;  3RDE A;  1TTO A;  5IER A;  4WWU C;  5CK6 A;  1K73 4;  2BU4 A;  3G16 A;  1FGM A;  1RTU A;  1BNJ A;  3V92 A;  3B4O A;  1RGH A;  2BHM A;  3H51 A;  3CCQ 3;  2GXF A;  4HM4 B;  3WMD A;  3BB9 A;  4WHA A;  3F40 A;  2AAE A;  1B20 A;  3CXC 2;  1W01 A;  1B2X A;  1SIH A;  3K7C A;  2RBI A;  3MYT A;  1JN5 A;  1MWU A;  2YFJ B;  1OHO A;  2YFI B;  1GYB A;  5G2G A;  1EG9 B;  3CCR 3;  1FW7 A;  1V74 A;  3BNB A;  4XBY A;  4EV5 A;  3AHS A;  1N5P A;  4JRF A;  1BNR A;  1ROV A;  4HZ9 B;  2QA4 3;  2F5W A;  2P05 A;  2XF3 A;  1RN1 A;  3PZW A;  5LC6 A;  1I2F A;  5CF2 A;  2F99 A;  2PZV A;  2CG1 A;  2XSO B;  5HGR A;  3T8U A;  2KF5 A;  4AKY A;  1EA2 A;  4HM8 B;  3FZW A;  2QEX 3;  1M9G A;  1U5O A;  4EV2 A;  1TIJ A;  1B2Z A;  3WHO A;  5KP4 A;  1PYL A;  1WTH A;  1N5H A;  3CPO A;  3NX0 A;  3H3H A;  1RGK A;  3NQZ A;  1BIR A;  3B7C A;  5CXO A;  1IVW A;  1O7H B;  1CQS A;  4LYL B;  1IT7 A;  1VZZ A;  1LOW A;  4XDV A;  1FGT A;  1STD A;  4HM0 B;  1OF5 A;  2RGQ A;  1ASK A;  1RDS A;  3KE7 A;  3PGB A;  3UJM A;  1IQ8 A;  1B27 A;  3DM8 A;  3A5E A;  3G71 3;  2RNT A;  1NO3 A;  2BMO B;  2KXG A;  4HBR A;  3UL6 A;  4BL2 A;  1VQM 3;  4IT7 A;  5M19 A;  5IW9 A;  2FGT A;  1IV7 A;  2IUJ A;  3J7Y d;  2XEP A;  2Z76 A;  1RCK A;  2CX0 A;  1JBT A;  3NHX A;  4HVN A;  2CFK A;  4ORL A;  1WMN A;  1Q81 4;  2D42 A;  3S28 A;  1PU4 A;  1OH0 A;  1VQ4 3;  2E2T A;  3KN4 A;  1VQ8 3;  1RCL A;  1YGE A;  4NPB A;  2HMO B;  1D6Y A;  3K63 A;  1EUI C;  2P38 A;  2Z7A A;  5M18 A;  2BMR B;  1UI8 A;  5CF1 A;  3LTD A;  4HM2 B;  1KSI A;  1T3B A;  2GSP A;  3BLZ A;  2CWU A;  4K90 B;  3X3Y A;  1ZGX A;  4MMY B;  4L8P A;  3D79 A;  2Y74 A;  1VQ6 3;  3LT8 A;  1J2B A;  3QK9 A;  3OWU A;  5DRV A;  3HK4 A;  4CPK A;  2KAA A;  4N6N B;  3PCS A;  4KFF A;  2P09 A;  5BVB A;  1LVN A;  3I0Y A;  1VQ9 3;  1RJO A;  1YI2 3;  2UX0 A;  1DMN A;  5DRE A;  3WR2 A;  1W6G A;  1IVV A;  2QGU A;  3BU4 A;  2GEY A;  4G1M B;  4EXR A;  2WOF A;  1I3F A;  3FLJ A;  3GSP A;  1RGC A;  4O2H A;  3JUN A;  3NM2 A;  5FW5 A;  4KFD A;  3MWZ A;  3UL5 A;  2XRX B;  1M90 4;  3EJV A;  3CCS 3;  3F7S A;  3WA2 X;  3WOE B;  5STD A;  1A2K A;  1AV4 A;  1YVB I;  1CH0 A;  4MMX B;  1JJ2 2;  1W6C A;  1UW1 A;  1GS3 A;  1JV2 B;  4FCZ A;  3WDG B;  1W5Z A;  5GSP A;  5BU4 A;  1OGZ A;  7RNT A;  1BRI A;  4KFE A;  3FF0 A;  2CX1 A;  3EB8 A;  1OAC A;  1BSA A;  1TP6 A;  4LSO A;  1YHQ 3; 
#chains in the Genus database with same CATH homology
 1GY7 A;  2K0M A;  2OQE C;  2CW9 A;  2ZDJ A;  1KC8 4;  1Q86 4;  2IMJ A;  4HJL B;  4QWT A;  1NWW A;  2RFR A;  2STD A;  1OF5 B;  3GZX B;  1S5A A;  1E97 A;  3LYG A;  1CEW I;  3KII A;  2E2V A;  3ER7 A;  1GY5 A;  2CWT A;  3WA3 A;  1T5Y A;  1YJ9 3;  2Z6B A;  4WFO A;  2HMJ B;  1O7P B;  5A0O B;  5BXQ A;  4HM1 B;  1IU7 A;  3V99 A;  1STF I;  1JKG A;  2Q07 A;  3NBB A;  3STD A;  3S5C A;  3CC7 3;  3FH1 A;  4TX4 A;  1FGR A;  2BO9 B;  3G0K A;  2W56 A;  3KZT A;  3Q2P A;  1OUN A;  5D83 A;  4FMC A;  4RNZ A;  1VQO 3;  2PNC A;  4N6L A;  3B4P A;  3FG4 A;  2CWV A;  1EKM A;  3EF8 A;  4LZI A;  3LH4 A;  3K9M C;  3CC4 3;  3X40 A;  3ROB A;  2OCT A;  3Q1C A;  1OCV A;  2F98 A;  2OOV A;  4XM4 A;  2XGN A;  4BTX A;  1ULI B;  3LTB A;  2GBW B;  4RNY A;  3GWR A;  3RGA A;  5AIF A;  2BT3 A;  5IG3 A;  4RBN A;  1AVL A;  1KWI A;  1Q40 A;  3WOD G;  5IF6 A;  1LNH A;  2HMM B;  7STD A;  1NU3 A;  1MNL A;  2C11 A;  3PXM A;  1QAL A;  3DY5 A;  2B24 B;  1WQL B;  1YIT 3;  1E3V A;  1M1X B;  2Y73 A;  3JUQ A;  1IT8 A;  5JBS A;  4XDW A;  1KD1 4;  4NRE A;  1GD3 A;  5ELJ A;  3LZA A;  1NJI 4;  4HKV B;  1HKX A;  3NV0 A;  2CKF B;  3EBY A;  3SLU A;  5AEW B;  1W00 A;  4L8O A;  5KP3 A;  5FGO A;  1K8A 4;  3EN8 A;  3MKI A;  4I4K A;  2OOV C;  3LTA A;  3Q90 A;  5AIG A;  1W2B 2;  1OHS A;  5AYS C;  2CK3 H;  4WYK B;  1W02 A;  3T0U A;  3GRD A;  2CH9 A;  3MG1 A;  3CU3 A;  1C7H A;  3F7X A;  2INX A;  2M7O A;  4PEJ A;  4L7K A;  2XR8 B;  3EQQ B;  4H61 A;  5ELU A;  4LGQ A;  2WOH A;  2P0X A;  1JKG B;  2E2U A;  1CYU A;  2ML6 A;  1SJW A;  3I56 3;  2WGO A;  5JPU A;  2W56 B;  2K54 A;  2HMN B;  3G8Z A;  5AYR B;  5AIH A;  2XH9 A;  1A90 A;  4FMD A;  3TDG A;  1TU5 A;  1WMP A;  2XFT A;  3FCS B;  5IG5 A;  4OUQ A;  2I9W A;  1N8Q A;  3OX9 A;  4O3V A;  1ROA A;  3MPH A;  3NXJ A;  2IA7 A;  3PYJ A;  3V98 A;  3SED A;  3X41 A;  1SII A;  1DMM A;  1Q40 B;  4IPB A;  2MC8 A;  3X3Z A;  1LXE A;  4LEH A;  4XB5 A;  4BTW A;  4AKZ A;  4HZB B;  3FG3 A;  2FXT A;  1W2Z A;  1O7W B;  3JVC A;  1TFK A;  3UB1 A;  3CME 3;  2YFL B;  1JB4 A;  3MG2 A;  3LOY A;  4Q53 A;  1EQK A;  1TUH A;  3MSO A;  4IIA A;  3SOA A;  5TGN A;  4U13 A;  4XBX A;  1FGO A;  1LOX A;  3AMO A;  1OGX A;  2P0M A;  4N6O B;  4R1K A;  3S29 A;  2LYX A;  2GEX A;  3NV0 B;  4FR9 A;  4ZM8 A;  4N3V A;  5CLK A;  3SVA A;  1WMO A;  3FKA A;  3DXO A;  3GAX A;  1QVF 2;  3CCM 3;  3FF2 A;  1A2V A;  1YIJ 3;  1FA3 A;  4WYK A;  2XSH B;  1K9M 4;  1KQS 2;  5IEN A;  1DYU A;  3CPW 2;  6STD A;  1JRQ A;  3JUO A;  2XFS A;  1O7G B;  1K41 A;  3X3X A;  3DUK A;  5KP1 A;  3N8B A;  1UI7 A;  1CYV A;  5AII A;  1IK3 A;  2KRT A;  3LT9 A;  4K1U A;  4N6U A;  4R80 A;  4EBG A;  3DGO A;  1JB5 A;  1N8R 4;  1BUQ A;  2L4V A;  1Q42 A;  3DGL A;  2Z77 A;  2BMQ B;  3EHC A;  3OW2 2;  2OTL 3;  3I55 3;  3DGN A;  2HML B;  4FCM A;  4J9A A;  1F8N A;  2W6J H;  2O9U X;  1R4C A;  2W9P A;  3JUM A;  1L5G B;  1O7N B;  4OK0 A;  3GZR A;  1QMA A;  3SOY A;  4HYZ A;  1DMQ A;  3DGM A;  4R9K A;  1O7M B;  1S72 3;  5LC7 A;  1D6Z A;  1NDO B;  1IDP A;  3S27 A;  1OHP A;  1IVX A;  3D3L A;  5I97 A;  4HM6 B;  4EC6 A;  4MMZ B;  3SXX A;  3VF1 A;  2YX9 A;  8CHO A;  1RN7 A;  3MG3 A;  3HIG A;  1E3R A;  2W0Q A;  5EQL A;  3PCR A;  2OTJ 3;  1WNH A;  4LMI A;  3HX8 A;  3CD6 3;  4RZM A;  5EVH A;  2CHC A;  2GU1 A;  3SX1 A;  3KSE D;  3CNM A;  1AR0 A;  1Q82 4;  3FSD A;  4MJD A;  5IG4 A;  5IG0 A;  2KCD A;  2OWP A;  2ZL8 A;  1US1 A;  3PS8 A;  4JF8 A;  5IEO A;  1N9J A;  1VQ5 3;  4EYC A;  3LXU X;  2CFG A;  3AMO B;  4OVM A;  5D82 A;  3S67 A;  3A76 A;  5JPP A;  5AI1 A;  3IMA B;  1GY6 A;  1SPU A;  2JDI H;  1Z1S A;  3T8N A;  3KKG A;  5AEU B;  3KFQ C;  2D1W A;  4R4K A;  3VGN A;  3F14 A;  4FMB A;  1A67 A;  1VQN 3;  1IVU A;  3U97 A;  1SQW A;  4J8T A;  4AEQ A;  3EE1 A;  1ULJ B;  1DVD A;  4NHF A;  3LTC A;  4KVH A;  1JNQ A;  1M1K 4;  1VQP 3;  2LQV A;  2QIY A;  3EC9 A;  2A15 A;  3GZY B;  1K28 A;  3K0Z A;  1G96 A;  1Q7Y 4;  3CMA 3;  4N6V 0;  4STD A;  5D81 A;  2CIU A;  3BNC A;  3UNL A;  4MEI A;  2SBL A;  3G4S 3;  3F9S A;  3OWS A;  3RGR A;  1NB5 I;  3K5T A;  4N6T A;  4O02 B;  4R9L A;  2FNQ A;  1N9E A;  2HMK B;  3NBR A;  3OV4 A;  1U8C B;  2ML5 A;  3FG1 A;  2WO0 A;  1RKY A;  3HZP A;  2GBX B;  4GB5 A;  1UUW B;  3MHE A;  2W03 A;  2W2C A;  4H3U A;  3LML A;  2CFD A;  2CC3 A;  1OPY A;  2OQE A;  3B8L A;  5IEP A;  3FGY A;  3F8H A;  4HM3 B;  3CNX A;  1VQL 3;  1QJG A;  3N9H A;  1NB3 I;  3IJE B;  1MOL A;  3CCL 3;  2IUK A;  4X2H A;  2XGL A;  3NQY A;  4CCV A;  1YJW 3;  3NBJ A;  1IQX A;  1W6Y A;  3X42 A;  3WOF B;  3E99 A;  3NM7 A;  3CC2 3;  1JN5 B;  3HII A;  3HI7 A;  3IPT A;  1RRL A;  3L0R A;  4X2O A;  4K61 A;  1DVC A;  1IQY A;  3OWY A;  1FGQ A;  1HU9 A;  2CG0 A;  4GL6 A;  3NUV A;  1RRH A;  1D6U A;  2GU3 A;  1Y4K A;  2R4I A;  2RCD A;  2WGQ A;  3EN1 B;  3EX9 A;  2F86 B;  3CCJ 3;  3VSY A;  2V1L A;  3D9R A;  3BNE A;  4CDL A;  4HM5 B;  3U1W A;  1IV9 A;  1JB2 A;  2C10 A;  2RSX A;  4XBT A;  4HM7 B;  4BTY A;  1YJN 3;  2B1X B;  3OXA A;  1VQ7 3;  1UUV B;  3CCU 3;  3DMC A;  3ALA A;  4K1V A;  4FMA A;  4WP5 A;  4FCJ A;  2BNG A;  1W4N A;  2CFL A;  1VQK 3;  4N6M A;  5EEO A;  1PFP A;  1AVK A;  1TFO A;  3DZL A;  4KZ1 A;  2W9Q A;  1QAF A;  3KSP A;  3N54 B;  1ZX2 A;  2O3O A;  1GD4 A;  3O8Y A;  3CCE 3;  4O8S A;  1W7C A;  3ECF A;  3M8C A;  3EBT A;  1ZO2 A;  1QVG 2;  1ISK A;  1QAK A;  2JQ5 A;  1FUW A;  2W04 A;  3GZB A;  3CCV 3;  3QRD A;  3G6E 3;  3JUP A;  3RDE A;  2CFW A;  3BND A;  3F8X A;  2MF7 A;  5IER A;  4WWU C;  5CK6 A;  1K73 4;  3G16 A;  1FGM A;  3V92 A;  3B4O A;  2BHM A;  3H51 A;  3CCQ 3;  2GXF A;  4HM4 B;  3WMD A;  3BB9 A;  4WHA A;  3F40 A;  3CXC 2;  1W01 A;  1SIH A;  3K7C A;  3MYT A;  1JN5 A;  2YFJ B;  1OHO A;  2YFI B;  1GYB A;  5G2G A;  1EG9 B;  3CCR 3;  1V74 A;  3BNB A;  4XBY A;  4EV5 A;  1N5P A;  4JRF A;  1ROV A;  4HZ9 B;  2QA4 3;  2P05 A;  2XF3 A;  3PZW A;  5LC6 A;  5CF2 A;  2F99 A;  2PZV A;  2CG1 A;  2XSO B;  5HGR A;  3T8U A;  4AKY A;  1EA2 A;  4HM8 B;  3FZW A;  2QEX 3;  1M9G A;  1U5O A;  4EV2 A;  1TIJ A;  5KP4 A;  1WTH A;  1N5H A;  3CPO A;  3NX0 A;  3H3H A;  3NQZ A;  5CXO A;  3B7C A;  1IVW A;  1O7H B;  1CQS A;  1IT7 A;  1VZZ A;  4XDV A;  1FGT A;  1STD A;  4HM0 B;  1OF5 A;  2RGQ A;  1ASK A;  3KE7 A;  3PGB A;  3UJM A;  1IQ8 A;  3DM8 A;  3G71 3;  1NO3 A;  2BMO B;  2KXG A;  4HBR A;  3UL6 A;  1VQM 3;  4IT7 A;  5IW9 A;  2FGT A;  1IV7 A;  2IUJ A;  3J7Y d;  2XEP A;  2Z76 A;  3NHX A;  4HVN A;  2CFK A;  4ORL A;  1WMN A;  1Q81 4;  2D42 A;  3S28 A;  1PU4 A;  1OH0 A;  1VQ4 3;  2E2T A;  3KN4 A;  1VQ8 3;  1YGE A;  2HMO B;  1D6Y A;  3K63 A;  2P38 A;  2Z7A A;  2BMR B;  1UI8 A;  5CF1 A;  3LTD A;  4HM2 B;  1KSI A;  3BLZ A;  2CWU A;  4K90 B;  3X3Y A;  4MMY B;  4L8P A;  1VQ6 3;  2Y74 A;  3LT8 A;  1J2B A;  3QK9 A;  3OWU A;  5DRV A;  3HK4 A;  4N6N B;  3PCS A;  4KFF A;  2P09 A;  5BVB A;  1LVN A;  3I0Y A;  1VQ9 3;  1RJO A;  1YI2 3;  2UX0 A;  1DMN A;  5DRE A;  4EXR A;  1W6G A;  1IVV A;  2QGU A;  2GEY A;  4G1M B;  2WOF A;  4O2H A;  3FLJ A;  5FW5 A;  3JUN A;  3NM2 A;  3UL5 A;  4KFD A;  3MWZ A;  2XRX B;  1M90 4;  3EJV A;  3CCS 3;  3F7S A;  3WA2 X;  3WOE B;  5STD A;  1A2K A;  1AV4 A;  1YVB I;  4MMX B;  1JJ2 2;  1W6C A;  1UW1 A;  1GS3 A;  1JV2 B;  4FCZ A;  3WDG B;  1W5Z A;  1OGZ A;  4KFE A;  3FF0 A;  3EB8 A;  1OAC A;  1TP6 A;  4LSO A;  1YHQ 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...