2UX0A

Structure of the oligomerisation domain of calcium-calmodulin dependent protein kinase ii gamma
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
137
structure length
137
Chain Sequence
SMTEDEDLKVRKQEIIKITEQLIEAINNGDFEAYTKICDPGLTSFEPEALGNLVEGMDFHKFYFENLLSKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWLNVHYHCSGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CALCIUM-CALMODULIN DEPENDENT PROTEIN KINASE (CAM KINASE) II
publication title Structure of the Camkiidelta/Calmodulin Complex Reveals the Molecular Mechanism of Camkii Kinase Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 39
structure length 137
sequence length 137
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.11.17: Calcium/calmodulin-dependent protein kinase.
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08332 CaMKII_AD Calcium/calmodulin dependent protein kinase II association domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2ux0A00
1OF5B 3NUVA 5EVHA 3FZWA 3STDA 1ZX2A 3FF0A 5TGNA 4WWUC 8CHOA 2B1XB 2BMOB 3DXOA 4K1VA 3NV0B 4HKVB 4X2HA 2HMLB 3H51A 5IF6A 2QIYA 4FCJA 3MG2A 1QJGA 1HKXA 3JUNA 2CHCA 6STDA 1OHOA 3OV4A 4OUQA 5IENA 3MG3A 1TUHA 1OGXA 3BB9A 4XBYA 3M8CA 1ZO2A 3F14A 1O7PB 5AEUB 3EX9A 5KP4A 5D83A 5KP1A 2XSOB 3KSPA 3HX8A 4XDVA 1O7HB 4CDLA 1OHPA 3FF2A 2Z77A 5AIIA 1CQSA 4XM4A 2A15A 1OF5A 5JPPA 4XB5A 3E99A 3GZYB 1U5OA 3MSOA 3LZAA 1EA2A 1K41A 2F86B 3KKGA 3B8LA 4HM6B 3SEDA 3GWRA 4LMIA 3NV0A 3DZLA 4KVHA 2GBWB 3F8XA 3H3HA 4WP5A 4RZMA 1O7WB 2F99A 3EBTA 3FSDA 3G16A 2OWPA 4FCMA 3ER7A 1Q40B 3HZPA 5IG5A 3UNLA 1OGZA 1ASKA 2GEYA 3NM2A 1A2KA 1VZZA 1DMNA 1JB2A 2HMJB 4HVNA 3A76A 4XDWA 2XSHB 4WYKB 1OCVA 2XRXB 2UX0A 5IG4A 1GS3A 5BXQA 4HM8B 4U13A 2Z76A 5CXOA 5HGRA 1GY7A 2BMRB 1W02A 2GBXB 1ULJB 4XBTA 3K0ZA 4HM2B 2W2CA 3MG1A 2STDA 3EHCA 1OUNA 3KE7A 3EN1B 3EQQB 3VSYA 1Q40A 4IIAA 3NXJA 1NWWA 5AIFA 3B7CA 2F98A 5D82A 3K7CA 1JN5B 3EJVA 3WMDA 4HM5B 4HM0B 1NU3A 1JB4A 2YFIB 4LEHA 4WYKA 5D81A 2GXFA 3FGYA 1UUWB 3UJMA 4ORLA 3B4OA 2XR8B 3G0KA 3DM8A 4PEJA 1OHSA 3JUQA 3F7XA 3BLZA 3Q90A 2BMQB 1W6YA 1OH0A 3FLJA 3EC9A 4XBXA 1Q42A 5DRVA 2R4IA 1O7GB 5CF1A 2HMOB 3GRDA 4HJLB 1O7MB 2PZVA 1BUQA 1ISKA 1WQLB 1DMMA 3MHEA 3OWUA 1OPYA 4R1KA 1JKGB 3NHXA 2QGUA 3CNMA 3FKAA 5DREA 5IG3A 1STDA 1GY5A 1GYBA 2YFJB 3CNXA 1SJWA 4HM4B 5AEWB 5AIHA 1IDPA 1JB5A 1GY6A 2JQ5A 4L8OA 4I4KA 2Z7AA 1Z1SA 3IPTA 5CLKA 4R9KA 3RGAA 3EN8A 3EF8A 3KZTA 5AI1A 1DMQA 3OXAA 5CK6A 4X2OA 4K1UA 3ECFA 3OWYA 1E3RA 3HK4A 4HZ9B 5AIGA 3D9RA 3F40A 4HM3B 4LGQA 3VGNA 2INXA 2HMKB 3MYTA 3DMCA 3LYGA 2GEXA 1C7HA 5FW5A 4HM1B 1ULIB 4J9AA 1W00A 1S5AA 1AR0A 3JUOA 1JKGA 3EBYA 5STDA 4STDA 3F9SA 3NBRA 3FH1A 4L8PA 1E97A 5IERA 5G2GA 4MJDA 4H3UA 4GB5A 5KP3A 2BNGA 4L7KA 3S5CA 1O7NB 7STDA 5IG0A 2RGQA 1W01A 3GZBA 3CPOA 3OX9A 3DUKA 2HMNB 3OWSA 2I9WA 4HM7B 4HZBB 1UUVB 3RGRA 3MKIA 1TP6A 3SOAA 1EG9B 3F8HA 4R9LA 1NDOB 3I0YA 4N3VA 2IMJA 1QMAA 3F7SA 3T8UA 1E3VA 3CU3A 2CKFB 2YFLB 3GZRA 1JN5A 3SOYA 2B24B 5JPUA 3GZXB 3G8ZA 3T8NA 5CF2A 3ROBA 5IEPA 2RCDA 2RFRA 2HMMB 3JUMA 4Q53A 3B4PA 2K54A 4OVMA 4J8TA 3JUPA 5BVBA 5IEOA
chains in the Genus database with same CATH superfamily
1OF5B 2LQVA 3NUVA 5EVHA 1ROAA 3CCL3 1G96A 1YJN3 1IQ8A 3FZWA 3A5EA 1MGRA 1RNTA 3STDA 1ZX2A 5AYRB 3FF0A 1B2MA 5TGNA 2OQEA 3N8BA 4NHFA 4FMAA 1IVXA 1BANA 3AGNA 1R4CA 1RGAA 4WWUC 4KFEA 2K3DA 8CHOA 2KCDA 2M7OA 1PYLA 1X1UA 2B1XB 2V1LA 3HOHA 2BMOB 1BNSA 3DXOA 4K1VA 3NV0B 3QK9A 1MWRA 4HKVB 4WHAA 1FUTA 5JBSA 3LT9A 1RGHA 2UUGC 1TRQA 4X2HA 2HMLB 1BAOA 1I2EA 2W0QA 3ZG5A 3CPW2 5EQLA 2H0GA 3H51A 1QAKA 1RGLA 5IF6A 2O9UX 1FA3A 2QIYA 1KD14 1VQL3 2J8XB 4FCJA 3MG2A 4EC6A 4EV5A 1QJGA 1FGQA 1HKXA 3JUNA 1QVF2 1JZDA 1T2HA 2CHCA 6STDA 1OHOA 1EQKA 3OV4A 4BTXA 3CD63 2P05A 5LC7A 4OUQA 2AAEA 5IENA 1JJ22 1RCLA 4RNYA 2KF4A 1FZUA 3KN4A 1ZGXA 2OTJ3 2L1SA 3MG3A 1TUHA 1OGXA 1RN4A 3BB9A 3N54B 3WDGB 2UGIA 1N9JA 4XBYA 1BSDA 4GHOA 3M8CA 1N9EA 1ZO2A 4CCVA 2BU4A 1ROVA 3F14A 1O7PB 5AYSC 5AEUB 1D6ZA 3LTCA 1LNHA 3U1WA 3LXUX 1A67A 1UCKA 3EX9A 2RSXA 3PGBA 3S29A 2W04A 1WNHA 5KP4A 4KZ1A 5D83A 2XSOB 3BNDA 3KSPA 2CFLA 2CFGA 3HX8A 9RNTA 4XDVA 1O7HB 4CDLA 1WTHA 1OHPA 3FG4A 1IK3A 1NB5I 1MNLA 3FF2A 1CEWI 4O3VA 2CH9A 2Z77A 5AIIA 4AEQA 1CQSA 4XM4A 1YJW3 1UUGB 1RN1A 2A15A 1AQZA 1OF5A 1SQWA 2Q07A 1I0XA 5JPPA 1S723 1W6CA 4GL6A 4XB5A 3HIGA 3V98A 3QRDA 3SVAA 4BTWA 2R41A 3BNEA 3E99A 1UGHI 4QWTA 5ELJA 1K8A4 1Q824 4I5QA 3D5GA 1RCKA 1BRGA 2IA7A 1A90A 3AMOB 3GZYB 5BU4A 1FUWA 5EEOA 1LOVA 1U5OA 4R80A 3MSOA 4LZIA 1K734 3LZAA 1EA2A 1K41A 2F86B 2P0XA 1GMQA 3KKGA 3B8LA 4HM6B 3SEDA 3GWRA 1RLSA 3MWZA 3NV0A 1MOLA 1LNIA 2GBWB 3DZLA 4KVHA 1B2XA 3F8XA 1FW7A 2XF3A 3H3HA 1RGEA 5RNTA 4FCZA 1GD4A 2W6JH 4WP5A 1W2B2 1B3SA 4RZMA 1X1YA 1O7WB 2KRTA 1J2BA 2OOVC 2F99A 4LYLB 1Q9EA 3EBTA 3FSDA 3G16A 2OWPA 4CJNA 4FCMA 1WMPA 1IVUA 4R4KA 2XFTA 1RJOA 1U8CB 3ER7A 2W9QA 1Q40B 2IUKA 2W03A 3FCSB 3HZPA 3KSED 3LMLA 1QVG2 4HBRA 3IJEB 1BSAA 3DGMA 1V58A 5IG5A 1SIHA 4HOHA 1G02A 3UNLA 1I70A 1OGZA 3X3XA 5FGOA 1ASKA 1N5HA 3L0RA 2GEYA 3T0UA 3NM2A 1A2KA 3Q3FA 4TX4A 1Q7Y4 2OTL3 1LVNA 1I3IA 3URPA 2P38A 3I553 1G0TA 1VZZA 3NBBA 1DMNA 1JB2A 2HMJB 1BRKA 4HVNA 1BSEA 3G713 2C11A 3A76A 3G6E3 3LTDA 1M1K4 4XDWA 1BRJA 2XSHB 4WYKB 1RRLA 3ZG0A 1YJ93 3S27A 3VF1A 1OCVA 1VQ93 2XRXB 2CC3A 5IW9A 2UX0A 2YX9A 1DETA 5IG4A 1UGIA 2CWUA 1GS3A 5BXQA 1AV4A 1B21A 4HM8B 4U13A 1KQS2 1TRPA 4EXRA 1YIJ3 1BGSA 1IV9A 1I2FA 2WGOA 3AMOA 2Z76A 1AVKA 1PFPA 4NPBA 3PCSA 5CXOA 3PZWA 5HGRA 3UL5A 4JRFA 2ML6A 3FG1A 3S28A 1AY7A 2CX1A 2WOFA 4KFDA 4BL2A 1BUJA 2QA43 1GY7A 2BMRB 1W02A 2RBIA 1GOYA 2GBXB 1BNGA 1ULJB 4O2HA 1X1XA 4XBTA 3RDEA 3GSPA 1EKMA 2IYJA 2MC8A 1BSBA 3K0ZA 2CX0A 4HM2B 2CG0A 2W2CA 1UI7A 3ALAA 1AVLA 2GU3A 2L4VA 1I2GA 3MG1A 3FG3A 4N6UA 3CCQ3 2STDA 3EHCA 3D4AA 1W6GA 1L5GB 1GMRA 1YGEA 1BVIA 1OUNA 3KE7A 1RNBA 3EN1B 3EQQB 1N8R4 3VSYA 1Q40A 4IIAA 3NXJA 2RNTA 4CPKA 1Q7HA 1NWWA 1VQ73 5AIFA 2QEX3 1GD3A 1LXEA 3G4S3 1VQ53 4N6NB 3B7CA 1T5YA 2F98A 3TDGA 3V92A 2W56B 4LMIA 5D82A 3WODG 1N5PA 2CWTA 3K7CA 1B2UA 1IU7A 1JN5B 3EJVA 5LC6A 1GMPA 3WMDA 1K9M4 2BT3A 4HM5B 3D3LA 4HM0B 1FGTA 4BL3A 1NU3A 1JB4A 1Y4KA 3DGOA 1IQYA 3NQZA 1VQQA 2YFIB 3LOYA 2Y74A 1STFI 3DY5A 1HZ1A 4LEHA 2ZL8A 1Q864 4WYKA 1BRSA 5D81A 3NQYA 4K90B 2OOVA 1JRQA 3SYUA 1VQ83 3CCU3 1Q814 1SARA 2GXFA 1I0VA 2W9PA 1JBSA 1T3BA 3FGYA 1UUWB 4MEIA 3UJMA 4ORLA 5I97A 1T2IA 2XFSA 3B4OA 3X42A 3CCR3 3ZFZA 2XR8B 4J5GA 2WO0A 3GAXA 3G0KA 4H61A 1F8NA 3X41A 2XH9A 2F56A 2P0MA 3DM8A 1OHSA 4PEJA 3SLUA 1DYUA 2C10A 1SIIA 3K5TA 3JUQA 2HOHA 3F7XA 2KAAA 2AADA 1DVDA 3BLZA 3Q90A 3DGNA 3V99A 1VQM3 3RNTA 2BMQB 3Q1CA 2IUJA 1YI23 1IVWA 1W6YA 2KF3A 1OH0A 2KF6A 3FLJA 4OK0A 1KSIA 2Y73A 3EC9A 2WOHA 4XBXA 1Q42A 2JDIH 2H0HA 1HU9A 3AHSA 4IT7A 1BNEA 1WMOA 5DRVA 2R4IA 1O7GB 1KWIA 1QAFA 2F4YA 2XEPA 1MWSA 1DVCA 5CF1A 2HMOB 4JF8A 3GRDA 4KFFA 4IPBA 4HJLB 2CFWA 1RGFA 1O7MB 3X3YA 1JZOA 2KF5A 2PZVA 1KC84 1BUQA 3LH4A 1ISKA 1SPUA 4BU4A 1WQLB 2W56A 1DMMA 3MHEA 2K0MA 1VQP3 3PCRA 1W7CA 3OWUA 5A0OB 1OPYA 3WOFB 1VQ43 1YGWA 4R1KA 2LYXA 1JKGB 2OCTA 4N6LA 3NHXA 4O8SA 2QGUA 4RNTA 3UL6A 1IYYA 1BRHA 1B2ZA 1LOWA 1LQGC 4G1MB 4HYZA 3KFQC 3CNMA 1K28A 3FKAA 5DREA 1LRAA 5IG3A 1STDA 1VQK3 2D42A 1YNVX 1GY5A 4BIRA 1GYBA 1MGWA 2BIRA 4N6V0 4O02B 1CYUA 2YFJB 3CNXA 1SJWA 2KXGA 4HAAA 1C54A 1TJDA 2GU1A 1X1WA 2ZDJA 5G1KA 4HM4B 5AEWB 5AIHA 1IDPA 1CYVA 1JB5A 1GY6A 4AKZA 2D1WA 1FGMA 1M904 1RTUA 3SXXA 1TIJA 3NX0A 2JQ5A 4N6TA 4L8OA 4I4KA 1RSNA 2Z7AA 4RNZA 1TFOA 1LOYA 1EEJA 1GOVA 1I3FA 1US1A 1Z1SA 2E2TA 1TTOA 2MF7A 3D5IA 3IPTA 3KCHA 3EN8A 4R9KA 5CLKA 5G1LA 3RGAA 3EF8A 3KZTA 4EBGA 5AI1A 1PY3A 1BRNL 1GOUA 3MPHA 1B2SA 1CH0A 3PS8A 1DMQA 3K9MC 4RBNA 3O8YA 3CC43 1BOXA 2ZHXB 3OXAA 5CK6A 1PU4A 3CCM3 5M18A 3CC73 1NNVA 2CIUA 3CCE3 3IMAB 4X2OA 4K1UA 3BNBA 1NB3I 3ECFA 3OWYA 1VQO3 1YVSA 1HYFA 1LOXA 1E3RA 3HK4A 2Z6BA 1V74A 4DKIA 1JNQA 4HZ9B 5AIGA 3WOEB 4AKYA 2CK3H 3D9RA 2BO9B 3F40A 6RNTA 1BNJA 4EYCA 2GSPA 4HM3B 1FGRA 2H0IA 4LGQA 3VGNA 1NO3A 2INXA 2HMKB 3S67A 3MYTA 2CFKA 3DMCA 3LYGA 2GEXA 2PNCA 1C7HA 5FW5A 3CXC2 3OW22 1UCJA 4EV2A 4HM1B 4ZM8A 1WMNA 1ULIB 1IT7A 1RGKA 2FXTA 4J9AA 1W00A 1S5AA 1AR0A 3EE1A 3KIIA 3JUOA 3CCJ3 3HIIA 1BU4A 1M9GA 1JKGA 2OQEC 3HI7A 1N8QA 3EBYA 3N9HA 5STDA 7RNTA 4STDA 3I563 3F9SA 3NBRA 3BU4A 1BNIA 3FH1A 3WA2X 1B27A 1D6UA 1V57A 1RN7A 1YVBI 3AGOA 2XGLA 1IV7A 2BHMA 2IY2A 4L8PA 3LTAA 4MMXB 2ML5A 1E97A 7GSPA 5IERA 5G2GA 2SARA 4MJDA 5BIRA 1RMSA 1UW1A 1LQMB 4H3UA 3J7Yd 4GB5A 1RGCA 5KP3A 1VQN3 2F5MA 2XGNA 2BNGA 2CWVA 6GSPA 3X40A 4L7KA 3S5CA 1O7NB 1W4NA 3DH2A 1FUSA 3WHOA 2C4BA 7STDA 3Q2PA 5IG0A 2WGQA 3U97A 2RGQA 1W01A 3GZBA 3CPOA 3OX9A 3DUKA 4J5KA 2HMNB 3OWSA 5HOHA 1YIT3 1MWTA 2I9WA 1RDSA 3NBJA 3CC23 4HM7B 3UB1A 1BNFA 4HZBB 1MWUA 1QALA 4LSOA 2CW9A 3WR2A 3K63A 1R4YA 3AHWA 1FYSA 1UUVB 4N6MA 3RGRA 3MKIA 1TP6A 3SOAA 1EG9B 2F5WA 2O3OA 3DGYA 1GSPA 5GSPA 3PXMA 2CG1A 4MMZB 1D6YA 1BIRA 3F8HA 4R9LA 1BSCA 1RRHA 3DGLA 1NDOB 3I0YA 3CMA3 4N3VA 2FGTA 4NREA 1BNRA 3BIRA 2IMJA 4ILFA 1RHLA 1RGGA 2E2VA 3EB8A 1TU5A 3NM7A 1QMAA 4GSPA 1UI8A 2ZA4A 1I8VA 3F7SA 1E3VA 1A2PA 3T8UA 1VQ63 3CU3A 2CKFB 1M1XB 1OACA 4FMBA 2YFLB 3GZRA 1DE3A 2P09A 1W2ZA 2E2UA 3JVCA 3D79A 1JV2B 4N6OB 3X3ZA 8RNTA 1JN5A 3SOYA 1ZS7A 5M19A 4WFOA 2B24B 1EUIC 1FGOA 1JBTA 4BTYA 1RKYA 5JPUA 3GZXB 3G8ZA 4KT3B 3SX1A 3T8NA 5ELUA 2CFDA 4FMDA 4EW5A 1BRIA 4MMYB 5CF2A 1IT8A 3ROBA 4FR9A 1YHQ3 5IEPA 3LT8A 3WA3A 3CME3 1UCLA 2RCDA 3PYJA 1UDII 2RFRA 2HMMB 3LTBA 3JUMA 4FMCA 3BNCA 2SBLA 4Q53A 1IQXA 3B4PA 2K54A 4OVMA 5KP1A 4J8TA 4K61A 3JUPA 1JBRA 1W5ZA 1B20A 2FNQA 5BVBA 3CCV3 3CCS3 1UCIA 1IVVA 1A2VA 1TFKA 1NJI4 5IEOA 5M1AA
chains in the Genus database with same CATH topology
1OF5B 2LQVA 3NUVA 5EVHA 1ROAA 3CCL3 1G96A 1YJN3 1IQ8A 3FZWA 3STDA 1ZX2A 5AYRB 3FF0A 5TGNA 2OQEA 3N8BA 4NHFA 4FMAA 1IVXA 1R4CA 4WWUC 4KFEA 8CHOA 2KCDA 2M7OA 2B1XB 2V1LA 2BMOB 3DXOA 4K1VA 3NV0B 3QK9A 4HKVB 4WHAA 5JBSA 3LT9A 4X2HA 2HMLB 2W0QA 3CPW2 5EQLA 3H51A 1QAKA 5IF6A 2O9UX 1FA3A 2QIYA 1KD14 1VQL3 4FCJA 3MG2A 4EC6A 4EV5A 1QJGA 1FGQA 1HKXA 3JUNA 1QVF2 2CHCA 6STDA 1OHOA 1EQKA 3OV4A 4BTXA 3CD63 2P05A 5LC7A 4OUQA 5IENA 1JJ22 4RNYA 3KN4A 2OTJ3 3MG3A 1TUHA 1OGXA 3N54B 3BB9A 3WDGB 1N9JA 4XBYA 3M8CA 1N9EA 1ZO2A 4CCVA 1ROVA 3F14A 1O7PB 5AYSC 5AEUB 1D6ZA 3LTCA 1LNHA 3U1WA 3LXUX 1A67A 3EX9A 2RSXA 3PGBA 3S29A 2W04A 1WNHA 5KP4A 4KZ1A 5D83A 2XSOB 3BNDA 3KSPA 2CFLA 2CFGA 3HX8A 5KP1A 4XDVA 1O7HB 4CDLA 1WTHA 1OHPA 3FG4A 1IK3A 1NB5I 1MNLA 3FF2A 1CEWI 4O3VA 2CH9A 2Z77A 5AIIA 4AEQA 1CQSA 4XM4A 1YJW3 2A15A 1OF5A 1SQWA 2Q07A 5JPPA 1S723 1W6CA 4GL6A 4XB5A 3HIGA 3V98A 3QRDA 3SVAA 4BTWA 3BNEA 3E99A 5ELJA 4QWTA 1K8A4 1Q824 2IA7A 1A90A 3AMOB 3GZYB 1FUWA 5EEOA 1U5OA 4R80A 3MSOA 4LZIA 1K734 3LZAA 1EA2A 1K41A 2F86B 2P0XA 3KKGA 3B8LA 4HM6B 3SEDA 3GWRA 4LMIA 3MWZA 3NV0A 1MOLA 3DZLA 2GBWB 4KVHA 3F8XA 2XF3A 3H3HA 4FCZA 1GD4A 2W6JH 4WP5A 1W2B2 4RZMA 1O7WB 2KRTA 1J2BA 2OOVC 2F99A 3EBTA 3FSDA 3G16A 2OWPA 4FCMA 1WMPA 1IVUA 4R4KA 2XFTA 1RJOA 1U8CB 3ER7A 2W9QA 1Q40B 2IUKA 2W03A 3FCSB 3HZPA 3KSED 3LMLA 1QVG2 4HBRA 3IJEB 3DGMA 5IG5A 1SIHA 3UNLA 1OGZA 3X3XA 5FGOA 1ASKA 1N5HA 3L0RA 2GEYA 3T0UA 3NM2A 1A2KA 4TX4A 1Q7Y4 2OTL3 1LVNA 3I553 2P38A 1VZZA 3NBBA 1DMNA 1JB2A 2HMJB 4HVNA 3G713 3G6E3 2C11A 3A76A 3LTDA 1M1K4 4XDWA 2XSHB 4WYKB 1RRLA 1YJ93 3S27A 3VF1A 1OCVA 1VQ93 2XRXB 2CC3A 5IW9A 2UX0A 2YX9A 5IG4A 2CWUA 1GS3A 5BXQA 1AV4A 4HM8B 1KQS2 4U13A 4EXRA 1YIJ3 1IV9A 2WGOA 3AMOA 2Z76A 1AVKA 1PFPA 5CXOA 3PCSA 5HGRA 3PZWA 3UL5A 4JRFA 2ML6A 3FG1A 3S28A 4KFDA 2WOFA 2QA43 1GY7A 2BMRB 1W02A 2GBXB 1ULJB 4O2HA 3RDEA 4XBTA 1EKMA 2MC8A 3K0ZA 4HM2B 2CG0A 2W2CA 1UI7A 3ALAA 1AVLA 2GU3A 2L4VA 3MG1A 4N6UA 3FG3A 3CCQ3 2STDA 3EHCA 1W6GA 1L5GB 1YGEA 1OUNA 3KE7A 3EN1B 3EQQB 1N8R4 3VSYA 1Q40A 4IIAA 3NXJA 1NWWA 1VQ73 5AIFA 2QEX3 1GD3A 1LXEA 3G4S3 1VQ53 4N6NB 3B7CA 1T5YA 2F98A 3TDGA 3V92A 2W56B 5D82A 3WODG 1N5PA 2CWTA 3K7CA 1IU7A 1JN5B 3EJVA 5LC6A 3WMDA 1K9M4 2BT3A 4HM5B 3D3LA 4HM0B 1FGTA 1NU3A 1JB4A 1Y4KA 3DGOA 1IQYA 3NQZA 2YFIB 3LOYA 2Y74A 1STFI 3DY5A 4LEHA 2ZL8A 1Q864 4WYKA 5D81A 3NQYA 4K90B 2OOVA 1JRQA 1VQ83 3CCU3 1Q814 2GXFA 2W9PA 3FGYA 1UUWB 4MEIA 3UJMA 4ORLA 5I97A 2XFSA 3B4OA 3X42A 3CCR3 2XR8B 2WO0A 3GAXA 3G0KA 4H61A 1F8NA 3X41A 2XH9A 2P0MA 3DM8A 4PEJA 1OHSA 3SLUA 1DYUA 2C10A 1SIIA 3K5TA 3JUQA 3F7XA 1DVDA 3BLZA 3Q90A 3DGNA 3V99A 1VQM3 2BMQB 3Q1CA 2IUJA 1YI23 1IVWA 1W6YA 1OH0A 3FLJA 4OK0A 1KSIA 2Y73A 3EC9A 2WOHA 4XBXA 1Q42A 2JDIH 1HU9A 4IT7A 1WMOA 5DRVA 2R4IA 1O7GB 1KWIA 1QAFA 2XEPA 1DVCA 5CF1A 2HMOB 4JF8A 3GRDA 4KFFA 4IPBA 4HJLB 2CFWA 1O7MB 3X3YA 2PZVA 1KC84 1BUQA 3LH4A 1ISKA 1SPUA 1WQLB 2W56A 1DMMA 3MHEA 2K0MA 1VQP3 3PCRA 1W7CA 3OWUA 5A0OB 1OPYA 3WOFB 1VQ43 4R1KA 2LYXA 1JKGB 2OCTA 4N6LA 3NHXA 4O8SA 2QGUA 3UL6A 4G1MB 4HYZA 3KFQC 3CNMA 1K28A 3FKAA 5DREA 5IG3A 1STDA 1VQK3 2D42A 1GY5A 1GYBA 4N6V0 4O02B 1CYUA 2YFJB 3CNXA 1SJWA 2KXGA 2GU1A 2ZDJA 4HM4B 5AEWB 5AIHA 1IDPA 1CYVA 1JB5A 1GY6A 4AKZA 2D1WA 1FGMA 1M904 3SXXA 1TIJA 3NX0A 2JQ5A 4N6TA 4L8OA 4I4KA 2Z7AA 4RNZA 1TFOA 1US1A 1Z1SA 2E2TA 2MF7A 3IPTA 4R9KA 5CLKA 3RGAA 3EN8A 3EF8A 3KZTA 4EBGA 5AI1A 3MPHA 3PS8A 1DMQA 3K9MC 4RBNA 3O8YA 3CC43 3OXAA 5CK6A 1PU4A 3CCM3 3CC73 2CIUA 3CCE3 3IMAB 4X2OA 4K1UA 3BNBA 1NB3I 3ECFA 3OWYA 1VQO3 1LOXA 1E3RA 3HK4A 2Z6BA 1V74A 1JNQA 4HZ9B 5AIGA 3WOEB 4AKYA 2CK3H 3D9RA 2BO9B 3F40A 4EYCA 4HM3B 1FGRA 4LGQA 3VGNA 2INXA 1NO3A 2HMKB 3S67A 3MYTA 2CFKA 3DMCA 3LYGA 2GEXA 2PNCA 1C7HA 5FW5A 3CXC2 3OW22 4EV2A 4HM1B 4ZM8A 1WMNA 1ULIB 1IT7A 2FXTA 4J9AA 1W00A 1S5AA 1AR0A 3EE1A 3KIIA 3JUOA 3CCJ3 3HIIA 1M9GA 1JKGA 2OQEC 3HI7A 1N8QA 3EBYA 3N9HA 5STDA 4STDA 3I563 3F9SA 3NBRA 3FH1A 3WA2X 1D6UA 1YVBI 1RN7A 2XGLA 1IV7A 2BHMA 4L8PA 3LTAA 4MMXB 2ML5A 1E97A 5IERA 5G2GA 4MJDA 1UW1A 4H3UA 3J7Yd 4GB5A 1VQN3 5KP3A 2XGNA 2BNGA 2CWVA 3X40A 4L7KA 3S5CA 1O7NB 1W4NA 7STDA 3Q2PA 5IG0A 2WGQA 3U97A 2RGQA 1W01A 3GZBA 3CPOA 3OX9A 3DUKA 2HMNB 3OWSA 1YIT3 2I9WA 3NBJA 3CC23 4HM7B 3UB1A 4HZBB 1QALA 4LSOA 2CW9A 3K63A 1UUVB 4N6MA 3RGRA 3MKIA 1TP6A 3SOAA 1EG9B 2O3OA 3PXMA 2CG1A 4MMZB 1D6YA 3F8HA 4R9LA 1RRHA 3DGLA 1NDOB 3I0YA 3CMA3 4N3VA 2FGTA 4NREA 2IMJA 1TU5A 2E2VA 3EB8A 3NM7A 1QMAA 1UI8A 3F7SA 1E3VA 3T8UA 1VQ63 3CU3A 2CKFB 1M1XB 1OACA 4FMBA 2YFLB 3GZRA 2P09A 1W2ZA 2E2UA 3JVCA 1JV2B 4N6OB 3X3ZA 1JN5A 3SOYA 4WFOA 2B24B 1FGOA 4BTYA 1RKYA 5JPUA 3GZXB 3G8ZA 3T8NA 3SX1A 5ELUA 2CFDA 4FMDA 4MMYB 5CF2A 1IT8A 3ROBA 4FR9A 1YHQ3 5IEPA 3LT8A 3WA3A 3CME3 3PYJA 2RCDA 2RFRA 2HMMB 3LTBA 3JUMA 4FMCA 3BNCA 2SBLA 4Q53A 1IQXA 3B4PA 2K54A 4OVMA 4J8TA 4K61A 3JUPA 1W5ZA 2FNQA 5BVBA 3CCV3 3CCS3 1IVVA 1A2VA 1TFKA 1NJI4 5IEOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OF5 B;  3NUV A;  5EVH A;  3FZW A;  3STD A;  1ZX2 A;  3FF0 A;  5TGN A;  4WWU C;  8CHO A;  2B1X B;  2BMO B;  3DXO A;  4K1V A;  3NV0 B;  4HKV B;  4X2H A;  2HML B;  3H51 A;  5IF6 A;  2QIY A;  4FCJ A;  3MG2 A;  1QJG A;  1HKX A;  3JUN A;  2CHC A;  6STD A;  1OHO A;  3OV4 A;  4OUQ A;  5IEN A;  3MG3 A;  1TUH A;  1OGX A;  3BB9 A;  4XBY A;  3M8C A;  1ZO2 A;  3F14 A;  1O7P B;  5AEU B;  3EX9 A;  5KP4 A;  5D83 A;  5KP1 A;  2XSO B;  3KSP A;  3HX8 A;  4XDV A;  1O7H B;  4CDL A;  1OHP A;  3FF2 A;  2Z77 A;  5AII A;  1CQS A;  4XM4 A;  2A15 A;  1OF5 A;  5JPP A;  4XB5 A;  3E99 A;  3GZY B;  1U5O A;  3MSO A;  3LZA A;  1EA2 A;  1K41 A;  2F86 B;  3KKG A;  3B8L A;  4HM6 B;  3SED A;  3GWR A;  4LMI A;  3NV0 A;  3DZL A;  4KVH A;  2GBW B;  3F8X A;  3H3H A;  4WP5 A;  4RZM A;  1O7W B;  2F99 A;  3EBT A;  3FSD A;  3G16 A;  2OWP A;  4FCM A;  3ER7 A;  1Q40 B;  3HZP A;  5IG5 A;  3UNL A;  1OGZ A;  1ASK A;  2GEY A;  3NM2 A;  1A2K A;  1VZZ A;  1DMN A;  1JB2 A;  2HMJ B;  4HVN A;  3A76 A;  4XDW A;  2XSH B;  4WYK B;  1OCV A;  2XRX B;  2UX0 A;  5IG4 A;  1GS3 A;  5BXQ A;  4HM8 B;  4U13 A;  2Z76 A;  5CXO A;  5HGR A;  1GY7 A;  2BMR B;  1W02 A;  2GBX B;  1ULJ B;  4XBT A;  3K0Z A;  4HM2 B;  2W2C A;  3MG1 A;  2STD A;  3EHC A;  1OUN A;  3KE7 A;  3EN1 B;  3EQQ B;  3VSY A;  1Q40 A;  4IIA A;  3NXJ A;  1NWW A;  5AIF A;  3B7C A;  2F98 A;  5D82 A;  3K7C A;  1JN5 B;  3EJV A;  3WMD A;  4HM5 B;  4HM0 B;  1NU3 A;  1JB4 A;  2YFI B;  4LEH A;  4WYK A;  5D81 A;  2GXF A;  3FGY A;  1UUW B;  3UJM A;  4ORL A;  3B4O A;  2XR8 B;  3G0K A;  3DM8 A;  4PEJ A;  1OHS A;  3JUQ A;  3F7X A;  3BLZ A;  3Q90 A;  2BMQ B;  1W6Y A;  1OH0 A;  3FLJ A;  3EC9 A;  4XBX A;  1Q42 A;  5DRV A;  2R4I A;  1O7G B;  5CF1 A;  2HMO B;  3GRD A;  4HJL B;  1O7M B;  2PZV A;  1BUQ A;  1ISK A;  1WQL B;  1DMM A;  3MHE A;  3OWU A;  1OPY A;  4R1K A;  1JKG B;  3NHX A;  2QGU A;  3CNM A;  3FKA A;  5DRE A;  5IG3 A;  1STD A;  1GY5 A;  1GYB A;  2YFJ B;  3CNX A;  1SJW A;  4HM4 B;  5AEW B;  5AIH A;  1IDP A;  1JB5 A;  1GY6 A;  2JQ5 A;  4L8O A;  4I4K A;  2Z7A A;  1Z1S A;  3IPT A;  5CLK A;  4R9K A;  3RGA A;  3EN8 A;  3EF8 A;  3KZT A;  5AI1 A;  1DMQ A;  3OXA A;  5CK6 A;  4X2O A;  4K1U A;  3ECF A;  3OWY A;  1E3R A;  3HK4 A;  4HZ9 B;  5AIG A;  3D9R A;  3F40 A;  4HM3 B;  4LGQ A;  3VGN A;  2INX A;  2HMK B;  3MYT A;  3DMC A;  3LYG A;  2GEX A;  1C7H A;  5FW5 A;  4HM1 B;  1ULI B;  4J9A A;  1W00 A;  1S5A A;  1AR0 A;  3JUO A;  1JKG A;  3EBY A;  5STD A;  4STD A;  3F9S A;  3NBR A;  3FH1 A;  4L8P A;  1E97 A;  5IER A;  5G2G A;  4MJD A;  4H3U A;  4GB5 A;  5KP3 A;  2BNG A;  4L7K A;  3S5C A;  1O7N B;  7STD A;  5IG0 A;  2RGQ A;  1W01 A;  3GZB A;  3CPO A;  3OX9 A;  3DUK A;  2HMN B;  3OWS A;  2I9W A;  4HM7 B;  4HZB B;  1UUV B;  3RGR A;  3MKI A;  1TP6 A;  3SOA A;  1EG9 B;  3F8H A;  4R9L A;  1NDO B;  3I0Y A;  4N3V A;  2IMJ A;  1QMA A;  3F7S A;  3T8U A;  1E3V A;  3CU3 A;  2CKF B;  2YFL B;  3GZR A;  1JN5 A;  3SOY A;  2B24 B;  5JPU A;  3GZX B;  3G8Z A;  3T8N A;  5CF2 A;  3ROB A;  5IEP A;  2RCD A;  2RFR A;  2HMM B;  3JUM A;  4Q53 A;  3B4P A;  2K54 A;  4OVM A;  4J8T A;  3JUP A;  5BVB A;  5IEO A; 
#chains in the Genus database with same CATH topology
 1OF5 B;  2LQV A;  3NUV A;  5EVH A;  1ROA A;  3CCL 3;  1G96 A;  1YJN 3;  1IQ8 A;  3FZW A;  3A5E A;  1MGR A;  1RNT A;  3STD A;  1ZX2 A;  5AYR B;  3FF0 A;  1B2M A;  5TGN A;  2OQE A;  3N8B A;  4NHF A;  4FMA A;  1IVX A;  1BAN A;  3AGN A;  1R4C A;  1RGA A;  4WWU C;  4KFE A;  2K3D A;  8CHO A;  2KCD A;  2M7O A;  1PYL A;  1X1U A;  2B1X B;  2V1L A;  3HOH A;  2BMO B;  1BNS A;  3DXO A;  4K1V A;  3NV0 B;  3QK9 A;  1MWR A;  4HKV B;  4WHA A;  1FUT A;  5JBS A;  3LT9 A;  1RGH A;  2UUG C;  1TRQ A;  4X2H A;  2HML B;  1BAO A;  1I2E A;  2W0Q A;  3ZG5 A;  3CPW 2;  5EQL A;  2H0G A;  3H51 A;  1QAK A;  1RGL A;  5IF6 A;  2O9U X;  1FA3 A;  2QIY A;  1KD1 4;  1VQL 3;  2J8X B;  4FCJ A;  3MG2 A;  4EC6 A;  4EV5 A;  1QJG A;  1FGQ A;  1HKX A;  3JUN A;  1QVF 2;  1JZD A;  1T2H A;  2CHC A;  6STD A;  1OHO A;  1EQK A;  3OV4 A;  4BTX A;  3CD6 3;  2P05 A;  5LC7 A;  4OUQ A;  2AAE A;  5IEN A;  1JJ2 2;  1RCL A;  4RNY A;  2KF4 A;  1FZU A;  3KN4 A;  1ZGX A;  2OTJ 3;  2L1S A;  3MG3 A;  1TUH A;  1OGX A;  1RN4 A;  3BB9 A;  3N54 B;  3WDG B;  2UGI A;  1N9J A;  4XBY A;  1BSD A;  4GHO A;  3M8C A;  1N9E A;  1ZO2 A;  4CCV A;  2BU4 A;  1ROV A;  3F14 A;  1O7P B;  5AYS C;  5AEU B;  1D6Z A;  3LTC A;  1LNH A;  3U1W A;  3LXU X;  1A67 A;  1UCK A;  3EX9 A;  2RSX A;  3PGB A;  3S29 A;  2W04 A;  1WNH A;  5KP4 A;  4KZ1 A;  5D83 A;  2XSO B;  3BND A;  3KSP A;  2CFL A;  2CFG A;  3HX8 A;  9RNT A;  4XDV A;  1O7H B;  4CDL A;  1WTH A;  1OHP A;  3FG4 A;  1IK3 A;  1NB5 I;  1MNL A;  3FF2 A;  1CEW I;  4O3V A;  2CH9 A;  2Z77 A;  5AII A;  4AEQ A;  1CQS A;  4XM4 A;  1YJW 3;  1UUG B;  1RN1 A;  2A15 A;  1AQZ A;  1OF5 A;  1SQW A;  2Q07 A;  1I0X A;  5JPP A;  1S72 3;  1W6C A;  4GL6 A;  4XB5 A;  3HIG A;  3V98 A;  3QRD A;  3SVA A;  4BTW A;  2R41 A;  3BNE A;  3E99 A;  1UGH I;  4QWT A;  5ELJ A;  1K8A 4;  1Q82 4;  4I5Q A;  3D5G A;  1RCK A;  1BRG A;  2IA7 A;  1A90 A;  3AMO B;  3GZY B;  5BU4 A;  1FUW A;  5EEO A;  1LOV A;  1U5O A;  4R80 A;  3MSO A;  4LZI A;  1K73 4;  3LZA A;  1EA2 A;  1K41 A;  2F86 B;  2P0X A;  1GMQ A;  3KKG A;  3B8L A;  4HM6 B;  3SED A;  3GWR A;  1RLS A;  3MWZ A;  3NV0 A;  1MOL A;  1LNI A;  2GBW B;  3DZL A;  4KVH A;  1B2X A;  3F8X A;  1FW7 A;  2XF3 A;  3H3H A;  1RGE A;  5RNT A;  4FCZ A;  1GD4 A;  2W6J H;  4WP5 A;  1W2B 2;  1B3S A;  4RZM A;  1X1Y A;  1O7W B;  2KRT A;  1J2B A;  2OOV C;  2F99 A;  4LYL B;  1Q9E A;  3EBT A;  3FSD A;  3G16 A;  2OWP A;  4CJN A;  4FCM A;  1WMP A;  1IVU A;  4R4K A;  2XFT A;  1RJO A;  1U8C B;  3ER7 A;  2W9Q A;  1Q40 B;  2IUK A;  2W03 A;  3FCS B;  3HZP A;  3KSE D;  3LML A;  1QVG 2;  4HBR A;  3IJE B;  1BSA A;  3DGM A;  1V58 A;  5IG5 A;  1SIH A;  4HOH A;  1G02 A;  3UNL A;  1I70 A;  1OGZ A;  3X3X A;  5FGO A;  1ASK A;  1N5H A;  3L0R A;  2GEY A;  3T0U A;  3NM2 A;  1A2K A;  3Q3F A;  4TX4 A;  1Q7Y 4;  2OTL 3;  1LVN A;  1I3I A;  3URP A;  2P38 A;  3I55 3;  1G0T A;  1VZZ A;  3NBB A;  1DMN A;  1JB2 A;  2HMJ B;  1BRK A;  4HVN A;  1BSE A;  3G71 3;  2C11 A;  3A76 A;  3G6E 3;  3LTD A;  1M1K 4;  4XDW A;  1BRJ A;  2XSH B;  4WYK B;  1RRL A;  3ZG0 A;  1YJ9 3;  3S27 A;  3VF1 A;  1OCV A;  1VQ9 3;  2XRX B;  2CC3 A;  5IW9 A;  2UX0 A;  2YX9 A;  1DET A;  5IG4 A;  1UGI A;  2CWU A;  1GS3 A;  5BXQ A;  1AV4 A;  1B21 A;  4HM8 B;  4U13 A;  1KQS 2;  1TRP A;  4EXR A;  1YIJ 3;  1BGS A;  1IV9 A;  1I2F A;  2WGO A;  3AMO A;  2Z76 A;  1AVK A;  1PFP A;  4NPB A;  3PCS A;  5CXO A;  3PZW A;  5HGR A;  3UL5 A;  4JRF A;  2ML6 A;  3FG1 A;  3S28 A;  1AY7 A;  2CX1 A;  2WOF A;  4KFD A;  4BL2 A;  1BUJ A;  2QA4 3;  1GY7 A;  2BMR B;  1W02 A;  2RBI A;  1GOY A;  2GBX B;  1BNG A;  1ULJ B;  4O2H A;  1X1X A;  4XBT A;  3RDE A;  3GSP A;  1EKM A;  2IYJ A;  2MC8 A;  1BSB A;  3K0Z A;  2CX0 A;  4HM2 B;  2CG0 A;  2W2C A;  1UI7 A;  3ALA A;  1AVL A;  2GU3 A;  2L4V A;  1I2G A;  3MG1 A;  3FG3 A;  4N6U A;  3CCQ 3;  2STD A;  3EHC A;  3D4A A;  1W6G A;  1L5G B;  1GMR A;  1YGE A;  1BVI A;  1OUN A;  3KE7 A;  1RNB A;  3EN1 B;  3EQQ B;  1N8R 4;  3VSY A;  1Q40 A;  4IIA A;  3NXJ A;  2RNT A;  4CPK A;  1Q7H A;  1NWW A;  1VQ7 3;  5AIF A;  2QEX 3;  1GD3 A;  1LXE A;  3G4S 3;  1VQ5 3;  4N6N B;  3B7C A;  1T5Y A;  2F98 A;  3TDG A;  3V92 A;  2W56 B;  4LMI A;  5D82 A;  3WOD G;  1N5P A;  2CWT A;  3K7C A;  1B2U A;  1IU7 A;  1JN5 B;  3EJV A;  5LC6 A;  1GMP A;  3WMD A;  1K9M 4;  2BT3 A;  4HM5 B;  3D3L A;  4HM0 B;  1FGT A;  4BL3 A;  1NU3 A;  1JB4 A;  1Y4K A;  3DGO A;  1IQY A;  3NQZ A;  1VQQ A;  2YFI B;  3LOY A;  2Y74 A;  1STF I;  3DY5 A;  1HZ1 A;  4LEH A;  2ZL8 A;  1Q86 4;  4WYK A;  1BRS A;  5D81 A;  3NQY A;  4K90 B;  2OOV A;  1JRQ A;  3SYU A;  1VQ8 3;  3CCU 3;  1Q81 4;  1SAR A;  2GXF A;  1I0V A;  2W9P A;  1JBS A;  1T3B A;  3FGY A;  1UUW B;  4MEI A;  3UJM A;  4ORL A;  5I97 A;  1T2I A;  2XFS A;  3B4O A;  3X42 A;  3CCR 3;  3ZFZ A;  2XR8 B;  4J5G A;  2WO0 A;  3GAX A;  3G0K A;  4H61 A;  1F8N A;  3X41 A;  2XH9 A;  2F56 A;  2P0M A;  3DM8 A;  1OHS A;  4PEJ A;  3SLU A;  1DYU A;  2C10 A;  1SII A;  3K5T A;  3JUQ A;  2HOH A;  3F7X A;  2KAA A;  2AAD A;  1DVD A;  3BLZ A;  3Q90 A;  3DGN A;  3V99 A;  1VQM 3;  3RNT A;  2BMQ B;  3Q1C A;  2IUJ A;  1YI2 3;  1IVW A;  1W6Y A;  2KF3 A;  1OH0 A;  2KF6 A;  3FLJ A;  4OK0 A;  1KSI A;  2Y73 A;  3EC9 A;  2WOH A;  4XBX A;  1Q42 A;  2JDI H;  2H0H A;  1HU9 A;  3AHS A;  4IT7 A;  1BNE A;  1WMO A;  5DRV A;  2R4I A;  1O7G B;  1KWI A;  1QAF A;  2F4Y A;  2XEP A;  1MWS A;  1DVC A;  5CF1 A;  2HMO B;  4JF8 A;  3GRD A;  4KFF A;  4IPB A;  4HJL B;  2CFW A;  1RGF A;  1O7M B;  3X3Y A;  1JZO A;  2KF5 A;  2PZV A;  1KC8 4;  1BUQ A;  3LH4 A;  1ISK A;  1SPU A;  4BU4 A;  1WQL B;  2W56 A;  1DMM A;  3MHE A;  2K0M A;  1VQP 3;  3PCR A;  1W7C A;  3OWU A;  5A0O B;  1OPY A;  3WOF B;  1VQ4 3;  1YGW A;  4R1K A;  2LYX A;  1JKG B;  2OCT A;  4N6L A;  3NHX A;  4O8S A;  2QGU A;  4RNT A;  3UL6 A;  1IYY A;  1BRH A;  1B2Z A;  1LOW A;  1LQG C;  4G1M B;  4HYZ A;  3KFQ C;  3CNM A;  1K28 A;  3FKA A;  5DRE A;  1LRA A;  5IG3 A;  1STD A;  1VQK 3;  2D42 A;  1YNV X;  1GY5 A;  4BIR A;  1GYB A;  1MGW A;  2BIR A;  4N6V 0;  4O02 B;  1CYU A;  2YFJ B;  3CNX A;  1SJW A;  2KXG A;  4HAA A;  1C54 A;  1TJD A;  2GU1 A;  1X1W A;  2ZDJ A;  5G1K A;  4HM4 B;  5AEW B;  5AIH A;  1IDP A;  1CYV A;  1JB5 A;  1GY6 A;  4AKZ A;  2D1W A;  1FGM A;  1M90 4;  1RTU A;  3SXX A;  1TIJ A;  3NX0 A;  2JQ5 A;  4N6T A;  4L8O A;  4I4K A;  1RSN A;  2Z7A A;  4RNZ A;  1TFO A;  1LOY A;  1EEJ A;  1GOV A;  1I3F A;  1US1 A;  1Z1S A;  2E2T A;  1TTO A;  2MF7 A;  3D5I A;  3IPT A;  3KCH A;  3EN8 A;  4R9K A;  5CLK A;  5G1L A;  3RGA A;  3EF8 A;  3KZT A;  4EBG A;  5AI1 A;  1PY3 A;  1BRN L;  1GOU A;  3MPH A;  1B2S A;  1CH0 A;  3PS8 A;  1DMQ A;  3K9M C;  4RBN A;  3O8Y A;  3CC4 3;  1BOX A;  2ZHX B;  3OXA A;  5CK6 A;  1PU4 A;  3CCM 3;  5M18 A;  3CC7 3;  1NNV A;  2CIU A;  3CCE 3;  3IMA B;  4X2O A;  4K1U A;  3BNB A;  1NB3 I;  3ECF A;  3OWY A;  1VQO 3;  1YVS A;  1HYF A;  1LOX A;  1E3R A;  3HK4 A;  2Z6B A;  1V74 A;  4DKI A;  1JNQ A;  4HZ9 B;  5AIG A;  3WOE B;  4AKY A;  2CK3 H;  3D9R A;  2BO9 B;  3F40 A;  6RNT A;  1BNJ A;  4EYC A;  2GSP A;  4HM3 B;  1FGR A;  2H0I A;  4LGQ A;  3VGN A;  1NO3 A;  2INX A;  2HMK B;  3S67 A;  3MYT A;  2CFK A;  3DMC A;  3LYG A;  2GEX A;  2PNC A;  1C7H A;  5FW5 A;  3CXC 2;  3OW2 2;  1UCJ A;  4EV2 A;  4HM1 B;  4ZM8 A;  1WMN A;  1ULI B;  1IT7 A;  1RGK A;  2FXT A;  4J9A A;  1W00 A;  1S5A A;  1AR0 A;  3EE1 A;  3KII A;  3JUO A;  3CCJ 3;  3HII A;  1BU4 A;  1M9G A;  1JKG A;  2OQE C;  3HI7 A;  1N8Q A;  3EBY A;  3N9H A;  5STD A;  7RNT A;  4STD A;  3I56 3;  3F9S A;  3NBR A;  3BU4 A;  1BNI A;  3FH1 A;  3WA2 X;  1B27 A;  1D6U A;  1V57 A;  1RN7 A;  1YVB I;  3AGO A;  2XGL A;  1IV7 A;  2BHM A;  2IY2 A;  4L8P A;  3LTA A;  4MMX B;  2ML5 A;  1E97 A;  7GSP A;  5IER A;  5G2G A;  2SAR A;  4MJD A;  5BIR A;  1RMS A;  1UW1 A;  1LQM B;  4H3U A;  3J7Y d;  4GB5 A;  1RGC A;  5KP3 A;  1VQN 3;  2F5M A;  2XGN A;  2BNG A;  2CWV A;  6GSP A;  3X40 A;  4L7K A;  3S5C A;  1O7N B;  1W4N A;  3DH2 A;  1FUS A;  3WHO A;  2C4B A;  7STD A;  3Q2P A;  5IG0 A;  2WGQ A;  3U97 A;  2RGQ A;  1W01 A;  3GZB A;  3CPO A;  3OX9 A;  3DUK A;  4J5K A;  2HMN B;  3OWS A;  5HOH A;  1YIT 3;  1MWT A;  2I9W A;  1RDS A;  3NBJ A;  3CC2 3;  4HM7 B;  3UB1 A;  1BNF A;  4HZB B;  1MWU A;  1QAL A;  4LSO A;  2CW9 A;  3WR2 A;  3K63 A;  1R4Y A;  3AHW A;  1FYS A;  1UUV B;  4N6M A;  3RGR A;  3MKI A;  1TP6 A;  3SOA A;  1EG9 B;  2F5W A;  2O3O A;  3DGY A;  1GSP A;  5GSP A;  3PXM A;  2CG1 A;  4MMZ B;  1D6Y A;  1BIR A;  3F8H A;  4R9L A;  1BSC A;  1RRH A;  3DGL A;  1NDO B;  3I0Y A;  3CMA 3;  4N3V A;  2FGT A;  4NRE A;  1BNR A;  3BIR A;  2IMJ A;  4ILF A;  1RHL A;  1RGG A;  2E2V A;  3EB8 A;  1TU5 A;  3NM7 A;  1QMA A;  4GSP A;  1UI8 A;  2ZA4 A;  1I8V A;  3F7S A;  1E3V A;  1A2P A;  3T8U A;  1VQ6 3;  3CU3 A;  2CKF B;  1M1X B;  1OAC A;  4FMB A;  2YFL B;  3GZR A;  1DE3 A;  2P09 A;  1W2Z A;  2E2U A;  3JVC A;  3D79 A;  1JV2 B;  4N6O B;  3X3Z A;  8RNT A;  1JN5 A;  3SOY A;  1ZS7 A;  5M19 A;  4WFO A;  2B24 B;  1EUI C;  1FGO A;  1JBT A;  4BTY A;  1RKY A;  5JPU A;  3GZX B;  3G8Z A;  4KT3 B;  3SX1 A;  3T8N A;  5ELU A;  2CFD A;  4FMD A;  4EW5 A;  1BRI A;  4MMY B;  5CF2 A;  1IT8 A;  3ROB A;  4FR9 A;  1YHQ 3;  5IEP A;  3LT8 A;  3WA3 A;  3CME 3;  1UCL A;  2RCD A;  3PYJ A;  1UDI I;  2RFR A;  2HMM B;  3LTB A;  3JUM A;  4FMC A;  3BNC A;  2SBL A;  4Q53 A;  1IQX A;  3B4P A;  2K54 A;  4OVM A;  5KP1 A;  4J8T A;  4K61 A;  3JUP A;  1JBR A;  1W5Z A;  1B20 A;  2FNQ A;  5BVB A;  3CCV 3;  3CCS 3;  1UCI A;  1IVV A;  1A2V A;  1TFK A;  1NJI 4;  5IEO A;  5M1A A; 
#chains in the Genus database with same CATH homology
 1OF5 B;  2LQV A;  3NUV A;  5EVH A;  1ROA A;  3CCL 3;  1G96 A;  1YJN 3;  1IQ8 A;  3FZW A;  3STD A;  1ZX2 A;  5AYR B;  3FF0 A;  5TGN A;  2OQE A;  3N8B A;  4NHF A;  4FMA A;  1IVX A;  1R4C A;  4WWU C;  4KFE A;  8CHO A;  2KCD A;  2M7O A;  2B1X B;  2V1L A;  2BMO B;  3DXO A;  4K1V A;  3NV0 B;  3QK9 A;  4HKV B;  4WHA A;  5JBS A;  3LT9 A;  4X2H A;  2HML B;  2W0Q A;  3CPW 2;  5EQL A;  3H51 A;  1QAK A;  5IF6 A;  2O9U X;  1FA3 A;  2QIY A;  1KD1 4;  1VQL 3;  4FCJ A;  3MG2 A;  4EC6 A;  4EV5 A;  1QJG A;  1FGQ A;  1HKX A;  3JUN A;  1QVF 2;  2CHC A;  6STD A;  1OHO A;  1EQK A;  3OV4 A;  4BTX A;  3CD6 3;  2P05 A;  5LC7 A;  4OUQ A;  5IEN A;  1JJ2 2;  4RNY A;  3KN4 A;  2OTJ 3;  3MG3 A;  1TUH A;  1OGX A;  3N54 B;  3BB9 A;  3WDG B;  1N9J A;  4XBY A;  3M8C A;  1N9E A;  1ZO2 A;  4CCV A;  1ROV A;  3F14 A;  1O7P B;  5AYS C;  5AEU B;  1D6Z A;  3LTC A;  1LNH A;  3U1W A;  3LXU X;  1A67 A;  3EX9 A;  2RSX A;  3PGB A;  3S29 A;  2W04 A;  1WNH A;  5KP4 A;  4KZ1 A;  5D83 A;  2XSO B;  3BND A;  3KSP A;  2CFL A;  2CFG A;  3HX8 A;  5KP1 A;  4XDV A;  1O7H B;  4CDL A;  1WTH A;  1OHP A;  3FG4 A;  1IK3 A;  1NB5 I;  1MNL A;  3FF2 A;  1CEW I;  4O3V A;  2CH9 A;  2Z77 A;  5AII A;  4AEQ A;  1CQS A;  4XM4 A;  1YJW 3;  2A15 A;  1OF5 A;  1SQW A;  2Q07 A;  5JPP A;  1S72 3;  1W6C A;  4GL6 A;  4XB5 A;  3HIG A;  3V98 A;  3QRD A;  3SVA A;  4BTW A;  3BNE A;  3E99 A;  5ELJ A;  4QWT A;  1K8A 4;  1Q82 4;  2IA7 A;  1A90 A;  3AMO B;  3GZY B;  1FUW A;  5EEO A;  1U5O A;  4R80 A;  3MSO A;  4LZI A;  1K73 4;  3LZA A;  1EA2 A;  1K41 A;  2F86 B;  2P0X A;  3KKG A;  3B8L A;  4HM6 B;  3SED A;  3GWR A;  4LMI A;  3MWZ A;  3NV0 A;  1MOL A;  3DZL A;  2GBW B;  4KVH A;  3F8X A;  2XF3 A;  3H3H A;  4FCZ A;  1GD4 A;  2W6J H;  4WP5 A;  1W2B 2;  4RZM A;  1O7W B;  2KRT A;  1J2B A;  2OOV C;  2F99 A;  3EBT A;  3FSD A;  3G16 A;  2OWP A;  4FCM A;  1WMP A;  1IVU A;  4R4K A;  2XFT A;  1RJO A;  1U8C B;  3ER7 A;  2W9Q A;  1Q40 B;  2IUK A;  2W03 A;  3FCS B;  3HZP A;  3KSE D;  3LML A;  1QVG 2;  4HBR A;  3IJE B;  3DGM A;  5IG5 A;  1SIH A;  3UNL A;  1OGZ A;  3X3X A;  5FGO A;  1ASK A;  1N5H A;  3L0R A;  2GEY A;  3T0U A;  3NM2 A;  1A2K A;  4TX4 A;  1Q7Y 4;  2OTL 3;  1LVN A;  3I55 3;  2P38 A;  1VZZ A;  3NBB A;  1DMN A;  1JB2 A;  2HMJ B;  4HVN A;  3G71 3;  3G6E 3;  2C11 A;  3A76 A;  3LTD A;  1M1K 4;  4XDW A;  2XSH B;  4WYK B;  1RRL A;  1YJ9 3;  3S27 A;  3VF1 A;  1OCV A;  1VQ9 3;  2XRX B;  2CC3 A;  5IW9 A;  2UX0 A;  2YX9 A;  5IG4 A;  2CWU A;  1GS3 A;  5BXQ A;  1AV4 A;  4HM8 B;  1KQS 2;  4U13 A;  4EXR A;  1YIJ 3;  1IV9 A;  2WGO A;  3AMO A;  2Z76 A;  1AVK A;  1PFP A;  5CXO A;  3PCS A;  5HGR A;  3PZW A;  3UL5 A;  4JRF A;  2ML6 A;  3FG1 A;  3S28 A;  4KFD A;  2WOF A;  2QA4 3;  1GY7 A;  2BMR B;  1W02 A;  2GBX B;  1ULJ B;  4O2H A;  3RDE A;  4XBT A;  1EKM A;  2MC8 A;  3K0Z A;  4HM2 B;  2CG0 A;  2W2C A;  1UI7 A;  3ALA A;  1AVL A;  2GU3 A;  2L4V A;  3MG1 A;  4N6U A;  3FG3 A;  3CCQ 3;  2STD A;  3EHC A;  1W6G A;  1L5G B;  1YGE A;  1OUN A;  3KE7 A;  3EN1 B;  3EQQ B;  1N8R 4;  3VSY A;  1Q40 A;  4IIA A;  3NXJ A;  1NWW A;  1VQ7 3;  5AIF A;  2QEX 3;  1GD3 A;  1LXE A;  3G4S 3;  1VQ5 3;  4N6N B;  3B7C A;  1T5Y A;  2F98 A;  3TDG A;  3V92 A;  2W56 B;  5D82 A;  3WOD G;  1N5P A;  2CWT A;  3K7C A;  1IU7 A;  1JN5 B;  3EJV A;  5LC6 A;  3WMD A;  1K9M 4;  2BT3 A;  4HM5 B;  3D3L A;  4HM0 B;  1FGT A;  1NU3 A;  1JB4 A;  1Y4K A;  3DGO A;  1IQY A;  3NQZ A;  2YFI B;  3LOY A;  2Y74 A;  1STF I;  3DY5 A;  4LEH A;  2ZL8 A;  1Q86 4;  4WYK A;  5D81 A;  3NQY A;  4K90 B;  2OOV A;  1JRQ A;  1VQ8 3;  3CCU 3;  1Q81 4;  2GXF A;  2W9P A;  3FGY A;  1UUW B;  4MEI A;  3UJM A;  4ORL A;  5I97 A;  2XFS A;  3B4O A;  3X42 A;  3CCR 3;  2XR8 B;  2WO0 A;  3GAX A;  3G0K A;  4H61 A;  1F8N A;  3X41 A;  2XH9 A;  2P0M A;  3DM8 A;  4PEJ A;  1OHS A;  3SLU A;  1DYU A;  2C10 A;  1SII A;  3K5T A;  3JUQ A;  3F7X A;  1DVD A;  3BLZ A;  3Q90 A;  3DGN A;  3V99 A;  1VQM 3;  2BMQ B;  3Q1C A;  2IUJ A;  1YI2 3;  1IVW A;  1W6Y A;  1OH0 A;  3FLJ A;  4OK0 A;  1KSI A;  2Y73 A;  3EC9 A;  2WOH A;  4XBX A;  1Q42 A;  2JDI H;  1HU9 A;  4IT7 A;  1WMO A;  5DRV A;  2R4I A;  1O7G B;  1KWI A;  1QAF A;  2XEP A;  1DVC A;  5CF1 A;  2HMO B;  4JF8 A;  3GRD A;  4KFF A;  4IPB A;  4HJL B;  2CFW A;  1O7M B;  3X3Y A;  2PZV A;  1KC8 4;  1BUQ A;  3LH4 A;  1ISK A;  1SPU A;  1WQL B;  2W56 A;  1DMM A;  3MHE A;  2K0M A;  1VQP 3;  3PCR A;  1W7C A;  3OWU A;  5A0O B;  1OPY A;  3WOF B;  1VQ4 3;  4R1K A;  2LYX A;  1JKG B;  2OCT A;  4N6L A;  3NHX A;  4O8S A;  2QGU A;  3UL6 A;  4G1M B;  4HYZ A;  3KFQ C;  3CNM A;  1K28 A;  3FKA A;  5DRE A;  5IG3 A;  1STD A;  1VQK 3;  2D42 A;  1GY5 A;  1GYB A;  4N6V 0;  4O02 B;  1CYU A;  2YFJ B;  3CNX A;  1SJW A;  2KXG A;  2GU1 A;  2ZDJ A;  4HM4 B;  5AEW B;  5AIH A;  1IDP A;  1CYV A;  1JB5 A;  1GY6 A;  4AKZ A;  2D1W A;  1FGM A;  1M90 4;  3SXX A;  1TIJ A;  3NX0 A;  2JQ5 A;  4N6T A;  4L8O A;  4I4K A;  2Z7A A;  4RNZ A;  1TFO A;  1US1 A;  1Z1S A;  2E2T A;  2MF7 A;  3IPT A;  4R9K A;  5CLK A;  3RGA A;  3EN8 A;  3EF8 A;  3KZT A;  4EBG A;  5AI1 A;  3MPH A;  3PS8 A;  1DMQ A;  3K9M C;  4RBN A;  3O8Y A;  3CC4 3;  3OXA A;  5CK6 A;  1PU4 A;  3CCM 3;  3CC7 3;  2CIU A;  3CCE 3;  3IMA B;  4X2O A;  4K1U A;  3BNB A;  1NB3 I;  3ECF A;  3OWY A;  1VQO 3;  1LOX A;  1E3R A;  3HK4 A;  2Z6B A;  1V74 A;  1JNQ A;  4HZ9 B;  5AIG A;  3WOE B;  4AKY A;  2CK3 H;  3D9R A;  2BO9 B;  3F40 A;  4EYC A;  4HM3 B;  1FGR A;  4LGQ A;  3VGN A;  2INX A;  1NO3 A;  2HMK B;  3S67 A;  3MYT A;  2CFK A;  3DMC A;  3LYG A;  2GEX A;  2PNC A;  1C7H A;  5FW5 A;  3CXC 2;  3OW2 2;  4EV2 A;  4HM1 B;  4ZM8 A;  1WMN A;  1ULI B;  1IT7 A;  2FXT A;  4J9A A;  1W00 A;  1S5A A;  1AR0 A;  3EE1 A;  3KII A;  3JUO A;  3CCJ 3;  3HII A;  1M9G A;  1JKG A;  2OQE C;  3HI7 A;  1N8Q A;  3EBY A;  3N9H A;  5STD A;  4STD A;  3I56 3;  3F9S A;  3NBR A;  3FH1 A;  3WA2 X;  1D6U A;  1YVB I;  1RN7 A;  2XGL A;  1IV7 A;  2BHM A;  4L8P A;  3LTA A;  4MMX B;  2ML5 A;  1E97 A;  5IER A;  5G2G A;  4MJD A;  1UW1 A;  4H3U A;  3J7Y d;  4GB5 A;  1VQN 3;  5KP3 A;  2XGN A;  2BNG A;  2CWV A;  3X40 A;  4L7K A;  3S5C A;  1O7N B;  1W4N A;  7STD A;  3Q2P A;  5IG0 A;  2WGQ A;  3U97 A;  2RGQ A;  1W01 A;  3GZB A;  3CPO A;  3OX9 A;  3DUK A;  2HMN B;  3OWS A;  1YIT 3;  2I9W A;  3NBJ A;  3CC2 3;  4HM7 B;  3UB1 A;  4HZB B;  1QAL A;  4LSO A;  2CW9 A;  3K63 A;  1UUV B;  4N6M A;  3RGR A;  3MKI A;  1TP6 A;  3SOA A;  1EG9 B;  2O3O A;  3PXM A;  2CG1 A;  4MMZ B;  1D6Y A;  3F8H A;  4R9L A;  1RRH A;  3DGL A;  1NDO B;  3I0Y A;  3CMA 3;  4N3V A;  2FGT A;  4NRE A;  2IMJ A;  1TU5 A;  2E2V A;  3EB8 A;  3NM7 A;  1QMA A;  1UI8 A;  3F7S A;  1E3V A;  3T8U A;  1VQ6 3;  3CU3 A;  2CKF B;  1M1X B;  1OAC A;  4FMB A;  2YFL B;  3GZR A;  2P09 A;  1W2Z A;  2E2U A;  3JVC A;  1JV2 B;  4N6O B;  3X3Z A;  1JN5 A;  3SOY A;  4WFO A;  2B24 B;  1FGO A;  4BTY A;  1RKY A;  5JPU A;  3GZX B;  3G8Z A;  3T8N A;  3SX1 A;  5ELU A;  2CFD A;  4FMD A;  4MMY B;  5CF2 A;  1IT8 A;  3ROB A;  4FR9 A;  1YHQ 3;  5IEP A;  3LT8 A;  3WA3 A;  3CME 3;  3PYJ A;  2RCD A;  2RFR A;  2HMM B;  3LTB A;  3JUM A;  4FMC A;  3BNC A;  2SBL A;  4Q53 A;  1IQX A;  3B4P A;  2K54 A;  4OVM A;  4J8T A;  4K61 A;  3JUP A;  1W5Z A;  2FNQ A;  5BVB A;  3CCV 3;  3CCS 3;  1IVV A;  1A2V A;  1TFK A;  1NJI 4;  5IEO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...