1BRNL

Subsite binding in an rnase: structure of a barnase-tetranucleotide complex at 1.76 angstroms resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Subsite binding in an RNase: structure of a barnase-tetranucleotide complex at 1.76-A resolution.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase/dna
molecule keywords DNA (5'-D(*CP*GP*AP*C)-3')
total genus 28
structure length 108
sequence length 108
chains with identical sequence M
ec nomenclature ec 3.1.27.-:
pdb deposition date 1993-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1brnL00
2KF3A 2RNTA 2C4BA 1TTOA 5BU4A 1BSAA 1BSDA 1I8VA 2BU4A 1DETA 1RLSA 1BSBA 1RGHA 1JBTA 7GSPA 1BRHA 3AHWA 3AGNA 1FUTA 6GSPA 1RGGA 1PY3A 3BU4A 5HOHA 1RDSA 1BSCA 1IYYA 1HZ1A 1JBSA 1RGAA 3AGOA 1RN1A 5GSPA 2AADA 1I0VA 1X1YA 1YGWA 1DE3A 4GSPA 4HOHA 1GMPA 6RNTA 1RMSA 1B3SA 1B2ZA 1PYLA 8RNTA 1I70A 1T2IA 1RNBA 1BNJA 1RHLA 5BIRA 1X1UA 2KF6A 3D4AA 1BRNL 1RTUA 3AHSA 1RSNA 2F5WA 1GMQA 2HOHA 1UCKA 1CH0A 1I2FA 1UCIA 1I2EA 1RGEA 2F4YA 1G02A 1BVIA 3DH2A 3Q3FA 1FW7A 1B20A 3D5GA 1RGCA 1TRPA 1UCJA 4GHOA 1B2SA 4RNTA 1RCKA 1I3FA 3KCHA 1MGRA 1BRSA 1BANA 1LNIA 2RBIA 1SARA 4J5KA 1JBRA 1B27A 4J5GA 2F5MA 1BNGA 1BRGA 2KAAA 1FUSA 1RGLA 1BIRA 4BU4A 1LRAA 1TRQA 1ZGXA 1GOYA 1LOWA 1BOXA 3WR2A 1BAOA 1RGKA 1HYFA 1C54A 1BNEA 1BNRA 1RNTA 1BUJA 1BRIA 1MGWA 2KF5A 1GOUA 3A5EA 1I3IA 1GMRA 1LOVA 1RCLA 1BNSA 5RNTA 1X1WA 4HAAA 1GSPA 1LOYA 1I0XA 2BIRA 3DGYA 3RNTA 7RNTA 3GSPA 1B2XA 1BSEA 1BGSA 3WHOA 1B2MA 1RN4A 1AQZA 4BIRA 2F56A 2GSPA 1FYSA 3SYUA 1Q9EA 1BU4A 2AAEA 3BIRA 3URPA 1UCLA 1BRJA 1YVSA 1YNVX 1I2GA 1T2HA 1BNFA 2ZA4A 2SARA 1B21A 1GOVA 2KF4A 1BRKA 1BNIA 1R4YA 1AY7A 3D5IA 9RNTA 3HOHA 1FZUA 1B2UA 1X1XA 1A2PA 1RGFA
chains in the Genus database with same CATH superfamily
2XR8B 2KF3A 2C4BA 2CFWA 1TTOA 3OX9A 1BSAA 3D9RA 5JBSA 2WO0A 3MHEA 4XBTA 1D6YA 2ZL8A 1WTHA 1Z1SA 1YHQ3 1BSBA 2CG0A 3HI7A 1BRHA 1WMPA 1YJW3 5IG5A 3AHWA 3GZRA 4HYZA 2OQEA 1GD4A 2P09A 4NREA 1KWIA 1ZX2A 2L4VA 3EHCA 3G713 4HM7B 1K28A 3BB9A 2XRXB 1HZ1A 3LXUX 1JBSA 4I4KA 3GZYB 5BXQA 1YJ93 1RN1A 1T3BA 2IMJA 3HIGA 2AADA 1EA2A 1I0VA 1DE3A 4EW5A 3JUPA 2BMRB 1IV7A 3V99A 1W6CA 3DGOA 1T2IA 3EJVA 1JZDA 1RHLA 5BIRA 2JQ5A 4FCMA 1RTUA 1FGOA 3AHSA 1RSNA 3NQYA 3IMAB 3FZWA 3WA3A 3G8ZA 4XB5A 2HOHA 5AYRB 1S723 4K1UA 4HM1B 3KSPA 2O9UX 2C10A 3EC9A 3LZAA 4TX4A 1I2EA 1W2B2 4XBYA 2GBXB 3LTDA 3TDGA 4GL6A 5TGNA 5I97A 2CFKA 2IA7A 1Q7HA 5JPUA 5G1LA 1B20A 3G4S3 3CMA3 2W9QA 2XSHB 1RGCA 1GS3A 1M904 1Q824 2L1SA 4FMAA 5AI1A 1B2SA 3RGAA 3VF1A 5BVBA 1VQK3 2CFLA 1TJDA 2CHCA 1BANA 1LNIA 2OWPA 4KZ1A 1LQMB 1OUNA 3FGYA 1RN7A 4O3VA 1IU7A 1K734 3KIIA 4J5GA 4KT3B 2F5MA 1A90A 3UL6A 2E2TA 1Y4KA 4AKYA 5AIGA 3CCQ3 2YFIB 1LRAA 3CC43 2LQVA 1GOYA 2C11A 2WOFA 5M18A 5M19A 1BOXA 1LVNA 5AIFA 3T8NA 3F40A 1OF5B 2MF7A 3NBRA 1HYFA 1ASKA 1C54A 4CJNA 4AEQA 1BNRA 3DGLA 2H0GA 3Q2PA 3Q1CA 4BTYA 1M1K4 3A5EA 1AR0A 1US1A 4KFEA 3CC73 1GMRA 2J8XB 3WOEB 2Z7AA 3AMOA 2WGOA 4R9LA 5RNTA 1GSPA 3DUKA 3D3LA 3T8UA 4EXRA 1DMNA 1O7NB 7RNTA 3MSOA 2QIYA 3GSPA 4JRFA 3WODG 1RJOA 1MOLA 1QAFA 3SXXA 1BGSA 2ZHXB 1QMAA 4MMXB 1D6UA 3EF8A 1RN4A 3IJEB 3FCSB 1YJN3 2V1LA 1KC84 2BMOB 1IVUA 3S28A 1OGZA 1Q9EA 3EN1B 3URPA 4XBXA 1BRJA 1C7HA 2PNCA 1CEWI 3OWSA 1A2VA 1IQ8A 4PEJA 1I2GA 1T2HA 3GRDA 4CCVA 2SARA 2YFJB 1GOVA 2KF4A 1SJWA 5G2GA 1AY7A 2MC8A 4LZIA 1DMQA 1ROVA 2XFTA 3CCS3 2FXTA 1VZZA 2RNTA 1ZO2A 5BU4A 2XF3A 4L8PA 4WP5A 5M1AA 1W01A 3SVAA 1OPYA 2CX1A 2PZVA 1DETA 4FCZA 3WMDA 1RGHA 3SOYA 1JBTA 3GZXB 4FR9A 2HMNB 1VQ63 2WOHA 2JDIH 1VQ53 1EQKA 3K7CA 6GSPA 3LOYA 1PY3A 3BU4A 3OXAA 1JN5B 4H61A 1Q42A 2A15A 2E2UA 3ECFA 4AKZA 5A0OB 1RDSA 1IDPA 3F9SA 3NM7A 2HMKB 3F7SA 2YFLB 4WYKA 1IYYA 2CWUA 4FMCA 3DGNA 3AGOA 4MEIA 3SOAA 2KCDA 3KSED 2CK3H 2OOVC 3EN8A 1NB3I 4HM3B 1PU4A 1YGWA 1WNHA 5G1KA 4GSPA 2F98A 4EBGA 1GMPA 3HIIA 3STDA 1J2BA 1TU5A 1V58A 3D79A 1UW1A 1M9GA 1OCVA 1WMNA 3FF2A 8RNTA 1ULIB 1YGEA 1RRHA 3NXJA 1RNBA 4L8OA 4R9KA 3DY5A 5JPPA 1FGRA 2P38A 4HZ9B 2GEYA 1OACA 3NUVA 3FH1A 1T5YA 1GMQA 2F5WA 4R80A 1Q7Y4 3UNLA 2O3OA 1CH0A 1I2FA 1LNHA 2BMQB 4N6MA 1UCIA 1VQM3 1QVG2 1Q814 2BNGA 1KD14 1MWUA 1WMOA 2F4YA 1AVLA 1G02A 4IIAA 2B24B 4ZM8A 1R4CA 1FW7A 3LTBA 1UCJA 3EX9A 3BNDA 4GHOA 1TUHA 3MG2A 4RNTA 2ML5A 1RRLA 1MGRA 2UGIA 1IQXA 4QWTA 2Q07A 4HJLB 4XDWA 1JB2A 3PCSA 1OHPA 3SEDA 1PFPA 1O7MB 3F8HA 3NBJA 1BNGA 2Y73A 1SQWA 1E3RA 5CF1A 2CH9A 3DM8A 4KFDA 4ILFA 5DRVA 1V57A 3LYGA 4FMBA 2CFGA 4HM6B 1IT7A 3KFQC 1STDA 6STDA 3NQZA 1OF5A 3WR2A 1CYUA 1IV9A 2GU3A 5HGRA 1BUJA 4O2HA 1ISKA 3HK4A 1GYBA 3A76A 4OVMA 4RNYA 1U5OA 4OUQA 8CHOA 1LOVA 2W9PA 3I563 1KQS2 2INXA 3FKAA 2STDA 5CF2A 2W0QA 3DGYA 3RNTA 4K1VA 1B2XA 3NM2A 4KFFA 4O8SA 4X2HA 5IG0A 3X41A 4R1KA 1FGQA 2RFRA 5CK6A 3G6E3 2QA43 3ZFZA 2F56A 4LYLB 1FYSA 3SYUA 3F8XA 2YX9A 3SLUA 3ROBA 5CXOA 2W56A 1U8CB 3JUOA 1UI8A 1BNFA 1VQP3 1LXEA 1Q40A 4IT7A 4KVHA 3CCL3 1BRKA 1BNIA 5ELUA 9RNTA 1B2UA 3LMLA 2Z77A 1A2PA 1JV2B 5STDA 1D6ZA 3PS8A 2IYJA 1UUWB 3OW22 3ER7A 2RSXA 3RGRA 2BU4A 2ML6A 1N9JA 3PXMA 5EEOA 4N6NB 4STDA 4GB5A 1ROAA 3MYTA 2QEX3 3GAXA 1EKMA 7GSPA 1VQL3 2R4IA 1JB5A 5IEOA 1GD3A 1JZOA 5LC6A 3CCM3 1W4NA 1FUTA 3B4OA 3IPTA 3BNBA 1LQGC 2CG1A 1O7HB 2P05A 2D1WA 4FCJA 1QALA 3S27A 1FA3A 1BSCA 4MMZB 2F86B 3KE7A 1W6YA 3QRDA 1DYUA 3NBBA 2BT3A 2CKFB 5GSPA 1E3VA 5AIHA 2HMJB 5EVHA 3X3YA 1UGHI 3S67A 2KXGA 3UJMA 1VQ43 5FW5A 1STFI 1IT8A 1B2ZA 1PYLA 1MWSA 2OCTA 3MKIA 1I70A 3CU3A 1G96A 2FNQA 1BNJA 4BTWA 1K41A 1VQ83 4MMYB 1X1UA 5D83A 3D4AA 3FG1A 1EUIC 3K0ZA 1BRNL 2ZDJA 3HZPA 1TP6A 4H3UA 1L5GB 3B8LA 2Z76A 1UCKA 2KRTA 3N54B 2I9WA 1W02A 3JUQA 4HM4B 4EC6A 3DGMA 1RGEA 3CD63 1NO3A 1ULJB 1W00A 4HKVB 3DH2A 1BVIA 3Q3FA 3X42A 1MWTA 3B4PA 4XDVA 2E2VA 3MG1A 1JJ22 3WDGB 4EV5A 3CME3 1K8A4 3MPHA 1I3FA 2XGLA 3G0KA 4LEHA 1N8R4 1IVWA 1DVDA 1KSIA 4LGQA 1JKGB 2RBIA 1UUVB 4N6LA 4EYCA 4J5KA 1JBRA 3X3XA 1JKGA 3Q90A 1IQYA 1W7CA 4X2OA 1NU3A 3EQQB 1BRGA 1A67A 1FUSA 5IG4A 1RKYA 1VQN3 1BIRA 4J9AA 1LOXA 4BU4A 5ELJA 4CDLA 1TRQA 1GY6A 5IF6A 1W2ZA 1LOWA 2GBWB 4HM8B 3UB1A 5KP4A 1VQQA 1S5AA 1FGMA 4N6V0 3FLJA 2K3DA 1BNEA 2R41A 1RNTA 1UI7A 3DMCA 3EB8A 1MGWA 3CCE3 1NNVA 4N6OB 2CC3A 4OK0A 3H3HA 1EG9B 3K63A 4EV2A 4IPBA 4DKIA 1QVF2 1RCLA 1BNSA 3F14A 4MJDA 4NHFA 4BL2A 3CPOA 3LT8A 1LOYA 1YIJ3 3BLZA 2BIRA 4K90B 2XSOB 1Q864 1BSEA 1SPUA 3J7Yd 3CCV3 4WFOA 1UDII 4U13A 4N3VA 3BNEA 3NX0A 4BIRA 2RGQA 3GWRA 5IERA 1HU9A 1G0TA 3V92A 4JF8A 1BU4A 3BIRA 4O02B 2BHMA 2Z6BA 1YVSA 1YNVX 3O8YA 3N9HA 2UX0A 2IY2A 4HVNA 4R4KA 4NPBA 5AIIA 1R4YA 3KN4A 3D5IA 3U97A 4HM2B 5AEUB 1YI23 2SBLA 3LTCA 1IVVA 1RGFA 2HMLB 1N8QA 3WOFB 3CPW2 2B1XB 2HMMB 3K9MC 3ZG0A 1BSDA 1I8VA 2RCDA 1CYVA 1N9EA 1RLSA 1EEJA 3PGBA 3CNXA 1QJGA 3LTAA 3HX8A 2K0MA 4HBRA 1GY7A 1O7PB 2XH9A 3AGNA 5IG3A 3CXC2 3MG3A 5CLKA 2XFSA 1Q40B 1IVXA 3KKGA 4FMDA 3CCJ3 2CIUA 1O7GB 1CQSA 1RGGA 2W56B 3LT9A 3WA2X 5HOHA 1MNLA 1SIIA 1MWRA 2LYXA 3OV4A 3FG4A 4BTXA 3VGNA 1FUWA 3ALAA 1JRQA 3JVCA 1AV4A 1RGAA 1N5PA 2CWTA 4HM5B 4L7KA 2F99A 3B7CA 1M1XB 3GZBA 1AVKA 4G1MB 5KP1A 1X1YA 4HM0B 3BNCA 5D82A 4HOHA 2XEPA 6RNTA 1RMSA 4ORLA 2D42A 1B3SA 4LMIA 3VSYA 3MWZA 7STDA 1OHOA 1NWWA 1SIHA 4RNZA 1FGTA 3E99A 2W6JH 2HMOB 3T0UA 1TFKA 2KF6A 2FGTA 3I553 1VQO3 1N5HA 3CC23 3SX1A 3JUNA 5D81A 3KZTA 4RBNA 3NV0B 1YVBI 1DMMA 5DREA 2OQEC 2P0XA 2CWVA 2CW9A 3I0YA 1IK3A 5IEPA 1HKXA 1ZS7A 1W5ZA 4N6UA 5LC7A 3D5GA 1OH0A 1TRPA 1NB5I 3ZG5A 1OGXA 3X3ZA 3JUMA 1RCKA 3NHXA 3KCHA 3FF0A 4N6TA 2W04A 1BRSA 2H0HA 4CPKA 5IW9A 3G16A 1UGIA 1K9M4 2K54A 5EQLA 1SARA 3X40A 1B27A 2M7OA 3V98A 3K5TA 3AMOB 2WGQA 5IENA 2KAAA 1RGLA 1TIJA 1JB4A 3FSDA 3H51A 3U1WA 1ZGXA 3EBYA 3L0RA 3CCR3 4K61A 3S29A 1BAOA 1RGKA 2OTJ3 1BUQA 3RDEA 2Y74A 1YIT3 3NV0A 3EE1A 2IUJA 1GY5A 1WQLB 1BRIA 2CFDA 2GU1A 2KF5A 1JNQA 1W6GA 1VQ73 1GOUA 1VQ93 1I3IA 5AYSC 3OWUA 2OTL3 3DZLA 4WWUC 3PCRA 3M8CA 1X1WA 2BO9B 4HAAA 1F8NA 4WHAA 4LSOA 4BL3A 1I0XA 3FG3A 1UUGB 4RZMA 3PZWA 1NDOB 4Q53A 1O7WB 3N8BA 3WHOA 1NJI4 4J8TA 1B2MA 1DVCA 1AQZA 4XM4A 2GEXA 2H0IA 3DXOA 1OHSA 3UL5A 2W03A 2CX0A 2GSPA 3CCU3 3PYJA 2GXFA 4WYKB 5FGOA 1TFOA 5AEWB 2AAEA 1UCLA 2OOVA 2W2CA 1JN5A 2QGUA 3LH4A 3EBTA 3S5CA 1E97A 2P0MA 1A2KA 2ZA4A 2IUKA 4HZBB 1B21A 3CNMA 3QK9A 5KP3A 3F7XA 3HOHA 1FZUA 1X1XA 2XGNA 4I5QA 1QAKA 1V74A 3OWYA 2UUGC
chains in the Genus database with same CATH topology
2KF3A 2RNTA 2C4BA 1TTOA 5BU4A 1BSAA 1BSDA 1I8VA 2BU4A 1DETA 1RLSA 1BSBA 1RGHA 1JBTA 7GSPA 1BRHA 3AHWA 3AGNA 1FUTA 6GSPA 1RGGA 1PY3A 3BU4A 5HOHA 1RDSA 1BSCA 1IYYA 1HZ1A 1JBSA 1RGAA 3AGOA 1RN1A 5GSPA 2AADA 1I0VA 1X1YA 1YGWA 1DE3A 4GSPA 4HOHA 1GMPA 6RNTA 1RMSA 1B3SA 1B2ZA 1PYLA 8RNTA 1I70A 1T2IA 1RNBA 1BNJA 1RHLA 5BIRA 1X1UA 2KF6A 3D4AA 1BRNL 1RTUA 3AHSA 1RSNA 2F5WA 1GMQA 2HOHA 1UCKA 1CH0A 1I2FA 1UCIA 1I2EA 1RGEA 2F4YA 1G02A 1BVIA 3DH2A 3Q3FA 1FW7A 1B20A 3D5GA 1RGCA 1TRPA 1UCJA 4GHOA 1B2SA 4RNTA 1RCKA 1I3FA 3KCHA 1MGRA 1BRSA 1BANA 1LNIA 2RBIA 1SARA 4J5KA 1JBRA 1B27A 4J5GA 2F5MA 1BNGA 1BRGA 2KAAA 1FUSA 1RGLA 1BIRA 4BU4A 1LRAA 1TRQA 1ZGXA 1GOYA 1LOWA 1BOXA 3WR2A 1BAOA 1RGKA 1HYFA 1C54A 1BNEA 1BNRA 1RNTA 1BUJA 1BRIA 1MGWA 2KF5A 1GOUA 3A5EA 1I3IA 1GMRA 1LOVA 1RCLA 1BNSA 5RNTA 1X1WA 4HAAA 1GSPA 1LOYA 1I0XA 2BIRA 3DGYA 3RNTA 7RNTA 3GSPA 1B2XA 1BSEA 1BGSA 3WHOA 1B2MA 1RN4A 1AQZA 4BIRA 2F56A 2GSPA 1FYSA 3SYUA 1Q9EA 1BU4A 2AAEA 3BIRA 3URPA 1UCLA 1BRJA 1YVSA 1YNVX 1I2GA 1T2HA 1BNFA 2ZA4A 2SARA 1B21A 1GOVA 2KF4A 1BRKA 1BNIA 1R4YA 1AY7A 3D5IA 9RNTA 3HOHA 1FZUA 1B2UA 1X1XA 1A2PA 1RGFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KF3 A;  2RNT A;  2C4B A;  1TTO A;  5BU4 A;  1BSA A;  1BSD A;  1I8V A;  2BU4 A;  1DET A;  1RLS A;  1BSB A;  1RGH A;  1JBT A;  7GSP A;  1BRH A;  3AHW A;  3AGN A;  1FUT A;  6GSP A;  1RGG A;  1PY3 A;  3BU4 A;  5HOH A;  1RDS A;  1BSC A;  1IYY A;  1HZ1 A;  1JBS A;  1RGA A;  3AGO A;  1RN1 A;  5GSP A;  2AAD A;  1I0V A;  1X1Y A;  1YGW A;  1DE3 A;  4GSP A;  4HOH A;  1GMP A;  6RNT A;  1RMS A;  1B3S A;  1B2Z A;  1PYL A;  8RNT A;  1I70 A;  1T2I A;  1RNB A;  1BNJ A;  1RHL A;  5BIR A;  1X1U A;  2KF6 A;  3D4A A;  1BRN L;  1RTU A;  3AHS A;  1RSN A;  2F5W A;  1GMQ A;  2HOH A;  1UCK A;  1CH0 A;  1I2F A;  1UCI A;  1I2E A;  1RGE A;  2F4Y A;  1G02 A;  1BVI A;  3DH2 A;  3Q3F A;  1FW7 A;  1B20 A;  3D5G A;  1RGC A;  1TRP A;  1UCJ A;  4GHO A;  1B2S A;  4RNT A;  1RCK A;  1I3F A;  3KCH A;  1MGR A;  1BRS A;  1BAN A;  1LNI A;  2RBI A;  1SAR A;  4J5K A;  1JBR A;  1B27 A;  4J5G A;  2F5M A;  1BNG A;  1BRG A;  2KAA A;  1FUS A;  1RGL A;  1BIR A;  4BU4 A;  1LRA A;  1TRQ A;  1ZGX A;  1GOY A;  1LOW A;  1BOX A;  3WR2 A;  1BAO A;  1RGK A;  1HYF A;  1C54 A;  1BNE A;  1BNR A;  1RNT A;  1BUJ A;  1BRI A;  1MGW A;  2KF5 A;  1GOU A;  3A5E A;  1I3I A;  1GMR A;  1LOV A;  1RCL A;  1BNS A;  5RNT A;  1X1W A;  4HAA A;  1GSP A;  1LOY A;  1I0X A;  2BIR A;  3DGY A;  3RNT A;  7RNT A;  3GSP A;  1B2X A;  1BSE A;  1BGS A;  3WHO A;  1B2M A;  1RN4 A;  1AQZ A;  4BIR A;  2F56 A;  2GSP A;  1FYS A;  3SYU A;  1Q9E A;  1BU4 A;  2AAE A;  3BIR A;  3URP A;  1UCL A;  1BRJ A;  1YVS A;  1YNV X;  1I2G A;  1T2H A;  1BNF A;  2ZA4 A;  2SAR A;  1B21 A;  1GOV A;  2KF4 A;  1BRK A;  1BNI A;  1R4Y A;  1AY7 A;  3D5I A;  9RNT A;  3HOH A;  1FZU A;  1B2U A;  1X1X A;  1A2P A;  1RGF A; 
#chains in the Genus database with same CATH topology
 2XR8 B;  2KF3 A;  2C4B A;  2CFW A;  1TTO A;  3OX9 A;  1BSA A;  3D9R A;  5JBS A;  2WO0 A;  3MHE A;  4XBT A;  1D6Y A;  2ZL8 A;  1WTH A;  1Z1S A;  1YHQ 3;  1BSB A;  2CG0 A;  3HI7 A;  1BRH A;  1WMP A;  1YJW 3;  5IG5 A;  3AHW A;  3GZR A;  4HYZ A;  2OQE A;  1GD4 A;  2P09 A;  4NRE A;  1KWI A;  1ZX2 A;  2L4V A;  3EHC A;  3G71 3;  4HM7 B;  1K28 A;  3BB9 A;  2XRX B;  1HZ1 A;  3LXU X;  1JBS A;  4I4K A;  3GZY B;  5BXQ A;  1YJ9 3;  1RN1 A;  1T3B A;  2IMJ A;  3HIG A;  2AAD A;  1EA2 A;  1I0V A;  1DE3 A;  4EW5 A;  3JUP A;  2BMR B;  1IV7 A;  3V99 A;  1W6C A;  3DGO A;  1T2I A;  3EJV A;  1JZD A;  1RHL A;  5BIR A;  2JQ5 A;  4FCM A;  1RTU A;  1FGO A;  3AHS A;  1RSN A;  3NQY A;  3IMA B;  3FZW A;  3WA3 A;  3G8Z A;  4XB5 A;  2HOH A;  5AYR B;  1S72 3;  4K1U A;  4HM1 B;  3KSP A;  2O9U X;  2C10 A;  3EC9 A;  3LZA A;  4TX4 A;  1I2E A;  1W2B 2;  4XBY A;  2GBX B;  3LTD A;  3TDG A;  4GL6 A;  5TGN A;  5I97 A;  2CFK A;  2IA7 A;  1Q7H A;  5JPU A;  5G1L A;  1B20 A;  3G4S 3;  3CMA 3;  2W9Q A;  2XSH B;  1RGC A;  1GS3 A;  1M90 4;  1Q82 4;  2L1S A;  4FMA A;  5AI1 A;  1B2S A;  3RGA A;  3VF1 A;  5BVB A;  1VQK 3;  2CFL A;  1TJD A;  2CHC A;  1BAN A;  1LNI A;  2OWP A;  4KZ1 A;  1LQM B;  1OUN A;  3FGY A;  1RN7 A;  4O3V A;  1IU7 A;  1K73 4;  3KII A;  4J5G A;  4KT3 B;  2F5M A;  1A90 A;  3UL6 A;  2E2T A;  1Y4K A;  4AKY A;  5AIG A;  3CCQ 3;  2YFI B;  1LRA A;  3CC4 3;  2LQV A;  1GOY A;  2C11 A;  2WOF A;  5M18 A;  5M19 A;  1BOX A;  1LVN A;  5AIF A;  3T8N A;  3F40 A;  1OF5 B;  2MF7 A;  3NBR A;  1HYF A;  1ASK A;  1C54 A;  4CJN A;  4AEQ A;  1BNR A;  3DGL A;  2H0G A;  3Q2P A;  3Q1C A;  4BTY A;  1M1K 4;  3A5E A;  1AR0 A;  1US1 A;  4KFE A;  3CC7 3;  1GMR A;  2J8X B;  3WOE B;  2Z7A A;  3AMO A;  2WGO A;  4R9L A;  5RNT A;  1GSP A;  3DUK A;  3D3L A;  3T8U A;  4EXR A;  1DMN A;  1O7N B;  7RNT A;  3MSO A;  2QIY A;  3GSP A;  4JRF A;  3WOD G;  1RJO A;  1MOL A;  1QAF A;  3SXX A;  1BGS A;  2ZHX B;  1QMA A;  4MMX B;  1D6U A;  3EF8 A;  1RN4 A;  3IJE B;  3FCS B;  1YJN 3;  2V1L A;  1KC8 4;  2BMO B;  1IVU A;  3S28 A;  1OGZ A;  1Q9E A;  3EN1 B;  3URP A;  4XBX A;  1BRJ A;  1C7H A;  2PNC A;  1CEW I;  3OWS A;  1A2V A;  1IQ8 A;  4PEJ A;  1I2G A;  1T2H A;  3GRD A;  4CCV A;  2SAR A;  2YFJ B;  1GOV A;  2KF4 A;  1SJW A;  5G2G A;  1AY7 A;  2MC8 A;  4LZI A;  1DMQ A;  1ROV A;  2XFT A;  3CCS 3;  2FXT A;  1VZZ A;  2RNT A;  1ZO2 A;  5BU4 A;  2XF3 A;  4L8P A;  4WP5 A;  5M1A A;  1W01 A;  3SVA A;  1OPY A;  2CX1 A;  2PZV A;  1DET A;  4FCZ A;  3WMD A;  1RGH A;  3SOY A;  1JBT A;  3GZX B;  4FR9 A;  2HMN B;  1VQ6 3;  2WOH A;  2JDI H;  1VQ5 3;  1EQK A;  3K7C A;  6GSP A;  3LOY A;  1PY3 A;  3BU4 A;  3OXA A;  1JN5 B;  4H61 A;  1Q42 A;  2A15 A;  2E2U A;  3ECF A;  4AKZ A;  5A0O B;  1RDS A;  1IDP A;  3F9S A;  3NM7 A;  2HMK B;  3F7S A;  2YFL B;  4WYK A;  1IYY A;  2CWU A;  4FMC A;  3DGN A;  3AGO A;  4MEI A;  3SOA A;  2KCD A;  3KSE D;  2CK3 H;  2OOV C;  3EN8 A;  1NB3 I;  4HM3 B;  1PU4 A;  1YGW A;  1WNH A;  5G1K A;  4GSP A;  2F98 A;  4EBG A;  1GMP A;  3HII A;  3STD A;  1J2B A;  1TU5 A;  1V58 A;  3D79 A;  1UW1 A;  1M9G A;  1OCV A;  1WMN A;  3FF2 A;  8RNT A;  1ULI B;  1YGE A;  1RRH A;  3NXJ A;  1RNB A;  4L8O A;  4R9K A;  3DY5 A;  5JPP A;  1FGR A;  2P38 A;  4HZ9 B;  2GEY A;  1OAC A;  3NUV A;  3FH1 A;  1T5Y A;  1GMQ A;  2F5W A;  4R80 A;  1Q7Y 4;  3UNL A;  2O3O A;  1CH0 A;  1I2F A;  1LNH A;  2BMQ B;  4N6M A;  1UCI A;  1VQM 3;  1QVG 2;  1Q81 4;  2BNG A;  1KD1 4;  1MWU A;  1WMO A;  2F4Y A;  1AVL A;  1G02 A;  4IIA A;  2B24 B;  4ZM8 A;  1R4C A;  1FW7 A;  3LTB A;  1UCJ A;  3EX9 A;  3BND A;  4GHO A;  1TUH A;  3MG2 A;  4RNT A;  2ML5 A;  1RRL A;  1MGR A;  2UGI A;  1IQX A;  4QWT A;  2Q07 A;  4HJL B;  4XDW A;  1JB2 A;  3PCS A;  1OHP A;  3SED A;  1PFP A;  1O7M B;  3F8H A;  3NBJ A;  1BNG A;  2Y73 A;  1SQW A;  1E3R A;  5CF1 A;  2CH9 A;  3DM8 A;  4KFD A;  4ILF A;  5DRV A;  1V57 A;  3LYG A;  4FMB A;  2CFG A;  4HM6 B;  1IT7 A;  3KFQ C;  1STD A;  6STD A;  3NQZ A;  1OF5 A;  3WR2 A;  1CYU A;  1IV9 A;  2GU3 A;  5HGR A;  1BUJ A;  4O2H A;  1ISK A;  3HK4 A;  1GYB A;  3A76 A;  4OVM A;  4RNY A;  1U5O A;  4OUQ A;  8CHO A;  1LOV A;  2W9P A;  3I56 3;  1KQS 2;  2INX A;  3FKA A;  2STD A;  5CF2 A;  2W0Q A;  3DGY A;  3RNT A;  4K1V A;  1B2X A;  3NM2 A;  4KFF A;  4O8S A;  4X2H A;  5IG0 A;  3X41 A;  4R1K A;  1FGQ A;  2RFR A;  5CK6 A;  3G6E 3;  2QA4 3;  3ZFZ A;  2F56 A;  4LYL B;  1FYS A;  3SYU A;  3F8X A;  2YX9 A;  3SLU A;  3ROB A;  5CXO A;  2W56 A;  1U8C B;  3JUO A;  1UI8 A;  1BNF A;  1VQP 3;  1LXE A;  1Q40 A;  4IT7 A;  4KVH A;  3CCL 3;  1BRK A;  1BNI A;  5ELU A;  9RNT A;  1B2U A;  3LML A;  2Z77 A;  1A2P A;  1JV2 B;  5STD A;  1D6Z A;  3PS8 A;  2IYJ A;  1UUW B;  3OW2 2;  3ER7 A;  2RSX A;  3RGR A;  2BU4 A;  2ML6 A;  1N9J A;  3PXM A;  5EEO A;  4N6N B;  4STD A;  4GB5 A;  1ROA A;  3MYT A;  2QEX 3;  3GAX A;  1EKM A;  7GSP A;  1VQL 3;  2R4I A;  1JB5 A;  5IEO A;  1GD3 A;  1JZO A;  5LC6 A;  3CCM 3;  1W4N A;  1FUT A;  3B4O A;  3IPT A;  3BNB A;  1LQG C;  2CG1 A;  1O7H B;  2P05 A;  2D1W A;  4FCJ A;  1QAL A;  3S27 A;  1FA3 A;  1BSC A;  4MMZ B;  2F86 B;  3KE7 A;  1W6Y A;  3QRD A;  1DYU A;  3NBB A;  2BT3 A;  2CKF B;  5GSP A;  1E3V A;  5AIH A;  2HMJ B;  5EVH A;  3X3Y A;  1UGH I;  3S67 A;  2KXG A;  3UJM A;  1VQ4 3;  5FW5 A;  1STF I;  1IT8 A;  1B2Z A;  1PYL A;  1MWS A;  2OCT A;  3MKI A;  1I70 A;  3CU3 A;  1G96 A;  2FNQ A;  1BNJ A;  4BTW A;  1K41 A;  1VQ8 3;  4MMY B;  1X1U A;  5D83 A;  3D4A A;  3FG1 A;  1EUI C;  3K0Z A;  1BRN L;  2ZDJ A;  3HZP A;  1TP6 A;  4H3U A;  1L5G B;  3B8L A;  2Z76 A;  1UCK A;  2KRT A;  3N54 B;  2I9W A;  1W02 A;  3JUQ A;  4HM4 B;  4EC6 A;  3DGM A;  1RGE A;  3CD6 3;  1NO3 A;  1ULJ B;  1W00 A;  4HKV B;  3DH2 A;  1BVI A;  3Q3F A;  3X42 A;  1MWT A;  3B4P A;  4XDV A;  2E2V A;  3MG1 A;  1JJ2 2;  3WDG B;  4EV5 A;  3CME 3;  1K8A 4;  3MPH A;  1I3F A;  2XGL A;  3G0K A;  4LEH A;  1N8R 4;  1IVW A;  1DVD A;  1KSI A;  4LGQ A;  1JKG B;  2RBI A;  1UUV B;  4N6L A;  4EYC A;  4J5K A;  1JBR A;  3X3X A;  1JKG A;  3Q90 A;  1IQY A;  1W7C A;  4X2O A;  1NU3 A;  3EQQ B;  1BRG A;  1A67 A;  1FUS A;  5IG4 A;  1RKY A;  1VQN 3;  1BIR A;  4J9A A;  1LOX A;  4BU4 A;  5ELJ A;  4CDL A;  1TRQ A;  1GY6 A;  5IF6 A;  1W2Z A;  1LOW A;  2GBW B;  4HM8 B;  3UB1 A;  5KP4 A;  1VQQ A;  1S5A A;  1FGM A;  4N6V 0;  3FLJ A;  2K3D A;  1BNE A;  2R41 A;  1RNT A;  1UI7 A;  3DMC A;  3EB8 A;  1MGW A;  3CCE 3;  1NNV A;  4N6O B;  2CC3 A;  4OK0 A;  3H3H A;  1EG9 B;  3K63 A;  4EV2 A;  4IPB A;  4DKI A;  1QVF 2;  1RCL A;  1BNS A;  3F14 A;  4MJD A;  4NHF A;  4BL2 A;  3CPO A;  3LT8 A;  1LOY A;  1YIJ 3;  3BLZ A;  2BIR A;  4K90 B;  2XSO B;  1Q86 4;  1BSE A;  1SPU A;  3J7Y d;  3CCV 3;  4WFO A;  1UDI I;  4U13 A;  4N3V A;  3BNE A;  3NX0 A;  4BIR A;  2RGQ A;  3GWR A;  5IER A;  1HU9 A;  1G0T A;  3V92 A;  4JF8 A;  1BU4 A;  3BIR A;  4O02 B;  2BHM A;  2Z6B A;  1YVS A;  1YNV X;  3O8Y A;  3N9H A;  2UX0 A;  2IY2 A;  4HVN A;  4R4K A;  4NPB A;  5AII A;  1R4Y A;  3KN4 A;  3D5I A;  3U97 A;  4HM2 B;  5AEU B;  1YI2 3;  2SBL A;  3LTC A;  1IVV A;  1RGF A;  2HML B;  1N8Q A;  3WOF B;  3CPW 2;  2B1X B;  2HMM B;  3K9M C;  3ZG0 A;  1BSD A;  1I8V A;  2RCD A;  1CYV A;  1N9E A;  1RLS A;  1EEJ A;  3PGB A;  3CNX A;  1QJG A;  3LTA A;  3HX8 A;  2K0M A;  4HBR A;  1GY7 A;  1O7P B;  2XH9 A;  3AGN A;  5IG3 A;  3CXC 2;  3MG3 A;  5CLK A;  2XFS A;  1Q40 B;  1IVX A;  3KKG A;  4FMD A;  3CCJ 3;  2CIU A;  1O7G B;  1CQS A;  1RGG A;  2W56 B;  3LT9 A;  3WA2 X;  5HOH A;  1MNL A;  1SII A;  1MWR A;  2LYX A;  3OV4 A;  3FG4 A;  4BTX A;  3VGN A;  1FUW A;  3ALA A;  1JRQ A;  3JVC A;  1AV4 A;  1RGA A;  1N5P A;  2CWT A;  4HM5 B;  4L7K A;  2F99 A;  3B7C A;  1M1X B;  3GZB A;  1AVK A;  4G1M B;  5KP1 A;  1X1Y A;  4HM0 B;  3BNC A;  5D82 A;  4HOH A;  2XEP A;  6RNT A;  1RMS A;  4ORL A;  2D42 A;  1B3S A;  4LMI A;  3VSY A;  3MWZ A;  7STD A;  1OHO A;  1NWW A;  1SIH A;  4RNZ A;  1FGT A;  3E99 A;  2W6J H;  2HMO B;  3T0U A;  1TFK A;  2KF6 A;  2FGT A;  3I55 3;  1VQO 3;  1N5H A;  3CC2 3;  3SX1 A;  3JUN A;  5D81 A;  3KZT A;  4RBN A;  3NV0 B;  1YVB I;  1DMM A;  5DRE A;  2OQE C;  2P0X A;  2CWV A;  2CW9 A;  3I0Y A;  1IK3 A;  5IEP A;  1HKX A;  1ZS7 A;  1W5Z A;  4N6U A;  5LC7 A;  3D5G A;  1OH0 A;  1TRP A;  1NB5 I;  3ZG5 A;  1OGX A;  3X3Z A;  3JUM A;  1RCK A;  3NHX A;  3KCH A;  3FF0 A;  4N6T A;  2W04 A;  1BRS A;  2H0H A;  4CPK A;  5IW9 A;  3G16 A;  1UGI A;  1K9M 4;  2K54 A;  5EQL A;  1SAR A;  3X40 A;  1B27 A;  2M7O A;  3V98 A;  3K5T A;  3AMO B;  2WGQ A;  5IEN A;  2KAA A;  1RGL A;  1TIJ A;  1JB4 A;  3FSD A;  3H51 A;  3U1W A;  1ZGX A;  3EBY A;  3L0R A;  3CCR 3;  4K61 A;  3S29 A;  1BAO A;  1RGK A;  2OTJ 3;  1BUQ A;  3RDE A;  2Y74 A;  1YIT 3;  3NV0 A;  3EE1 A;  2IUJ A;  1GY5 A;  1WQL B;  1BRI A;  2CFD A;  2GU1 A;  2KF5 A;  1JNQ A;  1W6G A;  1VQ7 3;  1GOU A;  1VQ9 3;  1I3I A;  5AYS C;  3OWU A;  2OTL 3;  3DZL A;  4WWU C;  3PCR A;  3M8C A;  1X1W A;  2BO9 B;  4HAA A;  1F8N A;  4WHA A;  4LSO A;  4BL3 A;  1I0X A;  3FG3 A;  1UUG B;  4RZM A;  3PZW A;  1NDO B;  4Q53 A;  1O7W B;  3N8B A;  3WHO A;  1NJI 4;  4J8T A;  1B2M A;  1DVC A;  1AQZ A;  4XM4 A;  2GEX A;  2H0I A;  3DXO A;  1OHS A;  3UL5 A;  2W03 A;  2CX0 A;  2GSP A;  3CCU 3;  3PYJ A;  2GXF A;  4WYK B;  5FGO A;  1TFO A;  5AEW B;  2AAE A;  1UCL A;  2OOV A;  2W2C A;  1JN5 A;  2QGU A;  3LH4 A;  3EBT A;  3S5C A;  1E97 A;  2P0M A;  1A2K A;  2ZA4 A;  2IUK A;  4HZB B;  1B21 A;  3CNM A;  3QK9 A;  5KP3 A;  3F7X A;  3HOH A;  1FZU A;  1X1X A;  2XGN A;  4I5Q A;  1QAK A;  1V74 A;  3OWY A;  2UUG C; 
#chains in the Genus database with same CATH homology
 2KF3 A;  2RNT A;  2C4B A;  1TTO A;  5BU4 A;  1BSA A;  1BSD A;  1I8V A;  2BU4 A;  1DET A;  1RLS A;  1BSB A;  1RGH A;  1JBT A;  7GSP A;  1BRH A;  3AHW A;  3AGN A;  1FUT A;  6GSP A;  1RGG A;  1PY3 A;  3BU4 A;  5HOH A;  1RDS A;  1BSC A;  1IYY A;  1HZ1 A;  1JBS A;  1RGA A;  3AGO A;  1RN1 A;  5GSP A;  2AAD A;  1I0V A;  1X1Y A;  1YGW A;  1DE3 A;  4GSP A;  4HOH A;  1GMP A;  6RNT A;  1RMS A;  1B3S A;  1B2Z A;  1PYL A;  8RNT A;  1I70 A;  1T2I A;  1RNB A;  1BNJ A;  1RHL A;  5BIR A;  1X1U A;  2KF6 A;  3D4A A;  1BRN L;  1RTU A;  3AHS A;  1RSN A;  2F5W A;  1GMQ A;  2HOH A;  1UCK A;  1CH0 A;  1I2F A;  1UCI A;  1I2E A;  1RGE A;  2F4Y A;  1G02 A;  1BVI A;  3DH2 A;  3Q3F A;  1FW7 A;  1B20 A;  3D5G A;  1RGC A;  1TRP A;  1UCJ A;  4GHO A;  1B2S A;  4RNT A;  1RCK A;  1I3F A;  3KCH A;  1MGR A;  1BRS A;  1BAN A;  1LNI A;  2RBI A;  1SAR A;  4J5K A;  1JBR A;  1B27 A;  4J5G A;  2F5M A;  1BNG A;  1BRG A;  2KAA A;  1FUS A;  1RGL A;  1BIR A;  4BU4 A;  1LRA A;  1TRQ A;  1ZGX A;  1GOY A;  1LOW A;  1BOX A;  3WR2 A;  1BAO A;  1RGK A;  1HYF A;  1C54 A;  1BNE A;  1BNR A;  1RNT A;  1BUJ A;  1BRI A;  1MGW A;  2KF5 A;  1GOU A;  3A5E A;  1I3I A;  1GMR A;  1LOV A;  1RCL A;  1BNS A;  5RNT A;  1X1W A;  4HAA A;  1GSP A;  1LOY A;  1I0X A;  2BIR A;  3DGY A;  3RNT A;  7RNT A;  3GSP A;  1B2X A;  1BSE A;  1BGS A;  3WHO A;  1B2M A;  1RN4 A;  1AQZ A;  4BIR A;  2F56 A;  2GSP A;  1FYS A;  3SYU A;  1Q9E A;  1BU4 A;  2AAE A;  3BIR A;  3URP A;  1UCL A;  1BRJ A;  1YVS A;  1YNV X;  1I2G A;  1T2H A;  1BNF A;  2ZA4 A;  2SAR A;  1B21 A;  1GOV A;  2KF4 A;  1BRK A;  1BNI A;  1R4Y A;  1AY7 A;  3D5I A;  9RNT A;  3HOH A;  1FZU A;  1B2U A;  1X1X A;  1A2P A;  1RGF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...