4R4KA

Crystal structure of a cystatin-like protein (baccac_01506) from bacteroides caccae atcc 43185 at 1.69 a resolution
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
151
structure length
151
Chain Sequence
EIAQSGEDFKSFLDKFTSSAAFQYTRIKFPLKTPITLLADDGETEKTFPFTKEKWPLLDSETMKEERIEQEEGGIYVSKFTLNEPVHKVFEAGYEESEIDLRVEFEQAADGKWYVVDCYTGWYGYDLPIGELKQTIQQVKEENAAFKEIHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
publication title Crystal structure of a hypothetical protein (BACCAC_01506) from Bacteroides caccae ATCC 43185 at 1.69 A resolution
rcsb
source organism Bacteroides caccae
total genus 44
structure length 151
sequence length 151
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.410 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4r4kA00
2ML5A 2ML6A 4R4KA
chains in the Genus database with same CATH superfamily
1STDA 2HMJB 2WGOA 1V74A 1AVLA 2RNTA 3GAXA 4FMAA 5JBSA 2ZL8A 3LMLA 3BNDA 1RN4A 1BRIA 1T3BA 1YJ93 1K9M4 2L1SA 3HIIA 1S5AA 1UGHI 3N8BA 4MMZB 1Q814 1K28A 3AHSA 2E2TA 1B2MA 1JZOA 4KFEA 1YGEA 1V57A 1AY7A 1RCLA 3N54B 1EA2A 3IPTA 1JRQA 2P09A 4K1UA 3RDEA 1WMNA 3O8YA 1SQWA 4WP5A 2CFKA 5CK6A 1W4NA 3GZYB 4X2OA 4FMBA 1Q7HA 3I0YA 1F8NA 1GOUA 5IG3A 2OOVC 3F8HA 5DRVA 5BVBA 2STDA 2V1LA 3JUNA 1M1K4 1NU3A 1W7CA 1Z1SA 2BMOB 1VQL3 3WMDA 3B7CA 4FMDA 4R80A 1Q40B 3RGAA 3G0KA 4XBXA 1X1WA 3J7Yd 1RGEA 2K0MA 1WMPA 2JQ5A 3KZTA 4WFOA 1BIRA 3G16A 2BMRB 3IMAB 3D5GA 1GMRA 2W03A 3UNLA 1OH0A 1BU4A 1CH0A 1LXEA 1LNHA 2FGTA 3X3XA 1BSCA 3MWZA 3AGNA 4LGQA 3F9SA 1VQO3 1RGFA 4N6OB 1G02A 3PCRA 5ELUA 3CCV3 1W00A 2KF4A 2XEPA 3ECFA 2KRTA 4ORLA 2CIUA 4XBYA 3ER7A 3GZXB 1O7HB 2RFRA 4HOHA 3I563 1BGSA 4IIAA 1X1XA 3EN8A 4HM7B 1GMQA 1OGZA 1DVDA 4STDA 3CNMA 2W9PA 3HK4A 2B24B 3CCU3 1IQ8A 2W2CA 1PY3A 1LNIA 3X3ZA 5KP3A 1FZUA 3OV4A 2XGNA 1RGAA 3OWUA 3EC9A 3TDGA 4CPKA 1OF5B 2QEX3 1GOVA 1HKXA 1OHOA 2L4VA 2HMOB 1IQXA 3AHWA 5STDA 3DMCA 4RBNA 2Z7AA 2GEXA 1FUSA 1S723 3K63A 1W2B2 1B2XA 2C4BA 1D6YA 1TP6A 4FMCA 2W04A 1GD4A 2XGLA 3D9RA 4HM6B 2MC8A 7GSPA 5I97A 1KC84 1I0VA 3EHCA 3CC23 3PCSA 1LOVA 1IQYA 1I70A 4OUQA 2RCDA 1OGXA 3GRDA 1BRGA 3X40A 3NM7A 1EKMA 2XFTA 1WNHA 4WYKA 2F99A 3B4PA 1N8R4 6STDA 1OACA 1CYUA 4DKIA 5AIGA 2GBWB 4L7KA 2CX0A 1RCKA 3LTDA 3PGBA 1NDOB 2UGIA 3DXOA 3MYTA 1RJOA 2D42A 4EV5A 1VQK3 1B27A 1RDSA 1TU5A 3FSDA 5LC7A 4MJDA 5AIIA 4IT7A 1M1XB 4RNYA 2KF6A 2XR8B 3BNEA 3LTCA 3SEDA 3DUKA 2CFDA 2E2VA 3S29A 3OX9A 3G8ZA 1OPYA 1US1A 4BL2A 2MF7A 2P0XA 4HM5B 4HZ9B 1IDPA 2IY2A 3SXXA 1KQS2 3BU4A 1UCLA 3BNBA 1NWWA 4KZ1A 1T2HA 1TUHA 2P05A 5EEOA 2HMLB 1KD14 1JB2A 1YIJ3 2BMQB 1IU7A 1QJGA 1SJWA 3BNCA 1BNRA 1E3RA 3NBRA 3BIRA 1WQLB 1O7GB 3AMOA 4HM8B 1O7WB 1W6GA 3S67A 1TTOA 1CYVA 3MKIA 4HKVB 3SX1A 2J8XB 3F14A 2H0HA 3QRDA 2IUKA 3LT9A 5ELJA 3D5IA 1UDII 3KIIA 3D4AA 1BSBA 2OQEA 7STDA 1K8A4 2CW9A 3WHOA 3OW22 1HZ1A 1FGTA 4AEQA 7RNTA 4XDWA 3FCSB 1BRNL 3T0UA 1NB5I 5IG5A 1VQ43 3B4OA 1JJ22 1EQKA 2GXFA 4OVMA 4N6NB 2ML5A 2KF5A 1UI7A 4LEHA 2CX1A 2F86B 3DGNA 1QAFA 4LYLB 1YJN3 1BNIA 3KN4A 1GY6A 2GU3A 1IV9A 2HMMB 4HM3B 1N5HA 4QWTA 1HYFA 3AGOA 1GY7A 3S5CA 3U97A 3VF1A 4BIRA 5HOHA 3X42A 1GSPA 3LH4A 3ROBA 1VQN3 1JV2B 1JBSA 1B2SA 3CCS3 1EG9B 2ZA4A 3DH2A 1UW1A 5BXQA 3CD63 3MHEA 3NQZA 2W56B 3JUOA 5D83A 5IG4A 3CXC2 4HM0B 5IERA 3Q90A 1MWRA 1FUWA 1JB5A 3ZG5A 3FG1A 3CCQ3 2CFWA 4N6LA 1MWUA 2CWVA 4KVHA 4N6V0 1NB3I 3MG2A 2D1WA 2KCDA 4N6TA 1ULIB 2CHCA 2RGQA 4I5QA 2OOVA 4BL3A 2CKFB 1BRJA 3WOFB 2UUGC 5AYSC 4H61A 1RKYA 1ZX2A 2R4IA 2YFJB 1VQ83 3MG3A 1BUJA 5G1LA 2Z6BA 5FGOA 1O7MB 1FGRA 3OWSA 3KCHA 4HAAA 4CCVA 1T2IA 1JKGA 1M9GA 4HYZA 1BOXA 5EVHA 2CG1A 3JUPA 3KKGA 2C10A 1NJI4 2Z77A 3KE7A 4BTXA 1I8VA 4J9AA 3EE1A 3D3LA 5BIRA 2K54A 1BNGA 4GHOA 3S27A 9RNTA 1VQ63 1G96A 4FCZA 3WOEB 2YFIB 1W02A 2F56A 5IENA 4H3UA 1N5PA 1O7PB 4XBTA 1I3FA 1FW7A 1GYBA 3QK9A 5AEWB 1DETA 3N9HA 1LOYA 1A2VA 3MSOA 4K90B 2IUJA 5M19A 1J2BA 1B3SA 1QVF2 4XDVA 1A67A 3CCE3 2XF3A 3NV0B 4RNTA 4N6UA 1K41A 2O9UX 1MGWA 2OTL3 4Q53A 3CCL3 4L8PA 4J5KA 5RNTA 1R4YA 4HM4B 3RNTA 1G0TA 4BTYA 1JBRA 3G4S3 3CME3 2AAEA 1X1UA 3T8UA 2FXTA 1W5ZA 3K5TA 3ZG0A 4N3VA 3CPW2 1BRKA 1U8CB 4J5GA 1YVSA 1MWSA 2XFSA 3X3YA 4TX4A 1T5YA 2HOHA 1RSNA 1BRSA 5IF6A 4EXRA 2H0GA 1RMSA 5A0OB 1BRHA 4KFDA 4N6MA 5EQLA 2F98A 2F4YA 3HZPA 3JUMA 4RNZA 3SOYA 3NUVA 1OUNA 4R9LA 1I2GA 3KFQC 1YJW3 4CJNA 1RHLA 1JBTA 4O2HA 1Q864 1BSDA 3EB8A 2CWUA 1I0XA 5G1KA 1STFI 1Q824 1JNQA 1IYYA 4OK0A 4ZM8A 5GSPA 2KXGA 1BNEA 5AEUB 3I553 3B8LA 4KFFA 1W6CA 2WGQA 3CPOA 5M18A 3NBJA 1DE3A 3FLJA 1A2KA 1QAKA 3PYJA 2SBLA 1IVWA 2CH9A 1VQM3 1MGRA 2XRXB 1YIT3 8RNTA 4NHFA 2Q07A 3CCJ3 1RGKA 2H0IA 4HBRA 3H3HA 5LC6A 1A2PA 2OTJ3 3VSYA 1N9JA 1RN1A 3RGRA 1GOYA 2BIRA 1K734 1O7NB 1TJDA 1FA3A 4HJLB 4NPBA 3LXUX 4WWUC 1MWTA 3LZAA 5D81A 3URPA 2K3DA 5AIHA 4I4KA 3DGOA 1IK3A 1TIJA 2XH9A 3DZLA 4IPBA 1YHQ3 2CFGA 5M1AA 3CNXA 2LYXA 2Y74A 1DMQA 1RN7A 3UJMA 1CEWI 3HX8A 8CHOA 2CC3A 1EUIC 1BVIA 1N8QA 4KT3B 4O3VA 4R4KA 5AYRB 1LVNA 2INXA 3DGMA 3IJEB 4EYCA 1RGGA 1TRPA 1FYSA 1WTHA 1IVXA 1QVG2 1BNFA 1I2EA 1N9EA 3GWRA 1HU9A 1E3VA 3KSED 1DMMA 4MMXB 1IVVA 1SIIA 1GD3A 1RLSA 2CWTA 3PXMA 4O8SA 3CC73 4GB5A 1ISKA 1LQGC 1Q9EA 4JRFA 1JN5A 5D82A 1TRQA 3NX0A 4WYKB 1UCJA 5IEPA 1MOLA 4BTWA 3FKAA 3WDGB 1R4CA 1AQZA 2PZVA 3WA2X 1VZZA 4XM4A 1OF5A 1DYUA 5KP4A 2Z76A 1RTUA 3LT8A 3CC43 1UI8A 3NQYA 3K9MC 3STDA 1GY5A 4AKYA 3K7CA 1VQP3 2RBIA 3V98A 1W2ZA 2F5WA 1LOWA 3EX9A 1B21A 3ZFZA 3CU3A 4X2HA 2R41A 1D6UA 1AV4A 1PFPA 1E97A 1UUGB 4J8TA 1C7HA 2IMJA 1ULJB 3SLUA 1YI23 1BANA 2BNGA 1AVKA 3FF0A 1UGIA 1BSAA 2A15A 2P0MA 1YVBI 1Y4KA 1SIHA 2OWPA 2QGUA 2AADA 3EF8A 1PYLA 3HOHA 4K61A 3AMOB 3F40A 1VQ53 1VQ93 2CFLA 4EBGA 5CXOA 1UCKA 5AIFA 1DVCA 2ZDJA 1SPUA 4EV2A 2XSHB 2IYJA 2Y73A 2GEYA 3ALAA 1TFOA 3BLZA 1RNTA 5TGNA 3LTBA 2ML6A 3DGLA 3PS8A 3GZRA 2E2UA 1I3IA 3LYGA 4FCMA 3CMA3 1DMNA 2LQVA 3UB1A 1RRLA 1SARA 3VGNA 2CG0A 3Q3FA 3DGYA 1I2FA 1WMOA 1A90A 2YFLB 1KSIA 3WODG 1NO3A 3DY5A 1ZGXA 1RRHA 4HVNA 2I9WA 2RSXA 1VQ73 4R9KA 2GU1A 3GSPA 1TFKA 3G713 1B20A 1LQMB 1FGQA 3JVCA 4R1KA 1QALA 1UUVB 2JDIH 1JN5B 4MEIA 5IW9A 3MG1A 2W0QA 2SARA 1ROVA 3SYUA 4O02B 3GZBA 5JPUA 1ROAA 2HMNB 1BNJA 1EEJA 4HZBB 1Q7Y4 3K0ZA 1NNVA 5FW5A 3FZWA 4EW5A 1ASKA 1BSEA 2OCTA 3KSPA 3SOAA 2GSPA 3A5EA 3X41A 3E99A 5CF1A 3HI7A 1AR0A 1FUTA 3OXAA 5IG0A 1MNLA 2B1XB 4ILFA 4GL6A 3H51A 3F8XA 4HM1B 1KWIA 3WR2A 1OHSA 3FG3A 3SVAA 1BUQA 2BT3A 1B2ZA 1UUWB 5AI1A 4AKZA 5JPPA 1YNVX 2BO9B 2PNCA 1L5GB 3CCR3 4NREA 5KP1A 3EBYA 5CLKA 2XSOB 2W6JH 2QIYA 6RNTA 4JF8A 4XB5A 1IT8A 3L0RA 4CDLA 2W56A 1JZDA 1W6YA 4HM2B 1YGWA 3G6E3 1OCVA 5HGRA 1JKGB 1ZS7A 2WOHA 2C11A 3NHXA 5BU4A 2P38A 4RZMA 1QMAA 2CK3H 4GSPA 3EBTA 3CCM3 3V92A 1FGMA 1U5OA 2KAAA 1RNBA 3FG4A 3EJVA 2O3OA 1CQSA 3MPHA 4LMIA 3U1WA 1V58A 1GMPA 5IEOA 3EN1B 3M8CA 1VQQA 1W01A 5G2GA 4PEJA 3HIGA 3NM2A 2KF3A 1ZO2A 3S28A 1M904 1IT7A 1GS3A 2WO0A 2IA7A 4G1MB 1Q40A 5CF2A 4LSOA 3EQQB 1IV7A 1LRAA 2UX0A 2HMKB 4FR9A 1JB4A 3F7SA 1BNSA 3FH1A 1OHPA 3BB9A 3NXJA 2BHMA 3PZWA 3DM8A 3JUQA 4FCJA 4BU4A 2BU4A 2M7OA 3V99A 3OWYA 2OQEC 3A76A 4K1VA 1X1YA 2ZHXB 1FGOA 6GSPA 3Q1CA 1PU4A 2F5MA 2WOFA 1IVUA 2FNQA 1BAOA 3UL6A 1UCIA 1RGHA 3FF2A 3NBBA 1Q42A 4LZIA 3F7XA 3LTAA 3Q2PA 3LOYA 1D6ZA 4WHAA 5DREA 3T8NA 4MMYB 2GBXB 2YX9A 4L8OA 1LOXA 3WA3A 1RGCA 2QA43 3D79A 2W9QA 3UL5A 1C54A 3FGYA 4EC6A 3NV0A 1B2UA 1RGLA 4U13A
chains in the Genus database with same CATH topology
1STDA 2HMJB 2WGOA 1V74A 1AVLA 3GAXA 4FMAA 5JBSA 2ZL8A 3LMLA 3BNDA 1YJ93 1K9M4 3HIIA 1S5AA 3N8BA 4MMZB 1Q814 1K28A 2E2TA 4KFEA 1YGEA 3N54B 1EA2A 3IPTA 1JRQA 2P09A 4K1UA 3RDEA 1WMNA 3O8YA 1SQWA 4WP5A 2CFKA 5CK6A 1W4NA 3GZYB 4X2OA 4FMBA 3I0YA 1F8NA 5IG3A 2OOVC 3F8HA 5DRVA 5BVBA 2STDA 2V1LA 3JUNA 1M1K4 1NU3A 1W7CA 1Z1SA 2BMOB 1VQL3 3WMDA 3B7CA 4FMDA 4R80A 1Q40B 3RGAA 3G0KA 4XBXA 3J7Yd 2K0MA 1WMPA 2JQ5A 3KZTA 4WFOA 3G16A 2BMRB 3IMAB 2W03A 3UNLA 1OH0A 2FGTA 1LXEA 1LNHA 3X3XA 3MWZA 4LGQA 3F9SA 1VQO3 4N6OB 3PCRA 5ELUA 3CCV3 1W00A 2XEPA 3ECFA 4ORLA 2KRTA 2CIUA 4XBYA 3ER7A 3GZXB 1O7HB 2RFRA 3I563 4IIAA 3EN8A 4HM7B 1OGZA 1DVDA 4STDA 3CNMA 2W9PA 3HK4A 2B24B 3CCU3 1IQ8A 2W2CA 3X3ZA 5KP3A 3OV4A 2XGNA 3OWUA 3TDGA 3EC9A 2QEX3 1OF5B 1HKXA 1OHOA 2L4VA 2HMOB 1IQXA 5STDA 3DMCA 4RBNA 2Z7AA 2GEXA 1S723 1W2B2 3K63A 1D6YA 1TP6A 4FMCA 2W04A 1GD4A 2XGLA 3D9RA 4HM6B 2MC8A 5I97A 1KC84 3EHCA 3CC23 3PCSA 1IQYA 4OUQA 2RCDA 1OGXA 3GRDA 3X40A 3NM7A 1EKMA 2XFTA 1WNHA 4WYKA 2F99A 3B4PA 1N8R4 6STDA 1OACA 1CYUA 5AIGA 2GBWB 4L7KA 3LTDA 3PGBA 1NDOB 3DXOA 3MYTA 1RJOA 2D42A 4EV5A 1VQK3 1TU5A 3FSDA 5LC7A 4MJDA 5AIIA 4IT7A 1M1XB 4RNYA 2XR8B 3BNEA 3LTCA 3SEDA 3DUKA 2CFDA 2E2VA 3S29A 3OX9A 3G8ZA 1OPYA 1US1A 2P0XA 2MF7A 4HM5B 4HZ9B 1IDPA 3SXXA 1KQS2 3BNBA 1NWWA 4KZ1A 1TUHA 2P05A 5EEOA 2HMLB 1KD14 1JB2A 1YIJ3 2BMQB 1IU7A 1QJGA 1SJWA 3BNCA 1E3RA 3NBRA 4HM8B 1WQLB 1O7GB 3AMOA 1O7WB 1W6GA 3S67A 1CYVA 3MKIA 4HKVB 3SX1A 3F14A 3QRDA 2IUKA 3LT9A 5ELJA 2OQEA 1K8A4 3KIIA 7STDA 2CW9A 3OW22 1FGTA 4AEQA 4XDWA 3FCSB 3T0UA 1NB5I 5IG5A 1VQ43 3B4OA 1JJ22 1EQKA 2GXFA 4OVMA 4N6NB 2ML5A 1UI7A 4LEHA 2F86B 3DGNA 1QAFA 1YJN3 3KN4A 1GY6A 2GU3A 1IV9A 2HMMB 4HM3B 1N5HA 4QWTA 3U97A 1GY7A 3S5CA 3VF1A 3X42A 3LH4A 3ROBA 1VQN3 1JV2B 3CCS3 1EG9B 1UW1A 5BXQA 3CD63 3MHEA 3NQZA 2W56B 3JUOA 5D83A 5IG4A 3CXC2 4HM0B 5IERA 3Q90A 1FUWA 1JB5A 3FG1A 3CCQ3 2CFWA 4N6LA 2CWVA 4KVHA 4N6V0 1NB3I 3MG2A 2D1WA 2KCDA 4N6TA 1ULIB 2CHCA 2RGQA 2OOVA 2CKFB 3WOFB 5AYSC 4H61A 1RKYA 1ZX2A 2R4IA 2YFJB 1VQ83 3MG3A 2Z6BA 5FGOA 1O7MB 1FGRA 3OWSA 4CCVA 1JKGA 1M9GA 4HYZA 5EVHA 2CG1A 3JUPA 3KKGA 2C10A 1NJI4 2Z77A 3KE7A 4BTXA 4J9AA 3EE1A 3D3LA 2K54A 1VQ63 3S27A 1G96A 4FCZA 3WOEB 2YFIB 1W02A 5IENA 4H3UA 1N5PA 1O7PB 4XBTA 1GYBA 3QK9A 5AEWB 3N9HA 4K90B 1J2BA 1A2VA 3MSOA 2IUJA 1QVF2 4XDVA 1A67A 3CCE3 2XF3A 3NV0B 4N6UA 1K41A 2O9UX 2OTL3 4Q53A 3CCL3 4L8PA 4HM4B 4BTYA 3G4S3 3CME3 3T8UA 2FXTA 1W5ZA 3K5TA 3CPW2 4N3VA 1U8CB 2XFSA 3X3YA 4TX4A 1T5YA 5IF6A 4EXRA 5A0OB 4N6MA 4KFDA 5EQLA 2F98A 3HZPA 3JUMA 4RNZA 3SOYA 3NUVA 1OUNA 4R9LA 1YJW3 3KFQC 4O2HA 1Q864 3EB8A 2CWUA 1STFI 1Q824 1JNQA 4OK0A 2KXGA 5AEUB 3I553 3B8LA 4KFFA 1W6CA 2WGQA 3CPOA 3NBJA 3FLJA 1A2KA 1QAKA 3PYJA 2SBLA 1IVWA 2CH9A 1VQM3 2XRXB 1YIT3 4NHFA 2Q07A 3CCJ3 5LC6A 4HBRA 3H3HA 2OTJ3 3VSYA 1N9JA 3RGRA 1K734 1O7NB 1FA3A 4HJLB 3LXUX 4WWUC 3LZAA 5D81A 5AIHA 4I4KA 3DGOA 1IK3A 1TIJA 2XH9A 3DZLA 4IPBA 1YHQ3 2CFGA 3CNXA 2LYXA 2Y74A 1DMQA 1RN7A 3UJMA 1CEWI 3HX8A 8CHOA 2CC3A 1N8QA 4O3VA 4R4KA 5AYRB 1LVNA 2INXA 3DGMA 3IJEB 4EYCA 1QVG2 1WTHA 1IVXA 1N9EA 3GWRA 3KSED 1HU9A 1E3VA 1DMMA 4MMXB 1IVVA 1SIIA 1GD3A 2CWTA 4O8SA 3PXMA 3CC73 4GB5A 1ISKA 4JRFA 1JN5A 5D82A 3NX0A 4WYKB 5IEPA 1MOLA 4BTWA 3FKAA 3WDGB 1R4CA 2PZVA 3WA2X 1VZZA 4XM4A 1OF5A 1DYUA 5KP4A 2Z76A 3LT8A 3CC43 1UI8A 3NQYA 3K9MC 3STDA 1GY5A 4AKYA 3K7CA 1VQP3 3V98A 1W2ZA 3EX9A 3CU3A 4X2HA 1D6UA 1AV4A 1PFPA 1E97A 4J8TA 1C7HA 2IMJA 1ULJB 3SLUA 1YI23 2BNGA 1AVKA 3FF0A 2A15A 2P0MA 1YVBI 1Y4KA 1SIHA 2OWPA 2QGUA 3EF8A 4K61A 3AMOB 3F40A 1VQ53 1VQ93 2CFLA 4EBGA 5CXOA 5AIFA 1DVCA 2ZDJA 1SPUA 4EV2A 2XSHB 2Y73A 2GEYA 3ALAA 1TFOA 3BLZA 5TGNA 3LTBA 2ML6A 3DGLA 3PS8A 3GZRA 2E2UA 3LYGA 4FCMA 3CMA3 1DMNA 2LQVA 3UB1A 1RRLA 3VGNA 2CG0A 1WMOA 1A90A 2YFLB 1KSIA 3WODG 1NO3A 3DY5A 1RRHA 4HVNA 2I9WA 2RSXA 1VQ73 4R9KA 2GU1A 1TFKA 3G713 1FGQA 3JVCA 4R1KA 1QALA 1UUVB 2JDIH 1JN5B 4MEIA 5IW9A 3MG1A 2W0QA 1ROVA 4O02B 3GZBA 5JPUA 1ROAA 2HMNB 4HZBB 1Q7Y4 3K0ZA 5FW5A 3FZWA 1ASKA 2OCTA 3KSPA 3SOAA 5CF1A 3X41A 3E99A 3HI7A 1AR0A 3OXAA 5IG0A 1MNLA 2B1XB 4GL6A 3H51A 3F8XA 4HM1B 1KWIA 1OHSA 3FG3A 3SVAA 1BUQA 2BT3A 1UUWB 5AI1A 4AKZA 5JPPA 2BO9B 1L5GB 2PNCA 3CCR3 4NREA 5KP1A 3EBYA 5CLKA 2XSOB 2W6JH 2QIYA 4JF8A 4XB5A 1IT8A 3L0RA 4CDLA 2W56A 4HM2B 1W6YA 3G6E3 1OCVA 5HGRA 1JKGB 2WOHA 2C11A 3NHXA 2P38A 4RZMA 1QMAA 2CK3H 3CCM3 3EBTA 3V92A 1FGMA 1U5OA 3FG4A 3EJVA 2O3OA 1CQSA 3MPHA 4LMIA 3U1WA 5IEOA 3EN1B 3M8CA 1W01A 5G2GA 4PEJA 3HIGA 3NM2A 1ZO2A 3S28A 1M904 1IT7A 1GS3A 2WO0A 2IA7A 4G1MB 1Q40A 5CF2A 4LSOA 3EQQB 1IV7A 2UX0A 2HMKB 4FR9A 1JB4A 3F7SA 3FH1A 3NXJA 1OHPA 3BB9A 4FCJA 2BHMA 3PZWA 3DM8A 3JUQA 2M7OA 3V99A 3OWYA 2OQEC 3A76A 4K1VA 1FGOA 3Q1CA 1PU4A 2WOFA 1IVUA 2FNQA 3UL6A 3FF2A 4LZIA 4ZM8A 3NBBA 1Q42A 3F7XA 3LTAA 3Q2PA 3LOYA 1D6ZA 4WHAA 5DREA 3T8NA 4MMYB 2GBXB 2YX9A 4L8OA 1LOXA 3WA3A 2QA43 2W9QA 3UL5A 3FGYA 4EC6A 3NV0A 4U13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ML5 A;  2ML6 A;  4R4K A; 
#chains in the Genus database with same CATH topology
 1STD A;  2HMJ B;  2WGO A;  1V74 A;  1AVL A;  2RNT A;  3GAX A;  4FMA A;  5JBS A;  2ZL8 A;  3LML A;  3BND A;  1RN4 A;  1BRI A;  1T3B A;  1YJ9 3;  1K9M 4;  2L1S A;  3HII A;  1S5A A;  1UGH I;  3N8B A;  4MMZ B;  1Q81 4;  1K28 A;  3AHS A;  2E2T A;  1B2M A;  1JZO A;  4KFE A;  1YGE A;  1V57 A;  1AY7 A;  1RCL A;  3N54 B;  1EA2 A;  3IPT A;  1JRQ A;  2P09 A;  4K1U A;  3RDE A;  1WMN A;  3O8Y A;  1SQW A;  4WP5 A;  2CFK A;  5CK6 A;  1W4N A;  3GZY B;  4X2O A;  4FMB A;  1Q7H A;  3I0Y A;  1F8N A;  1GOU A;  5IG3 A;  2OOV C;  3F8H A;  5DRV A;  5BVB A;  2STD A;  2V1L A;  3JUN A;  1M1K 4;  1NU3 A;  1W7C A;  1Z1S A;  2BMO B;  1VQL 3;  3WMD A;  3B7C A;  4FMD A;  4R80 A;  1Q40 B;  3RGA A;  3G0K A;  4XBX A;  1X1W A;  3J7Y d;  1RGE A;  2K0M A;  1WMP A;  2JQ5 A;  3KZT A;  4WFO A;  1BIR A;  3G16 A;  2BMR B;  3IMA B;  3D5G A;  1GMR A;  2W03 A;  3UNL A;  1OH0 A;  1BU4 A;  1CH0 A;  1LXE A;  1LNH A;  2FGT A;  3X3X A;  1BSC A;  3MWZ A;  3AGN A;  4LGQ A;  3F9S A;  1VQO 3;  1RGF A;  4N6O B;  1G02 A;  3PCR A;  5ELU A;  3CCV 3;  1W00 A;  2KF4 A;  2XEP A;  3ECF A;  2KRT A;  4ORL A;  2CIU A;  4XBY A;  3ER7 A;  3GZX B;  1O7H B;  2RFR A;  4HOH A;  3I56 3;  1BGS A;  4IIA A;  1X1X A;  3EN8 A;  4HM7 B;  1GMQ A;  1OGZ A;  1DVD A;  4STD A;  3CNM A;  2W9P A;  3HK4 A;  2B24 B;  3CCU 3;  1IQ8 A;  2W2C A;  1PY3 A;  1LNI A;  3X3Z A;  5KP3 A;  1FZU A;  3OV4 A;  2XGN A;  1RGA A;  3OWU A;  3EC9 A;  3TDG A;  4CPK A;  1OF5 B;  2QEX 3;  1GOV A;  1HKX A;  1OHO A;  2L4V A;  2HMO B;  1IQX A;  3AHW A;  5STD A;  3DMC A;  4RBN A;  2Z7A A;  2GEX A;  1FUS A;  1S72 3;  3K63 A;  1W2B 2;  1B2X A;  2C4B A;  1D6Y A;  1TP6 A;  4FMC A;  2W04 A;  1GD4 A;  2XGL A;  3D9R A;  4HM6 B;  2MC8 A;  7GSP A;  5I97 A;  1KC8 4;  1I0V A;  3EHC A;  3CC2 3;  3PCS A;  1LOV A;  1IQY A;  1I70 A;  4OUQ A;  2RCD A;  1OGX A;  3GRD A;  1BRG A;  3X40 A;  3NM7 A;  1EKM A;  2XFT A;  1WNH A;  4WYK A;  2F99 A;  3B4P A;  1N8R 4;  6STD A;  1OAC A;  1CYU A;  4DKI A;  5AIG A;  2GBW B;  4L7K A;  2CX0 A;  1RCK A;  3LTD A;  3PGB A;  1NDO B;  2UGI A;  3DXO A;  3MYT A;  1RJO A;  2D42 A;  4EV5 A;  1VQK 3;  1B27 A;  1RDS A;  1TU5 A;  3FSD A;  5LC7 A;  4MJD A;  5AII A;  4IT7 A;  1M1X B;  4RNY A;  2KF6 A;  2XR8 B;  3BNE A;  3LTC A;  3SED A;  3DUK A;  2CFD A;  2E2V A;  3S29 A;  3OX9 A;  3G8Z A;  1OPY A;  1US1 A;  4BL2 A;  2MF7 A;  2P0X A;  4HM5 B;  4HZ9 B;  1IDP A;  2IY2 A;  3SXX A;  1KQS 2;  3BU4 A;  1UCL A;  3BNB A;  1NWW A;  4KZ1 A;  1T2H A;  1TUH A;  2P05 A;  5EEO A;  2HML B;  1KD1 4;  1JB2 A;  1YIJ 3;  2BMQ B;  1IU7 A;  1QJG A;  1SJW A;  3BNC A;  1BNR A;  1E3R A;  3NBR A;  3BIR A;  1WQL B;  1O7G B;  3AMO A;  4HM8 B;  1O7W B;  1W6G A;  3S67 A;  1TTO A;  1CYV A;  3MKI A;  4HKV B;  3SX1 A;  2J8X B;  3F14 A;  2H0H A;  3QRD A;  2IUK A;  3LT9 A;  5ELJ A;  3D5I A;  1UDI I;  3KII A;  3D4A A;  1BSB A;  2OQE A;  7STD A;  1K8A 4;  2CW9 A;  3WHO A;  3OW2 2;  1HZ1 A;  1FGT A;  4AEQ A;  7RNT A;  4XDW A;  3FCS B;  1BRN L;  3T0U A;  1NB5 I;  5IG5 A;  1VQ4 3;  3B4O A;  1JJ2 2;  1EQK A;  2GXF A;  4OVM A;  4N6N B;  2ML5 A;  2KF5 A;  1UI7 A;  4LEH A;  2CX1 A;  2F86 B;  3DGN A;  1QAF A;  4LYL B;  1YJN 3;  1BNI A;  3KN4 A;  1GY6 A;  2GU3 A;  1IV9 A;  2HMM B;  4HM3 B;  1N5H A;  4QWT A;  1HYF A;  3AGO A;  1GY7 A;  3S5C A;  3U97 A;  3VF1 A;  4BIR A;  5HOH A;  3X42 A;  1GSP A;  3LH4 A;  3ROB A;  1VQN 3;  1JV2 B;  1JBS A;  1B2S A;  3CCS 3;  1EG9 B;  2ZA4 A;  3DH2 A;  1UW1 A;  5BXQ A;  3CD6 3;  3MHE A;  3NQZ A;  2W56 B;  3JUO A;  5D83 A;  5IG4 A;  3CXC 2;  4HM0 B;  5IER A;  3Q90 A;  1MWR A;  1FUW A;  1JB5 A;  3ZG5 A;  3FG1 A;  3CCQ 3;  2CFW A;  4N6L A;  1MWU A;  2CWV A;  4KVH A;  4N6V 0;  1NB3 I;  3MG2 A;  2D1W A;  2KCD A;  4N6T A;  1ULI B;  2CHC A;  2RGQ A;  4I5Q A;  2OOV A;  4BL3 A;  2CKF B;  1BRJ A;  3WOF B;  2UUG C;  5AYS C;  4H61 A;  1RKY A;  1ZX2 A;  2R4I A;  2YFJ B;  1VQ8 3;  3MG3 A;  1BUJ A;  5G1L A;  2Z6B A;  5FGO A;  1O7M B;  1FGR A;  3OWS A;  3KCH A;  4HAA A;  4CCV A;  1T2I A;  1JKG A;  1M9G A;  4HYZ A;  1BOX A;  5EVH A;  2CG1 A;  3JUP A;  3KKG A;  2C10 A;  1NJI 4;  2Z77 A;  3KE7 A;  4BTX A;  1I8V A;  4J9A A;  3EE1 A;  3D3L A;  5BIR A;  2K54 A;  1BNG A;  4GHO A;  3S27 A;  9RNT A;  1VQ6 3;  1G96 A;  4FCZ A;  3WOE B;  2YFI B;  1W02 A;  2F56 A;  5IEN A;  4H3U A;  1N5P A;  1O7P B;  4XBT A;  1I3F A;  1FW7 A;  1GYB A;  3QK9 A;  5AEW B;  1DET A;  3N9H A;  1LOY A;  1A2V A;  3MSO A;  4K90 B;  2IUJ A;  5M19 A;  1J2B A;  1B3S A;  1QVF 2;  4XDV A;  1A67 A;  3CCE 3;  2XF3 A;  3NV0 B;  4RNT A;  4N6U A;  1K41 A;  2O9U X;  1MGW A;  2OTL 3;  4Q53 A;  3CCL 3;  4L8P A;  4J5K A;  5RNT A;  1R4Y A;  4HM4 B;  3RNT A;  1G0T A;  4BTY A;  1JBR A;  3G4S 3;  3CME 3;  2AAE A;  1X1U A;  3T8U A;  2FXT A;  1W5Z A;  3K5T A;  3ZG0 A;  4N3V A;  3CPW 2;  1BRK A;  1U8C B;  4J5G A;  1YVS A;  1MWS A;  2XFS A;  3X3Y A;  4TX4 A;  1T5Y A;  2HOH A;  1RSN A;  1BRS A;  5IF6 A;  4EXR A;  2H0G A;  1RMS A;  5A0O B;  1BRH A;  4KFD A;  4N6M A;  5EQL A;  2F98 A;  2F4Y A;  3HZP A;  3JUM A;  4RNZ A;  3SOY A;  3NUV A;  1OUN A;  4R9L A;  1I2G A;  3KFQ C;  1YJW 3;  4CJN A;  1RHL A;  1JBT A;  4O2H A;  1Q86 4;  1BSD A;  3EB8 A;  2CWU A;  1I0X A;  5G1K A;  1STF I;  1Q82 4;  1JNQ A;  1IYY A;  4OK0 A;  4ZM8 A;  5GSP A;  2KXG A;  1BNE A;  5AEU B;  3I55 3;  3B8L A;  4KFF A;  1W6C A;  2WGQ A;  3CPO A;  5M18 A;  3NBJ A;  1DE3 A;  3FLJ A;  1A2K A;  1QAK A;  3PYJ A;  2SBL A;  1IVW A;  2CH9 A;  1VQM 3;  1MGR A;  2XRX B;  1YIT 3;  8RNT A;  4NHF A;  2Q07 A;  3CCJ 3;  1RGK A;  2H0I A;  4HBR A;  3H3H A;  5LC6 A;  1A2P A;  2OTJ 3;  3VSY A;  1N9J A;  1RN1 A;  3RGR A;  1GOY A;  2BIR A;  1K73 4;  1O7N B;  1TJD A;  1FA3 A;  4HJL B;  4NPB A;  3LXU X;  4WWU C;  1MWT A;  3LZA A;  5D81 A;  3URP A;  2K3D A;  5AIH A;  4I4K A;  3DGO A;  1IK3 A;  1TIJ A;  2XH9 A;  3DZL A;  4IPB A;  1YHQ 3;  2CFG A;  5M1A A;  3CNX A;  2LYX A;  2Y74 A;  1DMQ A;  1RN7 A;  3UJM A;  1CEW I;  3HX8 A;  8CHO A;  2CC3 A;  1EUI C;  1BVI A;  1N8Q A;  4KT3 B;  4O3V A;  4R4K A;  5AYR B;  1LVN A;  2INX A;  3DGM A;  3IJE B;  4EYC A;  1RGG A;  1TRP A;  1FYS A;  1WTH A;  1IVX A;  1QVG 2;  1BNF A;  1I2E A;  1N9E A;  3GWR A;  1HU9 A;  1E3V A;  3KSE D;  1DMM A;  4MMX B;  1IVV A;  1SII A;  1GD3 A;  1RLS A;  2CWT A;  3PXM A;  4O8S A;  3CC7 3;  4GB5 A;  1ISK A;  1LQG C;  1Q9E A;  4JRF A;  1JN5 A;  5D82 A;  1TRQ A;  3NX0 A;  4WYK B;  1UCJ A;  5IEP A;  1MOL A;  4BTW A;  3FKA A;  3WDG B;  1R4C A;  1AQZ A;  2PZV A;  3WA2 X;  1VZZ A;  4XM4 A;  1OF5 A;  1DYU A;  5KP4 A;  2Z76 A;  1RTU A;  3LT8 A;  3CC4 3;  1UI8 A;  3NQY A;  3K9M C;  3STD A;  1GY5 A;  4AKY A;  3K7C A;  1VQP 3;  2RBI A;  3V98 A;  1W2Z A;  2F5W A;  1LOW A;  3EX9 A;  1B21 A;  3ZFZ A;  3CU3 A;  4X2H A;  2R41 A;  1D6U A;  1AV4 A;  1PFP A;  1E97 A;  1UUG B;  4J8T A;  1C7H A;  2IMJ A;  1ULJ B;  3SLU A;  1YI2 3;  1BAN A;  2BNG A;  1AVK A;  3FF0 A;  1UGI A;  1BSA A;  2A15 A;  2P0M A;  1YVB I;  1Y4K A;  1SIH A;  2OWP A;  2QGU A;  2AAD A;  3EF8 A;  1PYL A;  3HOH A;  4K61 A;  3AMO B;  3F40 A;  1VQ5 3;  1VQ9 3;  2CFL A;  4EBG A;  5CXO A;  1UCK A;  5AIF A;  1DVC A;  2ZDJ A;  1SPU A;  4EV2 A;  2XSH B;  2IYJ A;  2Y73 A;  2GEY A;  3ALA A;  1TFO A;  3BLZ A;  1RNT A;  5TGN A;  3LTB A;  2ML6 A;  3DGL A;  3PS8 A;  3GZR A;  2E2U A;  1I3I A;  3LYG A;  4FCM A;  3CMA 3;  1DMN A;  2LQV A;  3UB1 A;  1RRL A;  1SAR A;  3VGN A;  2CG0 A;  3Q3F A;  3DGY A;  1I2F A;  1WMO A;  1A90 A;  2YFL B;  1KSI A;  3WOD G;  1NO3 A;  3DY5 A;  1ZGX A;  1RRH A;  4HVN A;  2I9W A;  2RSX A;  1VQ7 3;  4R9K A;  2GU1 A;  3GSP A;  1TFK A;  3G71 3;  1B20 A;  1LQM B;  1FGQ A;  3JVC A;  4R1K A;  1QAL A;  1UUV B;  2JDI H;  1JN5 B;  4MEI A;  5IW9 A;  3MG1 A;  2W0Q A;  2SAR A;  1ROV A;  3SYU A;  4O02 B;  3GZB A;  5JPU A;  1ROA A;  2HMN B;  1BNJ A;  1EEJ A;  4HZB B;  1Q7Y 4;  3K0Z A;  1NNV A;  5FW5 A;  3FZW A;  4EW5 A;  1ASK A;  1BSE A;  2OCT A;  3KSP A;  3SOA A;  2GSP A;  3A5E A;  3X41 A;  3E99 A;  5CF1 A;  3HI7 A;  1AR0 A;  1FUT A;  3OXA A;  5IG0 A;  1MNL A;  2B1X B;  4ILF A;  4GL6 A;  3H51 A;  3F8X A;  4HM1 B;  1KWI A;  3WR2 A;  1OHS A;  3FG3 A;  3SVA A;  1BUQ A;  2BT3 A;  1B2Z A;  1UUW B;  5AI1 A;  4AKZ A;  5JPP A;  1YNV X;  2BO9 B;  2PNC A;  1L5G B;  3CCR 3;  4NRE A;  5KP1 A;  3EBY A;  5CLK A;  2XSO B;  2W6J H;  2QIY A;  6RNT A;  4JF8 A;  4XB5 A;  1IT8 A;  3L0R A;  4CDL A;  2W56 A;  1JZD A;  1W6Y A;  4HM2 B;  1YGW A;  3G6E 3;  1OCV A;  5HGR A;  1JKG B;  1ZS7 A;  2WOH A;  2C11 A;  3NHX A;  5BU4 A;  2P38 A;  4RZM A;  1QMA A;  2CK3 H;  4GSP A;  3EBT A;  3CCM 3;  3V92 A;  1FGM A;  1U5O A;  2KAA A;  1RNB A;  3FG4 A;  3EJV A;  2O3O A;  1CQS A;  3MPH A;  4LMI A;  3U1W A;  1V58 A;  1GMP A;  5IEO A;  3EN1 B;  3M8C A;  1VQQ A;  1W01 A;  5G2G A;  4PEJ A;  3HIG A;  3NM2 A;  2KF3 A;  1ZO2 A;  3S28 A;  1M90 4;  1IT7 A;  1GS3 A;  2WO0 A;  2IA7 A;  4G1M B;  1Q40 A;  5CF2 A;  4LSO A;  3EQQ B;  1IV7 A;  1LRA A;  2UX0 A;  2HMK B;  4FR9 A;  1JB4 A;  3F7S A;  1BNS A;  3FH1 A;  1OHP A;  3BB9 A;  3NXJ A;  2BHM A;  3PZW A;  3DM8 A;  3JUQ A;  4FCJ A;  4BU4 A;  2BU4 A;  2M7O A;  3V99 A;  3OWY A;  2OQE C;  3A76 A;  4K1V A;  1X1Y A;  2ZHX B;  1FGO A;  6GSP A;  3Q1C A;  1PU4 A;  2F5M A;  2WOF A;  1IVU A;  2FNQ A;  1BAO A;  3UL6 A;  1UCI A;  1RGH A;  3FF2 A;  3NBB A;  1Q42 A;  4LZI A;  3F7X A;  3LTA A;  3Q2P A;  3LOY A;  1D6Z A;  4WHA A;  5DRE A;  3T8N A;  4MMY B;  2GBX B;  2YX9 A;  4L8O A;  1LOX A;  3WA3 A;  1RGC A;  2QA4 3;  3D79 A;  2W9Q A;  3UL5 A;  1C54 A;  3FGY A;  4EC6 A;  3NV0 A;  1B2U A;  1RGL A;  4U13 A; 
#chains in the Genus database with same CATH homology
 1STD A;  2HMJ B;  2WGO A;  1V74 A;  1AVL A;  3GAX A;  4FMA A;  5JBS A;  2ZL8 A;  3LML A;  3BND A;  1YJ9 3;  1K9M 4;  3HII A;  1S5A A;  3N8B A;  4MMZ B;  1Q81 4;  1K28 A;  2E2T A;  4KFE A;  1YGE A;  3N54 B;  1EA2 A;  3IPT A;  1JRQ A;  2P09 A;  4K1U A;  3RDE A;  1WMN A;  3O8Y A;  1SQW A;  4WP5 A;  2CFK A;  5CK6 A;  1W4N A;  3GZY B;  4X2O A;  4FMB A;  3I0Y A;  1F8N A;  5IG3 A;  2OOV C;  3F8H A;  5DRV A;  5BVB A;  2STD A;  2V1L A;  3JUN A;  1M1K 4;  1NU3 A;  1W7C A;  1Z1S A;  2BMO B;  1VQL 3;  3WMD A;  3B7C A;  4FMD A;  4R80 A;  1Q40 B;  3RGA A;  3G0K A;  4XBX A;  3J7Y d;  2K0M A;  1WMP A;  2JQ5 A;  3KZT A;  4WFO A;  3G16 A;  2BMR B;  3IMA B;  2W03 A;  3UNL A;  1OH0 A;  2FGT A;  1LXE A;  1LNH A;  3X3X A;  3MWZ A;  4LGQ A;  3F9S A;  1VQO 3;  4N6O B;  3PCR A;  5ELU A;  3CCV 3;  1W00 A;  2XEP A;  3ECF A;  4ORL A;  2KRT A;  2CIU A;  4XBY A;  3ER7 A;  3GZX B;  1O7H B;  2RFR A;  3I56 3;  4IIA A;  3EN8 A;  4HM7 B;  1OGZ A;  1DVD A;  4STD A;  3CNM A;  2W9P A;  3HK4 A;  2B24 B;  3CCU 3;  1IQ8 A;  2W2C A;  3X3Z A;  5KP3 A;  3OV4 A;  2XGN A;  3OWU A;  3TDG A;  3EC9 A;  2QEX 3;  1OF5 B;  1HKX A;  1OHO A;  2L4V A;  2HMO B;  1IQX A;  5STD A;  3DMC A;  4RBN A;  2Z7A A;  2GEX A;  1S72 3;  1W2B 2;  3K63 A;  1D6Y A;  1TP6 A;  4FMC A;  2W04 A;  1GD4 A;  2XGL A;  3D9R A;  4HM6 B;  2MC8 A;  5I97 A;  1KC8 4;  3EHC A;  3CC2 3;  3PCS A;  1IQY A;  4OUQ A;  2RCD A;  1OGX A;  3GRD A;  3X40 A;  3NM7 A;  1EKM A;  2XFT A;  1WNH A;  4WYK A;  2F99 A;  3B4P A;  1N8R 4;  6STD A;  1OAC A;  1CYU A;  5AIG A;  2GBW B;  4L7K A;  3LTD A;  3PGB A;  1NDO B;  3DXO A;  3MYT A;  1RJO A;  2D42 A;  4EV5 A;  1VQK 3;  1TU5 A;  3FSD A;  5LC7 A;  4MJD A;  5AII A;  4IT7 A;  1M1X B;  4RNY A;  2XR8 B;  3BNE A;  3LTC A;  3SED A;  3DUK A;  2CFD A;  2E2V A;  3S29 A;  3OX9 A;  3G8Z A;  1OPY A;  1US1 A;  2P0X A;  2MF7 A;  4HM5 B;  4HZ9 B;  1IDP A;  3SXX A;  1KQS 2;  3BNB A;  1NWW A;  4KZ1 A;  1TUH A;  2P05 A;  5EEO A;  2HML B;  1KD1 4;  1JB2 A;  1YIJ 3;  2BMQ B;  1IU7 A;  1QJG A;  1SJW A;  3BNC A;  1E3R A;  3NBR A;  4HM8 B;  1WQL B;  1O7G B;  3AMO A;  1O7W B;  1W6G A;  3S67 A;  1CYV A;  3MKI A;  4HKV B;  3SX1 A;  3F14 A;  3QRD A;  2IUK A;  3LT9 A;  5ELJ A;  2OQE A;  1K8A 4;  3KII A;  7STD A;  2CW9 A;  3OW2 2;  1FGT A;  4AEQ A;  4XDW A;  3FCS B;  3T0U A;  1NB5 I;  5IG5 A;  1VQ4 3;  3B4O A;  1JJ2 2;  1EQK A;  2GXF A;  4OVM A;  4N6N B;  2ML5 A;  1UI7 A;  4LEH A;  2F86 B;  3DGN A;  1QAF A;  1YJN 3;  3KN4 A;  1GY6 A;  2GU3 A;  1IV9 A;  2HMM B;  4HM3 B;  1N5H A;  4QWT A;  3U97 A;  1GY7 A;  3S5C A;  3VF1 A;  3X42 A;  3LH4 A;  3ROB A;  1VQN 3;  1JV2 B;  3CCS 3;  1EG9 B;  1UW1 A;  5BXQ A;  3CD6 3;  3MHE A;  3NQZ A;  2W56 B;  3JUO A;  5D83 A;  5IG4 A;  3CXC 2;  4HM0 B;  5IER A;  3Q90 A;  1FUW A;  1JB5 A;  3FG1 A;  3CCQ 3;  2CFW A;  4N6L A;  2CWV A;  4KVH A;  4N6V 0;  1NB3 I;  3MG2 A;  2D1W A;  2KCD A;  4N6T A;  1ULI B;  2CHC A;  2RGQ A;  2OOV A;  2CKF B;  3WOF B;  5AYS C;  4H61 A;  1RKY A;  1ZX2 A;  2R4I A;  2YFJ B;  1VQ8 3;  3MG3 A;  2Z6B A;  5FGO A;  1O7M B;  1FGR A;  3OWS A;  4CCV A;  1JKG A;  1M9G A;  4HYZ A;  5EVH A;  2CG1 A;  3JUP A;  3KKG A;  2C10 A;  1NJI 4;  2Z77 A;  3KE7 A;  4BTX A;  4J9A A;  3EE1 A;  3D3L A;  2K54 A;  1VQ6 3;  3S27 A;  1G96 A;  4FCZ A;  3WOE B;  2YFI B;  1W02 A;  5IEN A;  4H3U A;  1N5P A;  1O7P B;  4XBT A;  1GYB A;  3QK9 A;  5AEW B;  3N9H A;  4K90 B;  1J2B A;  1A2V A;  3MSO A;  2IUJ A;  1QVF 2;  4XDV A;  1A67 A;  3CCE 3;  2XF3 A;  3NV0 B;  4N6U A;  1K41 A;  2O9U X;  2OTL 3;  4Q53 A;  3CCL 3;  4L8P A;  4HM4 B;  4BTY A;  3G4S 3;  3CME 3;  3T8U A;  2FXT A;  1W5Z A;  3K5T A;  3CPW 2;  4N3V A;  1U8C B;  2XFS A;  3X3Y A;  4TX4 A;  1T5Y A;  5IF6 A;  4EXR A;  5A0O B;  4N6M A;  4KFD A;  5EQL A;  2F98 A;  3HZP A;  3JUM A;  4RNZ A;  3SOY A;  3NUV A;  1OUN A;  4R9L A;  1YJW 3;  3KFQ C;  4O2H A;  1Q86 4;  3EB8 A;  2CWU A;  1STF I;  1Q82 4;  1JNQ A;  4OK0 A;  2KXG A;  5AEU B;  3I55 3;  3B8L A;  4KFF A;  1W6C A;  2WGQ A;  3CPO A;  3NBJ A;  3FLJ A;  1A2K A;  1QAK A;  3PYJ A;  2SBL A;  1IVW A;  2CH9 A;  1VQM 3;  2XRX B;  1YIT 3;  4NHF A;  2Q07 A;  3CCJ 3;  5LC6 A;  4HBR A;  3H3H A;  2OTJ 3;  3VSY A;  1N9J A;  3RGR A;  1K73 4;  1O7N B;  1FA3 A;  4HJL B;  3LXU X;  4WWU C;  3LZA A;  5D81 A;  5AIH A;  4I4K A;  3DGO A;  1IK3 A;  1TIJ A;  2XH9 A;  3DZL A;  4IPB A;  1YHQ 3;  2CFG A;  3CNX A;  2LYX A;  2Y74 A;  1DMQ A;  1RN7 A;  3UJM A;  1CEW I;  3HX8 A;  8CHO A;  2CC3 A;  1N8Q A;  4O3V A;  4R4K A;  5AYR B;  1LVN A;  2INX A;  3DGM A;  3IJE B;  4EYC A;  1QVG 2;  1WTH A;  1IVX A;  1N9E A;  3GWR A;  3KSE D;  1HU9 A;  1E3V A;  1DMM A;  4MMX B;  1IVV A;  1SII A;  1GD3 A;  2CWT A;  4O8S A;  3PXM A;  3CC7 3;  4GB5 A;  1ISK A;  4JRF A;  1JN5 A;  5D82 A;  3NX0 A;  4WYK B;  5IEP A;  1MOL A;  4BTW A;  3FKA A;  3WDG B;  1R4C A;  2PZV A;  3WA2 X;  1VZZ A;  4XM4 A;  1OF5 A;  1DYU A;  5KP4 A;  2Z76 A;  3LT8 A;  3CC4 3;  1UI8 A;  3NQY A;  3K9M C;  3STD A;  1GY5 A;  4AKY A;  3K7C A;  1VQP 3;  3V98 A;  1W2Z A;  3EX9 A;  3CU3 A;  4X2H A;  1D6U A;  1AV4 A;  1PFP A;  1E97 A;  4J8T A;  1C7H A;  2IMJ A;  1ULJ B;  3SLU A;  1YI2 3;  2BNG A;  1AVK A;  3FF0 A;  2A15 A;  2P0M A;  1YVB I;  1Y4K A;  1SIH A;  2OWP A;  2QGU A;  3EF8 A;  4K61 A;  3AMO B;  3F40 A;  1VQ5 3;  1VQ9 3;  2CFL A;  4EBG A;  5CXO A;  5AIF A;  1DVC A;  2ZDJ A;  1SPU A;  4EV2 A;  2XSH B;  2Y73 A;  2GEY A;  3ALA A;  1TFO A;  3BLZ A;  5TGN A;  3LTB A;  2ML6 A;  3DGL A;  3PS8 A;  3GZR A;  2E2U A;  3LYG A;  4FCM A;  3CMA 3;  1DMN A;  2LQV A;  3UB1 A;  1RRL A;  3VGN A;  2CG0 A;  1WMO A;  1A90 A;  2YFL B;  1KSI A;  3WOD G;  1NO3 A;  3DY5 A;  1RRH A;  4HVN A;  2I9W A;  2RSX A;  1VQ7 3;  4R9K A;  2GU1 A;  1TFK A;  3G71 3;  1FGQ A;  3JVC A;  4R1K A;  1QAL A;  1UUV B;  2JDI H;  1JN5 B;  4MEI A;  5IW9 A;  3MG1 A;  2W0Q A;  1ROV A;  4O02 B;  3GZB A;  5JPU A;  1ROA A;  2HMN B;  4HZB B;  1Q7Y 4;  3K0Z A;  5FW5 A;  3FZW A;  1ASK A;  2OCT A;  3KSP A;  3SOA A;  5CF1 A;  3X41 A;  3E99 A;  3HI7 A;  1AR0 A;  3OXA A;  5IG0 A;  1MNL A;  2B1X B;  4GL6 A;  3H51 A;  3F8X A;  4HM1 B;  1KWI A;  1OHS A;  3FG3 A;  3SVA A;  1BUQ A;  2BT3 A;  1UUW B;  5AI1 A;  4AKZ A;  5JPP A;  2BO9 B;  1L5G B;  2PNC A;  3CCR 3;  4NRE A;  5KP1 A;  3EBY A;  5CLK A;  2XSO B;  2W6J H;  2QIY A;  4JF8 A;  4XB5 A;  1IT8 A;  3L0R A;  4CDL A;  2W56 A;  4HM2 B;  1W6Y A;  3G6E 3;  1OCV A;  5HGR A;  1JKG B;  2WOH A;  2C11 A;  3NHX A;  2P38 A;  4RZM A;  1QMA A;  2CK3 H;  3CCM 3;  3EBT A;  3V92 A;  1FGM A;  1U5O A;  3FG4 A;  3EJV A;  2O3O A;  1CQS A;  3MPH A;  4LMI A;  3U1W A;  5IEO A;  3EN1 B;  3M8C A;  1W01 A;  5G2G A;  4PEJ A;  3HIG A;  3NM2 A;  1ZO2 A;  3S28 A;  1M90 4;  1IT7 A;  1GS3 A;  2WO0 A;  2IA7 A;  4G1M B;  1Q40 A;  5CF2 A;  4LSO A;  3EQQ B;  1IV7 A;  2UX0 A;  2HMK B;  4FR9 A;  1JB4 A;  3F7S A;  3FH1 A;  3NXJ A;  1OHP A;  3BB9 A;  4FCJ A;  2BHM A;  3PZW A;  3DM8 A;  3JUQ A;  2M7O A;  3V99 A;  3OWY A;  2OQE C;  3A76 A;  4K1V A;  1FGO A;  3Q1C A;  1PU4 A;  2WOF A;  1IVU A;  2FNQ A;  3UL6 A;  3FF2 A;  4LZI A;  4ZM8 A;  3NBB A;  1Q42 A;  3F7X A;  3LTA A;  3Q2P A;  3LOY A;  1D6Z A;  4WHA A;  5DRE A;  3T8N A;  4MMY B;  2GBX B;  2YX9 A;  4L8O A;  1LOX A;  3WA3 A;  2QA4 3;  2W9Q A;  3UL5 A;  3FGY A;  4EC6 A;  3NV0 A;  4U13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...