1BRNL

Subsite binding in an rnase: structure of a barnase-tetranucleotide complex at 1.76 angstroms resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*CP*GP*AP*C)-3')
publication title Subsite binding in an RNase: structure of a barnase-tetranucleotide complex at 1.76-A resolution.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase/dna
total genus 28
structure length 108
sequence length 108
chains with identical sequence M
ec nomenclature ec 3.1.27.-:
pdb deposition date 1993-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1brnL00
1BIRA 1X1UA 3AGNA 2F5MA 1GSPA 1I3IA 1FUTA 4GHOA 1HYFA 4BU4A 1A2PA 1BSBA 1MGWA 3HOHA 4GSPA 1AQZA 1PYLA 2HOHA 3RNTA 1JBSA 3SYUA 1B20A 7RNTA 3BIRA 4J5GA 1BOXA 4HOHA 1BNGA 1BAOA 1RSNA 1UCKA 1BRSA 3D4AA 1RCKA 1BRIA 1JBRA 1UCLA 1RGCA 1LOYA 1RGFA 2KF6A 1RNTA 2KAAA 3Q3FA 2F56A 1I2GA 1RGKA 1PY3A 3AHSA 1ZGXA 1RGLA 2BIRA 1CH0A 1LRAA 1RN4A 3A5EA 1BNFA 1YVSA 3DH2A 1GOVA 3KCHA 1B3SA 1FUSA 1X1YA 1RHLA 1BRGA 1TTOA 1SARA 3D5GA 1LOVA 1GMRA 1RGAA 7GSPA 4BIRA 1LOWA 1B2ZA 1B2UA 1DETA 1B21A 1FZUA 1I8VA 1BRNL 1BNSA 1I3FA 2RNTA 1G02A 3GSPA 1BANA 1BSCA 1MGRA 1T2HA 1BSEA 1IYYA 2BU4A 1GMQA 1TRPA 3BU4A 1RGGA 3DGYA 1B2SA 1BSAA 1BVIA 1GOUA 1B2XA 2RBIA 1BRJA 1YNVX 1BRHA 1B27A 1RGEA 1BRKA 1B2MA 1BNIA 2GSPA 5HOHA 2AAEA 4J5KA 1I0VA 1UCJA 6RNTA 8RNTA 5BIRA 1I70A 1I0XA 2AADA 1RGHA 1LNIA 1BUJA 1BGSA 3WR2A 1HZ1A 1GMPA 3D5IA 2SARA 2KF4A 1RLSA 2C4BA 1Q9EA 1RTUA 1BU4A 1DE3A 1C54A 3URPA 1FW7A 4RNTA 1T2IA 1RMSA 1BSDA 3WHOA 1TRQA 1FYSA 1YGWA 5GSPA 1I2EA 1X1WA 5RNTA 2KF5A 1RDSA 1BNJA 1X1XA 1GOYA 1R4YA 3AHWA 1BNEA 2F5WA 1RNBA 5BU4A 1AY7A 1UCIA 1I2FA 4HAAA 1BNRA 6GSPA 3AGOA 2KF3A 9RNTA 1RN1A 1JBTA 1RCLA 2F4YA 2ZA4A
chains in the Genus database with same CATH superfamily
3X42A 3AGNA 2F5MA 1GS3A 5ELJA 1L5GB 4BL2A 5CXOA 5BVBA 1IVXA 4GHOA 2IY2A 1HYFA 3GZXB 3LTBA 1A2PA 3DGOA 3WMDA 1DMMA 2ML6A 3OWUA 4GSPA 1AQZA 4R1KA 2YFLB 1GYBA 1PYLA 4RNYA 5EEOA 3S67A 1OPYA 2PNCA 1MWTA 7STDA 1VQ63 2XRXB 2CIUA 3EJVA 3CC43 3F7XA 3VF1A 1AR0A 1N8QA 3FG3A 1N9JA 3BIRA 1UUGB 3Q90A 1BOXA 3DM8A 2R4IA 2O3OA 2KXGA 2UUGC 1VQP3 3PS8A 1BAOA 2W6JH 3DXOA 2XF3A 3BNCA 4NPBA 3UJMA 1JKGB 3VGNA 1BRSA 1QVF2 2F86B 1V58A 1BRIA 1RGCA 1R4CA 1FGTA 2H0HA 3CMA3 1JRQA 5CLKA 5LC6A 2RSXA 2C11A 4RZMA 4XB5A 2F56A 3AHSA 3WOEB 5FW5A 1RGLA 5IENA 4FCMA 1LRAA 5AYSC 6STDA 4FMAA 1Q824 4XBYA 1YVSA 2ZL8A 2H0IA 3CCU3 1FUSA 1X1YA 2P09A 4IPBA 1RHLA 1M1K4 1SJWA 1YVBI 1SARA 2QGUA 3D5GA 3SVAA 1LOVA 5IF6A 1UW1A 2HMLB 1GY6A 1QMAA 3MG3A 4WP5A 5A0OB 1OACA 5TGNA 1RKYA 1PFPA 4GL6A 1B2ZA 3NUVA 1ZO2A 3LT9A 1B2UA 1K41A 4N6MA 1V74A 1BNSA 2RNTA 2YX9A 3CC73 2GBXB 1IYYA 1T2HA 1W6GA 1NB5I 4MMZB 4FCJA 1TRPA 1FGQA 3BU4A 5IG5A 3BNEA 2CFWA 1UI7A 3B4OA 2H0GA 1B2SA 1BSAA 2W2CA 3FLJA 3B8LA 1VQL3 1YNVX 5M19A 1YJ93 3T8UA 1Q814 1W2B2 1S5AA 1RGEA 3BNBA 3FGYA 1OHSA 3NM2A 1I0VA 2FNQA 4HYZA 1C7HA 3KFQC 8RNTA 4BTXA 1STDA 5IG4A 3CCJ3 1I0XA 2XGLA 4N6NB 4Q53A 4EV2A 1IQ8A 1KWIA 2AADA 4HKVB 3T8NA 1LVNA 4AKYA 3LZAA 1OGZA 1LNIA 2Y73A 1KQS2 1W01A 3Q1CA 4EC6A 2B1XB 2RGQA 1EQKA 4OK0A 2O9UX 1HZ1A 1WQLB 3D5IA 1AV4A 1YJN3 1JN5B 2HMKB 3LMLA 3GRDA 1WMNA 3URPA 3FH1A 3UNLA 2IUKA 2OWPA 3CNXA 1VZZA 5KP3A 5CF1A 1DMQA 1X1WA 3JVCA 3OWYA 2QEX3 3NV0B 3LTAA 1EKMA 3FG1A 4LYLB 4U13A 1IQYA 1BNJA 3MYTA 2F99A 2MC8A 4HBRA 2OTJ3 1W2ZA 2B24B 3FF2A 4HZBB 3WA2X 4BL3A 3LXUX 1AY7A 4CJNA 3GZYB 1UCIA 1RNBA 3LH4A 1IVWA 2LYXA 3S5CA 3UB1A 3JUNA 1TFOA 2W0QA 3KIIA 1NJI4 1N8R4 1B2XA 1M1XB 1MNLA 3OWSA 2BNGA 1K8A4 3FF0A 1GSPA 1I3IA 1RN7A 5KP1A 3PZWA 3S29A 3EX9A 3CPW2 1ASKA 3EE1A 5EVHA 3CCS3 4LSOA 1G96A 2CHCA 3NBBA 2FGTA 3F8XA 3RNTA 3SEDA 1JJ22 3V92A 3BB9A 4KFEA 1QALA 2E2TA 1LQMB 2STDA 2OCTA 4FMDA 1A2KA 5G1KA 2XEPA 3B7CA 4HOHA 1VQ73 1A2VA 1F8NA 1JB4A 4WYKB 4KT3B 1E3RA 3MG2A 4L8OA 3PGBA 3RDEA 1U8CB 3UL6A 1UUVB 4FMBA 2E2VA 4PEJA 4N6TA 2P38A 3VSYA 1UGHI 1NB3I 1US1A 1NO3A 2E2UA 1W00A 3D4AA 3S27A 3DGMA 2GXFA 2RCDA 3LT8A 4O3VA 1JBRA 2GU3A 2XSHB 3OW22 4HM6B 3DY5A 2KF6A 4R80A 2RFRA 3I0YA 2CX1A 3CCE3 1OH0A 1PY3A 5G1LA 1VQK3 2BMQB 1NWWA 5I97A 1FA3A 2Q07A 1SPUA 1M904 3MWZA 3ZFZA 1BNFA 1A90A 5AYRB 2UX0A 1GD4A 2KCDA 1ISKA 1T3BA 1O7NB 3EQQB 3F7SA 1KC84 1TTOA 5LC7A 5CF2A 1YI23 4CCVA 3SX1A 2QIYA 3BLZA 1LOWA 1D6UA 2YFJB 3KSPA 4IT7A 1I8VA 1I3FA 3GSPA 3ECFA 2R41A 3K63A 4GB5A 1TIJA 2A15A 4BTYA 3CD63 4RNZA 3ZG5A 4IIAA 1ZS7A 1BSCA 1MGRA 3V98A 2W56A 2XH9A 2BU4A 2F98A 3V99A 2P0MA 1QAKA 3D9RA 3X3XA 1WNHA 4XDVA 1Q40B 3NQZA 3CME3 1W4NA 5AIGA 1QAFA 4STDA 4J8TA 3G6E3 1IVVA 3CNMA 1KSIA 3HIGA 4O02B 1FGMA 3SXXA 1UCJA 6RNTA 1VQ93 2CWVA 3DUKA 3HK4A 2JDIH 3BNDA 3OV4A 3MSOA 3WR2A 3F14A 2SARA 4FR9A 1O7PB 2HMJB 3EN1B 1BU4A 5FGOA 3KN4A 1C54A 1UDII 4RNTA 2BMRB 4K61A 4KZ1A 1G0TA 3WHOA 3WOFB 1FYSA 3FCSB 1MWSA 1YGWA 3HZPA 3X40A 2K0MA 5AEUB 2CW9A 3U1WA 1OCVA 4WHAA 4H3UA 2WGOA 1X1XA 2ZHXB 3AMOA 3NBJA 3NM7A 4N6UA 1R4YA 1CYVA 1K28A 1W6YA 5IERA 5JPPA 5BU4A 3EBTA 4CDLA 3CCL3 3WA3A 3GWRA 4HAAA 1BNRA 2CG1A 1SIIA 2CFGA 1Z1SA 2CK3H 4HM1B 1YGEA 1RN1A 1JBTA 4J9AA 2ZA4A 3FG4A 4EV5A 3WODG 1PU4A 2OTL3 1BIRA 4LZIA 3GZRA 3K9MC 3IJEB 1TU5A 1A67A 5DREA 4TX4A 3NHXA 2CFDA 4BU4A 4FCZA 1OF5A 3QRDA 5ELUA 1CYUA 3HOHA 3X3ZA 1ULIB 1RJOA 1RRLA 3X41A 3T0UA 3N9HA 1DMNA 3SYUA 1B20A 3PCRA 2W03A 7RNTA 4L7KA 5EQLA 1GD3A 1IV7A 5IG3A 5KP4A 4HM4B 4L8PA 1IT7A 2FXTA 3X3YA 3SLUA 4J5GA 1W5ZA 1RRHA 3QK9A 4N6V0 3GAXA 1BNGA 4I5QA 3ROBA 1WMPA 3UL5A 1EA2A 4ORLA 3U97A 1RCKA 1N5HA 1UCLA 2CH9A 1LOYA 4NHFA 1JB2A 1RGFA 1ROVA 2JQ5A 1RNTA 2GU1A 2KAAA 4WYKA 5IEOA 4EW5A 3CCM3 2BMOB 1I2GA 1RGKA 4FMCA 1IVUA 4LGQA 1Q864 2BIRA 3G8ZA 1VQ43 1RN4A 2IMJA 3NBRA 3CCQ3 2GEYA 1LQGC 4AEQA 1HU9A 5CK6A 3DH2A 4XBXA 1B3SA 2BHMA 3FSDA 5D82A 5DRVA 3N54B 1BRGA 4MMYB 1OGXA 1YHQ3 5M18A 3JUOA 4MMXB 4WWUC 4EBGA 1GMRA 1RGAA 2CX0A 5AI1A 3SOYA 4ILFA 1ROAA 2M7OA 1JB5A 1STFI 1DETA 1B21A 1NDOB 2L1SA 4H61A 1BRNL 2L4VA 3OXAA 1J2BA 5D81A 4K90B 3EB8A 5D83A 1AVLA 1BSEA 3LYGA 5G2GA 3CC23 1WTHA 4AKZA 5STDA 3JUPA 2QA43 1E3VA 3DGLA 3D79A 3DGYA 3EBYA 1IV9A 1JKGA 4XBTA 5IEPA 1GOUA 3G713 3CXC2 1VQM3 1YIT3 1BRJA 2CWTA 1BRHA 2IA7A 3K5TA 1YIJ3 5IW9A 1YJW3 1K9M4 1DVDA 1B27A 1BRKA 3B4PA 4DKIA 4HM5B 1BNIA 2AAEA 3F8HA 4R9LA 3KZTA 1VQO3 5BIRA 4OUQA 1MWRA 1MWUA 1HKXA 1ZX2A 3K7CA 1OUNA 1W02A 1RGHA 3GZBA 2Z7AA 3K0ZA 3PXMA 1BGSA 4CPKA 1GMPA 1RLSA 2K3DA 4X2HA 1GY5A 1Q9EA 1RTUA 1EG9B 3DGNA 3FKAA 4MEIA 1FW7A 4ZM8A 8CHOA 1IK3A 3A76A 1RMSA 1BSDA 2WO0A 2HMOB 5GSPA 1I2EA 3CCV3 3EN8A 4R4KA 1UUWB 3OX9A 5RNTA 2Z76A 1SQWA 4RBNA 1RDSA 3O8YA 2IYJA 1IU7A 2C10A 3STDA 1CEWI 4JRFA 1N5PA 2OQEC 3AHWA 1BNEA 3RGAA 1Q7Y4 2F5WA 3I563 2HMMB 2P05A 1I2FA 4QWTA 3EC9A 2LQVA 4R9KA 2GEXA 3MKIA 1LOXA 1TUHA 3AGOA 4HM0B 2K54A 1EUIC 3DZLA 1VQ83 1E97A 1D6ZA 2F4YA 4HM2B 1QJGA 1Q7HA 2Y74A 1X1UA 2Z6BA 3MG1A 2D42A 5HGRA 2W04A 2OQEA 1FUTA 3NX0A 1FUWA 3F40A 4WFOA 1BSBA 1MGWA 2V1LA 3KSED 1V57A 1TFKA 2HOHA 1JBSA 3LTDA 1IDPA 3F9SA 4KFFA 2XSOB 1VQQA 2KRTA 2XR8B 2ML5A 2XFSA 1JN5A 3N8BA 3I553 2HMNB 5JBSA 2XFTA 3ALAA 3CPOA 2CKFB 1M9GA 3D3LA 2CFLA 3EHCA 2W56B 5AIFA 3L0RA 1TP6A 1JZDA 2I9WA 2UGIA 1KD14 3NV0A 4N3VA 1RSNA 3HIIA 5AIIA 5IG0A 3J7Yd 1UCKA 4LMIA 1O7GB 1S723 4K1VA 1JV2B 3KE7A 1IT8A 3RGRA 1OHPA 1Y4KA 1T5YA 1W7CA 2INXA 3Q3FA 4OVMA 1TJDA 2PZVA 1ZGXA 1QVG2 2BT3A 3NXJA 1CQSA 1CH0A 1VQN3 3A5EA 4BTWA 2OOVC 4G1MB 3WDGB 1DYUA 2YFIB 3IPTA 1GOVA 3KCHA 3CU3A 5M1AA 2WOFA 3ZG0A 3MHEA 1DVCA 4HZ9B 2D1WA 1FGRA 1NU3A 4XDWA 4LEHA 4HJLB 1AVKA 2CC3A 7GSPA 3HI7A 4NREA 4BIRA 4HM8B 3M8CA 3TDGA 2CFKA 3HX8A 3IMAB 4MJDA 2OOVA 3E99A 3CCR3 1FZUA 3AMOB 1IQXA 1D6YA 1G02A 1Q42A 1BANA 1FGOA 2BO9B 3G0KA 1ULJB 1JNQA 1O7MB 3Q2PA 2WGQA 1GMQA 1U5OA 2W9QA 3H51A 4KFDA 4O2HA 1RGGA 3H3HA 5AEWB 2RBIA 1BVIA 2J8XB 2SBLA 1WMOA 1NNVA 3LTCA 4EYCA 3KKGA 4EXRA 5BXQA 3G4S3 1K734 4HM3B 3SOAA 1B2MA 4O8SA 2GSPA 1BUQA 5HOHA 4N6OB 4J5KA 3FZWA 1JZOA 1OF5B 1I70A 4HVNA 4I4KA 1UGIA 5AIHA 2WOHA 4JF8A 4XM4A 1O7WB 1BUJA 1W6CA 4KVHA 1OHOA 2ZDJA 1VQ53 2KF4A 4HM7B 5JPUA 1MOLA 3LOYA 2C4BA 4K1UA 1LNHA 3PCSA 1DE3A 1T2IA 3JUQA 2GBWB 1TRQA 3PYJA 3JUMA 1N9EA 1UI8A 2CWUA 3G16A 2P0XA 4N6LA 2KF5A 2XGNA 1GOYA 2W9PA 4X2OA 3DMCA 1SIHA 1O7HB 3S28A 2Z77A 3EF8A 3MPHA 3NQYA 3ER7A 1LXEA 6GSPA 1Q40A 2IUJA 1EEJA 2KF3A 2MF7A 9RNTA 2CG0A 1RCLA 1GY7A
chains in the Genus database with same CATH topology
1BIRA 1X1UA 3AGNA 2F5MA 1GSPA 1I3IA 1FUTA 4GHOA 1HYFA 4BU4A 1A2PA 1BSBA 1MGWA 3HOHA 4GSPA 1AQZA 1PYLA 2HOHA 3RNTA 1JBSA 3SYUA 1B20A 7RNTA 3BIRA 4J5GA 1BOXA 4HOHA 1BNGA 1BAOA 1RSNA 1UCKA 1BRSA 3D4AA 1RCKA 1BRIA 1JBRA 1UCLA 1RGCA 1LOYA 1RGFA 2KF6A 1RNTA 2KAAA 3Q3FA 2F56A 1I2GA 1RGKA 1PY3A 3AHSA 1ZGXA 1RGLA 2BIRA 1CH0A 1LRAA 1RN4A 3A5EA 1BNFA 1YVSA 3DH2A 1GOVA 3KCHA 1B3SA 1FUSA 1X1YA 1RHLA 1BRGA 1TTOA 1SARA 3D5GA 1LOVA 1GMRA 1RGAA 7GSPA 4BIRA 1LOWA 1B2ZA 1B2UA 1DETA 1B21A 1FZUA 1I8VA 1BRNL 1BNSA 1I3FA 2RNTA 1G02A 3GSPA 1BANA 1BSCA 1MGRA 1T2HA 1BSEA 1IYYA 2BU4A 1GMQA 1TRPA 3BU4A 1RGGA 3DGYA 1B2SA 1BSAA 1BVIA 1GOUA 1B2XA 2RBIA 1BRJA 1YNVX 1BRHA 1B27A 1RGEA 1BRKA 1B2MA 1BNIA 2GSPA 5HOHA 2AAEA 4J5KA 1I0VA 1UCJA 6RNTA 8RNTA 5BIRA 1I70A 1I0XA 2AADA 1RGHA 1LNIA 1BUJA 1BGSA 3WR2A 1HZ1A 1GMPA 3D5IA 2SARA 2KF4A 1RLSA 2C4BA 1Q9EA 1RTUA 1BU4A 1DE3A 1C54A 3URPA 1FW7A 4RNTA 1T2IA 1RMSA 1BSDA 3WHOA 1TRQA 1FYSA 1YGWA 5GSPA 1I2EA 1X1WA 5RNTA 2KF5A 1RDSA 1BNJA 1X1XA 1GOYA 1R4YA 3AHWA 1BNEA 2F5WA 1RNBA 5BU4A 1AY7A 1UCIA 1I2FA 4HAAA 1BNRA 6GSPA 3AGOA 2KF3A 9RNTA 1RN1A 1JBTA 1RCLA 2F4YA 2ZA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BIR A;  1X1U A;  3AGN A;  2F5M A;  1GSP A;  1I3I A;  1FUT A;  4GHO A;  1HYF A;  4BU4 A;  1A2P A;  1BSB A;  1MGW A;  3HOH A;  4GSP A;  1AQZ A;  1PYL A;  2HOH A;  3RNT A;  1JBS A;  3SYU A;  1B20 A;  7RNT A;  3BIR A;  4J5G A;  1BOX A;  4HOH A;  1BNG A;  1BAO A;  1RSN A;  1UCK A;  1BRS A;  3D4A A;  1RCK A;  1BRI A;  1JBR A;  1UCL A;  1RGC A;  1LOY A;  1RGF A;  2KF6 A;  1RNT A;  2KAA A;  3Q3F A;  2F56 A;  1I2G A;  1RGK A;  1PY3 A;  3AHS A;  1ZGX A;  1RGL A;  2BIR A;  1CH0 A;  1LRA A;  1RN4 A;  3A5E A;  1BNF A;  1YVS A;  3DH2 A;  1GOV A;  3KCH A;  1B3S A;  1FUS A;  1X1Y A;  1RHL A;  1BRG A;  1TTO A;  1SAR A;  3D5G A;  1LOV A;  1GMR A;  1RGA A;  7GSP A;  4BIR A;  1LOW A;  1B2Z A;  1B2U A;  1DET A;  1B21 A;  1FZU A;  1I8V A;  1BRN L;  1BNS A;  1I3F A;  2RNT A;  1G02 A;  3GSP A;  1BAN A;  1BSC A;  1MGR A;  1T2H A;  1BSE A;  1IYY A;  2BU4 A;  1GMQ A;  1TRP A;  3BU4 A;  1RGG A;  3DGY A;  1B2S A;  1BSA A;  1BVI A;  1GOU A;  1B2X A;  2RBI A;  1BRJ A;  1YNV X;  1BRH A;  1B27 A;  1RGE A;  1BRK A;  1B2M A;  1BNI A;  2GSP A;  5HOH A;  2AAE A;  4J5K A;  1I0V A;  1UCJ A;  6RNT A;  8RNT A;  5BIR A;  1I70 A;  1I0X A;  2AAD A;  1RGH A;  1LNI A;  1BUJ A;  1BGS A;  3WR2 A;  1HZ1 A;  1GMP A;  3D5I A;  2SAR A;  2KF4 A;  1RLS A;  2C4B A;  1Q9E A;  1RTU A;  1BU4 A;  1DE3 A;  1C54 A;  3URP A;  1FW7 A;  4RNT A;  1T2I A;  1RMS A;  1BSD A;  3WHO A;  1TRQ A;  1FYS A;  1YGW A;  5GSP A;  1I2E A;  1X1W A;  5RNT A;  2KF5 A;  1RDS A;  1BNJ A;  1X1X A;  1GOY A;  1R4Y A;  3AHW A;  1BNE A;  2F5W A;  1RNB A;  5BU4 A;  1AY7 A;  1UCI A;  1I2F A;  4HAA A;  1BNR A;  6GSP A;  3AGO A;  2KF3 A;  9RNT A;  1RN1 A;  1JBT A;  1RCL A;  2F4Y A;  2ZA4 A; 
#chains in the Genus database with same CATH topology
 3X42 A;  3AGN A;  2F5M A;  1GS3 A;  5ELJ A;  1L5G B;  4BL2 A;  5CXO A;  5BVB A;  1IVX A;  4GHO A;  2IY2 A;  1HYF A;  3GZX B;  3LTB A;  1A2P A;  3DGO A;  3WMD A;  1DMM A;  2ML6 A;  3OWU A;  4GSP A;  1AQZ A;  4R1K A;  2YFL B;  1GYB A;  1PYL A;  4RNY A;  5EEO A;  3S67 A;  1OPY A;  2PNC A;  1MWT A;  7STD A;  1VQ6 3;  2XRX B;  2CIU A;  3EJV A;  3CC4 3;  3F7X A;  3VF1 A;  1AR0 A;  1N8Q A;  3FG3 A;  1N9J A;  3BIR A;  1UUG B;  3Q90 A;  1BOX A;  3DM8 A;  2R4I A;  2O3O A;  2KXG A;  2UUG C;  1VQP 3;  3PS8 A;  1BAO A;  2W6J H;  3DXO A;  2XF3 A;  3BNC A;  4NPB A;  3UJM A;  1JKG B;  3VGN A;  1BRS A;  1QVF 2;  2F86 B;  1V58 A;  1BRI A;  1RGC A;  1R4C A;  1FGT A;  2H0H A;  3CMA 3;  1JRQ A;  5CLK A;  5LC6 A;  2RSX A;  2C11 A;  4RZM A;  4XB5 A;  2F56 A;  3AHS A;  3WOE B;  5FW5 A;  1RGL A;  5IEN A;  4FCM A;  1LRA A;  5AYS C;  6STD A;  4FMA A;  1Q82 4;  4XBY A;  1YVS A;  2ZL8 A;  2H0I A;  3CCU 3;  1FUS A;  1X1Y A;  2P09 A;  4IPB A;  1RHL A;  1M1K 4;  1SJW A;  1YVB I;  1SAR A;  2QGU A;  3D5G A;  3SVA A;  1LOV A;  5IF6 A;  1UW1 A;  2HML B;  1GY6 A;  1QMA A;  3MG3 A;  4WP5 A;  5A0O B;  1OAC A;  5TGN A;  1RKY A;  1PFP A;  4GL6 A;  1B2Z A;  3NUV A;  1ZO2 A;  3LT9 A;  1B2U A;  1K41 A;  4N6M A;  1V74 A;  1BNS A;  2RNT A;  2YX9 A;  3CC7 3;  2GBX B;  1IYY A;  1T2H A;  1W6G A;  1NB5 I;  4MMZ B;  4FCJ A;  1TRP A;  1FGQ A;  3BU4 A;  5IG5 A;  3BNE A;  2CFW A;  1UI7 A;  3B4O A;  2H0G A;  1B2S A;  1BSA A;  2W2C A;  3FLJ A;  3B8L A;  1VQL 3;  1YNV X;  5M19 A;  1YJ9 3;  3T8U A;  1Q81 4;  1W2B 2;  1S5A A;  1RGE A;  3BNB A;  3FGY A;  1OHS A;  3NM2 A;  1I0V A;  2FNQ A;  4HYZ A;  1C7H A;  3KFQ C;  8RNT A;  4BTX A;  1STD A;  5IG4 A;  3CCJ 3;  1I0X A;  2XGL A;  4N6N B;  4Q53 A;  4EV2 A;  1IQ8 A;  1KWI A;  2AAD A;  4HKV B;  3T8N A;  1LVN A;  4AKY A;  3LZA A;  1OGZ A;  1LNI A;  2Y73 A;  1KQS 2;  1W01 A;  3Q1C A;  4EC6 A;  2B1X B;  2RGQ A;  1EQK A;  4OK0 A;  2O9U X;  1HZ1 A;  1WQL B;  3D5I A;  1AV4 A;  1YJN 3;  1JN5 B;  2HMK B;  3LML A;  3GRD A;  1WMN A;  3URP A;  3FH1 A;  3UNL A;  2IUK A;  2OWP A;  3CNX A;  1VZZ A;  5KP3 A;  5CF1 A;  1DMQ A;  1X1W A;  3JVC A;  3OWY A;  2QEX 3;  3NV0 B;  3LTA A;  1EKM A;  3FG1 A;  4LYL B;  4U13 A;  1IQY A;  1BNJ A;  3MYT A;  2F99 A;  2MC8 A;  4HBR A;  2OTJ 3;  1W2Z A;  2B24 B;  3FF2 A;  4HZB B;  3WA2 X;  4BL3 A;  3LXU X;  1AY7 A;  4CJN A;  3GZY B;  1UCI A;  1RNB A;  3LH4 A;  1IVW A;  2LYX A;  3S5C A;  3UB1 A;  3JUN A;  1TFO A;  2W0Q A;  3KII A;  1NJI 4;  1N8R 4;  1B2X A;  1M1X B;  1MNL A;  3OWS A;  2BNG A;  1K8A 4;  3FF0 A;  1GSP A;  1I3I A;  1RN7 A;  5KP1 A;  3PZW A;  3S29 A;  3EX9 A;  3CPW 2;  1ASK A;  3EE1 A;  5EVH A;  3CCS 3;  4LSO A;  1G96 A;  2CHC A;  3NBB A;  2FGT A;  3F8X A;  3RNT A;  3SED A;  1JJ2 2;  3V92 A;  3BB9 A;  4KFE A;  1QAL A;  2E2T A;  1LQM B;  2STD A;  2OCT A;  4FMD A;  1A2K A;  5G1K A;  2XEP A;  3B7C A;  4HOH A;  1VQ7 3;  1A2V A;  1F8N A;  1JB4 A;  4WYK B;  4KT3 B;  1E3R A;  3MG2 A;  4L8O A;  3PGB A;  3RDE A;  1U8C B;  3UL6 A;  1UUV B;  4FMB A;  2E2V A;  4PEJ A;  4N6T A;  2P38 A;  3VSY A;  1UGH I;  1NB3 I;  1US1 A;  1NO3 A;  2E2U A;  1W00 A;  3D4A A;  3S27 A;  3DGM A;  2GXF A;  2RCD A;  3LT8 A;  4O3V A;  1JBR A;  2GU3 A;  2XSH B;  3OW2 2;  4HM6 B;  3DY5 A;  2KF6 A;  4R80 A;  2RFR A;  3I0Y A;  2CX1 A;  3CCE 3;  1OH0 A;  1PY3 A;  5G1L A;  1VQK 3;  2BMQ B;  1NWW A;  5I97 A;  1FA3 A;  2Q07 A;  1SPU A;  1M90 4;  3MWZ A;  3ZFZ A;  1BNF A;  1A90 A;  5AYR B;  2UX0 A;  1GD4 A;  2KCD A;  1ISK A;  1T3B A;  1O7N B;  3EQQ B;  3F7S A;  1KC8 4;  1TTO A;  5LC7 A;  5CF2 A;  1YI2 3;  4CCV A;  3SX1 A;  2QIY A;  3BLZ A;  1LOW A;  1D6U A;  2YFJ B;  3KSP A;  4IT7 A;  1I8V A;  1I3F A;  3GSP A;  3ECF A;  2R41 A;  3K63 A;  4GB5 A;  1TIJ A;  2A15 A;  4BTY A;  3CD6 3;  4RNZ A;  3ZG5 A;  4IIA A;  1ZS7 A;  1BSC A;  1MGR A;  3V98 A;  2W56 A;  2XH9 A;  2BU4 A;  2F98 A;  3V99 A;  2P0M A;  1QAK A;  3D9R A;  3X3X A;  1WNH A;  4XDV A;  1Q40 B;  3NQZ A;  3CME 3;  1W4N A;  5AIG A;  1QAF A;  4STD A;  4J8T A;  3G6E 3;  1IVV A;  3CNM A;  1KSI A;  3HIG A;  4O02 B;  1FGM A;  3SXX A;  1UCJ A;  6RNT A;  1VQ9 3;  2CWV A;  3DUK A;  3HK4 A;  2JDI H;  3BND A;  3OV4 A;  3MSO A;  3WR2 A;  3F14 A;  2SAR A;  4FR9 A;  1O7P B;  2HMJ B;  3EN1 B;  1BU4 A;  5FGO A;  3KN4 A;  1C54 A;  1UDI I;  4RNT A;  2BMR B;  4K61 A;  4KZ1 A;  1G0T A;  3WHO A;  3WOF B;  1FYS A;  3FCS B;  1MWS A;  1YGW A;  3HZP A;  3X40 A;  2K0M A;  5AEU B;  2CW9 A;  3U1W A;  1OCV A;  4WHA A;  4H3U A;  2WGO A;  1X1X A;  2ZHX B;  3AMO A;  3NBJ A;  3NM7 A;  4N6U A;  1R4Y A;  1CYV A;  1K28 A;  1W6Y A;  5IER A;  5JPP A;  5BU4 A;  3EBT A;  4CDL A;  3CCL 3;  3WA3 A;  3GWR A;  4HAA A;  1BNR A;  2CG1 A;  1SII A;  2CFG A;  1Z1S A;  2CK3 H;  4HM1 B;  1YGE A;  1RN1 A;  1JBT A;  4J9A A;  2ZA4 A;  3FG4 A;  4EV5 A;  3WOD G;  1PU4 A;  2OTL 3;  1BIR A;  4LZI A;  3GZR A;  3K9M C;  3IJE B;  1TU5 A;  1A67 A;  5DRE A;  4TX4 A;  3NHX A;  2CFD A;  4BU4 A;  4FCZ A;  1OF5 A;  3QRD A;  5ELU A;  1CYU A;  3HOH A;  3X3Z A;  1ULI B;  1RJO A;  1RRL A;  3X41 A;  3T0U A;  3N9H A;  1DMN A;  3SYU A;  1B20 A;  3PCR A;  2W03 A;  7RNT A;  4L7K A;  5EQL A;  1GD3 A;  1IV7 A;  5IG3 A;  5KP4 A;  4HM4 B;  4L8P A;  1IT7 A;  2FXT A;  3X3Y A;  3SLU A;  4J5G A;  1W5Z A;  1RRH A;  3QK9 A;  4N6V 0;  3GAX A;  1BNG A;  4I5Q A;  3ROB A;  1WMP A;  3UL5 A;  1EA2 A;  4ORL A;  3U97 A;  1RCK A;  1N5H A;  1UCL A;  2CH9 A;  1LOY A;  4NHF A;  1JB2 A;  1RGF A;  1ROV A;  2JQ5 A;  1RNT A;  2GU1 A;  2KAA A;  4WYK A;  5IEO A;  4EW5 A;  3CCM 3;  2BMO B;  1I2G A;  1RGK A;  4FMC A;  1IVU A;  4LGQ A;  1Q86 4;  2BIR A;  3G8Z A;  1VQ4 3;  1RN4 A;  2IMJ A;  3NBR A;  3CCQ 3;  2GEY A;  1LQG C;  4AEQ A;  1HU9 A;  5CK6 A;  3DH2 A;  4XBX A;  1B3S A;  2BHM A;  3FSD A;  5D82 A;  5DRV A;  3N54 B;  1BRG A;  4MMY B;  1OGX A;  1YHQ 3;  5M18 A;  3JUO A;  4MMX B;  4WWU C;  4EBG A;  1GMR A;  1RGA A;  2CX0 A;  5AI1 A;  3SOY A;  4ILF A;  1ROA A;  2M7O A;  1JB5 A;  1STF I;  1DET A;  1B21 A;  1NDO B;  2L1S A;  4H61 A;  1BRN L;  2L4V A;  3OXA A;  1J2B A;  5D81 A;  4K90 B;  3EB8 A;  5D83 A;  1AVL A;  1BSE A;  3LYG A;  5G2G A;  3CC2 3;  1WTH A;  4AKZ A;  5STD A;  3JUP A;  2QA4 3;  1E3V A;  3DGL A;  3D79 A;  3DGY A;  3EBY A;  1IV9 A;  1JKG A;  4XBT A;  5IEP A;  1GOU A;  3G71 3;  3CXC 2;  1VQM 3;  1YIT 3;  1BRJ A;  2CWT A;  1BRH A;  2IA7 A;  3K5T A;  1YIJ 3;  5IW9 A;  1YJW 3;  1K9M 4;  1DVD A;  1B27 A;  1BRK A;  3B4P A;  4DKI A;  4HM5 B;  1BNI A;  2AAE A;  3F8H A;  4R9L A;  3KZT A;  1VQO 3;  5BIR A;  4OUQ A;  1MWR A;  1MWU A;  1HKX A;  1ZX2 A;  3K7C A;  1OUN A;  1W02 A;  1RGH A;  3GZB A;  2Z7A A;  3K0Z A;  3PXM A;  1BGS A;  4CPK A;  1GMP A;  1RLS A;  2K3D A;  4X2H A;  1GY5 A;  1Q9E A;  1RTU A;  1EG9 B;  3DGN A;  3FKA A;  4MEI A;  1FW7 A;  4ZM8 A;  8CHO A;  1IK3 A;  3A76 A;  1RMS A;  1BSD A;  2WO0 A;  2HMO B;  5GSP A;  1I2E A;  3CCV 3;  3EN8 A;  4R4K A;  1UUW B;  3OX9 A;  5RNT A;  2Z76 A;  1SQW A;  4RBN A;  1RDS A;  3O8Y A;  2IYJ A;  1IU7 A;  2C10 A;  3STD A;  1CEW I;  4JRF A;  1N5P A;  2OQE C;  3AHW A;  1BNE A;  3RGA A;  1Q7Y 4;  2F5W A;  3I56 3;  2HMM B;  2P05 A;  1I2F A;  4QWT A;  3EC9 A;  2LQV A;  4R9K A;  2GEX A;  3MKI A;  1LOX A;  1TUH A;  3AGO A;  4HM0 B;  2K54 A;  1EUI C;  3DZL A;  1VQ8 3;  1E97 A;  1D6Z A;  2F4Y A;  4HM2 B;  1QJG A;  1Q7H A;  2Y74 A;  1X1U A;  2Z6B A;  3MG1 A;  2D42 A;  5HGR A;  2W04 A;  2OQE A;  1FUT A;  3NX0 A;  1FUW A;  3F40 A;  4WFO A;  1BSB A;  1MGW A;  2V1L A;  3KSE D;  1V57 A;  1TFK A;  2HOH A;  1JBS A;  3LTD A;  1IDP A;  3F9S A;  4KFF A;  2XSO B;  1VQQ A;  2KRT A;  2XR8 B;  2ML5 A;  2XFS A;  1JN5 A;  3N8B A;  3I55 3;  2HMN B;  5JBS A;  2XFT A;  3ALA A;  3CPO A;  2CKF B;  1M9G A;  3D3L A;  2CFL A;  3EHC A;  2W56 B;  5AIF A;  3L0R A;  1TP6 A;  1JZD A;  2I9W A;  2UGI A;  1KD1 4;  3NV0 A;  4N3V A;  1RSN A;  3HII A;  5AII A;  5IG0 A;  3J7Y d;  1UCK A;  4LMI A;  1O7G B;  1S72 3;  4K1V A;  1JV2 B;  3KE7 A;  1IT8 A;  3RGR A;  1OHP A;  1Y4K A;  1T5Y A;  1W7C A;  2INX A;  3Q3F A;  4OVM A;  1TJD A;  2PZV A;  1ZGX A;  1QVG 2;  2BT3 A;  3NXJ A;  1CQS A;  1CH0 A;  1VQN 3;  3A5E A;  4BTW A;  2OOV C;  4G1M B;  3WDG B;  1DYU A;  2YFI B;  3IPT A;  1GOV A;  3KCH A;  3CU3 A;  5M1A A;  2WOF A;  3ZG0 A;  3MHE A;  1DVC A;  4HZ9 B;  2D1W A;  1FGR A;  1NU3 A;  4XDW A;  4LEH A;  4HJL B;  1AVK A;  2CC3 A;  7GSP A;  3HI7 A;  4NRE A;  4BIR A;  4HM8 B;  3M8C A;  3TDG A;  2CFK A;  3HX8 A;  3IMA B;  4MJD A;  2OOV A;  3E99 A;  3CCR 3;  1FZU A;  3AMO B;  1IQX A;  1D6Y A;  1G02 A;  1Q42 A;  1BAN A;  1FGO A;  2BO9 B;  3G0K A;  1ULJ B;  1JNQ A;  1O7M B;  3Q2P A;  2WGQ A;  1GMQ A;  1U5O A;  2W9Q A;  3H51 A;  4KFD A;  4O2H A;  1RGG A;  3H3H A;  5AEW B;  2RBI A;  1BVI A;  2J8X B;  2SBL A;  1WMO A;  1NNV A;  3LTC A;  4EYC A;  3KKG A;  4EXR A;  5BXQ A;  3G4S 3;  1K73 4;  4HM3 B;  3SOA A;  1B2M A;  4O8S A;  2GSP A;  1BUQ A;  5HOH A;  4N6O B;  4J5K A;  3FZW A;  1JZO A;  1OF5 B;  1I70 A;  4HVN A;  4I4K A;  1UGI A;  5AIH A;  2WOH A;  4JF8 A;  4XM4 A;  1O7W B;  1BUJ A;  1W6C A;  4KVH A;  1OHO A;  2ZDJ A;  1VQ5 3;  2KF4 A;  4HM7 B;  5JPU A;  1MOL A;  3LOY A;  2C4B A;  4K1U A;  1LNH A;  3PCS A;  1DE3 A;  1T2I A;  3JUQ A;  2GBW B;  1TRQ A;  3PYJ A;  3JUM A;  1N9E A;  1UI8 A;  2CWU A;  3G16 A;  2P0X A;  4N6L A;  2KF5 A;  2XGN A;  1GOY A;  2W9P A;  4X2O A;  3DMC A;  1SIH A;  1O7H B;  3S28 A;  2Z77 A;  3EF8 A;  3MPH A;  3NQY A;  3ER7 A;  1LXE A;  6GSP A;  1Q40 A;  2IUJ A;  1EEJ A;  2KF3 A;  2MF7 A;  9RNT A;  2CG0 A;  1RCL A;  1GY7 A; 
#chains in the Genus database with same CATH homology
 1BIR A;  1X1U A;  3AGN A;  2F5M A;  1GSP A;  1I3I A;  1FUT A;  4GHO A;  1HYF A;  4BU4 A;  1A2P A;  1BSB A;  1MGW A;  3HOH A;  4GSP A;  1AQZ A;  1PYL A;  2HOH A;  3RNT A;  1JBS A;  3SYU A;  1B20 A;  7RNT A;  3BIR A;  4J5G A;  1BOX A;  4HOH A;  1BNG A;  1BAO A;  1RSN A;  1UCK A;  1BRS A;  3D4A A;  1RCK A;  1BRI A;  1JBR A;  1UCL A;  1RGC A;  1LOY A;  1RGF A;  2KF6 A;  1RNT A;  2KAA A;  3Q3F A;  2F56 A;  1I2G A;  1RGK A;  1PY3 A;  3AHS A;  1ZGX A;  1RGL A;  2BIR A;  1CH0 A;  1LRA A;  1RN4 A;  3A5E A;  1BNF A;  1YVS A;  3DH2 A;  1GOV A;  3KCH A;  1B3S A;  1FUS A;  1X1Y A;  1RHL A;  1BRG A;  1TTO A;  1SAR A;  3D5G A;  1LOV A;  1GMR A;  1RGA A;  7GSP A;  4BIR A;  1LOW A;  1B2Z A;  1B2U A;  1DET A;  1B21 A;  1FZU A;  1I8V A;  1BRN L;  1BNS A;  1I3F A;  2RNT A;  1G02 A;  3GSP A;  1BAN A;  1BSC A;  1MGR A;  1T2H A;  1BSE A;  1IYY A;  2BU4 A;  1GMQ A;  1TRP A;  3BU4 A;  1RGG A;  3DGY A;  1B2S A;  1BSA A;  1BVI A;  1GOU A;  1B2X A;  2RBI A;  1BRJ A;  1YNV X;  1BRH A;  1B27 A;  1RGE A;  1BRK A;  1B2M A;  1BNI A;  2GSP A;  5HOH A;  2AAE A;  4J5K A;  1I0V A;  1UCJ A;  6RNT A;  8RNT A;  5BIR A;  1I70 A;  1I0X A;  2AAD A;  1RGH A;  1LNI A;  1BUJ A;  1BGS A;  3WR2 A;  1HZ1 A;  1GMP A;  3D5I A;  2SAR A;  2KF4 A;  1RLS A;  2C4B A;  1Q9E A;  1RTU A;  1BU4 A;  1DE3 A;  1C54 A;  3URP A;  1FW7 A;  4RNT A;  1T2I A;  1RMS A;  1BSD A;  3WHO A;  1TRQ A;  1FYS A;  1YGW A;  5GSP A;  1I2E A;  1X1W A;  5RNT A;  2KF5 A;  1RDS A;  1BNJ A;  1X1X A;  1GOY A;  1R4Y A;  3AHW A;  1BNE A;  2F5W A;  1RNB A;  5BU4 A;  1AY7 A;  1UCI A;  1I2F A;  4HAA A;  1BNR A;  6GSP A;  3AGO A;  2KF3 A;  9RNT A;  1RN1 A;  1JBT A;  1RCL A;  2F4Y A;  2ZA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...