1BRNL

Subsite binding in an rnase: structure of a barnase-tetranucleotide complex at 1.76 angstroms resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*CP*GP*AP*C)-3')
publication title Subsite binding in an RNase: structure of a barnase-tetranucleotide complex at 1.76-A resolution.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase/dna
total genus 28
structure length 108
sequence length 108
chains with identical sequence M
ec nomenclature ec 3.1.27.-:
pdb deposition date 1993-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1brnL00
1BU4A 1BNJA 1RHLA 4RNTA 1UCKA 3HOHA 1BRIA 2F56A 1RDSA 1BANA 1TRPA 1BNRA 1G02A 1YVSA 3D5IA 1BRHA 1BIRA 2F5WA 4J5KA 1BNIA 1FZUA 3BIRA 3GSPA 1RGHA 2C4BA 1UCLA 1BRJA 1A2PA 1R4YA 2SARA 1BOXA 3D4AA 1GMQA 3RNTA 1RMSA 1B21A 1LNIA 2AAEA 2ZA4A 2AADA 1RGLA 5GSPA 2GSPA 1RN1A 1RGFA 1BSEA 1HZ1A 1RCKA 1RLSA 1BRGA 1UCIA 4GHOA 5HOHA 1RGEA 1JBSA 1X1UA 1I3IA 1AY7A 1FUSA 1Q9EA 1C54A 1I3FA 1B2SA 1I8VA 2BIRA 5RNTA 2KF6A 1GSPA 2BU4A 1BSAA 1FW7A 5BIRA 9RNTA 1X1XA 1BRNL 2RNTA 1BSBA 1MGRA 1RGAA 7RNTA 1LOWA 2F4YA 3AHWA 1I0XA 1T2IA 1RCLA 1BGSA 1RNTA 1GOYA 1YNVX 1BNEA 4HOHA 1B2UA 1CH0A 1YGWA 1B2XA 1FUTA 1RSNA 1BNGA 1LOYA 1RTUA 6RNTA 3DGYA 1LRAA 2RBIA 3A5EA 1BRSA 1T2HA 1JBRA 1PY3A 1X1YA 1UCJA 1B3SA 3AGNA 1BNSA 2KAAA 1IYYA 1I0VA 4GSPA 1HYFA 1ZGXA 1B2ZA 3Q3FA 3BU4A 1JBTA 1SARA 3SYUA 1X1WA 1B2MA 3D5GA 1DETA 1BUJA 1GOUA 2KF3A 4BIRA 1GOVA 8RNTA 1LOVA 1GMPA 3WR2A 1BRKA 5BU4A 1RGGA 1BSDA 1RGKA 2KF4A 1DE3A 1GMRA 1BAOA 1I70A 1FYSA 2F5MA 4J5GA 4BU4A 3AHSA 1PYLA 1MGWA 3KCHA 6GSPA 1TRQA 1I2EA 7GSPA 1I2FA 1B20A 3DH2A 1RN4A 3AGOA 4HAAA 3WHOA 1BNFA 1AQZA 2HOHA 2KF5A 1I2GA 1RNBA 1B27A 1TTOA 3URPA 1BSCA 1BVIA 1RGCA
chains in the Genus database with same CATH superfamily
3PCRA 3G6E3 1W6GA 1OF5A 1UCKA 3DMCA 1OHPA 5JBSA 2F98A 4FMAA 2C10A 3D5IA 4J5KA 4H61A 4RNZA 3FG3A 1BNIA 3FG4A 5LC6A 3MWZA 2CX1A 5M1AA 1DMQA 1RGHA 4HYZA 1Q864 1GY7A 1Z1SA 1O7WB 1OHOA 1V58A 2GXFA 2YX9A 1LXEA 3KIIA 3D4AA 1K41A 3JUOA 3CCQ3 2I9WA 1VQ93 2M7OA 4EBGA 1VQQA 1NNVA 2CC3A 2AAEA 1EEJA 3K5TA 4K90B 1LQGC 1GYBA 5AIGA 2Z7AA 1EG9B 1RJOA 5GSPA 4CDLA 3CCE3 2BO9B 1R4CA 2KRTA 1BSEA 1RCKA 4LYLB 4NPBA 1RLSA 2H0IA 2XSHB 3OX9A 1K734 1RRHA 3GZBA 1RGEA 1UGHI 3LYGA 3G0KA 1X1UA 3DGOA 1QVG2 1I3IA 4XBTA 1Q9EA 3STDA 1DYUA 4HM4B 1UI8A 3HIGA 1KD14 1HU9A 3F9SA 5RNTA 2BIRA 2BMRB 3S27A 1YGEA 4EW5A 2BHMA 5D81A 5IW9A 3LMLA 3T0UA 1SIHA 4N6NB 1GY6A 1X1XA 1BRNL 3OWYA 1ZX2A 2RNTA 1EUIC 3KZTA 5G2GA 1LOWA 3CXC2 3NBRA 2K54A 1VQO3 3CCS3 1I0XA 3CCV3 3H3HA 1LVNA 1S5AA 3F40A 1YNVX 3KFQC 3UNLA 1JKGB 3CPOA 1JZOA 4MEIA 1B2XA 1E3VA 2CFLA 1RSNA 3UB1A 4ZM8A 1LOYA 4LZIA 3FF2A 3HZPA 1O7HB 4WP5A 4LGQA 4O2HA 1PY3A 1X1YA 1UCJA 3AGNA 4O8SA 1BNSA 1NB5I 2GBWB 1F8NA 1KSIA 3WMDA 4MMZB 1KC84 3EX9A 1RN7A 2QIYA 4GSPA 1YVBI 1HYFA 3SOAA 2KCDA 3NBBA 3Q3FA 1JBTA 2BNGA 3SYUA 1VQ43 2ZDJA 2W9PA 2E2UA 4XBXA 1NO3A 3FLJA 1GOVA 3NHXA 8RNTA 1GMPA 4RBNA 5KP3A 1BRKA 5BU4A 1W2B2 1W01A 3T8NA 1ROAA 2P38A 1DE3A 2MF7A 3WODG 1BAOA 1T5YA 2OQEC 1O7NB 2INXA 2W0QA 1FYSA 1W6YA 2FNQA 1W02A 3LTAA 3MPHA 2IUJA 3V92A 5KP4A 4BU4A 2JQ5A 1PYLA 1MGWA 1Q40B 1ULIB 2PNCA 1TRQA 1IVUA 2IA7A 2Z6BA 3HK4A 4AEQA 4XBYA 4CPKA 1NB3I 3IJEB 3ZFZA 3CC43 4HAAA 5BXQA 4R1KA 4FCMA 4NREA 1WTHA 4HM6B 4I4KA 5IF6A 3SLUA 1GS3A 5G1KA 3PYJA 1M1K4 1AVKA 2D1WA 1LNHA 2OWPA 3D9RA 3QK9A 1RGCA 1C7HA 4X2HA 3BNEA 1JN5A 2P09A 1D6UA 1RHLA 1WMPA 3EN8A 2XGLA 3FF0A 4ORLA 4EC6A 1WQLB 2FXTA 3BLZA 3HOHA 3FG1A 1BRIA 5G1LA 2F56A 1RDSA 2XEPA 3KSED 1YVSA 4MMYB 3B8LA 1BRHA 1A90A 1ISKA 2UUGC 4R80A 4HJLB 2CFDA 1STFI 3MSOA 5CK6A 1FZUA 4N6OB 5IG0A 2RGQA 5LC7A 2W9QA 1V74A 1JB5A 5A0OB 2OOVC 1BRJA 3I0YA 1D6YA 2WGOA 3CMA3 1R4YA 2SARA 2YFJB 3NV0A 3FZWA 4LEHA 4IT7A 1QVF2 2V1LA 3GZYB 3RNTA 1RMSA 1OACA 1RKYA 1LNIA 1SQWA 3OV4A 2CK3H 2OCTA 1RRLA 5JPPA 2GSPA 1QAFA 3F14A 3IPTA 3FSDA 1HZ1A 1OCVA 2BMQB 1JB4A 2ZL8A 1TU5A 1BRGA 3Q2PA 4GHOA 1A2KA 3MG3A 1AVLA 1CEWI 4HM2B 2BMOB 1JRQA 3O8YA 4EYCA 1JBSA 1GD3A 2Z77A 3CPW2 1B2SA 1I8VA 3JUQA 1J2BA 1QALA 1W2ZA 3CNXA 3GZRA 1FW7A 1MNLA 5AEUB 3L0RA 4KVHA 3D79A 3G8ZA 4J8TA 1FUWA 1BSBA 2QA43 3GAXA 1MGRA 3DXOA 3A76A 3MG2A 3ALAA 5IEOA 1N9JA 3AHWA 3AMOA 1T2IA 1RNTA 1EKMA 1GOYA 1IV7A 1B2UA 4NHFA 2FGTA 1CH0A 2RCDA 5DRVA 1IK3A 4KT3B 1FGRA 2ML6A 1TUHA 1BNGA 3X3ZA 1NDOB 1YHQ3 4HVNA 1JBRA 3M8CA 3JUPA 3CCL3 1YJW3 5ELUA 4L8OA 2UGIA 1ZGXA 3KE7A 2IYJA 5CXOA 1OH0A 3LTBA 3NXJA 1VQ83 1X1WA 1IV9A 1B2MA 1UI7A 3D5GA 4TX4A 3CCJ3 1STDA 2KF3A 2P05A 2XRXB 4O02B 5D82A 3X42A 3CNMA 4STDA 3WR2A 1ZS7A 4EXRA 1OUNA 2GEXA 4WYKB 2E2TA 2WOHA 2KF4A 4KFEA 2C11A 1DMMA 3N54B 1QMAA 3PGBA 3TDGA 1I70A 1KQS2 3LZAA 3OWSA 4FMCA 2IY2A 1CQSA 1FGMA 1MWSA 3AHSA 1TFKA 2CFKA 4XDWA 1I2EA 1AV4A 1I2FA 2B24B 1JZDA 1OHSA 1TFOA 3DH2A 1RN4A 2D42A 2F99A 4XDVA 1IDPA 2Y73A 3RGRA 3WHOA 3X41A 3CCM3 1EA2A 2HMOB 3NBJA 3WOEB 1A2VA 2HOHA 2W6JH 1N8QA 2XF3A 2R41A 3F7XA 3ZG5A 2KF5A 1VQL3 4FR9A 3URPA 1BSCA 1BVIA 1ZO2A 3DZLA 3EBTA 3LH4A 1VQ53 3G713 1UGIA 4O3VA 1K8A4 1BNJA 8CHOA 1YJ93 4RNTA 1OGZA 4ILFA 3UJMA 3NQYA 1FGQA 4AKYA 4HM3B 1CYUA 1O7GB 3FKAA 1TRPA 1G02A 3WDGB 3QRDA 1BIRA 1OGXA 2CWUA 4GB5A 1ASKA 3EB8A 1LOXA 1E3RA 1PFPA 3WA3A 3GSPA 3Q90A 5IG4A 2C4BA 1JKGA 5AIIA 1UCLA 1E97A 1MWUA 4KFFA 3UL6A 2CWVA 3GZXB 3S28A 4LMIA 1BOXA 5CF2A 5IERA 4WHAA 1GMQA 1W7CA 3ECFA 3NM7A 4N6V0 5TGNA 2XH9A 2JDIH 1IQYA 2OOVA 3BNBA 4CCVA 3LXUX 1N5HA 5IENA 2IMJA 3GRDA 3CD63 2ZA4A 1NWWA 3BB9A 1RGLA 1DMNA 1WNHA 2W04A 3MKIA 1FGOA 2YFLB 2LYXA 1RN1A 3N8BA 5AIHA 3SVAA 1YJN3 2XSOB 3ROBA 4N6LA 5BVBA 5HOHA 1IQXA 3OWUA 1YI23 2W56B 3B4OA 4HZBB 3HI7A 4OK0A 1N8R4 4K61A 4U13A 1K28A 1AY7A 1W4NA 1C54A 3DY5A 2W2CA 3KKGA 2L4VA 3RGAA 1IVVA 1I3FA 1WMOA 3S5CA 2KF6A 1GSPA 3EHCA 2SBLA 4HM1B 5AYRB 2BU4A 2XGNA 3CME3 5BIRA 1Q40A 1K9M4 3CU3A 4HM0B 1RGAA 4N6UA 1JV2B 1UUWB 2F4YA 7RNTA 5STDA 2CIUA 4QWTA 4EV2A 4HM5B 3H51A 3PCSA 1Q42A 1BNEA 3NUVA 4HOHA 2K3DA 4PEJA 4K1UA 3VF1A 1YGWA 1IT8A 1IVWA 1KWIA 1UW1A 1FUTA 3MG1A 1RTUA 2CG1A 1Q824 1ULJB 3B7CA 3WA2X 2LQVA 1LRAA 2RBIA 3A5EA 1T3BA 1T2HA 3EN1B 4WWUC 4DKIA 1US1A 1U5OA 5EQLA 2KAAA 1VZZA 2BT3A 2W56A 1I0VA 5D83A 1U8CB 2GU1A 1B2ZA 3K63A 5FW5A 3BU4A 3X40A 1SARA 2K0MA 1M904 3SEDA 2Y74A 2STDA 5ELJA 1DETA 1BUJA 1GOUA 4JF8A 3T8UA 3ZG0A 2QEX3 3DM8A 5CLKA 2MC8A 2RFRA 1N5PA 4R4KA 3JUMA 4KZ1A 3RDEA 1RGGA 5AI1A 1BSDA 1RGKA 4WFOA 4IPBA 1GMRA 3MYTA 2XFSA 5EVHA 1MOLA 2CWTA 4MJDA 1QJGA 4H3UA 1VQK3 1DVCA 5AEWB 7GSPA 1IQ8A 1GD4A 1NJI4 3U1WA 3AGOA 1VQ73 4BL2A 2P0XA 4HM8B 2RSXA 1AQZA 3F8HA 2H0GA 4JRFA 1RNBA 5IG3A 4BTXA 3HIIA 1TP6A 1TTOA 2CFWA 4EV5A 3V99A 3LTDA 3OXAA 1BU4A 3LOYA 5IEPA 4HZ9B 3SXXA 5KP1A 4X2OA 2ML5A 3E99A 3FCSB 1BANA 5AYSC 3PZWA 4LSOA 1BNRA 4HKVB 3VSYA 2F5WA 3S29A 2O9UX 1SIIA 4BL3A 3BIRA 2J8XB 4RZMA 2F86B 3BNDA 3IMAB 4AKZA 2YFIB 3D3LA 1A2PA 3NM2A 1M1XB 4XB5A 3V98A 3WOFB 2OTJ3 1W00A 1MWRA 1VQN3 5M18A 3S67A 2WO0A 3NX0A 5EEOA 3SX1A 1B21A 3X3YA 2A15A 4FCZA 3VGNA 1CYVA 3EQQB 2OTL3 3ER7A 1L5GB 1BUQA 2AADA 3LT8A 1VQM3 2GU3A 1EQKA 1YIT3 3BNCA 5IG5A 3PXMA 4XM4A 1RGFA 3JVCA 4GL6A 6STDA 1HKXA 1WMNA 2XR8B 2CX0A 2OQEA 1M9GA 1UCIA 1D6ZA 1TJDA 4N3VA 4L8PA 4FMBA 7STDA 1FUSA 4WYKA 4R9KA 3PS8A 1Q814 1G96A 2ZHXB 5CF1A 4L7KA 3KN4A 1SPUA 3SOYA 1BSAA 1A67A 1Q7HA 3NQZA 1JN5B 1G0TA 3GWRA 9RNTA 1O7PB 1IVXA 2HMJB 3B4PA 4I5QA 4KFDA 1Y4KA 3EF8A 1FA3A 2GBXB 4Q53A 1Q7Y4 2QGUA 3F8XA 1W5ZA 2W03A 1RCLA 1BGSA 3EJVA 5HGRA 5JPUA 3LT9A 5DREA 4BTYA 4HM7B 2HMMB 2R4IA 3FH1A 3EBYA 3KSPA 2CHCA 1JJ22 1PU4A 4K1VA 6RNTA 2CKFB 2E2VA 2CW9A 2KXGA 3DGYA 4HBRA 1UDII 3NV0B 1BRSA 3DGLA 1LQMB 3G4S3 1B3SA 2Z76A 3HX8A 4N6TA 1IT7A 2B1XB 1IYYA 3EC9A 4RNYA 1QAKA 1UUGB 2CH9A 4IIAA 3F7SA 1NU3A 2CFGA 1W6CA 3MHEA 5FGOA 3JUNA 2UX0A 1OF5B 3K7CA 2H0HA 2WGQA 1UUVB 3G16A 3Q1CA 3DGNA 1VQ63 1GY5A 1JB2A 1ROVA 4BIRA 1LOVA 4FMDA 3UL5A 4OUQA 3LTCA 5M19A 1SJWA 4CJNA 2HMLB 1YIJ3 1JNQA 2HMKB 1V57A 1IU7A 1AR0A 2L1SA 3DGMA 3EE1A 2CG0A 2PZVA 3N9HA 4J9AA 5I97A 1FGTA 3U97A 4J5GA 2F5MA 3DUKA 3K9MC 2P0MA 3I553 4R9LA 3KCHA 5AIFA 6GSPA 3CCU3 1DVDA 4N6MA 2IUKA 1S723 1MWTA 3X3XA 1B20A 3I563 3OW22 2O3OA 1VQP3 2GEYA 4BTWA 1O7MB 2Q07A 1BNFA 1OPYA 3AMOB 4G1MB 3CC23 3CC73 3FGYA 3K0ZA 1TIJA 2HMNB 1I2GA 4FCJA 4OVMA 1B27A 2XFTA 3J7Yd 2WOFA 3CCR3 1N9EA 4MMXB
chains in the Genus database with same CATH topology
1BU4A 1BNJA 1RHLA 4RNTA 1UCKA 3HOHA 1BRIA 2F56A 1RDSA 1BANA 1TRPA 1BNRA 1G02A 1YVSA 3D5IA 1BRHA 1BIRA 2F5WA 4J5KA 1BNIA 1FZUA 3BIRA 3GSPA 1RGHA 2C4BA 1UCLA 1BRJA 1A2PA 1R4YA 2SARA 1BOXA 3D4AA 1GMQA 3RNTA 1RMSA 1B21A 1LNIA 2AAEA 2ZA4A 2AADA 1RGLA 5GSPA 2GSPA 1RN1A 1RGFA 1BSEA 1HZ1A 1RCKA 1RLSA 1BRGA 1UCIA 4GHOA 5HOHA 1RGEA 1JBSA 1X1UA 1I3IA 1AY7A 1FUSA 1Q9EA 1C54A 1I3FA 1B2SA 1I8VA 2BIRA 5RNTA 2KF6A 1GSPA 2BU4A 1BSAA 1FW7A 5BIRA 9RNTA 1X1XA 1BRNL 2RNTA 1BSBA 1MGRA 1RGAA 7RNTA 1LOWA 2F4YA 3AHWA 1I0XA 1T2IA 1RCLA 1BGSA 1RNTA 1GOYA 1YNVX 1BNEA 4HOHA 1B2UA 1CH0A 1YGWA 1B2XA 1FUTA 1RSNA 1BNGA 1LOYA 1RTUA 6RNTA 3DGYA 1LRAA 2RBIA 3A5EA 1BRSA 1T2HA 1JBRA 1PY3A 1X1YA 1UCJA 1B3SA 3AGNA 1BNSA 2KAAA 1IYYA 1I0VA 4GSPA 1HYFA 1ZGXA 1B2ZA 3Q3FA 3BU4A 1JBTA 1SARA 3SYUA 1X1WA 1B2MA 3D5GA 1DETA 1BUJA 1GOUA 2KF3A 4BIRA 1GOVA 8RNTA 1LOVA 1GMPA 3WR2A 1BRKA 5BU4A 1RGGA 1BSDA 1RGKA 2KF4A 1DE3A 1GMRA 1BAOA 1I70A 1FYSA 2F5MA 4J5GA 4BU4A 3AHSA 1PYLA 1MGWA 3KCHA 6GSPA 1TRQA 1I2EA 7GSPA 1I2FA 1B20A 3DH2A 1RN4A 3AGOA 4HAAA 3WHOA 1BNFA 1AQZA 2HOHA 2KF5A 1I2GA 1RNBA 1B27A 1TTOA 3URPA 1BSCA 1BVIA 1RGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BU4 A;  1BNJ A;  1RHL A;  4RNT A;  1UCK A;  3HOH A;  1BRI A;  2F56 A;  1RDS A;  1BAN A;  1TRP A;  1BNR A;  1G02 A;  1YVS A;  3D5I A;  1BRH A;  1BIR A;  2F5W A;  4J5K A;  1BNI A;  1FZU A;  3BIR A;  3GSP A;  1RGH A;  2C4B A;  1UCL A;  1BRJ A;  1A2P A;  1R4Y A;  2SAR A;  1BOX A;  3D4A A;  1GMQ A;  3RNT A;  1RMS A;  1B21 A;  1LNI A;  2AAE A;  2ZA4 A;  2AAD A;  1RGL A;  5GSP A;  2GSP A;  1RN1 A;  1RGF A;  1BSE A;  1HZ1 A;  1RCK A;  1RLS A;  1BRG A;  1UCI A;  4GHO A;  5HOH A;  1RGE A;  1JBS A;  1X1U A;  1I3I A;  1AY7 A;  1FUS A;  1Q9E A;  1C54 A;  1I3F A;  1B2S A;  1I8V A;  2BIR A;  5RNT A;  2KF6 A;  1GSP A;  2BU4 A;  1BSA A;  1FW7 A;  5BIR A;  9RNT A;  1X1X A;  1BRN L;  2RNT A;  1BSB A;  1MGR A;  1RGA A;  7RNT A;  1LOW A;  2F4Y A;  3AHW A;  1I0X A;  1T2I A;  1RCL A;  1BGS A;  1RNT A;  1GOY A;  1YNV X;  1BNE A;  4HOH A;  1B2U A;  1CH0 A;  1YGW A;  1B2X A;  1FUT A;  1RSN A;  1BNG A;  1LOY A;  1RTU A;  6RNT A;  3DGY A;  1LRA A;  2RBI A;  3A5E A;  1BRS A;  1T2H A;  1JBR A;  1PY3 A;  1X1Y A;  1UCJ A;  1B3S A;  3AGN A;  1BNS A;  2KAA A;  1IYY A;  1I0V A;  4GSP A;  1HYF A;  1ZGX A;  1B2Z A;  3Q3F A;  3BU4 A;  1JBT A;  1SAR A;  3SYU A;  1X1W A;  1B2M A;  3D5G A;  1DET A;  1BUJ A;  1GOU A;  2KF3 A;  4BIR A;  1GOV A;  8RNT A;  1LOV A;  1GMP A;  3WR2 A;  1BRK A;  5BU4 A;  1RGG A;  1BSD A;  1RGK A;  2KF4 A;  1DE3 A;  1GMR A;  1BAO A;  1I70 A;  1FYS A;  2F5M A;  4J5G A;  4BU4 A;  3AHS A;  1PYL A;  1MGW A;  3KCH A;  6GSP A;  1TRQ A;  1I2E A;  7GSP A;  1I2F A;  1B20 A;  3DH2 A;  1RN4 A;  3AGO A;  4HAA A;  3WHO A;  1BNF A;  1AQZ A;  2HOH A;  2KF5 A;  1I2G A;  1RNB A;  1B27 A;  1TTO A;  3URP A;  1BSC A;  1BVI A;  1RGC A; 
#chains in the Genus database with same CATH topology
 3PCR A;  3G6E 3;  1W6G A;  1OF5 A;  1UCK A;  3DMC A;  1OHP A;  5JBS A;  2F98 A;  4FMA A;  2C10 A;  3D5I A;  4J5K A;  4H61 A;  4RNZ A;  3FG3 A;  1BNI A;  3FG4 A;  5LC6 A;  3MWZ A;  2CX1 A;  5M1A A;  1DMQ A;  1RGH A;  4HYZ A;  1Q86 4;  1GY7 A;  1Z1S A;  1O7W B;  1OHO A;  1V58 A;  2GXF A;  2YX9 A;  1LXE A;  3KII A;  3D4A A;  1K41 A;  3JUO A;  3CCQ 3;  2I9W A;  1VQ9 3;  2M7O A;  4EBG A;  1VQQ A;  1NNV A;  2CC3 A;  2AAE A;  1EEJ A;  3K5T A;  4K90 B;  1LQG C;  1GYB A;  5AIG A;  2Z7A A;  1EG9 B;  1RJO A;  5GSP A;  4CDL A;  3CCE 3;  2BO9 B;  1R4C A;  2KRT A;  1BSE A;  1RCK A;  4LYL B;  4NPB A;  1RLS A;  2H0I A;  2XSH B;  3OX9 A;  1K73 4;  1RRH A;  3GZB A;  1RGE A;  1UGH I;  3LYG A;  3G0K A;  1X1U A;  3DGO A;  1QVG 2;  1I3I A;  4XBT A;  1Q9E A;  3STD A;  1DYU A;  4HM4 B;  1UI8 A;  3HIG A;  1KD1 4;  1HU9 A;  3F9S A;  5RNT A;  2BIR A;  2BMR B;  3S27 A;  1YGE A;  4EW5 A;  2BHM A;  5D81 A;  5IW9 A;  3LML A;  3T0U A;  1SIH A;  4N6N B;  1GY6 A;  1X1X A;  1BRN L;  3OWY A;  1ZX2 A;  2RNT A;  1EUI C;  3KZT A;  5G2G A;  1LOW A;  3CXC 2;  3NBR A;  2K54 A;  1VQO 3;  3CCS 3;  1I0X A;  3CCV 3;  3H3H A;  1LVN A;  1S5A A;  3F40 A;  1YNV X;  3KFQ C;  3UNL A;  1JKG B;  3CPO A;  1JZO A;  4MEI A;  1B2X A;  1E3V A;  2CFL A;  1RSN A;  3UB1 A;  4ZM8 A;  1LOY A;  4LZI A;  3FF2 A;  3HZP A;  1O7H B;  4WP5 A;  4LGQ A;  4O2H A;  1PY3 A;  1X1Y A;  1UCJ A;  3AGN A;  4O8S A;  1BNS A;  1NB5 I;  2GBW B;  1F8N A;  1KSI A;  3WMD A;  4MMZ B;  1KC8 4;  3EX9 A;  1RN7 A;  2QIY A;  4GSP A;  1YVB I;  1HYF A;  3SOA A;  2KCD A;  3NBB A;  3Q3F A;  1JBT A;  2BNG A;  3SYU A;  1VQ4 3;  2ZDJ A;  2W9P A;  2E2U A;  4XBX A;  1NO3 A;  3FLJ A;  1GOV A;  3NHX A;  8RNT A;  1GMP A;  4RBN A;  5KP3 A;  1BRK A;  5BU4 A;  1W2B 2;  1W01 A;  3T8N A;  1ROA A;  2P38 A;  1DE3 A;  2MF7 A;  3WOD G;  1BAO A;  1T5Y A;  2OQE C;  1O7N B;  2INX A;  2W0Q A;  1FYS A;  1W6Y A;  2FNQ A;  1W02 A;  3LTA A;  3MPH A;  2IUJ A;  3V92 A;  5KP4 A;  4BU4 A;  2JQ5 A;  1PYL A;  1MGW A;  1Q40 B;  1ULI B;  2PNC A;  1TRQ A;  1IVU A;  2IA7 A;  2Z6B A;  3HK4 A;  4AEQ A;  4XBY A;  4CPK A;  1NB3 I;  3IJE B;  3ZFZ A;  3CC4 3;  4HAA A;  5BXQ A;  4R1K A;  4FCM A;  4NRE A;  1WTH A;  4HM6 B;  4I4K A;  5IF6 A;  3SLU A;  1GS3 A;  5G1K A;  3PYJ A;  1M1K 4;  1AVK A;  2D1W A;  1LNH A;  2OWP A;  3D9R A;  3QK9 A;  1RGC A;  1C7H A;  4X2H A;  3BNE A;  1JN5 A;  2P09 A;  1D6U A;  1RHL A;  1WMP A;  3EN8 A;  2XGL A;  3FF0 A;  4ORL A;  4EC6 A;  1WQL B;  2FXT A;  3BLZ A;  3HOH A;  3FG1 A;  1BRI A;  5G1L A;  2F56 A;  1RDS A;  2XEP A;  3KSE D;  1YVS A;  4MMY B;  3B8L A;  1BRH A;  1A90 A;  1ISK A;  2UUG C;  4R80 A;  4HJL B;  2CFD A;  1STF I;  3MSO A;  5CK6 A;  1FZU A;  4N6O B;  5IG0 A;  2RGQ A;  5LC7 A;  2W9Q A;  1V74 A;  1JB5 A;  5A0O B;  2OOV C;  1BRJ A;  3I0Y A;  1D6Y A;  2WGO A;  3CMA 3;  1R4Y A;  2SAR A;  2YFJ B;  3NV0 A;  3FZW A;  4LEH A;  4IT7 A;  1QVF 2;  2V1L A;  3GZY B;  3RNT A;  1RMS A;  1OAC A;  1RKY A;  1LNI A;  1SQW A;  3OV4 A;  2CK3 H;  2OCT A;  1RRL A;  5JPP A;  2GSP A;  1QAF A;  3F14 A;  3IPT A;  3FSD A;  1HZ1 A;  1OCV A;  2BMQ B;  1JB4 A;  2ZL8 A;  1TU5 A;  1BRG A;  3Q2P A;  4GHO A;  1A2K A;  3MG3 A;  1AVL A;  1CEW I;  4HM2 B;  2BMO B;  1JRQ A;  3O8Y A;  4EYC A;  1JBS A;  1GD3 A;  2Z77 A;  3CPW 2;  1B2S A;  1I8V A;  3JUQ A;  1J2B A;  1QAL A;  1W2Z A;  3CNX A;  3GZR A;  1FW7 A;  1MNL A;  5AEU B;  3L0R A;  4KVH A;  3D79 A;  3G8Z A;  4J8T A;  1FUW A;  1BSB A;  2QA4 3;  3GAX A;  1MGR A;  3DXO A;  3A76 A;  3MG2 A;  3ALA A;  5IEO A;  1N9J A;  3AHW A;  3AMO A;  1T2I A;  1RNT A;  1EKM A;  1GOY A;  1IV7 A;  1B2U A;  4NHF A;  2FGT A;  1CH0 A;  2RCD A;  5DRV A;  1IK3 A;  4KT3 B;  1FGR A;  2ML6 A;  1TUH A;  1BNG A;  3X3Z A;  1NDO B;  1YHQ 3;  4HVN A;  1JBR A;  3M8C A;  3JUP A;  3CCL 3;  1YJW 3;  5ELU A;  4L8O A;  2UGI A;  1ZGX A;  3KE7 A;  2IYJ A;  5CXO A;  1OH0 A;  3LTB A;  3NXJ A;  1VQ8 3;  1X1W A;  1IV9 A;  1B2M A;  1UI7 A;  3D5G A;  4TX4 A;  3CCJ 3;  1STD A;  2KF3 A;  2P05 A;  2XRX B;  4O02 B;  5D82 A;  3X42 A;  3CNM A;  4STD A;  3WR2 A;  1ZS7 A;  4EXR A;  1OUN A;  2GEX A;  4WYK B;  2E2T A;  2WOH A;  2KF4 A;  4KFE A;  2C11 A;  1DMM A;  3N54 B;  1QMA A;  3PGB A;  3TDG A;  1I70 A;  1KQS 2;  3LZA A;  3OWS A;  4FMC A;  2IY2 A;  1CQS A;  1FGM A;  1MWS A;  3AHS A;  1TFK A;  2CFK A;  4XDW A;  1I2E A;  1AV4 A;  1I2F A;  2B24 B;  1JZD A;  1OHS A;  1TFO A;  3DH2 A;  1RN4 A;  2D42 A;  2F99 A;  4XDV A;  1IDP A;  2Y73 A;  3RGR A;  3WHO A;  3X41 A;  3CCM 3;  1EA2 A;  2HMO B;  3NBJ A;  3WOE B;  1A2V A;  2HOH A;  2W6J H;  1N8Q A;  2XF3 A;  2R41 A;  3F7X A;  3ZG5 A;  2KF5 A;  1VQL 3;  4FR9 A;  3URP A;  1BSC A;  1BVI A;  1ZO2 A;  3DZL A;  3EBT A;  3LH4 A;  1VQ5 3;  3G71 3;  1UGI A;  4O3V A;  1K8A 4;  1BNJ A;  8CHO A;  1YJ9 3;  4RNT A;  1OGZ A;  4ILF A;  3UJM A;  3NQY A;  1FGQ A;  4AKY A;  4HM3 B;  1CYU A;  1O7G B;  3FKA A;  1TRP A;  1G02 A;  3WDG B;  3QRD A;  1BIR A;  1OGX A;  2CWU A;  4GB5 A;  1ASK A;  3EB8 A;  1LOX A;  1E3R A;  1PFP A;  3WA3 A;  3GSP A;  3Q90 A;  5IG4 A;  2C4B A;  1JKG A;  5AII A;  1UCL A;  1E97 A;  1MWU A;  4KFF A;  3UL6 A;  2CWV A;  3GZX B;  3S28 A;  4LMI A;  1BOX A;  5CF2 A;  5IER A;  4WHA A;  1GMQ A;  1W7C A;  3ECF A;  3NM7 A;  4N6V 0;  5TGN A;  2XH9 A;  2JDI H;  1IQY A;  2OOV A;  3BNB A;  4CCV A;  3LXU X;  1N5H A;  5IEN A;  2IMJ A;  3GRD A;  3CD6 3;  2ZA4 A;  1NWW A;  3BB9 A;  1RGL A;  1DMN A;  1WNH A;  2W04 A;  3MKI A;  1FGO A;  2YFL B;  2LYX A;  1RN1 A;  3N8B A;  5AIH A;  3SVA A;  1YJN 3;  2XSO B;  3ROB A;  4N6L A;  5BVB A;  5HOH A;  1IQX A;  3OWU A;  1YI2 3;  2W56 B;  3B4O A;  4HZB B;  3HI7 A;  4OK0 A;  1N8R 4;  4K61 A;  4U13 A;  1K28 A;  1AY7 A;  1W4N A;  1C54 A;  3DY5 A;  2W2C A;  3KKG A;  2L4V A;  3RGA A;  1IVV A;  1I3F A;  1WMO A;  3S5C A;  2KF6 A;  1GSP A;  3EHC A;  2SBL A;  4HM1 B;  5AYR B;  2BU4 A;  2XGN A;  3CME 3;  5BIR A;  1Q40 A;  1K9M 4;  3CU3 A;  4HM0 B;  1RGA A;  4N6U A;  1JV2 B;  1UUW B;  2F4Y A;  7RNT A;  5STD A;  2CIU A;  4QWT A;  4EV2 A;  4HM5 B;  3H51 A;  3PCS A;  1Q42 A;  1BNE A;  3NUV A;  4HOH A;  2K3D A;  4PEJ A;  4K1U A;  3VF1 A;  1YGW A;  1IT8 A;  1IVW A;  1KWI A;  1UW1 A;  1FUT A;  3MG1 A;  1RTU A;  2CG1 A;  1Q82 4;  1ULJ B;  3B7C A;  3WA2 X;  2LQV A;  1LRA A;  2RBI A;  3A5E A;  1T3B A;  1T2H A;  3EN1 B;  4WWU C;  4DKI A;  1US1 A;  1U5O A;  5EQL A;  2KAA A;  1VZZ A;  2BT3 A;  2W56 A;  1I0V A;  5D83 A;  1U8C B;  2GU1 A;  1B2Z A;  3K63 A;  5FW5 A;  3BU4 A;  3X40 A;  1SAR A;  2K0M A;  1M90 4;  3SED A;  2Y74 A;  2STD A;  5ELJ A;  1DET A;  1BUJ A;  1GOU A;  4JF8 A;  3T8U A;  3ZG0 A;  2QEX 3;  3DM8 A;  5CLK A;  2MC8 A;  2RFR A;  1N5P A;  4R4K A;  3JUM A;  4KZ1 A;  3RDE A;  1RGG A;  5AI1 A;  1BSD A;  1RGK A;  4WFO A;  4IPB A;  1GMR A;  3MYT A;  2XFS A;  5EVH A;  1MOL A;  2CWT A;  4MJD A;  1QJG A;  4H3U A;  1VQK 3;  1DVC A;  5AEW B;  7GSP A;  1IQ8 A;  1GD4 A;  1NJI 4;  3U1W A;  3AGO A;  1VQ7 3;  4BL2 A;  2P0X A;  4HM8 B;  2RSX A;  1AQZ A;  3F8H A;  2H0G A;  4JRF A;  1RNB A;  5IG3 A;  4BTX A;  3HII A;  1TP6 A;  1TTO A;  2CFW A;  4EV5 A;  3V99 A;  3LTD A;  3OXA A;  1BU4 A;  3LOY A;  5IEP A;  4HZ9 B;  3SXX A;  5KP1 A;  4X2O A;  2ML5 A;  3E99 A;  3FCS B;  1BAN A;  5AYS C;  3PZW A;  4LSO A;  1BNR A;  4HKV B;  3VSY A;  2F5W A;  3S29 A;  2O9U X;  1SII A;  4BL3 A;  3BIR A;  2J8X B;  4RZM A;  2F86 B;  3BND A;  3IMA B;  4AKZ A;  2YFI B;  3D3L A;  1A2P A;  3NM2 A;  1M1X B;  4XB5 A;  3V98 A;  3WOF B;  2OTJ 3;  1W00 A;  1MWR A;  1VQN 3;  5M18 A;  3S67 A;  2WO0 A;  3NX0 A;  5EEO A;  3SX1 A;  1B21 A;  3X3Y A;  2A15 A;  4FCZ A;  3VGN A;  1CYV A;  3EQQ B;  2OTL 3;  3ER7 A;  1L5G B;  1BUQ A;  2AAD A;  3LT8 A;  1VQM 3;  2GU3 A;  1EQK A;  1YIT 3;  3BNC A;  5IG5 A;  3PXM A;  4XM4 A;  1RGF A;  3JVC A;  4GL6 A;  6STD A;  1HKX A;  1WMN A;  2XR8 B;  2CX0 A;  2OQE A;  1M9G A;  1UCI A;  1D6Z A;  1TJD A;  4N3V A;  4L8P A;  4FMB A;  7STD A;  1FUS A;  4WYK A;  4R9K A;  3PS8 A;  1Q81 4;  1G96 A;  2ZHX B;  5CF1 A;  4L7K A;  3KN4 A;  1SPU A;  3SOY A;  1BSA A;  1A67 A;  1Q7H A;  3NQZ A;  1JN5 B;  1G0T A;  3GWR A;  9RNT A;  1O7P B;  1IVX A;  2HMJ B;  3B4P A;  4I5Q A;  4KFD A;  1Y4K A;  3EF8 A;  1FA3 A;  2GBX B;  4Q53 A;  1Q7Y 4;  2QGU A;  3F8X A;  1W5Z A;  2W03 A;  1RCL A;  1BGS A;  3EJV A;  5HGR A;  5JPU A;  3LT9 A;  5DRE A;  4BTY A;  4HM7 B;  2HMM B;  2R4I A;  3FH1 A;  3EBY A;  3KSP A;  2CHC A;  1JJ2 2;  1PU4 A;  4K1V A;  6RNT A;  2CKF B;  2E2V A;  2CW9 A;  2KXG A;  3DGY A;  4HBR A;  1UDI I;  3NV0 B;  1BRS A;  3DGL A;  1LQM B;  3G4S 3;  1B3S A;  2Z76 A;  3HX8 A;  4N6T A;  1IT7 A;  2B1X B;  1IYY A;  3EC9 A;  4RNY A;  1QAK A;  1UUG B;  2CH9 A;  4IIA A;  3F7S A;  1NU3 A;  2CFG A;  1W6C A;  3MHE A;  5FGO A;  3JUN A;  2UX0 A;  1OF5 B;  3K7C A;  2H0H A;  2WGQ A;  1UUV B;  3G16 A;  3Q1C A;  3DGN A;  1VQ6 3;  1GY5 A;  1JB2 A;  1ROV A;  4BIR A;  1LOV A;  4FMD A;  3UL5 A;  4OUQ A;  3LTC A;  5M19 A;  1SJW A;  4CJN A;  2HML B;  1YIJ 3;  1JNQ A;  2HMK B;  1V57 A;  1IU7 A;  1AR0 A;  2L1S A;  3DGM A;  3EE1 A;  2CG0 A;  2PZV A;  3N9H A;  4J9A A;  5I97 A;  1FGT A;  3U97 A;  4J5G A;  2F5M A;  3DUK A;  3K9M C;  2P0M A;  3I55 3;  4R9L A;  3KCH A;  5AIF A;  6GSP A;  3CCU 3;  1DVD A;  4N6M A;  2IUK A;  1S72 3;  1MWT A;  3X3X A;  1B20 A;  3I56 3;  3OW2 2;  2O3O A;  1VQP 3;  2GEY A;  4BTW A;  1O7M B;  2Q07 A;  1BNF A;  1OPY A;  3AMO B;  4G1M B;  3CC2 3;  3CC7 3;  3FGY A;  3K0Z A;  1TIJ A;  2HMN B;  1I2G A;  4FCJ A;  4OVM A;  1B27 A;  2XFT A;  3J7Y d;  2WOF A;  3CCR 3;  1N9E A;  4MMX B; 
#chains in the Genus database with same CATH homology
 1BU4 A;  1BNJ A;  1RHL A;  4RNT A;  1UCK A;  3HOH A;  1BRI A;  2F56 A;  1RDS A;  1BAN A;  1TRP A;  1BNR A;  1G02 A;  1YVS A;  3D5I A;  1BRH A;  1BIR A;  2F5W A;  4J5K A;  1BNI A;  1FZU A;  3BIR A;  3GSP A;  1RGH A;  2C4B A;  1UCL A;  1BRJ A;  1A2P A;  1R4Y A;  2SAR A;  1BOX A;  3D4A A;  1GMQ A;  3RNT A;  1RMS A;  1B21 A;  1LNI A;  2AAE A;  2ZA4 A;  2AAD A;  1RGL A;  5GSP A;  2GSP A;  1RN1 A;  1RGF A;  1BSE A;  1HZ1 A;  1RCK A;  1RLS A;  1BRG A;  1UCI A;  4GHO A;  5HOH A;  1RGE A;  1JBS A;  1X1U A;  1I3I A;  1AY7 A;  1FUS A;  1Q9E A;  1C54 A;  1I3F A;  1B2S A;  1I8V A;  2BIR A;  5RNT A;  2KF6 A;  1GSP A;  2BU4 A;  1BSA A;  1FW7 A;  5BIR A;  9RNT A;  1X1X A;  1BRN L;  2RNT A;  1BSB A;  1MGR A;  1RGA A;  7RNT A;  1LOW A;  2F4Y A;  3AHW A;  1I0X A;  1T2I A;  1RCL A;  1BGS A;  1RNT A;  1GOY A;  1YNV X;  1BNE A;  4HOH A;  1B2U A;  1CH0 A;  1YGW A;  1B2X A;  1FUT A;  1RSN A;  1BNG A;  1LOY A;  1RTU A;  6RNT A;  3DGY A;  1LRA A;  2RBI A;  3A5E A;  1BRS A;  1T2H A;  1JBR A;  1PY3 A;  1X1Y A;  1UCJ A;  1B3S A;  3AGN A;  1BNS A;  2KAA A;  1IYY A;  1I0V A;  4GSP A;  1HYF A;  1ZGX A;  1B2Z A;  3Q3F A;  3BU4 A;  1JBT A;  1SAR A;  3SYU A;  1X1W A;  1B2M A;  3D5G A;  1DET A;  1BUJ A;  1GOU A;  2KF3 A;  4BIR A;  1GOV A;  8RNT A;  1LOV A;  1GMP A;  3WR2 A;  1BRK A;  5BU4 A;  1RGG A;  1BSD A;  1RGK A;  2KF4 A;  1DE3 A;  1GMR A;  1BAO A;  1I70 A;  1FYS A;  2F5M A;  4J5G A;  4BU4 A;  3AHS A;  1PYL A;  1MGW A;  3KCH A;  6GSP A;  1TRQ A;  1I2E A;  7GSP A;  1I2F A;  1B20 A;  3DH2 A;  1RN4 A;  3AGO A;  4HAA A;  3WHO A;  1BNF A;  1AQZ A;  2HOH A;  2KF5 A;  1I2G A;  1RNB A;  1B27 A;  1TTO A;  3URP A;  1BSC A;  1BVI A;  1RGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...