3LTAA

Crystal structure of a non-biological atp binding protein with a tyr-phe mutation within the ligand binding domain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
69
structure length
69
Chain Sequence
DDDDKKTNWLKRIYRVRPCVKCKVAPRDWKVKNKHLRIFNMCKTCFNNSIDIGDDTYHGHVDWLMYADS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords ATP BINDING PROTEIN-DX
publication title Three-dimensional structures reveal multiple ADP/ATP binding modes for a synthetic class of artificial proteins.
pubmed doi rcsb
source organism Synthetic construct
total genus 19
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2010-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.210 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ltaA00
3DGNA 2P05A 3LTAA 1UW1A 3LT8A 3DGMA 3DGOA 2P09A 3LT9A 3LTBA 3LTCA 3LTDA 2P0XA 3DGLA
chains in the Genus database with same CATH superfamily
1OHSA 3CNXA 4HM8B 4FMDA 3CC23 3K63A 1EQKA 4CCVA 1IDPA 3WA2X 2KF3A 1Q9EA 4EC6A 5AIFA 1RSNA 4FCJA 1BSAA 1US1A 2CFWA 2XFSA 3AMOA 1N9JA 3EBTA 3PS8A 4QWTA 3STDA 6RNTA 3NX0A 5HOHA 1O7PB 1K734 1RLSA 1OGXA 1IQ8A 3KZTA 1FGTA 3T8NA 4U13A 3H51A 2F5WA 1LNIA 4O8SA 5G1LA 2K3DA 4Q53A 4MJDA 4NPBA 1RGCA 3BB9A 1TTOA 3CCU3 1F8NA 1W6CA 1UCIA 2CH9A 1A2PA 1IT7A 3DGLA 1IVWA 1M1XB 1UGIA 2RFRA 3FH1A 1FUWA 7GSPA 5IG5A 2GBWB 2R41A 3URPA 4TX4A 1GOUA 5JPPA 1YGEA 2WOFA 2P0XA 2CHCA 1NO3A 1RRHA 3LMLA 2CIUA 1K28A 3WR2A 1MNLA 1ZX2A 1OF5A 3MG3A 1B3SA 3EE1A 4BL2A 1VQN3 2SBLA 3EB8A 3D5GA 1Q864 3X42A 1EKMA 1VQQA 4EBGA 2P38A 3FF0A 3WOFB 3CCJ3 3I563 2KRTA 3KSPA 1IVVA 3WA3A 1FW7A 5M19A 2Z76A 1JN5A 1GY7A 4O02B 1MGWA 1AVKA 1I2FA 4ORLA 2KF4A 1BNIA 1EA2A 4BTYA 2WGOA 3ALAA 1OGZA 2XGNA 3AMOB 3WHOA 1JJ22 1GD3A 4MMYB 1YNVX 4N6MA 1STFI 3GZYB 4I5QA 2IA7A 1Q7HA 3K9MC 3SOYA 1IT8A 1FYSA 3CCQ3 4HBRA 4HM5B 1BNFA 4J9AA 1OUNA 1JRQA 2MF7A 1CEWI 2Z77A 1OH0A 1BRJA 2CFGA 2O3OA 1B2XA 3UL5A 2PNCA 1UDII 5JBSA 2UUGC 2W03A 1BRHA 4R9KA 4XBXA 3OWUA 3RGAA 5A0OB 5BU4A 1MOLA 1OHOA 4N6OB 1VQ73 5CK6A 1J2BA 1W2ZA 3BU4A 1W02A 2XSOB 5D83A 4AKYA 1GMRA 3IJEB 2IY2A 3DY5A 1OF5B 3OWYA 3GAXA 1UCJA 3GRDA 4MMXB 1EUIC 4NHFA 4DKIA 1BRKA 3CCE3 3I0YA 4HM4B 1RCKA 1MWRA 1NDOB 1RMSA 3S27A 4BIRA 3JUNA 2XR8B 4N6LA 4LMIA 1JN5B 4FCZA 4N3VA 4FCMA 3DM8A 4J5KA 1SIHA 3ER7A 1RGAA 1BVIA 1BRNL 4RNYA 1CH0A 3AGNA 3MYTA 3RDEA 5IW9A 3FG4A 5LC7A 2W56A 3ZG0A 9RNTA 3U1WA 3KIIA 3X3YA 2XSHB 1FGOA 2QGUA 1LOVA 1HU9A 5IF6A 3TDGA 1FZUA 2CFKA 3UNLA 4K90B 4XDVA 2LYXA 3DZLA 4KFEA 3VSYA 2HMJB 3MG1A 2XRXB 4G1MB 1IVXA 3B4PA 1JBRA 2IMJA 1DMNA 1YIT3 5M18A 3AGOA 1U8CB 3PZWA 1AQZA 1QALA 1YJ93 1NNVA 3SYUA 1GYBA 2XF3A 1X1XA 3SX1A 2F86B 2IUJA 4HM6B 1RNTA 2GXFA 3OW22 3LYGA 2P09A 3NBRA 1BNGA 2HMOB 3G8ZA 3A5EA 1IU7A 2F99A 1AY7A 1RDSA 5D82A 3VF1A 1VQK3 1VQ83 5TGNA 1MGRA 1G02A 5HGRA 4WYKB 3CCM3 3E99A 2HMMB 2QA43 1ZGXA 4XB5A 3EHCA 1YVSA 1N5PA 1S723 1FGMA 3FF2A 1T2HA 1RCLA 2Z6BA 4STDA 4HYZA 3HI7A 1ULJB 3BNDA 1I0XA 4HM0B 2CFDA 4AEQA 4RNZA 4EV2A 5STDA 3S29A 3CMA3 2HMLB 1E97A 3SXXA 2W56B 4R1KA 2D1WA 3HIGA 2QIYA 2HMKB 1I2GA 1N5HA 1GS3A 1NB3I 3F7XA 7STDA 1DVDA 3D3LA 3Q2PA 3F40A 5IG4A 2BMQB 2RNTA 5IG0A 3Q1CA 3CC73 1A90A 3GZRA 3HK4A 2GBXB 4CJNA 3MHEA 3CD63 1I8VA 2GU1A 4HAAA 4XDWA 1I3IA 5LC6A 5BIRA 1BAOA 1B20A 3D4AA 2KAAA 3ECFA 4WFOA 4JF8A 1BSBA 2OOVA 1YJN3 1YVBI 3S5CA 3F8XA 2F56A 2C11A 4L8OA 1X1YA 1ROVA 3V98A 1B27A 3GWRA 1CYUA 2OQEA 1LQGC 5CXOA 1KC84 4L8PA 5IG3A 2OQEC 4N6V0 2KCDA 2RGQA 2BIRA 2FXTA 3Q90A 1VQO3 3NBBA 4OUQA 1UUWB 1BSCA 2WOHA 4K1VA 1W2B2 2CX0A 1RGEA 1IV9A 2V1LA 3DGNA 3EX9A 3HX8A 1N9EA 1R4CA 4WHAA 1ASKA 5AIIA 1O7NB 1ZO2A 4EV5A 2OTJ3 3FSDA 1MWSA 4KFDA 2BT3A 2I9WA 3V99A 3J7Yd 4WWUC 2FNQA 3N54B 1OCVA 1KD14 3BNEA 1FUTA 1OHPA 1RGHA 2W9QA 2YFJB 2C4BA 4AKZA 1T2IA 4BL3A 4LEHA 2B24B 3SOAA 1DYUA 3CME3 3CCS3 1BRIA 1RGLA 2INXA 2BNGA 4FMAA 4GHOA 2ZA4A 3IMAB 5G1KA 3SLUA 4OVMA 3CU3A 3KE7A 3H3HA 3D9RA 4HM3B 4BU4A 1M1K4 3FG1A 3PXMA 2BMRB 2CK3H 1HYFA 3NXJA 4CDLA 2OWPA 1C7HA 4JRFA 2XGLA 1BOXA 4WP5A 1WMPA 1VQM3 1TU5A 3FG3A 1TIJA 1TFOA 4LZIA 1T5YA 5GSPA 2CKFB 1PY3A 1LOYA 3WOEB 3M8CA 1RN7A 3CNMA 2O9UX 1YHQ3 2A15A 2K0MA 2OCTA 2P05A 3DGMA 1GMQA 3WMDA 3NHXA 1S5AA 4IPBA 1I3FA 2JDIH 3F9SA 1FUSA 1A2KA 1UUGB 3A76A 4WYKA 4XBYA 3LTAA 1UW1A 2RBIA 3CXC2 3D5IA 1RJOA 3DUKA 1UCLA 5D81A 2CG0A 1BSEA 1QAFA 1W7CA 2W04A 1LXEA 3DGYA 4KFFA 1X1UA 3S67A 4HM2B 1DMQA 4BTWA 1VZZA 1TRQA 1K41A 5AI1A 3UL6A 4LYLB 1LNHA 5FW5A 1JNQA 4N6TA 2SARA 3DXOA 5KP4A 1RTUA 1UI7A 2K54A 3K5TA 4R80A 2H0HA 2CFLA 2L1SA 2B1XB 4N6NB 4J5GA 1W6GA 1RGGA 3WDGB 5DRVA 1BIRA 4RNTA 3EQQB 1LRAA 1JZOA 3MSOA 2WGQA 3V92A 1SARA 3G0KA 2H0IA 3EF8A 7RNTA 3ZFZA 2HMNB 1KQS2 1I70A 2FGTA 2CWTA 1QMAA 1JV2B 1B2UA 1W4NA 3F14A 5I97A 3F8HA 3LT8A 1GD4A 2ZDJA 1NWWA 1RGFA 1WTHA 1TP6A 3PYJA 1WMNA 3CCR3 1TJDA 3B4OA 1O7MB 3S28A 4NREA 1RN1A 1UUVB 3OV4A 1GSPA 3KFQC 4HJLB 2XEPA 1TRPA 1AR0A 3OXAA 3L0RA 1BNEA 1DMMA 2CG1A 1BNJA 3EN1B 4OK0A 4HOHA 1JZDA 3B7CA 4LSOA 5AYRB 1JBTA 3PCSA 8RNTA 3FKAA 2AAEA 3MWZA 4RZMA 3PCRA 1E3RA 1I0VA 1O7HB 1C54A 5AEWB 2W0QA 3JUMA 1LOWA 5JPUA 2L4VA 3LT9A 3QK9A 5AIHA 2GSPA 3MG2A 3OX9A 3GZBA 4RBNA 1IQXA 1PYLA 4HKVB 1FGRA 5FGOA 6STDA 3ROBA 3G16A 3LZAA 3JVCA 1G96A 3VGNA 2KF6A 2F4YA 3KN4A 1UCKA 2YFLB 1NB5I 1HKXA 1PU4A 1GOYA 3BIRA 4KT3B 5RNTA 1B21A 2RCDA 1D6YA 3DGOA 1BU4A 4GL6A 3CC43 1BRGA 4J8TA 1MWTA 1SIIA 1V57A 4L7KA 1BANA 1SQWA 6GSPA 1X1WA 3RNTA 8CHOA 3I553 1JB2A 4HM7B 4H61A 5ELUA 4K1UA 2CWVA 1MWUA 1L5GB 3NQYA 1OACA 4X2HA 1W01A 4R9LA 3KSED 1EG9B 1BUJA 1WQLB 1PFPA 2OOVC 2PZVA 2YX9A 1NJI4 1CYVA 2LQVA 5BXQA 5CF1A 2GU3A 4GSPA 1Q814 1YIJ3 1IQYA 1U5OA 2CC3A 3QRDA 1RKYA 1QVF2 1YI23 3FZWA 1AV4A 3HOHA 5KP3A 3F7SA 3IPTA 3MPHA 3Q3FA 1LVNA 4HM1B 1WMOA 1JKGA 2GEXA 5EEOA 1V58A 2IYJA 3AHSA 1ISKA 2KXGA 5KP1A 2F98A 1JB4A 4ZM8A 2W2CA 1CQSA 1K9M4 1SJWA 1LOXA 2R4IA 4FMCA 5AEUB 2RSXA 2QEX3 2UGIA 1YJW3 1TUHA 2W6JH 4XBTA 2M7OA 3T8UA 2BU4A 1VQ53 2IUKA 1N8R4 4GB5A 3D79A 2BO9B 3NV0A 1Q7Y4 1Y4KA 1ROAA 1ULIB 1IYYA 5IEPA 1K8A4 3X41A 1YGWA 1LQMB 1VQ93 4IT7A 3CPW2 2XH9A 2ZHXB 1N8QA 1A67A 3KKGA 4KZ1A 1QAKA 3T0UA 3CCV3 1QVG2 1G0TA 3BLZA 1Q40A 2W9PA 3JUQA 5EQLA 3UJMA 2YFIB 1T3BA 1JBSA 1BRSA 3LOYA 1NU3A 2E2UA 3N8BA 1B2ZA 4R4KA 3LTDA 1JB5A 2Y73A 3HZPA 3K7CA 3N9HA 1GY5A 2JQ5A 4EXRA 1BGSA 4EW5A 1IVUA 4H3UA 2CW9A 4FMBA 5ELJA 1QJGA 4X2OA 1JKGB 2CX1A 2E2TA 2ML6A 3NUVA 2F5MA 3FGYA 4N6UA 5EVHA 2ML5A 3ZG5A 1D6UA 3SVAA 2OTL3 2Y74A 1BUQA 2HOHA 1W00A 2D42A 3DH2A 3RGRA 5IERA 1UGHI 3GSPA 3G6E3 1I2EA 3FCSB 3LTCA 2GEYA 3O8YA 1E3VA 3G713 3JUPA 2Z7AA 5CLKA 4O2HA 4CPKA 5IENA 3NV0B 4KVHA 1O7GB 3KCHA 4HVNA 1VQ43 1GOVA 1KWIA 3X3ZA 3LTBA 4I4KA 1GMPA 3FLJA 1FA3A 1W5ZA 2BMOB 3NM2A 3NQZA 2H0GA 5BVBA 1B2MA 2ZL8A 1IK3A 3EN8A 1GY6A 3EC9A 1VQP3 1FGQA 1IV7A 5IEOA 1V74A 1W6YA 1Q40B 1STDA 5DREA 1RNBA 1VQ63 1WNHA 1ZS7A 3BNBA 3LH4A 3OWSA 2STDA 4PEJA 2CWUA 4FR9A 3X3XA 1M904 5CF2A 3SEDA 1Q42A 1EEJA 4K61A 3HIIA 4IIAA 5AYSC 3UB1A 4O3VA 1VQL3 1R4YA 3NM7A 4MEIA 1HZ1A 3DMCA 4HZ9B 1RN4A 2UX0A 3X40A 1D6ZA 4BTXA 3U97A 3BNCA 1DE3A 1A2VA 3G4S3 1Z1SA 4HZBB 1RGKA 3WODG 1DETA 5M1AA 1KSIA 1BNRA 3LXUX 1O7WB 3GZXB 3PGBA 1M9GA 2AADA 1B2SA 1OPYA 2XFTA 3AHWA 3K0ZA 2MC8A 4MMZB 3EBYA 3CCL3 1TFKA 1Q824 3NBJA 3B8LA 1RRLA 2E2VA 2Q07A 3EJVA 2P0MA 1BNSA 2J8XB 5G2GA 5AIGA 4LGQA 1BSDA 1AVLA 4EYCA 2WO0A 1RHLA 3JUOA 4XM4A 1UI8A 1SPUA 4ILFA 2BHMA 2KF5A 1DVCA 3MKIA 3CPOA 2C10A
chains in the Genus database with same CATH topology
1OHSA 3CNXA 4HM8B 4FMDA 3CC23 3K63A 1EQKA 4CCVA 1IDPA 3WA2X 4EC6A 5AIFA 4FCJA 1US1A 2XFSA 2CFWA 3AMOA 3PS8A 1N9JA 3EBTA 4QWTA 3STDA 3NX0A 1O7PB 1K734 1OGXA 1IQ8A 3KZTA 1FGTA 3T8NA 4U13A 3H51A 4O8SA 4Q53A 4MJDA 3BB9A 3CCU3 1F8NA 1W6CA 2CH9A 1IT7A 3DGLA 1M1XB 1IVWA 2RFRA 3FH1A 1FUWA 5IG5A 2GBWB 4TX4A 5JPPA 1YGEA 2WOFA 2P0XA 2CHCA 1NO3A 1RRHA 3LMLA 2CIUA 1K28A 1MNLA 1ZX2A 1OF5A 3MG3A 3EE1A 1VQN3 2SBLA 3EB8A 1Q864 3X42A 1EKMA 4EBGA 2P38A 3FF0A 3WOFB 3CCJ3 3I563 2KRTA 3KSPA 1IVVA 3WA3A 2Z76A 1JN5A 1GY7A 4O02B 1AVKA 4ORLA 1EA2A 4BTYA 2WGOA 3ALAA 1OGZA 2XGNA 3AMOB 1JJ22 1GD3A 4MMYB 4N6MA 1STFI 3GZYB 2IA7A 3K9MC 3SOYA 1IT8A 3CCQ3 4HBRA 4HM5B 4J9AA 1OUNA 1JRQA 2MF7A 1CEWI 2Z77A 1OH0A 2O3OA 2CFGA 3UL5A 2PNCA 5JBSA 4XBXA 2W03A 4R9KA 5A0OB 1VQ83 3OWUA 3RGAA 1MOLA 1OHOA 4N6OB 1VQ73 5CK6A 1J2BA 1W2ZA 1W02A 2XSOB 5D83A 4AKYA 3IJEB 3DY5A 1OF5B 3OWYA 3GAXA 4MMXB 3GRDA 4NHFA 3CCE3 3I0YA 4HM4B 1NDOB 3S27A 3JUNA 2XR8B 4N6LA 4LMIA 1JN5B 4FCZA 4N3VA 4FCMA 3DM8A 1SIHA 3ER7A 4RNYA 3MYTA 3RDEA 5IW9A 3FG4A 5LC7A 2W56A 3U1WA 3KIIA 3X3YA 2XSHB 1FGOA 2QGUA 1HU9A 5IF6A 3TDGA 2CFKA 3UNLA 4K90B 4XDVA 2LYXA 3DZLA 4KFEA 3VSYA 2HMJB 3MG1A 2XRXB 4G1MB 1IVXA 3B4PA 2IMJA 1DMNA 1YIT3 1U8CB 3PZWA 1QALA 1YJ93 1GYBA 2XF3A 3SX1A 2F86B 2IUJA 4HM6B 2GXFA 3OW22 3LYGA 2P09A 3NBRA 2HMOB 3G8ZA 1IU7A 2F99A 5D82A 3VF1A 1VQK3 5TGNA 5HGRA 4WYKB 3CCM3 3E99A 2HMMB 2QA43 4XB5A 3EHCA 1N5PA 1S723 1FGMA 3FF2A 2Z6BA 4STDA 4HYZA 3HI7A 1ULJB 3BNDA 4HM0B 2CFDA 4AEQA 4RNZA 4EV2A 5STDA 3S29A 3CMA3 2HMLB 1E97A 3SXXA 2W56B 4R1KA 2D1WA 3HIGA 2QIYA 2HMKB 1N5HA 1GS3A 1NB3I 3F7XA 7STDA 1DVDA 3D3LA 3Q2PA 3F40A 5IG4A 2BMQB 5IG0A 3CC73 3Q1CA 1A90A 3GZRA 3HK4A 2GBXB 3MHEA 3CD63 2GU1A 4XDWA 5LC6A 3ECFA 4WFOA 4JF8A 2OOVA 1YJN3 1YVBI 3S5CA 3F8XA 2C11A 4L8OA 1ROVA 3V98A 3GWRA 1CYUA 2OQEA 5CXOA 1KC84 4L8PA 5IG3A 2OQEC 4N6V0 2KCDA 2RGQA 2FXTA 3Q90A 1VQO3 3NBBA 4OUQA 1UUWB 2WOHA 4K1VA 1W2B2 1IV9A 2V1LA 3DGNA 3EX9A 3HX8A 1N9EA 1R4CA 4WHAA 1ASKA 5AIIA 1O7NB 1ZO2A 4EV5A 2OTJ3 3FSDA 4KFDA 3V99A 2BT3A 2I9WA 3J7Yd 4WWUC 2FNQA 3N54B 1OCVA 1KD14 3BNEA 1OHPA 2W9QA 2YFJB 4AKZA 4LEHA 2B24B 3SOAA 1DYUA 3CME3 3CCS3 4FMAA 2INXA 2BNGA 3IMAB 3SLUA 4OVMA 3CU3A 3KE7A 3H3HA 3D9RA 4HM3B 1M1K4 3FG1A 3PXMA 2BMRB 2CK3H 3NXJA 4CDLA 2OWPA 1C7HA 4JRFA 2XGLA 4WP5A 1WMPA 1VQM3 1TU5A 3FG3A 1TIJA 1TFOA 4LZIA 1T5YA 2CKFB 3WOEB 3M8CA 1RN7A 3CNMA 2O9UX 1YHQ3 2A15A 2K0MA 2OCTA 2P05A 3DGMA 3WMDA 3NHXA 1S5AA 4IPBA 2JDIH 3F9SA 1A2KA 3A76A 4WYKA 4XBYA 3CXC2 3LTAA 1UW1A 1RJOA 3DUKA 5D81A 2CG0A 1QAFA 1W7CA 2W04A 1LXEA 4KFFA 3S67A 4HM2B 1DMQA 4BTWA 1VZZA 1K41A 5AI1A 3UL6A 5KP4A 1LNHA 5FW5A 1JNQA 4N6TA 3DXOA 1UI7A 2K54A 3K5TA 4R80A 2CFLA 2B1XB 4N6NB 1W6GA 3WDGB 5DRVA 3EQQB 3MSOA 2WGQA 3V92A 3G0KA 3EF8A 1KQS2 2HMNB 2FGTA 2CWTA 1QMAA 1JV2B 1W4NA 3F14A 5I97A 3F8HA 3LT8A 1GD4A 2ZDJA 1NWWA 1WTHA 1TP6A 3PYJA 1WMNA 3CCR3 3B4OA 1O7MB 3S28A 4NREA 1UUVB 3OV4A 3KFQC 4HJLB 2XEPA 1AR0A 3OXAA 3L0RA 2CG1A 1DMMA 3EN1B 4OK0A 3B7CA 4LSOA 5AYRB 3PCSA 3FKAA 3MWZA 4RZMA 3PCRA 1E3RA 1O7HB 5AEWB 2W0QA 3JUMA 5JPUA 2L4VA 3LT9A 3QK9A 5AIHA 3MG2A 3OX9A 3GZBA 4RBNA 1IQXA 4HKVB 1FGRA 5FGOA 6STDA 3ROBA 3G16A 3LZAA 3JVCA 1G96A 3VGNA 3KN4A 2YFLB 1NB5I 1HKXA 1PU4A 2RCDA 1D6YA 3DGOA 4GL6A 3CC43 4J8TA 1SIIA 4L7KA 1SQWA 8CHOA 3I553 1JB2A 4HM7B 4H61A 5ELUA 4K1UA 2CWVA 1L5GB 3NQYA 1OACA 4X2HA 1W01A 4R9LA 3KSED 1EG9B 1WQLB 1PFPA 2OOVC 2PZVA 2YX9A 1NJI4 1CYVA 2LQVA 5BXQA 5CF1A 2GU3A 1Q814 1YIJ3 1IQYA 1U5OA 2CC3A 3QRDA 1RKYA 1QVF2 1YI23 3FZWA 1AV4A 5KP3A 3F7SA 3IPTA 3MPHA 1LVNA 4HM1B 1WMOA 1JKGA 2GEXA 5EEOA 1ISKA 2KXGA 5KP1A 2F98A 1JB4A 4ZM8A 2W2CA 1CQSA 1K9M4 1SJWA 2R4IA 1LOXA 4FMCA 5AEUB 2RSXA 2QEX3 1YJW3 1TUHA 2W6JH 4XBTA 2M7OA 3T8UA 1VQ53 2IUKA 1N8R4 4GB5A 2BO9B 3NV0A 1Q7Y4 1Y4KA 1ROAA 1ULIB 5IEPA 1K8A4 3X41A 1VQ93 4IT7A 3CPW2 2XH9A 1A67A 1N8QA 3KKGA 4KZ1A 1QAKA 3T0UA 3CCV3 1QVG2 3BLZA 1Q40A 2W9PA 3JUQA 5EQLA 3UJMA 2YFIB 3LOYA 1NU3A 2E2UA 3N8BA 4R4KA 3LTDA 1JB5A 2Y73A 3HZPA 3K7CA 3N9HA 1GY5A 2JQ5A 4EXRA 1IVUA 4H3UA 2CW9A 4FMBA 5ELJA 1QJGA 4X2OA 1JKGB 4N6UA 2E2TA 2ML6A 3NUVA 3FGYA 5EVHA 2ML5A 1D6UA 3SVAA 2OTL3 2Y74A 1BUQA 1W00A 2D42A 3RGRA 5IERA 3G6E3 3FCSB 3LTCA 2GEYA 3O8YA 1E3VA 3G713 3JUPA 2Z7AA 5CLKA 4O2HA 5IENA 3NV0B 4KVHA 1O7GB 4HVNA 1VQ43 1KWIA 3X3ZA 3LTBA 4I4KA 3FLJA 1FA3A 1W5ZA 2BMOB 3NM2A 3NQZA 5BVBA 2ZL8A 1IK3A 3EN8A 1GY6A 3EC9A 1VQP3 1FGQA 1IV7A 5IEOA 1V74A 1W6YA 1Q40B 1STDA 5DREA 1VQ63 1WNHA 3LH4A 3BNBA 3OWSA 2STDA 4PEJA 2CWUA 4FR9A 3X3XA 1M904 5CF2A 3SEDA 1Q42A 4K61A 3HIIA 4IIAA 5AYSC 3UB1A 4O3VA 1VQL3 3NM7A 4MEIA 3DMCA 4HZ9B 2UX0A 3X40A 1D6ZA 4BTXA 3U97A 3BNCA 1A2VA 3G4S3 1Z1SA 4HZBB 3WODG 1KSIA 3LXUX 1O7WB 3GZXB 3PGBA 1M9GA 3K0ZA 1OPYA 2XFTA 2MC8A 4MMZB 3EBYA 3CCL3 1TFKA 1Q824 3NBJA 3B8LA 1RRLA 2E2VA 2Q07A 3EJVA 2P0MA 5G2GA 5AIGA 4LGQA 1AVLA 4EYCA 2WO0A 3JUOA 4XM4A 1UI8A 1SPUA 2BHMA 1DVCA 3MKIA 3CPOA 2C10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DGN A;  2P05 A;  3LTA A;  1UW1 A;  3LT8 A;  3DGM A;  3DGO A;  2P09 A;  3LT9 A;  3LTB A;  3LTC A;  3LTD A;  2P0X A;  3DGL A; 
#chains in the Genus database with same CATH topology
 1OHS A;  3CNX A;  4HM8 B;  4FMD A;  3CC2 3;  3K63 A;  1EQK A;  4CCV A;  1IDP A;  3WA2 X;  2KF3 A;  1Q9E A;  4EC6 A;  5AIF A;  1RSN A;  4FCJ A;  1BSA A;  1US1 A;  2CFW A;  2XFS A;  3AMO A;  1N9J A;  3EBT A;  3PS8 A;  4QWT A;  3STD A;  6RNT A;  3NX0 A;  5HOH A;  1O7P B;  1K73 4;  1RLS A;  1OGX A;  1IQ8 A;  3KZT A;  1FGT A;  3T8N A;  4U13 A;  3H51 A;  2F5W A;  1LNI A;  4O8S A;  5G1L A;  2K3D A;  4Q53 A;  4MJD A;  4NPB A;  1RGC A;  3BB9 A;  1TTO A;  3CCU 3;  1F8N A;  1W6C A;  1UCI A;  2CH9 A;  1A2P A;  1IT7 A;  3DGL A;  1IVW A;  1M1X B;  1UGI A;  2RFR A;  3FH1 A;  1FUW A;  7GSP A;  5IG5 A;  2GBW B;  2R41 A;  3URP A;  4TX4 A;  1GOU A;  5JPP A;  1YGE A;  2WOF A;  2P0X A;  2CHC A;  1NO3 A;  1RRH A;  3LML A;  2CIU A;  1K28 A;  3WR2 A;  1MNL A;  1ZX2 A;  1OF5 A;  3MG3 A;  1B3S A;  3EE1 A;  4BL2 A;  1VQN 3;  2SBL A;  3EB8 A;  3D5G A;  1Q86 4;  3X42 A;  1EKM A;  1VQQ A;  4EBG A;  2P38 A;  3FF0 A;  3WOF B;  3CCJ 3;  3I56 3;  2KRT A;  3KSP A;  1IVV A;  3WA3 A;  1FW7 A;  5M19 A;  2Z76 A;  1JN5 A;  1GY7 A;  4O02 B;  1MGW A;  1AVK A;  1I2F A;  4ORL A;  2KF4 A;  1BNI A;  1EA2 A;  4BTY A;  2WGO A;  3ALA A;  1OGZ A;  2XGN A;  3AMO B;  3WHO A;  1JJ2 2;  1GD3 A;  4MMY B;  1YNV X;  4N6M A;  1STF I;  3GZY B;  4I5Q A;  2IA7 A;  1Q7H A;  3K9M C;  3SOY A;  1IT8 A;  1FYS A;  3CCQ 3;  4HBR A;  4HM5 B;  1BNF A;  4J9A A;  1OUN A;  1JRQ A;  2MF7 A;  1CEW I;  2Z77 A;  1OH0 A;  1BRJ A;  2CFG A;  2O3O A;  1B2X A;  3UL5 A;  2PNC A;  1UDI I;  5JBS A;  2UUG C;  2W03 A;  1BRH A;  4R9K A;  4XBX A;  3OWU A;  3RGA A;  5A0O B;  5BU4 A;  1MOL A;  1OHO A;  4N6O B;  1VQ7 3;  5CK6 A;  1J2B A;  1W2Z A;  3BU4 A;  1W02 A;  2XSO B;  5D83 A;  4AKY A;  1GMR A;  3IJE B;  2IY2 A;  3DY5 A;  1OF5 B;  3OWY A;  3GAX A;  1UCJ A;  3GRD A;  4MMX B;  1EUI C;  4NHF A;  4DKI A;  1BRK A;  3CCE 3;  3I0Y A;  4HM4 B;  1RCK A;  1MWR A;  1NDO B;  1RMS A;  3S27 A;  4BIR A;  3JUN A;  2XR8 B;  4N6L A;  4LMI A;  1JN5 B;  4FCZ A;  4N3V A;  4FCM A;  3DM8 A;  4J5K A;  1SIH A;  3ER7 A;  1RGA A;  1BVI A;  1BRN L;  4RNY A;  1CH0 A;  3AGN A;  3MYT A;  3RDE A;  5IW9 A;  3FG4 A;  5LC7 A;  2W56 A;  3ZG0 A;  9RNT A;  3U1W A;  3KII A;  3X3Y A;  2XSH B;  1FGO A;  2QGU A;  1LOV A;  1HU9 A;  5IF6 A;  3TDG A;  1FZU A;  2CFK A;  3UNL A;  4K90 B;  4XDV A;  2LYX A;  3DZL A;  4KFE A;  3VSY A;  2HMJ B;  3MG1 A;  2XRX B;  4G1M B;  1IVX A;  3B4P A;  1JBR A;  2IMJ A;  1DMN A;  1YIT 3;  5M18 A;  3AGO A;  1U8C B;  3PZW A;  1AQZ A;  1QAL A;  1YJ9 3;  1NNV A;  3SYU A;  1GYB A;  2XF3 A;  1X1X A;  3SX1 A;  2F86 B;  2IUJ A;  4HM6 B;  1RNT A;  2GXF A;  3OW2 2;  3LYG A;  2P09 A;  3NBR A;  1BNG A;  2HMO B;  3G8Z A;  3A5E A;  1IU7 A;  2F99 A;  1AY7 A;  1RDS A;  5D82 A;  3VF1 A;  1VQK 3;  1VQ8 3;  5TGN A;  1MGR A;  1G02 A;  5HGR A;  4WYK B;  3CCM 3;  3E99 A;  2HMM B;  2QA4 3;  1ZGX A;  4XB5 A;  3EHC A;  1YVS A;  1N5P A;  1S72 3;  1FGM A;  3FF2 A;  1T2H A;  1RCL A;  2Z6B A;  4STD A;  4HYZ A;  3HI7 A;  1ULJ B;  3BND A;  1I0X A;  4HM0 B;  2CFD A;  4AEQ A;  4RNZ A;  4EV2 A;  5STD A;  3S29 A;  3CMA 3;  2HML B;  1E97 A;  3SXX A;  2W56 B;  4R1K A;  2D1W A;  3HIG A;  2QIY A;  2HMK B;  1I2G A;  1N5H A;  1GS3 A;  1NB3 I;  3F7X A;  7STD A;  1DVD A;  3D3L A;  3Q2P A;  3F40 A;  5IG4 A;  2BMQ B;  2RNT A;  5IG0 A;  3Q1C A;  3CC7 3;  1A90 A;  3GZR A;  3HK4 A;  2GBX B;  4CJN A;  3MHE A;  3CD6 3;  1I8V A;  2GU1 A;  4HAA A;  4XDW A;  1I3I A;  5LC6 A;  5BIR A;  1BAO A;  1B20 A;  3D4A A;  2KAA A;  3ECF A;  4WFO A;  4JF8 A;  1BSB A;  2OOV A;  1YJN 3;  1YVB I;  3S5C A;  3F8X A;  2F56 A;  2C11 A;  4L8O A;  1X1Y A;  1ROV A;  3V98 A;  1B27 A;  3GWR A;  1CYU A;  2OQE A;  1LQG C;  5CXO A;  1KC8 4;  4L8P A;  5IG3 A;  2OQE C;  4N6V 0;  2KCD A;  2RGQ A;  2BIR A;  2FXT A;  3Q90 A;  1VQO 3;  3NBB A;  4OUQ A;  1UUW B;  1BSC A;  2WOH A;  4K1V A;  1W2B 2;  2CX0 A;  1RGE A;  1IV9 A;  2V1L A;  3DGN A;  3EX9 A;  3HX8 A;  1N9E A;  1R4C A;  4WHA A;  1ASK A;  5AII A;  1O7N B;  1ZO2 A;  4EV5 A;  2OTJ 3;  3FSD A;  1MWS A;  4KFD A;  2BT3 A;  2I9W A;  3V99 A;  3J7Y d;  4WWU C;  2FNQ A;  3N54 B;  1OCV A;  1KD1 4;  3BNE A;  1FUT A;  1OHP A;  1RGH A;  2W9Q A;  2YFJ B;  2C4B A;  4AKZ A;  1T2I A;  4BL3 A;  4LEH A;  2B24 B;  3SOA A;  1DYU A;  3CME 3;  3CCS 3;  1BRI A;  1RGL A;  2INX A;  2BNG A;  4FMA A;  4GHO A;  2ZA4 A;  3IMA B;  5G1K A;  3SLU A;  4OVM A;  3CU3 A;  3KE7 A;  3H3H A;  3D9R A;  4HM3 B;  4BU4 A;  1M1K 4;  3FG1 A;  3PXM A;  2BMR B;  2CK3 H;  1HYF A;  3NXJ A;  4CDL A;  2OWP A;  1C7H A;  4JRF A;  2XGL A;  1BOX A;  4WP5 A;  1WMP A;  1VQM 3;  1TU5 A;  3FG3 A;  1TIJ A;  1TFO A;  4LZI A;  1T5Y A;  5GSP A;  2CKF B;  1PY3 A;  1LOY A;  3WOE B;  3M8C A;  1RN7 A;  3CNM A;  2O9U X;  1YHQ 3;  2A15 A;  2K0M A;  2OCT A;  2P05 A;  3DGM A;  1GMQ A;  3WMD A;  3NHX A;  1S5A A;  4IPB A;  1I3F A;  2JDI H;  3F9S A;  1FUS A;  1A2K A;  1UUG B;  3A76 A;  4WYK A;  4XBY A;  3LTA A;  1UW1 A;  2RBI A;  3CXC 2;  3D5I A;  1RJO A;  3DUK A;  1UCL A;  5D81 A;  2CG0 A;  1BSE A;  1QAF A;  1W7C A;  2W04 A;  1LXE A;  3DGY A;  4KFF A;  1X1U A;  3S67 A;  4HM2 B;  1DMQ A;  4BTW A;  1VZZ A;  1TRQ A;  1K41 A;  5AI1 A;  3UL6 A;  4LYL B;  1LNH A;  5FW5 A;  1JNQ A;  4N6T A;  2SAR A;  3DXO A;  5KP4 A;  1RTU A;  1UI7 A;  2K54 A;  3K5T A;  4R80 A;  2H0H A;  2CFL A;  2L1S A;  2B1X B;  4N6N B;  4J5G A;  1W6G A;  1RGG A;  3WDG B;  5DRV A;  1BIR A;  4RNT A;  3EQQ B;  1LRA A;  1JZO A;  3MSO A;  2WGQ A;  3V92 A;  1SAR A;  3G0K A;  2H0I A;  3EF8 A;  7RNT A;  3ZFZ A;  2HMN B;  1KQS 2;  1I70 A;  2FGT A;  2CWT A;  1QMA A;  1JV2 B;  1B2U A;  1W4N A;  3F14 A;  5I97 A;  3F8H A;  3LT8 A;  1GD4 A;  2ZDJ A;  1NWW A;  1RGF A;  1WTH A;  1TP6 A;  3PYJ A;  1WMN A;  3CCR 3;  1TJD A;  3B4O A;  1O7M B;  3S28 A;  4NRE A;  1RN1 A;  1UUV B;  3OV4 A;  1GSP A;  3KFQ C;  4HJL B;  2XEP A;  1TRP A;  1AR0 A;  3OXA A;  3L0R A;  1BNE A;  1DMM A;  2CG1 A;  1BNJ A;  3EN1 B;  4OK0 A;  4HOH A;  1JZD A;  3B7C A;  4LSO A;  5AYR B;  1JBT A;  3PCS A;  8RNT A;  3FKA A;  2AAE A;  3MWZ A;  4RZM A;  3PCR A;  1E3R A;  1I0V A;  1O7H B;  1C54 A;  5AEW B;  2W0Q A;  3JUM A;  1LOW A;  5JPU A;  2L4V A;  3LT9 A;  3QK9 A;  5AIH A;  2GSP A;  3MG2 A;  3OX9 A;  3GZB A;  4RBN A;  1IQX A;  1PYL A;  4HKV B;  1FGR A;  5FGO A;  6STD A;  3ROB A;  3G16 A;  3LZA A;  3JVC A;  1G96 A;  3VGN A;  2KF6 A;  2F4Y A;  3KN4 A;  1UCK A;  2YFL B;  1NB5 I;  1HKX A;  1PU4 A;  1GOY A;  3BIR A;  4KT3 B;  5RNT A;  1B21 A;  2RCD A;  1D6Y A;  3DGO A;  1BU4 A;  4GL6 A;  3CC4 3;  1BRG A;  4J8T A;  1MWT A;  1SII A;  1V57 A;  4L7K A;  1BAN A;  1SQW A;  6GSP A;  1X1W A;  3RNT A;  8CHO A;  3I55 3;  1JB2 A;  4HM7 B;  4H61 A;  5ELU A;  4K1U A;  2CWV A;  1MWU A;  1L5G B;  3NQY A;  1OAC A;  4X2H A;  1W01 A;  4R9L A;  3KSE D;  1EG9 B;  1BUJ A;  1WQL B;  1PFP A;  2OOV C;  2PZV A;  2YX9 A;  1NJI 4;  1CYV A;  2LQV A;  5BXQ A;  5CF1 A;  2GU3 A;  4GSP A;  1Q81 4;  1YIJ 3;  1IQY A;  1U5O A;  2CC3 A;  3QRD A;  1RKY A;  1QVF 2;  1YI2 3;  3FZW A;  1AV4 A;  3HOH A;  5KP3 A;  3F7S A;  3IPT A;  3MPH A;  3Q3F A;  1LVN A;  4HM1 B;  1WMO A;  1JKG A;  2GEX A;  5EEO A;  1V58 A;  2IYJ A;  3AHS A;  1ISK A;  2KXG A;  5KP1 A;  2F98 A;  1JB4 A;  4ZM8 A;  2W2C A;  1CQS A;  1K9M 4;  1SJW A;  1LOX A;  2R4I A;  4FMC A;  5AEU B;  2RSX A;  2QEX 3;  2UGI A;  1YJW 3;  1TUH A;  2W6J H;  4XBT A;  2M7O A;  3T8U A;  2BU4 A;  1VQ5 3;  2IUK A;  1N8R 4;  4GB5 A;  3D79 A;  2BO9 B;  3NV0 A;  1Q7Y 4;  1Y4K A;  1ROA A;  1ULI B;  1IYY A;  5IEP A;  1K8A 4;  3X41 A;  1YGW A;  1LQM B;  1VQ9 3;  4IT7 A;  3CPW 2;  2XH9 A;  2ZHX B;  1N8Q A;  1A67 A;  3KKG A;  4KZ1 A;  1QAK A;  3T0U A;  3CCV 3;  1QVG 2;  1G0T A;  3BLZ A;  1Q40 A;  2W9P A;  3JUQ A;  5EQL A;  3UJM A;  2YFI B;  1T3B A;  1JBS A;  1BRS A;  3LOY A;  1NU3 A;  2E2U A;  3N8B A;  1B2Z A;  4R4K A;  3LTD A;  1JB5 A;  2Y73 A;  3HZP A;  3K7C A;  3N9H A;  1GY5 A;  2JQ5 A;  4EXR A;  1BGS A;  4EW5 A;  1IVU A;  4H3U A;  2CW9 A;  4FMB A;  5ELJ A;  1QJG A;  4X2O A;  1JKG B;  2CX1 A;  2E2T A;  2ML6 A;  3NUV A;  2F5M A;  3FGY A;  4N6U A;  5EVH A;  2ML5 A;  3ZG5 A;  1D6U A;  3SVA A;  2OTL 3;  2Y74 A;  1BUQ A;  2HOH A;  1W00 A;  2D42 A;  3DH2 A;  3RGR A;  5IER A;  1UGH I;  3GSP A;  3G6E 3;  1I2E A;  3FCS B;  3LTC A;  2GEY A;  3O8Y A;  1E3V A;  3G71 3;  3JUP A;  2Z7A A;  5CLK A;  4O2H A;  4CPK A;  5IEN A;  3NV0 B;  4KVH A;  1O7G B;  3KCH A;  4HVN A;  1VQ4 3;  1GOV A;  1KWI A;  3X3Z A;  3LTB A;  4I4K A;  1GMP A;  3FLJ A;  1FA3 A;  1W5Z A;  2BMO B;  3NM2 A;  3NQZ A;  2H0G A;  5BVB A;  1B2M A;  2ZL8 A;  1IK3 A;  3EN8 A;  1GY6 A;  3EC9 A;  1VQP 3;  1FGQ A;  1IV7 A;  5IEO A;  1V74 A;  1W6Y A;  1Q40 B;  1STD A;  5DRE A;  1RNB A;  1VQ6 3;  1WNH A;  1ZS7 A;  3BNB A;  3LH4 A;  3OWS A;  2STD A;  4PEJ A;  2CWU A;  4FR9 A;  3X3X A;  1M90 4;  5CF2 A;  3SED A;  1Q42 A;  1EEJ A;  4K61 A;  3HII A;  4IIA A;  5AYS C;  3UB1 A;  4O3V A;  1VQL 3;  1R4Y A;  3NM7 A;  4MEI A;  1HZ1 A;  3DMC A;  4HZ9 B;  1RN4 A;  2UX0 A;  3X40 A;  1D6Z A;  4BTX A;  3U97 A;  3BNC A;  1DE3 A;  1A2V A;  3G4S 3;  1Z1S A;  4HZB B;  1RGK A;  3WOD G;  1DET A;  5M1A A;  1KSI A;  1BNR A;  3LXU X;  1O7W B;  3GZX B;  3PGB A;  1M9G A;  2AAD A;  1B2S A;  1OPY A;  2XFT A;  3AHW A;  3K0Z A;  2MC8 A;  4MMZ B;  3EBY A;  3CCL 3;  1TFK A;  1Q82 4;  3NBJ A;  3B8L A;  1RRL A;  2E2V A;  2Q07 A;  3EJV A;  2P0M A;  1BNS A;  2J8X B;  5G2G A;  5AIG A;  4LGQ A;  1BSD A;  1AVL A;  4EYC A;  2WO0 A;  1RHL A;  3JUO A;  4XM4 A;  1UI8 A;  1SPU A;  4ILF A;  2BHM A;  2KF5 A;  1DVC A;  3MKI A;  3CPO A;  2C10 A; 
#chains in the Genus database with same CATH homology
 1OHS A;  3CNX A;  4HM8 B;  4FMD A;  3CC2 3;  3K63 A;  1EQK A;  4CCV A;  1IDP A;  3WA2 X;  4EC6 A;  5AIF A;  4FCJ A;  1US1 A;  2XFS A;  2CFW A;  3AMO A;  3PS8 A;  1N9J A;  3EBT A;  4QWT A;  3STD A;  3NX0 A;  1O7P B;  1K73 4;  1OGX A;  1IQ8 A;  3KZT A;  1FGT A;  3T8N A;  4U13 A;  3H51 A;  4O8S A;  4Q53 A;  4MJD A;  3BB9 A;  3CCU 3;  1F8N A;  1W6C A;  2CH9 A;  1IT7 A;  3DGL A;  1M1X B;  1IVW A;  2RFR A;  3FH1 A;  1FUW A;  5IG5 A;  2GBW B;  4TX4 A;  5JPP A;  1YGE A;  2WOF A;  2P0X A;  2CHC A;  1NO3 A;  1RRH A;  3LML A;  2CIU A;  1K28 A;  1MNL A;  1ZX2 A;  1OF5 A;  3MG3 A;  3EE1 A;  1VQN 3;  2SBL A;  3EB8 A;  1Q86 4;  3X42 A;  1EKM A;  4EBG A;  2P38 A;  3FF0 A;  3WOF B;  3CCJ 3;  3I56 3;  2KRT A;  3KSP A;  1IVV A;  3WA3 A;  2Z76 A;  1JN5 A;  1GY7 A;  4O02 B;  1AVK A;  4ORL A;  1EA2 A;  4BTY A;  2WGO A;  3ALA A;  1OGZ A;  2XGN A;  3AMO B;  1JJ2 2;  1GD3 A;  4MMY B;  4N6M A;  1STF I;  3GZY B;  2IA7 A;  3K9M C;  3SOY A;  1IT8 A;  3CCQ 3;  4HBR A;  4HM5 B;  4J9A A;  1OUN A;  1JRQ A;  2MF7 A;  1CEW I;  2Z77 A;  1OH0 A;  2O3O A;  2CFG A;  3UL5 A;  2PNC A;  5JBS A;  4XBX A;  2W03 A;  4R9K A;  5A0O B;  1VQ8 3;  3OWU A;  3RGA A;  1MOL A;  1OHO A;  4N6O B;  1VQ7 3;  5CK6 A;  1J2B A;  1W2Z A;  1W02 A;  2XSO B;  5D83 A;  4AKY A;  3IJE B;  3DY5 A;  1OF5 B;  3OWY A;  3GAX A;  4MMX B;  3GRD A;  4NHF A;  3CCE 3;  3I0Y A;  4HM4 B;  1NDO B;  3S27 A;  3JUN A;  2XR8 B;  4N6L A;  4LMI A;  1JN5 B;  4FCZ A;  4N3V A;  4FCM A;  3DM8 A;  1SIH A;  3ER7 A;  4RNY A;  3MYT A;  3RDE A;  5IW9 A;  3FG4 A;  5LC7 A;  2W56 A;  3U1W A;  3KII A;  3X3Y A;  2XSH B;  1FGO A;  2QGU A;  1HU9 A;  5IF6 A;  3TDG A;  2CFK A;  3UNL A;  4K90 B;  4XDV A;  2LYX A;  3DZL A;  4KFE A;  3VSY A;  2HMJ B;  3MG1 A;  2XRX B;  4G1M B;  1IVX A;  3B4P A;  2IMJ A;  1DMN A;  1YIT 3;  1U8C B;  3PZW A;  1QAL A;  1YJ9 3;  1GYB A;  2XF3 A;  3SX1 A;  2F86 B;  2IUJ A;  4HM6 B;  2GXF A;  3OW2 2;  3LYG A;  2P09 A;  3NBR A;  2HMO B;  3G8Z A;  1IU7 A;  2F99 A;  5D82 A;  3VF1 A;  1VQK 3;  5TGN A;  5HGR A;  4WYK B;  3CCM 3;  3E99 A;  2HMM B;  2QA4 3;  4XB5 A;  3EHC A;  1N5P A;  1S72 3;  1FGM A;  3FF2 A;  2Z6B A;  4STD A;  4HYZ A;  3HI7 A;  1ULJ B;  3BND A;  4HM0 B;  2CFD A;  4AEQ A;  4RNZ A;  4EV2 A;  5STD A;  3S29 A;  3CMA 3;  2HML B;  1E97 A;  3SXX A;  2W56 B;  4R1K A;  2D1W A;  3HIG A;  2QIY A;  2HMK B;  1N5H A;  1GS3 A;  1NB3 I;  3F7X A;  7STD A;  1DVD A;  3D3L A;  3Q2P A;  3F40 A;  5IG4 A;  2BMQ B;  5IG0 A;  3CC7 3;  3Q1C A;  1A90 A;  3GZR A;  3HK4 A;  2GBX B;  3MHE A;  3CD6 3;  2GU1 A;  4XDW A;  5LC6 A;  3ECF A;  4WFO A;  4JF8 A;  2OOV A;  1YJN 3;  1YVB I;  3S5C A;  3F8X A;  2C11 A;  4L8O A;  1ROV A;  3V98 A;  3GWR A;  1CYU A;  2OQE A;  5CXO A;  1KC8 4;  4L8P A;  5IG3 A;  2OQE C;  4N6V 0;  2KCD A;  2RGQ A;  2FXT A;  3Q90 A;  1VQO 3;  3NBB A;  4OUQ A;  1UUW B;  2WOH A;  4K1V A;  1W2B 2;  1IV9 A;  2V1L A;  3DGN A;  3EX9 A;  3HX8 A;  1N9E A;  1R4C A;  4WHA A;  1ASK A;  5AII A;  1O7N B;  1ZO2 A;  4EV5 A;  2OTJ 3;  3FSD A;  4KFD A;  3V99 A;  2BT3 A;  2I9W A;  3J7Y d;  4WWU C;  2FNQ A;  3N54 B;  1OCV A;  1KD1 4;  3BNE A;  1OHP A;  2W9Q A;  2YFJ B;  4AKZ A;  4LEH A;  2B24 B;  3SOA A;  1DYU A;  3CME 3;  3CCS 3;  4FMA A;  2INX A;  2BNG A;  3IMA B;  3SLU A;  4OVM A;  3CU3 A;  3KE7 A;  3H3H A;  3D9R A;  4HM3 B;  1M1K 4;  3FG1 A;  3PXM A;  2BMR B;  2CK3 H;  3NXJ A;  4CDL A;  2OWP A;  1C7H A;  4JRF A;  2XGL A;  4WP5 A;  1WMP A;  1VQM 3;  1TU5 A;  3FG3 A;  1TIJ A;  1TFO A;  4LZI A;  1T5Y A;  2CKF B;  3WOE B;  3M8C A;  1RN7 A;  3CNM A;  2O9U X;  1YHQ 3;  2A15 A;  2K0M A;  2OCT A;  2P05 A;  3DGM A;  3WMD A;  3NHX A;  1S5A A;  4IPB A;  2JDI H;  3F9S A;  1A2K A;  3A76 A;  4WYK A;  4XBY A;  3CXC 2;  3LTA A;  1UW1 A;  1RJO A;  3DUK A;  5D81 A;  2CG0 A;  1QAF A;  1W7C A;  2W04 A;  1LXE A;  4KFF A;  3S67 A;  4HM2 B;  1DMQ A;  4BTW A;  1VZZ A;  1K41 A;  5AI1 A;  3UL6 A;  5KP4 A;  1LNH A;  5FW5 A;  1JNQ A;  4N6T A;  3DXO A;  1UI7 A;  2K54 A;  3K5T A;  4R80 A;  2CFL A;  2B1X B;  4N6N B;  1W6G A;  3WDG B;  5DRV A;  3EQQ B;  3MSO A;  2WGQ A;  3V92 A;  3G0K A;  3EF8 A;  1KQS 2;  2HMN B;  2FGT A;  2CWT A;  1QMA A;  1JV2 B;  1W4N A;  3F14 A;  5I97 A;  3F8H A;  3LT8 A;  1GD4 A;  2ZDJ A;  1NWW A;  1WTH A;  1TP6 A;  3PYJ A;  1WMN A;  3CCR 3;  3B4O A;  1O7M B;  3S28 A;  4NRE A;  1UUV B;  3OV4 A;  3KFQ C;  4HJL B;  2XEP A;  1AR0 A;  3OXA A;  3L0R A;  2CG1 A;  1DMM A;  3EN1 B;  4OK0 A;  3B7C A;  4LSO A;  5AYR B;  3PCS A;  3FKA A;  3MWZ A;  4RZM A;  3PCR A;  1E3R A;  1O7H B;  5AEW B;  2W0Q A;  3JUM A;  5JPU A;  2L4V A;  3LT9 A;  3QK9 A;  5AIH A;  3MG2 A;  3OX9 A;  3GZB A;  4RBN A;  1IQX A;  4HKV B;  1FGR A;  5FGO A;  6STD A;  3ROB A;  3G16 A;  3LZA A;  3JVC A;  1G96 A;  3VGN A;  3KN4 A;  2YFL B;  1NB5 I;  1HKX A;  1PU4 A;  2RCD A;  1D6Y A;  3DGO A;  4GL6 A;  3CC4 3;  4J8T A;  1SII A;  4L7K A;  1SQW A;  8CHO A;  3I55 3;  1JB2 A;  4HM7 B;  4H61 A;  5ELU A;  4K1U A;  2CWV A;  1L5G B;  3NQY A;  1OAC A;  4X2H A;  1W01 A;  4R9L A;  3KSE D;  1EG9 B;  1WQL B;  1PFP A;  2OOV C;  2PZV A;  2YX9 A;  1NJI 4;  1CYV A;  2LQV A;  5BXQ A;  5CF1 A;  2GU3 A;  1Q81 4;  1YIJ 3;  1IQY A;  1U5O A;  2CC3 A;  3QRD A;  1RKY A;  1QVF 2;  1YI2 3;  3FZW A;  1AV4 A;  5KP3 A;  3F7S A;  3IPT A;  3MPH A;  1LVN A;  4HM1 B;  1WMO A;  1JKG A;  2GEX A;  5EEO A;  1ISK A;  2KXG A;  5KP1 A;  2F98 A;  1JB4 A;  4ZM8 A;  2W2C A;  1CQS A;  1K9M 4;  1SJW A;  2R4I A;  1LOX A;  4FMC A;  5AEU B;  2RSX A;  2QEX 3;  1YJW 3;  1TUH A;  2W6J H;  4XBT A;  2M7O A;  3T8U A;  1VQ5 3;  2IUK A;  1N8R 4;  4GB5 A;  2BO9 B;  3NV0 A;  1Q7Y 4;  1Y4K A;  1ROA A;  1ULI B;  5IEP A;  1K8A 4;  3X41 A;  1VQ9 3;  4IT7 A;  3CPW 2;  2XH9 A;  1A67 A;  1N8Q A;  3KKG A;  4KZ1 A;  1QAK A;  3T0U A;  3CCV 3;  1QVG 2;  3BLZ A;  1Q40 A;  2W9P A;  3JUQ A;  5EQL A;  3UJM A;  2YFI B;  3LOY A;  1NU3 A;  2E2U A;  3N8B A;  4R4K A;  3LTD A;  1JB5 A;  2Y73 A;  3HZP A;  3K7C A;  3N9H A;  1GY5 A;  2JQ5 A;  4EXR A;  1IVU A;  4H3U A;  2CW9 A;  4FMB A;  5ELJ A;  1QJG A;  4X2O A;  1JKG B;  4N6U A;  2E2T A;  2ML6 A;  3NUV A;  3FGY A;  5EVH A;  2ML5 A;  1D6U A;  3SVA A;  2OTL 3;  2Y74 A;  1BUQ A;  1W00 A;  2D42 A;  3RGR A;  5IER A;  3G6E 3;  3FCS B;  3LTC A;  2GEY A;  3O8Y A;  1E3V A;  3G71 3;  3JUP A;  2Z7A A;  5CLK A;  4O2H A;  5IEN A;  3NV0 B;  4KVH A;  1O7G B;  4HVN A;  1VQ4 3;  1KWI A;  3X3Z A;  3LTB A;  4I4K A;  3FLJ A;  1FA3 A;  1W5Z A;  2BMO B;  3NM2 A;  3NQZ A;  5BVB A;  2ZL8 A;  1IK3 A;  3EN8 A;  1GY6 A;  3EC9 A;  1VQP 3;  1FGQ A;  1IV7 A;  5IEO A;  1V74 A;  1W6Y A;  1Q40 B;  1STD A;  5DRE A;  1VQ6 3;  1WNH A;  3LH4 A;  3BNB A;  3OWS A;  2STD A;  4PEJ A;  2CWU A;  4FR9 A;  3X3X A;  1M90 4;  5CF2 A;  3SED A;  1Q42 A;  4K61 A;  3HII A;  4IIA A;  5AYS C;  3UB1 A;  4O3V A;  1VQL 3;  3NM7 A;  4MEI A;  3DMC A;  4HZ9 B;  2UX0 A;  3X40 A;  1D6Z A;  4BTX A;  3U97 A;  3BNC A;  1A2V A;  3G4S 3;  1Z1S A;  4HZB B;  3WOD G;  1KSI A;  3LXU X;  1O7W B;  3GZX B;  3PGB A;  1M9G A;  3K0Z A;  1OPY A;  2XFT A;  2MC8 A;  4MMZ B;  3EBY A;  3CCL 3;  1TFK A;  1Q82 4;  3NBJ A;  3B8L A;  1RRL A;  2E2V A;  2Q07 A;  3EJV A;  2P0M A;  5G2G A;  5AIG A;  4LGQ A;  1AVL A;  4EYC A;  2WO0 A;  3JUO A;  4XM4 A;  1UI8 A;  1SPU A;  2BHM A;  1DVC A;  3MKI A;  3CPO A;  2C10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...