2UX0A

Structure of the oligomerisation domain of calcium-calmodulin dependent protein kinase ii gamma
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
137
structure length
137
Chain Sequence
SMTEDEDLKVRKQEIIKITEQLIEAINNGDFEAYTKICDPGLTSFEPEALGNLVEGMDFHKFYFENLLSKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWLNVHYHCSGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CALCIUM-CALMODULIN DEPENDENT PROTEIN KINASE (CAM KINASE) II
publication title Structure of the Camkiidelta/Calmodulin Complex Reveals the Molecular Mechanism of Camkii Kinase Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 39
structure length 137
sequence length 137
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.11.17: Calcium/calmodulin-dependent protein kinase.
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08332 CaMKII_AD Calcium/calmodulin dependent protein kinase II association domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2ux0A00
4OVMA 2A15A 2YFIB 4XBXA 5AIGA 1W00A 5JPPA 3EN1B 3CPOA 1UUWB 1AR0A 3EBYA 3EX9A 2CKFB 4R9LA 5IF6A 2GXFA 4KVHA 3VSYA 1JB4A 3MSOA 5AIFA 4OUQA 3FLJA 4X2OA 3K7CA 3DZLA 3SOAA 4L7KA 3OV4A 2XSHB 5CXOA 1EA2A 3LZAA 1EG9B 1NWWA 2UX0A 5AEWB 2RFRA 3F8HA 3STDA 1A2KA 1O7WB 5FW5A 2K54A 3NHXA 3GRDA 4HM1B 4X2HA 1SJWA 4N3VA 1TUHA 3RGRA 3OX9A 4J9AA 4HM5B 4HM7B 3K0ZA 2CHCA 5AEUB 3FZWA 2STDA 3H51A 3FF2A 4HM0B 3HK4A 1IDPA 4L8OA 2GBXB 1GY5A 1E97A 4ORLA 3S5CA 4HJLB 5CF1A 5D83A 3KZTA 2RCDA 4IIAA 1OUNA 5AI1A 3DXOA 5IG0A 2R4IA 3B4OA 3ROBA 2BMRB 1O7HB 4Q53A 3GZYB 3MKIA 4WYKA 4LEHA 1NDOB 5IG4A 5D82A 5KP1A 2XRXB 1OHOA 4XM4A 2XR8B 2Z77A 2YFLB 1OPYA 3FGYA 4PEJA 3FF0A 5DREA 5D81A 5JPUA 4HM8B 1JN5A 3NUVA 1Z1SA 1OGZA 3F9SA 1JKGB 1C7HA 3B7CA 3EJVA 3EC9A 3MG1A 3NXJA 2BNGA 4HVNA 3OWSA 3MG2A 1UUVB 2BMOB 2HMMB 1Q40A 3VGNA 3GZBA 4R9KA 3EF8A 3E99A 6STDA 3JUQA 1O7GB 4CDLA 4HKVB 3I0YA 3JUMA 1QMAA 3Q90A 3F40A 3ECFA 2F99A 2B1XB 3G8ZA 3T8UA 3T8NA 2Z7AA 2RGQA 4K1UA 2HMKB 3F8XA 4FCMA 2QIYA 2XSOB 3BLZA 3DM8A 5BVBA 3EHCA 2HMOB 1ZX2A 3MYTA 3KE7A 1E3VA 1Q42A 3F7XA 2JQ5A 3EN8A 3G16A 3B4PA 2QGUA 3UNLA 3GWRA 4LGQA 3JUOA 4HM6B 1NU3A 5CF2A 1DMMA 4XDWA 3CU3A 4K1VA 1OH0A 4FCJA 2PZVA 4R1KA 3NBRA 4XBYA 2BMQB 3CNXA 4I4KA 3ER7A 1OHPA 5HGRA 1WQLB 5CK6A 3NM2A 1DMNA 3JUPA 2HMNB 4HM4B 3WMDA 1O7MB 3NV0A 3H3HA 2GEYA 3SOYA 2F98A 5TGNA 1ULIB 5AIIA 1E3RA 1JB2A 2I9WA 4WWUC 1OGXA 7STDA 4STDA 1STDA 1TP6A 5IERA 4WP5A 4WYKB 2HMLB 3A76A 3IPTA 3MHEA 4HZBB 1QJGA 3B8LA 1GY7A 3JUNA 5DRVA 5CLKA 3NV0B 1O7NB 3F14A 3DUKA 4HZ9B 3KKGA 3GZRA 1JN5B 1GYBA 3KSPA 5AIHA 3SEDA 1ASKA 2HMJB 3RGAA 4XBTA 1HKXA 3HX8A 1K41A 5BXQA 1W6YA 3CNMA 3FKAA 1BUQA 3BB9A 3GZXB 5IEPA 4XB5A 5IEOA 1Q40B 3EBTA 1GY6A 1O7PB 4HM2B 1VZZA 5EVHA 3OWUA 2GEXA 3OXAA 1CQSA 1W02A 1W01A 3FSDA 1U5OA 1OF5A 2B24B 2IMJA 3LYGA 1JB5A 3M8CA 5IG5A 5KP3A 1DMQA 2GBWB 4U13A 2OWPA 4J8TA 5KP4A 3MG3A 4GB5A 4H3UA 4LMIA 4XDVA 4RZMA 5STDA 8CHOA 3HZPA 1ISKA 3UJMA 2W2CA 5IG3A 1S5AA 3D9RA 4L8PA 1OF5B 1JKGA 1GS3A 5G2GA 1ZO2A 3OWYA 3F7SA 1OHSA 3DMCA 3G0KA 4HM3B 4MJDA 1OCVA 1ULJB 2Z76A 2F86B 3EQQB 3FH1A 5IENA 2INXA 2YFJB
chains in the Genus database with same CATH superfamily
4OVMA 2A15A 2YFIB 4XBXA 5AIGA 1W00A 1UDII 5LC7A 5JPPA 3SLUA 3CXC2 1M904 3EN1B 1V58A 1STFI 1UUWB 3CPOA 1AR0A 1PY3A 3G713 2KF5A 3EBYA 3EX9A 2MF7A 1VQM3 1RCKA 1GD3A 3GAXA 3CCS3 2CKFB 4MEIA 3WHOA 3O8YA 1RCLA 1TTOA 2WGOA 1RSNA 4BL2A 2F5MA 4R9LA 1B2ZA 5IF6A 5RNTA 1RHLA 1KQS2 5ELJA 1UI8A 1W7CA 1V57A 2E2VA 2GXFA 4KVHA 1GOVA 3VSYA 3A5EA 2F5WA 2F56A 1JB4A 1JV2B 1FUWA 3MSOA 1LRAA 2LYXA 5AIFA 4OUQA 3FLJA 4KFFA 1IK3A 2E2TA 2CX0A 3N9HA 1X1YA 4X2OA 3K7CA 3DZLA 3SOAA 2OQEA 1BNJA 4L7KA 1TRQA 1SQWA 2H0HA 3LTBA 1CYVA 2XSHB 3OV4A 2CWUA 5CXOA 2H0GA 1JBRA 1EA2A 2GSPA 1T5YA 3LZAA 1CEWI 1BRJA 5GSPA 1IVVA 1EG9B 1N5PA 3D3LA 1NWWA 2WO0A 2UX0A 3X41A 3CCQ3 5AEWB 2RFRA 3F8HA 1TFOA 1KC84 3HI7A 3STDA 1RGCA 4AKYA 1A2KA 3U1WA 1O7WB 5FW5A 1X1XA 2K54A 1TRPA 2KF3A 3NHXA 1LVNA 3GRDA 4HM1B 4X2HA 1S723 1JZOA 3BNDA 4N6UA 1BU4A 4RNZA 1SJWA 4N3VA 5BIRA 1NB5I 1TUHA 4EYCA 1BVIA 1BNSA 1C54A 1JNQA 1MNLA 3RGRA 1WMOA 3K63A 4R4KA 3OX9A 4J9AA 4HM5B 5FGOA 3KCHA 1VQN3 3X3ZA 2YX9A 4HM7B 1PU4A 3LTCA 1Q824 3K0ZA 1VQL3 2CHCA 1DETA 3PZWA 1IQYA 4N6NB 3ZFZA 5AEUB 3CC73 2W56B 3G4S3 1YI23 1BANA 3FZWA 3LTAA 2CC3A 1N8QA 2WOHA 3CMA3 3VF1A 1NJI4 1YGWA 2STDA 2JDIH 3H51A 1M9GA 3I553 3FF2A 4J5KA 1K9M4 1LOXA 3FG3A 1RN7A 1TFKA 4HM0B 3PCRA 3HK4A 1PFPA 4FR9A 4KFDA 1Q814 1CYUA 1IDPA 4L8OA 1DVDA 4R80A 1UGIA 2GBXB 2XGLA 2W03A 1A2VA 1GY5A 3DGYA 1R4YA 1E97A 1YJW3 4ORLA 3S5CA 3FG4A 3SYUA 4HJLB 3HIGA 5CF1A 5D83A 3KZTA 2RCDA 3ALAA 1ZS7A 4N6LA 3CCE3 4HAAA 4IIAA 4WHAA 1OUNA 1VQQA 5AI1A 1JJ22 4KZ1A 1LOYA 3DXOA 1HYFA 1IV7A 1M1XB 5IG0A 2R4IA 1A90A 1QVF2 3B4OA 3S29A 3ROBA 2BMRB 2CK3H 1O7HB 2OTJ3 4Q53A 2P0MA 4O8SA 4HBRA 3CCU3 4CCVA 2IYJA 3GZYB 1RMSA 2RBIA 1ZGXA 3MKIA 4WYKA 1B20A 4LEHA 1VQ63 2W9QA 1NDOB 2M7OA 3JVCA 4OK0A 1U8CB 1YIT3 1I8VA 5IG4A 5D82A 5KP1A 1IVUA 1WTHA 2XRXB 3Q3FA 1OHOA 1RRLA 1YJN3 4XM4A 2XR8B 2C11A 1FGRA 1IT8A 3S67A 2Z77A 3KFQC 2L4VA 4RBNA 2W04A 3EE1A 1VQ93 1B2UA 2YFLB 1YHQ3 1OPYA 4EBGA 5EQLA 1FGQA 2XFSA 3AMOA 3LMLA 3IMAB 4EC6A 2OQEC 2CX1A 1TIJA 3FGYA 4PEJA 3FF0A 1VQ83 2C10A 1RRHA 1W4NA 5DREA 2UUGC 5D81A 2P38A 4HM8B 5JPUA 1FGTA 4GHOA 2QEX3 5JBSA 1JN5A 3NUVA 1W2ZA 1RKYA 2O3OA 3FG1A 1Z1SA 1BRKA 1LQMB 1N5HA 1OGZA 1YJ93 1BNEA 1IVXA 3PGBA 3D4AA 1K28A 3F9SA 1RTUA 2IUKA 2ZL8A 2FNQA 3PYJA 4MMYB 1EEJA 1BRGA 1JKGB 5M19A 5ELUA 1BNGA 1C7HA 1SPUA 3G6E3 3B7CA 3EJVA 3EC9A 5HOHA 1IQ8A 3MG1A 3NXJA 1UCLA 1GOUA 1LOWA 2ZHXB 2BNGA 4HVNA 2KF4A 1UCJA 3OWSA 1UCKA 3MG2A 1RJOA 1UUVB 2BMOB 2HMMB 1VQK3 3N8BA 1J2BA 4O3VA 1TU5A 4N6MA 4DKIA 2KF6A 1Q40A 4WFOA 1B27A 1CH0A 1RDSA 3VGNA 1RGLA 1B2XA 2PNCA 3GZBA 2CIUA 1B2MA 4R9KA 3EF8A 4J5GA 3E99A 1FUSA 1I3IA 5G1LA 2ZA4A 1HZ1A 6STDA 4BTYA 1JRQA 1A2PA 2CFDA 1NNVA 1IT7A 3JUQA 3LH4A 3RNTA 4AKZA 1MWUA 1O7GB 4CDLA 5LC6A 1N9JA 3Q2PA 5A0OB 1BSDA 4HKVB 3V99A 2FXTA 3CD63 1RN1A 3I0YA 3CCV3 3JUMA 1QMAA 3Q90A 1T3BA 3F40A 3ECFA 1IQXA 4BTWA 2F99A 1M1K4 2B1XB 3G8ZA 1X1UA 3T8UA 3T8NA 3KIIA 3PS8A 1YVSA 1SIIA 2AAEA 4BTXA 1VQO3 1FZUA 1MWRA 2Z7AA 1YNVX 2ZDJA 6GSPA 1RNTA 2L1SA 2RGQA 4K1UA 1R4CA 1V74A 2HMKB 1LXEA 3F8XA 1AVLA 2D1WA 2P05A 4FCMA 4FMBA 2QIYA 2XSOB 1D6YA 3BLZA 3DM8A 4G1MB 4NHFA 3UL5A 1GMRA 3EHCA 4BIRA 5BVBA 1SARA 2HMOB 1TJDA 1MOLA 2KCDA 3WA3A 3X3XA 2J8XB 1ZX2A 3IJEB 3MYTA 3QK9A 1QAKA 4IPBA 1I0VA 4AEQA 4K90B 3KE7A 3SVAA 4RNTA 2BIRA 4EV5A 4LZIA 4CPKA 1UCIA 1VQ53 1E3VA 1Q42A 5M1AA 1PYLA 3F7XA 1RGHA 2JQ5A 4MMZB 1QVG2 2CFWA 2CFGA 3EN8A 2XF3A 3G16A 1D6UA 1UI7A 1BSEA 2CFLA 3B4PA 3DGMA 4ILFA 2QGUA 2F4YA 2HOHA 3UNLA 3RDEA 1MGWA 2IA7A 3GWRA 1FGMA 4LGQA 1FGOA 1MWTA 3JUOA 4FCZA 3PXMA 4HM6B 1RNBA 2BU4A 1NU3A 5CF2A 3WODG 3D5GA 1DMMA 2KAAA 4XDWA 2Q07A 2Z6BA 1RLSA 2WOFA 1VQP3 3CU3A 4K1VA 1OH0A 4FCJA 2PZVA 3BNEA 2GU3A 4R1KA 1K8A4 1W6CA 4JF8A 4KFEA 3T0UA 3K5TA 3NBRA 1KWIA 3UL6A 1F8NA 1LNIA 4XBYA 1W2B2 2Y73A 2BMQB 3CNXA 3L0RA 1VQ73 1GSPA 1BSAA 4I4KA 3ER7A 1OHPA 5HGRA 3SX1A 1WQLB 2XH9A 5CK6A 1MWSA 4EXRA 3NBBA 3NM2A 1RN4A 4JRFA 1DMNA 1FYSA 4HYZA 5AYRB 3DGOA 4TX4A 3MPHA 3JUPA 3K9MC 3UB1A 1DVCA 3ZG0A 2HMNB 4HM4B 4MMXB 3KSED 4K61A 1O7MB 3WMDA 3NV0A 3H3HA 2C4BA 2BHMA 1LNHA 1K734 1I0XA 1X1WA 2GEYA 3SOYA 2F98A 5TGNA 4EV2A 2AADA 1BAOA 2R41A 3LTDA 5EEOA 1JBTA 3X40A 1IYYA 1RGGA 1ULIB 3S28A 5AIIA 1E3RA 1G02A 1JB2A 3LOYA 2KRTA 2SARA 1Q864 1BSCA 1GD4A 2I9WA 4WWUC 1OGXA 1Y4KA 1IVWA 2WGQA 3DY5A 8RNTA 3GSPA 7STDA 4STDA 1STDA 1YIJ3 3SXXA 1TP6A 3AGNA 1AY7A 2RNTA 5IERA 4GL6A 1T2HA 4I5QA 1EQKA 4WP5A 4WYKB 2HMLB 2BT3A 3A76A 1BNRA 3IPTA 2OCTA 1MGRA 4CJNA 2V1LA 3MHEA 3NM7A 4FMDA 1QAFA 3Q1CA 4O2HA 4HZBB 1QJGA 3B8LA 1KD14 1GY7A 3CCR3 4N6V0 3X42A 3WOEB 1HU9A 3JUNA 2W6JH 5DRVA 3LXUX 5CLKA 1DE3A 2KXGA 3HIIA 5BU4A 3AMOB 3NV0B 1O7NB 1G0TA 6RNTA 3V92A 3BNBA 1FW7A 2ML5A 4RNYA 3F14A 3CME3 2CFKA 3J7Yd 3DUKA 4HZ9B 1VQ43 3KKGA 3GZRA 2CH9A 1JN5B 1GYBA 3KSPA 3AHSA 5AIHA 3SEDA 3V98A 7RNTA 4LSOA 7GSPA 1ASKA 2OOVA 2HMJB 3NQYA 2K3DA 1N9EA 4BU4A 3RGAA 3DH2A 4XBTA 2QA43 1HKXA 2E2UA 3HX8A 4O02B 1K41A 5BXQA 3NQZA 1UGHI 3OW22 1W6YA 2W56A 1RGFA 3CNMA 5M18A 2CW9A 3FKAA 1FA3A 3D79A 1BUQA 2XGNA 1W6GA 3URPA 3BB9A 2P0XA 4EW5A 1ROAA 1IU7A 1WMPA 3GZXB 5IEPA 2XEPA 4XB5A 1UW1A 1BUJA 5IEOA 1A67A 1IV9A 1W5ZA 1Q40B 2IUJA 3EBTA 1EKMA 3AGOA 1GY6A 2SBLA 4ZM8A 1BIRA 1O7PB 1WMNA 2FGTA 4HM2B 1VZZA 5EVHA 3OWUA 3N54B 4BL3A 2W0QA 1RGEA 1AQZA 2H0IA 1T2IA 3QRDA 2GEXA 3NBJA 3OXAA 2Y74A 3PCSA 4H61A 3WA2X 1CQSA 1BNIA 2MC8A 3S27A 4NPBA 1BOXA 1W02A 1GOYA 1W01A 2CG1A 3CCJ3 3MWZA 1BRIA 1I70A 3CCL3 3BNCA 2IY2A 1Q9EA 2O9UX 3FSDA 1U5OA 1OF5A 1DYUA 2B24B 4IT7A 1BGSA 1GMPA 1Q7HA 1AVKA 1BRNL 1AV4A 1FUTA 2IMJA 1BNFA 1JB5A 3LYGA 4QWTA 1BRSA 3M8CA 3BIRA 5IG5A 1RGAA 2UGIA 5KP3A 1NB3I 4GSPA 1D6ZA 1DMQA 2GBWB 1RGKA 2K0MA 3DGNA 4HOHA 3WOFB 3WR2A 4U13A 2OWPA 1I2GA 1QALA 2W9PA 4J8TA 1US1A 3KN4A 3U97A 5KP4A 4LYLB 3MG3A 3WDGB 4GB5A 3FCSB 1JZDA 1UUGB 4H3UA 2GU1A 3X3YA 4LMIA 4XDVA 3ZG5A 1SIHA 2XFTA 4RZMA 5STDA 8CHOA 5AYSC 3HZPA 5I97A 3I563 1NO3A 3HOHA 2CG0A 1ISKA 1GMQA 4FMCA 1N8R4 2ML6A 1KSIA 3UJMA 1EUIC 1LOVA 2RSXA 3DGLA 1WNHA 2W2CA 1B21A 3CCM3 5IW9A 3NX0A 5IG3A 1S5AA 3D9RA 3LT9A 1L5GB 4L8PA 1OF5B 2CWTA 1JKGA 1GS3A 1OACA 1G96A 5G2GA 1ZO2A 1YVBI 1I2FA 2D42A 4N6TA 9RNTA 3CPW2 1ROVA 3F7SA 3OWYA 5G1KA 1OHSA 1I2EA 2CWVA 1JBSA 1BSBA 3D5IA 3DMCA 1Q7Y4 3CC43 3G0KA 4HM3B 2OOVC 4MJDA 1OCVA 1ULJB 1BRHA 2Z76A 1YGEA 2F86B 3EB8A 2P09A 1B2SA 1I3FA 3EQQB 3FH1A 3AHWA 1B3SA 3TDGA 5IENA 2OTL3 2INXA 2LQVA 2YFJB 4NREA 4KT3B 1LQGC 2BO9B 4FMAA 3LT8A 3BU4A 4N6OB 3CC23
chains in the Genus database with same CATH topology
4OVMA 2A15A 2YFIB 4XBXA 5AIGA 1W00A 5JPPA 5LC7A 3CXC2 3SLUA 1M904 3EN1B 3G713 1STFI 1UUWB 3CPOA 1AR0A 3EBYA 3EX9A 2MF7A 1VQM3 3CCS3 1GD3A 3GAXA 2CKFB 4MEIA 3O8YA 2WGOA 4R9LA 5IF6A 1KQS2 5ELJA 1UI8A 1W7CA 2E2VA 2GXFA 4KVHA 3VSYA 1JB4A 1JV2B 1FUWA 3MSOA 2LYXA 5AIFA 4OUQA 3FLJA 4KFFA 1IK3A 2E2TA 3N9HA 4X2OA 3K7CA 3DZLA 3SOAA 2OQEA 4L7KA 1SQWA 3LTBA 1CYVA 2XSHB 3OV4A 2CWUA 5CXOA 1EA2A 1T5YA 3LZAA 1CEWI 1IVVA 1EG9B 1N5PA 3D3LA 1NWWA 2WO0A 2UX0A 3X41A 3CCQ3 5AEWB 2RFRA 3F8HA 1TFOA 1KC84 3HI7A 3STDA 4AKYA 1A2KA 3U1WA 1O7WB 5FW5A 2K54A 3NHXA 1LVNA 3GRDA 4HM1B 4X2HA 1S723 3BNDA 4N6UA 4RNZA 1SJWA 4N3VA 1NB5I 1TUHA 4EYCA 1JNQA 1MNLA 3RGRA 1WMOA 3K63A 4R4KA 3OX9A 4J9AA 4HM5B 5FGOA 1VQN3 3X3ZA 2YX9A 4HM7B 1PU4A 3LTCA 1Q824 3K0ZA 1VQL3 2CHCA 3PZWA 1IQYA 4N6NB 5AEUB 3CC73 2W56B 3G4S3 1YI23 3FZWA 3LTAA 2CC3A 1N8QA 2WOHA 3CMA3 3VF1A 1NJI4 2STDA 2JDIH 3H51A 1M9GA 3I553 3FF2A 1K9M4 1LOXA 3FG3A 1RN7A 1TFKA 4HM0B 3PCRA 3HK4A 1PFPA 4FR9A 4KFDA 1Q814 1CYUA 1IDPA 4L8OA 1DVDA 4R80A 2GBXB 2XGLA 2W03A 1A2VA 1GY5A 1E97A 1YJW3 4ORLA 3S5CA 3FG4A 4HJLB 3HIGA 5CF1A 5D83A 3KZTA 2RCDA 3ALAA 4N6LA 3CCE3 4WHAA 4IIAA 1OUNA 5AI1A 1JJ22 4KZ1A 3DXOA 1IV7A 1M1XB 5IG0A 2R4IA 1A90A 1QVF2 3B4OA 3S29A 3ROBA 2BMRB 2CK3H 1O7HB 2OTJ3 4Q53A 2P0MA 4O8SA 4HBRA 3CCU3 4CCVA 3GZYB 3MKIA 4WYKA 4LEHA 1VQ63 2W9QA 1NDOB 2M7OA 3JVCA 4OK0A 1U8CB 1YIT3 5IG4A 5D82A 5KP1A 1IVUA 1WTHA 2XRXB 1OHOA 1RRLA 1YJN3 4XM4A 2XR8B 2C11A 1FGRA 1IT8A 3S67A 2Z77A 3KFQC 2L4VA 4RBNA 2W04A 3EE1A 1VQ93 2YFLB 1YHQ3 1OPYA 4EBGA 5EQLA 1FGQA 2XFSA 3AMOA 3LMLA 3IMAB 4EC6A 2OQEC 1TIJA 3FGYA 4PEJA 3FF0A 1VQ83 2C10A 1RRHA 1W4NA 5DREA 5D81A 2P38A 4HM8B 5JPUA 1FGTA 2QEX3 5JBSA 1JN5A 3NUVA 1W2ZA 1RKYA 2O3OA 3FG1A 1Z1SA 1N5HA 1OGZA 1YJ93 1IVXA 3PGBA 4MMYB 1K28A 3F9SA 3PYJA 2IUKA 2ZL8A 2FNQA 1JKGB 5ELUA 3G6E3 1C7HA 1SPUA 3B7CA 3EJVA 3EC9A 1IQ8A 3MG1A 3NXJA 2BNGA 4HVNA 3OWSA 3MG2A 1RJOA 1UUVB 2BMOB 2HMMB 1VQK3 3N8BA 1J2BA 4O3VA 1TU5A 4N6MA 1Q40A 4WFOA 3VGNA 2PNCA 3GZBA 2CIUA 4R9KA 3EF8A 3E99A 6STDA 4BTYA 1JRQA 2CFDA 1IT7A 3JUQA 3LH4A 4AKZA 1O7GB 4CDLA 5LC6A 1N9JA 3Q2PA 5A0OB 3V99A 4HKVB 3CD63 2FXTA 3I0YA 3CCV3 3JUMA 1QMAA 3Q90A 3F40A 3ECFA 1IQXA 4BTWA 2F99A 1M1K4 2B1XB 3G8ZA 3T8UA 3T8NA 3KIIA 3PS8A 1SIIA 4BTXA 1VQO3 2Z7AA 2ZDJA 2RGQA 4K1UA 1R4CA 1V74A 2HMKB 1LXEA 3F8XA 1AVLA 2D1WA 2P05A 4FCMA 4FMBA 2QIYA 2XSOB 1D6YA 3BLZA 3DM8A 4G1MB 4NHFA 3UL5A 3EHCA 5BVBA 2HMOB 2KCDA 1MOLA 3WA3A 3X3XA 1ZX2A 3IJEB 3MYTA 3QK9A 1QAKA 4IPBA 4AEQA 4K90B 3KE7A 3SVAA 4EV5A 4LZIA 1VQ53 1E3VA 1Q42A 3F7XA 2JQ5A 4MMZB 1QVG2 2CFWA 2CFGA 3EN8A 2XF3A 3G16A 1D6UA 1UI7A 2CFLA 3B4PA 3DGMA 2QGUA 3UNLA 3RDEA 2IA7A 3GWRA 1FGMA 4LGQA 1FGOA 3JUOA 4FCZA 3PXMA 4HM6B 1NU3A 5CF2A 3WODG 1DMMA 4XDWA 2Q07A 2Z6BA 2WOFA 1VQP3 3CU3A 4K1VA 1OH0A 4FCJA 2PZVA 3BNEA 2GU3A 4R1KA 1K8A4 1W6CA 4JF8A 4KFEA 3T0UA 3K5TA 3NBRA 1KWIA 3UL6A 1F8NA 4XBYA 1W2B2 2Y73A 2BMQB 3CNXA 3L0RA 1VQ73 4I4KA 3ER7A 1OHPA 5HGRA 3SX1A 1WQLB 2XH9A 5CK6A 4EXRA 3NBBA 3NM2A 4JRFA 1DMNA 4HYZA 5AYRB 3DGOA 4TX4A 3MPHA 3JUPA 3K9MC 3UB1A 1DVCA 2HMNB 4HM4B 4MMXB 3KSED 4K61A 1O7MB 3WMDA 3NV0A 3H3HA 2BHMA 1LNHA 1K734 2GEYA 3SOYA 2F98A 5TGNA 4EV2A 5EEOA 3LTDA 3X40A 1ULIB 3S28A 5AIIA 1E3RA 1JB2A 3LOYA 2KRTA 1Q864 2I9WA 1GD4A 4WWUC 1OGXA 1Y4KA 1IVWA 2WGQA 3DY5A 7STDA 4STDA 1STDA 1YIJ3 3SXXA 1TP6A 5IERA 4GL6A 1EQKA 4WP5A 4WYKB 2HMLB 2BT3A 3A76A 3IPTA 2OCTA 2V1LA 3MHEA 3NM7A 4FMDA 1QAFA 3Q1CA 4O2HA 4HZBB 1QJGA 3B8LA 1KD14 1GY7A 3CCR3 4N6V0 3X42A 3WOEB 1HU9A 3JUNA 2W6JH 5DRVA 3LXUX 5CLKA 2KXGA 3HIIA 3AMOB 3NV0B 1O7NB 3V92A 3BNBA 2ML5A 4RNYA 3F14A 3CME3 2CFKA 3J7Yd 3DUKA 4HZ9B 1VQ43 3KKGA 3GZRA 2CH9A 1JN5B 1GYBA 3KSPA 5AIHA 3SEDA 3V98A 4LSOA 1ASKA 2OOVA 2HMJB 3NQYA 1N9EA 3RGAA 4XBTA 2QA43 1HKXA 2E2UA 3HX8A 4O02B 1K41A 5BXQA 3NQZA 3OW22 1W6YA 2W56A 1FA3A 3CNMA 2CW9A 3FKAA 1BUQA 2XGNA 1W6GA 3BB9A 2P0XA 1ROAA 1IU7A 1WMPA 3GZXB 5IEPA 2XEPA 4XB5A 1UW1A 5IEOA 1A67A 1IV9A 1W5ZA 1Q40B 2IUJA 3EBTA 1EKMA 1GY6A 2SBLA 4ZM8A 1WMNA 1O7PB 2FGTA 4HM2B 1VZZA 5EVHA 3OWUA 3N54B 2W0QA 3QRDA 2GEXA 3NBJA 3OXAA 2Y74A 3PCSA 4H61A 3WA2X 1CQSA 2MC8A 3S27A 1W02A 1W01A 2CG1A 3CCJ3 3MWZA 3CCL3 3BNCA 2O9UX 3FSDA 1U5OA 1OF5A 1DYUA 2B24B 4IT7A 1AVKA 1AV4A 2IMJA 3LYGA 1JB5A 4QWTA 3M8CA 5IG5A 5KP3A 1NB3I 1D6ZA 1DMQA 2GBWB 3DGNA 2K0MA 3WOFB 4U13A 2OWPA 1QALA 2W9PA 4J8TA 1US1A 3KN4A 3U97A 5KP4A 3MG3A 3WDGB 4GB5A 3FCSB 4H3UA 2GU1A 3X3YA 4LMIA 4XDVA 1SIHA 2XFTA 4RZMA 5STDA 8CHOA 5AYSC 3HZPA 5I97A 3I563 1NO3A 2CG0A 1ISKA 4FMCA 1N8R4 2ML6A 1KSIA 3UJMA 2RSXA 3DGLA 1WNHA 2W2CA 3CCM3 5IW9A 3NX0A 5IG3A 1S5AA 3D9RA 3LT9A 1L5GB 4L8PA 1OF5B 2CWTA 1JKGA 1GS3A 1OACA 1G96A 5G2GA 1YVBI 1ZO2A 2D42A 4N6TA 3CPW2 1ROVA 3F7SA 3OWYA 1OHSA 2CWVA 3DMCA 1Q7Y4 3CC43 3G0KA 4HM3B 2OOVC 4MJDA 1OCVA 1ULJB 2Z76A 1YGEA 2F86B 3EB8A 2P09A 3EQQB 3FH1A 3TDGA 2OTL3 5IENA 2INXA 2LQVA 2YFJB 4NREA 2BO9B 4FMAA 3LT8A 4N6OB 3CC23
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OVM A;  2A15 A;  2YFI B;  4XBX A;  5AIG A;  1W00 A;  5JPP A;  3EN1 B;  3CPO A;  1UUW B;  1AR0 A;  3EBY A;  3EX9 A;  2CKF B;  4R9L A;  5IF6 A;  2GXF A;  4KVH A;  3VSY A;  1JB4 A;  3MSO A;  5AIF A;  4OUQ A;  3FLJ A;  4X2O A;  3K7C A;  3DZL A;  3SOA A;  4L7K A;  3OV4 A;  2XSH B;  5CXO A;  1EA2 A;  3LZA A;  1EG9 B;  1NWW A;  2UX0 A;  5AEW B;  2RFR A;  3F8H A;  3STD A;  1A2K A;  1O7W B;  5FW5 A;  2K54 A;  3NHX A;  3GRD A;  4HM1 B;  4X2H A;  1SJW A;  4N3V A;  1TUH A;  3RGR A;  3OX9 A;  4J9A A;  4HM5 B;  4HM7 B;  3K0Z A;  2CHC A;  5AEU B;  3FZW A;  2STD A;  3H51 A;  3FF2 A;  4HM0 B;  3HK4 A;  1IDP A;  4L8O A;  2GBX B;  1GY5 A;  1E97 A;  4ORL A;  3S5C A;  4HJL B;  5CF1 A;  5D83 A;  3KZT A;  2RCD A;  4IIA A;  1OUN A;  5AI1 A;  3DXO A;  5IG0 A;  2R4I A;  3B4O A;  3ROB A;  2BMR B;  1O7H B;  4Q53 A;  3GZY B;  3MKI A;  4WYK A;  4LEH A;  1NDO B;  5IG4 A;  5D82 A;  5KP1 A;  2XRX B;  1OHO A;  4XM4 A;  2XR8 B;  2Z77 A;  2YFL B;  1OPY A;  3FGY A;  4PEJ A;  3FF0 A;  5DRE A;  5D81 A;  5JPU A;  4HM8 B;  1JN5 A;  3NUV A;  1Z1S A;  1OGZ A;  3F9S A;  1JKG B;  1C7H A;  3B7C A;  3EJV A;  3EC9 A;  3MG1 A;  3NXJ A;  2BNG A;  4HVN A;  3OWS A;  3MG2 A;  1UUV B;  2BMO B;  2HMM B;  1Q40 A;  3VGN A;  3GZB A;  4R9K A;  3EF8 A;  3E99 A;  6STD A;  3JUQ A;  1O7G B;  4CDL A;  4HKV B;  3I0Y A;  3JUM A;  1QMA A;  3Q90 A;  3F40 A;  3ECF A;  2F99 A;  2B1X B;  3G8Z A;  3T8U A;  3T8N A;  2Z7A A;  2RGQ A;  4K1U A;  2HMK B;  3F8X A;  4FCM A;  2QIY A;  2XSO B;  3BLZ A;  3DM8 A;  5BVB A;  3EHC A;  2HMO B;  1ZX2 A;  3MYT A;  3KE7 A;  1E3V A;  1Q42 A;  3F7X A;  2JQ5 A;  3EN8 A;  3G16 A;  3B4P A;  2QGU A;  3UNL A;  3GWR A;  4LGQ A;  3JUO A;  4HM6 B;  1NU3 A;  5CF2 A;  1DMM A;  4XDW A;  3CU3 A;  4K1V A;  1OH0 A;  4FCJ A;  2PZV A;  4R1K A;  3NBR A;  4XBY A;  2BMQ B;  3CNX A;  4I4K A;  3ER7 A;  1OHP A;  5HGR A;  1WQL B;  5CK6 A;  3NM2 A;  1DMN A;  3JUP A;  2HMN B;  4HM4 B;  3WMD A;  1O7M B;  3NV0 A;  3H3H A;  2GEY A;  3SOY A;  2F98 A;  5TGN A;  1ULI B;  5AII A;  1E3R A;  1JB2 A;  2I9W A;  4WWU C;  1OGX A;  7STD A;  4STD A;  1STD A;  1TP6 A;  5IER A;  4WP5 A;  4WYK B;  2HML B;  3A76 A;  3IPT A;  3MHE A;  4HZB B;  1QJG A;  3B8L A;  1GY7 A;  3JUN A;  5DRV A;  5CLK A;  3NV0 B;  1O7N B;  3F14 A;  3DUK A;  4HZ9 B;  3KKG A;  3GZR A;  1JN5 B;  1GYB A;  3KSP A;  5AIH A;  3SED A;  1ASK A;  2HMJ B;  3RGA A;  4XBT A;  1HKX A;  3HX8 A;  1K41 A;  5BXQ A;  1W6Y A;  3CNM A;  3FKA A;  1BUQ A;  3BB9 A;  3GZX B;  5IEP A;  4XB5 A;  5IEO A;  1Q40 B;  3EBT A;  1GY6 A;  1O7P B;  4HM2 B;  1VZZ A;  5EVH A;  3OWU A;  2GEX A;  3OXA A;  1CQS A;  1W02 A;  1W01 A;  3FSD A;  1U5O A;  1OF5 A;  2B24 B;  2IMJ A;  3LYG A;  1JB5 A;  3M8C A;  5IG5 A;  5KP3 A;  1DMQ A;  2GBW B;  4U13 A;  2OWP A;  4J8T A;  5KP4 A;  3MG3 A;  4GB5 A;  4H3U A;  4LMI A;  4XDV A;  4RZM A;  5STD A;  8CHO A;  3HZP A;  1ISK A;  3UJM A;  2W2C A;  5IG3 A;  1S5A A;  3D9R A;  4L8P A;  1OF5 B;  1JKG A;  1GS3 A;  5G2G A;  1ZO2 A;  3OWY A;  3F7S A;  1OHS A;  3DMC A;  3G0K A;  4HM3 B;  4MJD A;  1OCV A;  1ULJ B;  2Z76 A;  2F86 B;  3EQQ B;  3FH1 A;  5IEN A;  2INX A;  2YFJ B; 
#chains in the Genus database with same CATH topology
 4OVM A;  2A15 A;  2YFI B;  4XBX A;  5AIG A;  1W00 A;  1UDI I;  5LC7 A;  5JPP A;  3SLU A;  3CXC 2;  1M90 4;  3EN1 B;  1V58 A;  1STF I;  1UUW B;  3CPO A;  1AR0 A;  1PY3 A;  3G71 3;  2KF5 A;  3EBY A;  3EX9 A;  2MF7 A;  1VQM 3;  1RCK A;  1GD3 A;  3GAX A;  3CCS 3;  2CKF B;  4MEI A;  3WHO A;  3O8Y A;  1RCL A;  1TTO A;  2WGO A;  1RSN A;  4BL2 A;  2F5M A;  4R9L A;  1B2Z A;  5IF6 A;  5RNT A;  1RHL A;  1KQS 2;  5ELJ A;  1UI8 A;  1W7C A;  1V57 A;  2E2V A;  2GXF A;  4KVH A;  1GOV A;  3VSY A;  3A5E A;  2F5W A;  2F56 A;  1JB4 A;  1JV2 B;  1FUW A;  3MSO A;  1LRA A;  2LYX A;  5AIF A;  4OUQ A;  3FLJ A;  4KFF A;  1IK3 A;  2E2T A;  2CX0 A;  3N9H A;  1X1Y A;  4X2O A;  3K7C A;  3DZL A;  3SOA A;  2OQE A;  1BNJ A;  4L7K A;  1TRQ A;  1SQW A;  2H0H A;  3LTB A;  1CYV A;  2XSH B;  3OV4 A;  2CWU A;  5CXO A;  2H0G A;  1JBR A;  1EA2 A;  2GSP A;  1T5Y A;  3LZA A;  1CEW I;  1BRJ A;  5GSP A;  1IVV A;  1EG9 B;  1N5P A;  3D3L A;  1NWW A;  2WO0 A;  2UX0 A;  3X41 A;  3CCQ 3;  5AEW B;  2RFR A;  3F8H A;  1TFO A;  1KC8 4;  3HI7 A;  3STD A;  1RGC A;  4AKY A;  1A2K A;  3U1W A;  1O7W B;  5FW5 A;  1X1X A;  2K54 A;  1TRP A;  2KF3 A;  3NHX A;  1LVN A;  3GRD A;  4HM1 B;  4X2H A;  1S72 3;  1JZO A;  3BND A;  4N6U A;  1BU4 A;  4RNZ A;  1SJW A;  4N3V A;  5BIR A;  1NB5 I;  1TUH A;  4EYC A;  1BVI A;  1BNS A;  1C54 A;  1JNQ A;  1MNL A;  3RGR A;  1WMO A;  3K63 A;  4R4K A;  3OX9 A;  4J9A A;  4HM5 B;  5FGO A;  3KCH A;  1VQN 3;  3X3Z A;  2YX9 A;  4HM7 B;  1PU4 A;  3LTC A;  1Q82 4;  3K0Z A;  1VQL 3;  2CHC A;  1DET A;  3PZW A;  1IQY A;  4N6N B;  3ZFZ A;  5AEU B;  3CC7 3;  2W56 B;  3G4S 3;  1YI2 3;  1BAN A;  3FZW A;  3LTA A;  2CC3 A;  1N8Q A;  2WOH A;  3CMA 3;  3VF1 A;  1NJI 4;  1YGW A;  2STD A;  2JDI H;  3H51 A;  1M9G A;  3I55 3;  3FF2 A;  4J5K A;  1K9M 4;  1LOX A;  3FG3 A;  1RN7 A;  1TFK A;  4HM0 B;  3PCR A;  3HK4 A;  1PFP A;  4FR9 A;  4KFD A;  1Q81 4;  1CYU A;  1IDP A;  4L8O A;  1DVD A;  4R80 A;  1UGI A;  2GBX B;  2XGL A;  2W03 A;  1A2V A;  1GY5 A;  3DGY A;  1R4Y A;  1E97 A;  1YJW 3;  4ORL A;  3S5C A;  3FG4 A;  3SYU A;  4HJL B;  3HIG A;  5CF1 A;  5D83 A;  3KZT A;  2RCD A;  3ALA A;  1ZS7 A;  4N6L A;  3CCE 3;  4HAA A;  4IIA A;  4WHA A;  1OUN A;  1VQQ A;  5AI1 A;  1JJ2 2;  4KZ1 A;  1LOY A;  3DXO A;  1HYF A;  1IV7 A;  1M1X B;  5IG0 A;  2R4I A;  1A90 A;  1QVF 2;  3B4O A;  3S29 A;  3ROB A;  2BMR B;  2CK3 H;  1O7H B;  2OTJ 3;  4Q53 A;  2P0M A;  4O8S A;  4HBR A;  3CCU 3;  4CCV A;  2IYJ A;  3GZY B;  1RMS A;  2RBI A;  1ZGX A;  3MKI A;  4WYK A;  1B20 A;  4LEH A;  1VQ6 3;  2W9Q A;  1NDO B;  2M7O A;  3JVC A;  4OK0 A;  1U8C B;  1YIT 3;  1I8V A;  5IG4 A;  5D82 A;  5KP1 A;  1IVU A;  1WTH A;  2XRX B;  3Q3F A;  1OHO A;  1RRL A;  1YJN 3;  4XM4 A;  2XR8 B;  2C11 A;  1FGR A;  1IT8 A;  3S67 A;  2Z77 A;  3KFQ C;  2L4V A;  4RBN A;  2W04 A;  3EE1 A;  1VQ9 3;  1B2U A;  2YFL B;  1YHQ 3;  1OPY A;  4EBG A;  5EQL A;  1FGQ A;  2XFS A;  3AMO A;  3LML A;  3IMA B;  4EC6 A;  2OQE C;  2CX1 A;  1TIJ A;  3FGY A;  4PEJ A;  3FF0 A;  1VQ8 3;  2C10 A;  1RRH A;  1W4N A;  5DRE A;  2UUG C;  5D81 A;  2P38 A;  4HM8 B;  5JPU A;  1FGT A;  4GHO A;  2QEX 3;  5JBS A;  1JN5 A;  3NUV A;  1W2Z A;  1RKY A;  2O3O A;  3FG1 A;  1Z1S A;  1BRK A;  1LQM B;  1N5H A;  1OGZ A;  1YJ9 3;  1BNE A;  1IVX A;  3PGB A;  3D4A A;  1K28 A;  3F9S A;  1RTU A;  2IUK A;  2ZL8 A;  2FNQ A;  3PYJ A;  4MMY B;  1EEJ A;  1BRG A;  1JKG B;  5M19 A;  5ELU A;  1BNG A;  1C7H A;  1SPU A;  3G6E 3;  3B7C A;  3EJV A;  3EC9 A;  5HOH A;  1IQ8 A;  3MG1 A;  3NXJ A;  1UCL A;  1GOU A;  1LOW A;  2ZHX B;  2BNG A;  4HVN A;  2KF4 A;  1UCJ A;  3OWS A;  1UCK A;  3MG2 A;  1RJO A;  1UUV B;  2BMO B;  2HMM B;  1VQK 3;  3N8B A;  1J2B A;  4O3V A;  1TU5 A;  4N6M A;  4DKI A;  2KF6 A;  1Q40 A;  4WFO A;  1B27 A;  1CH0 A;  1RDS A;  3VGN A;  1RGL A;  1B2X A;  2PNC A;  3GZB A;  2CIU A;  1B2M A;  4R9K A;  3EF8 A;  4J5G A;  3E99 A;  1FUS A;  1I3I A;  5G1L A;  2ZA4 A;  1HZ1 A;  6STD A;  4BTY A;  1JRQ A;  1A2P A;  2CFD A;  1NNV A;  1IT7 A;  3JUQ A;  3LH4 A;  3RNT A;  4AKZ A;  1MWU A;  1O7G B;  4CDL A;  5LC6 A;  1N9J A;  3Q2P A;  5A0O B;  1BSD A;  4HKV B;  3V99 A;  2FXT A;  3CD6 3;  1RN1 A;  3I0Y A;  3CCV 3;  3JUM A;  1QMA A;  3Q90 A;  1T3B A;  3F40 A;  3ECF A;  1IQX A;  4BTW A;  2F99 A;  1M1K 4;  2B1X B;  3G8Z A;  1X1U A;  3T8U A;  3T8N A;  3KII A;  3PS8 A;  1YVS A;  1SII A;  2AAE A;  4BTX A;  1VQO 3;  1FZU A;  1MWR A;  2Z7A A;  1YNV X;  2ZDJ A;  6GSP A;  1RNT A;  2L1S A;  2RGQ A;  4K1U A;  1R4C A;  1V74 A;  2HMK B;  1LXE A;  3F8X A;  1AVL A;  2D1W A;  2P05 A;  4FCM A;  4FMB A;  2QIY A;  2XSO B;  1D6Y A;  3BLZ A;  3DM8 A;  4G1M B;  4NHF A;  3UL5 A;  1GMR A;  3EHC A;  4BIR A;  5BVB A;  1SAR A;  2HMO B;  1TJD A;  1MOL A;  2KCD A;  3WA3 A;  3X3X A;  2J8X B;  1ZX2 A;  3IJE B;  3MYT A;  3QK9 A;  1QAK A;  4IPB A;  1I0V A;  4AEQ A;  4K90 B;  3KE7 A;  3SVA A;  4RNT A;  2BIR A;  4EV5 A;  4LZI A;  4CPK A;  1UCI A;  1VQ5 3;  1E3V A;  1Q42 A;  5M1A A;  1PYL A;  3F7X A;  1RGH A;  2JQ5 A;  4MMZ B;  1QVG 2;  2CFW A;  2CFG A;  3EN8 A;  2XF3 A;  3G16 A;  1D6U A;  1UI7 A;  1BSE A;  2CFL A;  3B4P A;  3DGM A;  4ILF A;  2QGU A;  2F4Y A;  2HOH A;  3UNL A;  3RDE A;  1MGW A;  2IA7 A;  3GWR A;  1FGM A;  4LGQ A;  1FGO A;  1MWT A;  3JUO A;  4FCZ A;  3PXM A;  4HM6 B;  1RNB A;  2BU4 A;  1NU3 A;  5CF2 A;  3WOD G;  3D5G A;  1DMM A;  2KAA A;  4XDW A;  2Q07 A;  2Z6B A;  1RLS A;  2WOF A;  1VQP 3;  3CU3 A;  4K1V A;  1OH0 A;  4FCJ A;  2PZV A;  3BNE A;  2GU3 A;  4R1K A;  1K8A 4;  1W6C A;  4JF8 A;  4KFE A;  3T0U A;  3K5T A;  3NBR A;  1KWI A;  3UL6 A;  1F8N A;  1LNI A;  4XBY A;  1W2B 2;  2Y73 A;  2BMQ B;  3CNX A;  3L0R A;  1VQ7 3;  1GSP A;  1BSA A;  4I4K A;  3ER7 A;  1OHP A;  5HGR A;  3SX1 A;  1WQL B;  2XH9 A;  5CK6 A;  1MWS A;  4EXR A;  3NBB A;  3NM2 A;  1RN4 A;  4JRF A;  1DMN A;  1FYS A;  4HYZ A;  5AYR B;  3DGO A;  4TX4 A;  3MPH A;  3JUP A;  3K9M C;  3UB1 A;  1DVC A;  3ZG0 A;  2HMN B;  4HM4 B;  4MMX B;  3KSE D;  4K61 A;  1O7M B;  3WMD A;  3NV0 A;  3H3H A;  2C4B A;  2BHM A;  1LNH A;  1K73 4;  1I0X A;  1X1W A;  2GEY A;  3SOY A;  2F98 A;  5TGN A;  4EV2 A;  2AAD A;  1BAO A;  2R41 A;  3LTD A;  5EEO A;  1JBT A;  3X40 A;  1IYY A;  1RGG A;  1ULI B;  3S28 A;  5AII A;  1E3R A;  1G02 A;  1JB2 A;  3LOY A;  2KRT A;  2SAR A;  1Q86 4;  1BSC A;  1GD4 A;  2I9W A;  4WWU C;  1OGX A;  1Y4K A;  1IVW A;  2WGQ A;  3DY5 A;  8RNT A;  3GSP A;  7STD A;  4STD A;  1STD A;  1YIJ 3;  3SXX A;  1TP6 A;  3AGN A;  1AY7 A;  2RNT A;  5IER A;  4GL6 A;  1T2H A;  4I5Q A;  1EQK A;  4WP5 A;  4WYK B;  2HML B;  2BT3 A;  3A76 A;  1BNR A;  3IPT A;  2OCT A;  1MGR A;  4CJN A;  2V1L A;  3MHE A;  3NM7 A;  4FMD A;  1QAF A;  3Q1C A;  4O2H A;  4HZB B;  1QJG A;  3B8L A;  1KD1 4;  1GY7 A;  3CCR 3;  4N6V 0;  3X42 A;  3WOE B;  1HU9 A;  3JUN A;  2W6J H;  5DRV A;  3LXU X;  5CLK A;  1DE3 A;  2KXG A;  3HII A;  5BU4 A;  3AMO B;  3NV0 B;  1O7N B;  1G0T A;  6RNT A;  3V92 A;  3BNB A;  1FW7 A;  2ML5 A;  4RNY A;  3F14 A;  3CME 3;  2CFK A;  3J7Y d;  3DUK A;  4HZ9 B;  1VQ4 3;  3KKG A;  3GZR A;  2CH9 A;  1JN5 B;  1GYB A;  3KSP A;  3AHS A;  5AIH A;  3SED A;  3V98 A;  7RNT A;  4LSO A;  7GSP A;  1ASK A;  2OOV A;  2HMJ B;  3NQY A;  2K3D A;  1N9E A;  4BU4 A;  3RGA A;  3DH2 A;  4XBT A;  2QA4 3;  1HKX A;  2E2U A;  3HX8 A;  4O02 B;  1K41 A;  5BXQ A;  3NQZ A;  1UGH I;  3OW2 2;  1W6Y A;  2W56 A;  1RGF A;  3CNM A;  5M18 A;  2CW9 A;  3FKA A;  1FA3 A;  3D79 A;  1BUQ A;  2XGN A;  1W6G A;  3URP A;  3BB9 A;  2P0X A;  4EW5 A;  1ROA A;  1IU7 A;  1WMP A;  3GZX B;  5IEP A;  2XEP A;  4XB5 A;  1UW1 A;  1BUJ A;  5IEO A;  1A67 A;  1IV9 A;  1W5Z A;  1Q40 B;  2IUJ A;  3EBT A;  1EKM A;  3AGO A;  1GY6 A;  2SBL A;  4ZM8 A;  1BIR A;  1O7P B;  1WMN A;  2FGT A;  4HM2 B;  1VZZ A;  5EVH A;  3OWU A;  3N54 B;  4BL3 A;  2W0Q A;  1RGE A;  1AQZ A;  2H0I A;  1T2I A;  3QRD A;  2GEX A;  3NBJ A;  3OXA A;  2Y74 A;  3PCS A;  4H61 A;  3WA2 X;  1CQS A;  1BNI A;  2MC8 A;  3S27 A;  4NPB A;  1BOX A;  1W02 A;  1GOY A;  1W01 A;  2CG1 A;  3CCJ 3;  3MWZ A;  1BRI A;  1I70 A;  3CCL 3;  3BNC A;  2IY2 A;  1Q9E A;  2O9U X;  3FSD A;  1U5O A;  1OF5 A;  1DYU A;  2B24 B;  4IT7 A;  1BGS A;  1GMP A;  1Q7H A;  1AVK A;  1BRN L;  1AV4 A;  1FUT A;  2IMJ A;  1BNF A;  1JB5 A;  3LYG A;  4QWT A;  1BRS A;  3M8C A;  3BIR A;  5IG5 A;  1RGA A;  2UGI A;  5KP3 A;  1NB3 I;  4GSP A;  1D6Z A;  1DMQ A;  2GBW B;  1RGK A;  2K0M A;  3DGN A;  4HOH A;  3WOF B;  3WR2 A;  4U13 A;  2OWP A;  1I2G A;  1QAL A;  2W9P A;  4J8T A;  1US1 A;  3KN4 A;  3U97 A;  5KP4 A;  4LYL B;  3MG3 A;  3WDG B;  4GB5 A;  3FCS B;  1JZD A;  1UUG B;  4H3U A;  2GU1 A;  3X3Y A;  4LMI A;  4XDV A;  3ZG5 A;  1SIH A;  2XFT A;  4RZM A;  5STD A;  8CHO A;  5AYS C;  3HZP A;  5I97 A;  3I56 3;  1NO3 A;  3HOH A;  2CG0 A;  1ISK A;  1GMQ A;  4FMC A;  1N8R 4;  2ML6 A;  1KSI A;  3UJM A;  1EUI C;  1LOV A;  2RSX A;  3DGL A;  1WNH A;  2W2C A;  1B21 A;  3CCM 3;  5IW9 A;  3NX0 A;  5IG3 A;  1S5A A;  3D9R A;  3LT9 A;  1L5G B;  4L8P A;  1OF5 B;  2CWT A;  1JKG A;  1GS3 A;  1OAC A;  1G96 A;  5G2G A;  1ZO2 A;  1YVB I;  1I2F A;  2D42 A;  4N6T A;  9RNT A;  3CPW 2;  1ROV A;  3F7S A;  3OWY A;  5G1K A;  1OHS A;  1I2E A;  2CWV A;  1JBS A;  1BSB A;  3D5I A;  3DMC A;  1Q7Y 4;  3CC4 3;  3G0K A;  4HM3 B;  2OOV C;  4MJD A;  1OCV A;  1ULJ B;  1BRH A;  2Z76 A;  1YGE A;  2F86 B;  3EB8 A;  2P09 A;  1B2S A;  1I3F A;  3EQQ B;  3FH1 A;  3AHW A;  1B3S A;  3TDG A;  5IEN A;  2OTL 3;  2INX A;  2LQV A;  2YFJ B;  4NRE A;  4KT3 B;  1LQG C;  2BO9 B;  4FMA A;  3LT8 A;  3BU4 A;  4N6O B;  3CC2 3; 
#chains in the Genus database with same CATH homology
 4OVM A;  2A15 A;  2YFI B;  4XBX A;  5AIG A;  1W00 A;  5JPP A;  5LC7 A;  3CXC 2;  3SLU A;  1M90 4;  3EN1 B;  3G71 3;  1STF I;  1UUW B;  3CPO A;  1AR0 A;  3EBY A;  3EX9 A;  2MF7 A;  1VQM 3;  3CCS 3;  1GD3 A;  3GAX A;  2CKF B;  4MEI A;  3O8Y A;  2WGO A;  4R9L A;  5IF6 A;  1KQS 2;  5ELJ A;  1UI8 A;  1W7C A;  2E2V A;  2GXF A;  4KVH A;  3VSY A;  1JB4 A;  1JV2 B;  1FUW A;  3MSO A;  2LYX A;  5AIF A;  4OUQ A;  3FLJ A;  4KFF A;  1IK3 A;  2E2T A;  3N9H A;  4X2O A;  3K7C A;  3DZL A;  3SOA A;  2OQE A;  4L7K A;  1SQW A;  3LTB A;  1CYV A;  2XSH B;  3OV4 A;  2CWU A;  5CXO A;  1EA2 A;  1T5Y A;  3LZA A;  1CEW I;  1IVV A;  1EG9 B;  1N5P A;  3D3L A;  1NWW A;  2WO0 A;  2UX0 A;  3X41 A;  3CCQ 3;  5AEW B;  2RFR A;  3F8H A;  1TFO A;  1KC8 4;  3HI7 A;  3STD A;  4AKY A;  1A2K A;  3U1W A;  1O7W B;  5FW5 A;  2K54 A;  3NHX A;  1LVN A;  3GRD A;  4HM1 B;  4X2H A;  1S72 3;  3BND A;  4N6U A;  4RNZ A;  1SJW A;  4N3V A;  1NB5 I;  1TUH A;  4EYC A;  1JNQ A;  1MNL A;  3RGR A;  1WMO A;  3K63 A;  4R4K A;  3OX9 A;  4J9A A;  4HM5 B;  5FGO A;  1VQN 3;  3X3Z A;  2YX9 A;  4HM7 B;  1PU4 A;  3LTC A;  1Q82 4;  3K0Z A;  1VQL 3;  2CHC A;  3PZW A;  1IQY A;  4N6N B;  5AEU B;  3CC7 3;  2W56 B;  3G4S 3;  1YI2 3;  3FZW A;  3LTA A;  2CC3 A;  1N8Q A;  2WOH A;  3CMA 3;  3VF1 A;  1NJI 4;  2STD A;  2JDI H;  3H51 A;  1M9G A;  3I55 3;  3FF2 A;  1K9M 4;  1LOX A;  3FG3 A;  1RN7 A;  1TFK A;  4HM0 B;  3PCR A;  3HK4 A;  1PFP A;  4FR9 A;  4KFD A;  1Q81 4;  1CYU A;  1IDP A;  4L8O A;  1DVD A;  4R80 A;  2GBX B;  2XGL A;  2W03 A;  1A2V A;  1GY5 A;  1E97 A;  1YJW 3;  4ORL A;  3S5C A;  3FG4 A;  4HJL B;  3HIG A;  5CF1 A;  5D83 A;  3KZT A;  2RCD A;  3ALA A;  4N6L A;  3CCE 3;  4WHA A;  4IIA A;  1OUN A;  5AI1 A;  1JJ2 2;  4KZ1 A;  3DXO A;  1IV7 A;  1M1X B;  5IG0 A;  2R4I A;  1A90 A;  1QVF 2;  3B4O A;  3S29 A;  3ROB A;  2BMR B;  2CK3 H;  1O7H B;  2OTJ 3;  4Q53 A;  2P0M A;  4O8S A;  4HBR A;  3CCU 3;  4CCV A;  3GZY B;  3MKI A;  4WYK A;  4LEH A;  1VQ6 3;  2W9Q A;  1NDO B;  2M7O A;  3JVC A;  4OK0 A;  1U8C B;  1YIT 3;  5IG4 A;  5D82 A;  5KP1 A;  1IVU A;  1WTH A;  2XRX B;  1OHO A;  1RRL A;  1YJN 3;  4XM4 A;  2XR8 B;  2C11 A;  1FGR A;  1IT8 A;  3S67 A;  2Z77 A;  3KFQ C;  2L4V A;  4RBN A;  2W04 A;  3EE1 A;  1VQ9 3;  2YFL B;  1YHQ 3;  1OPY A;  4EBG A;  5EQL A;  1FGQ A;  2XFS A;  3AMO A;  3LML A;  3IMA B;  4EC6 A;  2OQE C;  1TIJ A;  3FGY A;  4PEJ A;  3FF0 A;  1VQ8 3;  2C10 A;  1RRH A;  1W4N A;  5DRE A;  5D81 A;  2P38 A;  4HM8 B;  5JPU A;  1FGT A;  2QEX 3;  5JBS A;  1JN5 A;  3NUV A;  1W2Z A;  1RKY A;  2O3O A;  3FG1 A;  1Z1S A;  1N5H A;  1OGZ A;  1YJ9 3;  1IVX A;  3PGB A;  4MMY B;  1K28 A;  3F9S A;  3PYJ A;  2IUK A;  2ZL8 A;  2FNQ A;  1JKG B;  5ELU A;  3G6E 3;  1C7H A;  1SPU A;  3B7C A;  3EJV A;  3EC9 A;  1IQ8 A;  3MG1 A;  3NXJ A;  2BNG A;  4HVN A;  3OWS A;  3MG2 A;  1RJO A;  1UUV B;  2BMO B;  2HMM B;  1VQK 3;  3N8B A;  1J2B A;  4O3V A;  1TU5 A;  4N6M A;  1Q40 A;  4WFO A;  3VGN A;  2PNC A;  3GZB A;  2CIU A;  4R9K A;  3EF8 A;  3E99 A;  6STD A;  4BTY A;  1JRQ A;  2CFD A;  1IT7 A;  3JUQ A;  3LH4 A;  4AKZ A;  1O7G B;  4CDL A;  5LC6 A;  1N9J A;  3Q2P A;  5A0O B;  3V99 A;  4HKV B;  3CD6 3;  2FXT A;  3I0Y A;  3CCV 3;  3JUM A;  1QMA A;  3Q90 A;  3F40 A;  3ECF A;  1IQX A;  4BTW A;  2F99 A;  1M1K 4;  2B1X B;  3G8Z A;  3T8U A;  3T8N A;  3KII A;  3PS8 A;  1SII A;  4BTX A;  1VQO 3;  2Z7A A;  2ZDJ A;  2RGQ A;  4K1U A;  1R4C A;  1V74 A;  2HMK B;  1LXE A;  3F8X A;  1AVL A;  2D1W A;  2P05 A;  4FCM A;  4FMB A;  2QIY A;  2XSO B;  1D6Y A;  3BLZ A;  3DM8 A;  4G1M B;  4NHF A;  3UL5 A;  3EHC A;  5BVB A;  2HMO B;  2KCD A;  1MOL A;  3WA3 A;  3X3X A;  1ZX2 A;  3IJE B;  3MYT A;  3QK9 A;  1QAK A;  4IPB A;  4AEQ A;  4K90 B;  3KE7 A;  3SVA A;  4EV5 A;  4LZI A;  1VQ5 3;  1E3V A;  1Q42 A;  3F7X A;  2JQ5 A;  4MMZ B;  1QVG 2;  2CFW A;  2CFG A;  3EN8 A;  2XF3 A;  3G16 A;  1D6U A;  1UI7 A;  2CFL A;  3B4P A;  3DGM A;  2QGU A;  3UNL A;  3RDE A;  2IA7 A;  3GWR A;  1FGM A;  4LGQ A;  1FGO A;  3JUO A;  4FCZ A;  3PXM A;  4HM6 B;  1NU3 A;  5CF2 A;  3WOD G;  1DMM A;  4XDW A;  2Q07 A;  2Z6B A;  2WOF A;  1VQP 3;  3CU3 A;  4K1V A;  1OH0 A;  4FCJ A;  2PZV A;  3BNE A;  2GU3 A;  4R1K A;  1K8A 4;  1W6C A;  4JF8 A;  4KFE A;  3T0U A;  3K5T A;  3NBR A;  1KWI A;  3UL6 A;  1F8N A;  4XBY A;  1W2B 2;  2Y73 A;  2BMQ B;  3CNX A;  3L0R A;  1VQ7 3;  4I4K A;  3ER7 A;  1OHP A;  5HGR A;  3SX1 A;  1WQL B;  2XH9 A;  5CK6 A;  4EXR A;  3NBB A;  3NM2 A;  4JRF A;  1DMN A;  4HYZ A;  5AYR B;  3DGO A;  4TX4 A;  3MPH A;  3JUP A;  3K9M C;  3UB1 A;  1DVC A;  2HMN B;  4HM4 B;  4MMX B;  3KSE D;  4K61 A;  1O7M B;  3WMD A;  3NV0 A;  3H3H A;  2BHM A;  1LNH A;  1K73 4;  2GEY A;  3SOY A;  2F98 A;  5TGN A;  4EV2 A;  5EEO A;  3LTD A;  3X40 A;  1ULI B;  3S28 A;  5AII A;  1E3R A;  1JB2 A;  3LOY A;  2KRT A;  1Q86 4;  2I9W A;  1GD4 A;  4WWU C;  1OGX A;  1Y4K A;  1IVW A;  2WGQ A;  3DY5 A;  7STD A;  4STD A;  1STD A;  1YIJ 3;  3SXX A;  1TP6 A;  5IER A;  4GL6 A;  1EQK A;  4WP5 A;  4WYK B;  2HML B;  2BT3 A;  3A76 A;  3IPT A;  2OCT A;  2V1L A;  3MHE A;  3NM7 A;  4FMD A;  1QAF A;  3Q1C A;  4O2H A;  4HZB B;  1QJG A;  3B8L A;  1KD1 4;  1GY7 A;  3CCR 3;  4N6V 0;  3X42 A;  3WOE B;  1HU9 A;  3JUN A;  2W6J H;  5DRV A;  3LXU X;  5CLK A;  2KXG A;  3HII A;  3AMO B;  3NV0 B;  1O7N B;  3V92 A;  3BNB A;  2ML5 A;  4RNY A;  3F14 A;  3CME 3;  2CFK A;  3J7Y d;  3DUK A;  4HZ9 B;  1VQ4 3;  3KKG A;  3GZR A;  2CH9 A;  1JN5 B;  1GYB A;  3KSP A;  5AIH A;  3SED A;  3V98 A;  4LSO A;  1ASK A;  2OOV A;  2HMJ B;  3NQY A;  1N9E A;  3RGA A;  4XBT A;  2QA4 3;  1HKX A;  2E2U A;  3HX8 A;  4O02 B;  1K41 A;  5BXQ A;  3NQZ A;  3OW2 2;  1W6Y A;  2W56 A;  1FA3 A;  3CNM A;  2CW9 A;  3FKA A;  1BUQ A;  2XGN A;  1W6G A;  3BB9 A;  2P0X A;  1ROA A;  1IU7 A;  1WMP A;  3GZX B;  5IEP A;  2XEP A;  4XB5 A;  1UW1 A;  5IEO A;  1A67 A;  1IV9 A;  1W5Z A;  1Q40 B;  2IUJ A;  3EBT A;  1EKM A;  1GY6 A;  2SBL A;  4ZM8 A;  1WMN A;  1O7P B;  2FGT A;  4HM2 B;  1VZZ A;  5EVH A;  3OWU A;  3N54 B;  2W0Q A;  3QRD A;  2GEX A;  3NBJ A;  3OXA A;  2Y74 A;  3PCS A;  4H61 A;  3WA2 X;  1CQS A;  2MC8 A;  3S27 A;  1W02 A;  1W01 A;  2CG1 A;  3CCJ 3;  3MWZ A;  3CCL 3;  3BNC A;  2O9U X;  3FSD A;  1U5O A;  1OF5 A;  1DYU A;  2B24 B;  4IT7 A;  1AVK A;  1AV4 A;  2IMJ A;  3LYG A;  1JB5 A;  4QWT A;  3M8C A;  5IG5 A;  5KP3 A;  1NB3 I;  1D6Z A;  1DMQ A;  2GBW B;  3DGN A;  2K0M A;  3WOF B;  4U13 A;  2OWP A;  1QAL A;  2W9P A;  4J8T A;  1US1 A;  3KN4 A;  3U97 A;  5KP4 A;  3MG3 A;  3WDG B;  4GB5 A;  3FCS B;  4H3U A;  2GU1 A;  3X3Y A;  4LMI A;  4XDV A;  1SIH A;  2XFT A;  4RZM A;  5STD A;  8CHO A;  5AYS C;  3HZP A;  5I97 A;  3I56 3;  1NO3 A;  2CG0 A;  1ISK A;  4FMC A;  1N8R 4;  2ML6 A;  1KSI A;  3UJM A;  2RSX A;  3DGL A;  1WNH A;  2W2C A;  3CCM 3;  5IW9 A;  3NX0 A;  5IG3 A;  1S5A A;  3D9R A;  3LT9 A;  1L5G B;  4L8P A;  1OF5 B;  2CWT A;  1JKG A;  1GS3 A;  1OAC A;  1G96 A;  5G2G A;  1YVB I;  1ZO2 A;  2D42 A;  4N6T A;  3CPW 2;  1ROV A;  3F7S A;  3OWY A;  1OHS A;  2CWV A;  3DMC A;  1Q7Y 4;  3CC4 3;  3G0K A;  4HM3 B;  2OOV C;  4MJD A;  1OCV A;  1ULJ B;  2Z76 A;  1YGE A;  2F86 B;  3EB8 A;  2P09 A;  3EQQ B;  3FH1 A;  3TDG A;  2OTL 3;  5IEN A;  2INX A;  2LQV A;  2YFJ B;  4NRE A;  2BO9 B;  4FMA A;  3LT8 A;  4N6O B;  3CC2 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...