4R4KA

Crystal structure of a cystatin-like protein (baccac_01506) from bacteroides caccae atcc 43185 at 1.69 a resolution
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
151
structure length
151
Chain Sequence
EIAQSGEDFKSFLDKFTSSAAFQYTRIKFPLKTPITLLADDGETEKTFPFTKEKWPLLDSETMKEERIEQEEGGIYVSKFTLNEPVHKVFEAGYEESEIDLRVEFEQAADGKWYVVDCYTGWYGYDLPIGELKQTIQQVKEENAAFKEIHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a hypothetical protein (BACCAC_01506) from Bacteroides caccae ATCC 43185 at 1.69 A resolution
rcsb
source organism Bacteroides caccae
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 44
structure length 151
sequence length 151
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.410 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4r4kA00
2ML6A 4R4KA 2ML5A
chains in the Genus database with same CATH superfamily
1RLSA 2XFSA 3T0UA 5BIRA 1RGEA 5M18A 2OQEA 4BTXA 1JBTA 2P0MA 1RJOA 3KIIA 2OWPA 3ALAA 3WODG 3WA2X 3LOYA 5HGRA 3AMOA 1CEWI 3FLJA 4BL3A 1RHLA 1BNGA 1TU5A 1TTOA 2YFLB 2FNQA 1OHOA 4PEJA 3F14A 3H51A 2HOHA 1OHPA 3LYGA 4CDLA 1M904 3QRDA 1HZ1A 1VQK3 1BRKA 4KZ1A 3LT8A 1M1K4 3T8NA 1I8VA 1I2GA 3MG3A 1X1UA 4J8TA 3SOAA 2M7OA 3PXMA 3G4S3 3PCSA 5TGNA 1K9M4 2IUKA 2IYJA 2KCDA 1Q864 2KF6A 1O7GB 2ZA4A 4RZMA 1EG9B 1RKYA 1VZZA 2GEXA 4X2OA 5GSPA 2B24B 3L0RA 4N6MA 1NNVA 3CD63 6GSPA 2RBIA 3CCM3 1HKXA 1BSCA 1WMOA 3KKGA 2CX1A 2XF3A 4IIAA 4XBXA 2XSHB 1GMQA 1JB5A 1BUJA 2IA7A 4MMYB 1FW7A 1Q9EA 4R80A 1VQ73 3NXJA 4Q53A 3T8UA 4J5GA 1Z1SA 1O7PB 3BIRA 5LC7A 2QA43 3HOHA 2W9QA 2E2TA 4AKYA 2F5MA 1LQMB 1MOLA 1CYUA 3FG3A 5AI1A 3SEDA 2BHMA 4FCMA 5AIIA 3N9HA 3JUPA 3CCE3 2CFDA 3CNMA 5IERA 1E3RA 1Q824 4EBGA 1LXEA 2GSPA 3G713 2L1SA 3HK4A 3NHXA 3DZLA 2XFTA 3MPHA 1W6GA 2KXGA 3NV0B 1U8CB 1FUWA 1MWUA 2SBLA 3DGYA 1F8NA 3GSPA 3SLUA 4FMDA 1BSBA 3BNDA 3U1WA 1BVIA 3ECFA 1B21A 3WHOA 1RCLA 1UCLA 1IDPA 2KAAA 1DMQA 2L4VA 3JUMA 4BTYA 1K41A 2W0QA 4N6UA 3AHWA 1R4CA 1RRLA 2GU3A 1EQKA 3JUOA 1GMRA 1PYLA 5JPPA 4WHAA 1KC84 2INXA 3PZWA 2OOVA 1IT7A 5AIHA 2YFIB 4RNZA 3SVAA 7RNTA 4FMAA 2KRTA 2HMOB 3PYJA 1EA2A 4HBRA 2CWTA 4CCVA 1B2MA 1A2VA 2R4IA 1UUGB 3OWYA 3WOEB 3CCU3 1FGQA 1MGWA 3KFQC 4MJDA 5KP3A 3DY5A 1VQL3 1C54A 3NM7A 1X1YA 2XH9A 4XDWA 3URPA 1AV4A 1OGZA 3EBTA 1CQSA 1RGAA 1X1XA 3WR2A 3AHSA 3FF0A 1BRSA 3G0KA 4HM1B 1STFI 2WO0A 1BSDA 4O2HA 2H0HA 1V58A 1BU4A 1HU9A 1A2PA 2RGQA 1UGIA 4HZ9B 4IPBA 2CWUA 5IG5A 4JRFA 1YJN3 1Q7Y4 1VQN3 1V57A 3STDA 1I2FA 2ZDJA 1UCIA 1WNHA 1W5ZA 1UI8A 1BNEA 3CC43 5IG0A 4KFFA 1RCKA 2C11A 2Z76A 3OWSA 1L5GB 3PS8A 4CJNA 1UGHI 4R1KA 2WOFA 3FZWA 1VQ83 4RNTA 3LMLA 2R41A 4RNYA 4STDA 2RSXA 1YI23 1FUTA 2P09A 3DM8A 1N9JA 3OX9A 3AGNA 4J5KA 4GB5A 1NB3I 2V1LA 1EEJA 3S27A 1B2SA 1GY5A 1ROAA 2BU4A 1G02A 3EHCA 4R9KA 2C4BA 3WDGB 3IPTA 1RTUA 4NPBA 1Q7HA 3K0ZA 1TFKA 2CW9A 4JF8A 1WTHA 4GHOA 1IYYA 3K9MC 4HJLB 1YJ93 1T3BA 2O9UX 1ASKA 1RGFA 5FGOA 2QEX3 3N8BA 1X1WA 1QAKA 1UI7A 1UW1A 2RNTA 4HM6B 1RGLA 4MEIA 5EQLA 5CXOA 3EQQB 4HM5B 1ZX2A 3I553 3S28A 1YHQ3 2BT3A 3MG2A 5IG4A 1B3SA 2CFWA 3D4AA 3KSPA 3BB9A 1GYBA 5JPUA 2RFRA 3D79A 1STDA 1T2IA 1OHSA 1OUNA 2GBXB 3V92A 3CMA3 1VQ43 3NQZA 3B8LA 2CC3A 2BMRB 4LEHA 2ZHXB 5EVHA 3LTCA 1GD3A 1JZDA 3QK9A 1LOWA 2MC8A 3MG1A 4EV2A 1N9EA 5KP1A 4R9LA 4WP5A 2CG0A 4BU4A 1TFOA 2ZL8A 2ML6A 3CU3A 3SOYA 3F8HA 1RN7A 3WMDA 3UL6A 3PCRA 3FGYA 4HM7B 3EBYA 1R4YA 1KSIA 3HI7A 1IQ8A 3FG1A 1DE3A 4N6TA 3VF1A 3UJMA 1I2EA 1BRIA 1U5OA 1JKGA 2W56B 4DKIA 1YIJ3 1N8R4 4O02B 1WQLB 1AR0A 3OXAA 3G8ZA 4QWTA 1VQ63 3K5TA 1UUVB 2OOVC 1DVCA 4HM2B 1BNRA 1LQGC 1GOVA 1FA3A 4HAAA 1W6YA 1FZUA 5AEUB 3CC23 2XGNA 4FCZA 3V98A 4LZIA 1ZO2A 5G2GA 3SYUA 2LQVA 2QIYA 2D1WA 4FR9A 1BRNL 1GMPA 3DMCA 3RGRA 1YVSA 1IVXA 1ULIB 3V99A 2ML5A 3JUQA 1SIIA 3F40A 3AMOB 1JKGB 2W56A 5CF2A 2BNGA 1RN1A 1JBSA 1TRPA 3D3LA 3DGMA 4TX4A 1W2B2 4K90B 3NUVA 1IV7A 2XGLA 3VGNA 1JBRA 5D83A 3OWUA 4MMZB 4HYZA 4EXRA 2OCTA 1VQP3 3HX8A 3DUKA 1KWIA 2D42A 2P0XA 1B20A 2IMJA 1DETA 3LTBA 3Q1CA 4AEQA 3EX9A 3F7SA 4J9AA 1TP6A 1BNSA 2XEPA 1KQS2 3RDEA 1NB5I 5AEWB 1W01A 1RGCA 2GBWB 3MSOA 4FCJA 1QAFA 2B1XB 2YFJB 4AKZA 3A76A 1YGWA 1T5YA 3DXOA 3K63A 3KSED 4FMBA 1BRGA 1NDOB 1RMSA 2Z6BA 4KFEA 4N6V0 3KE7A 1LOYA 5AYRB 3EN8A 5IEOA 4N6LA 3PGBA 4EC6A 1Q42A 1RNTA 2UGIA 5JBSA 3JVCA 4KVHA 1O7MB 2WOHA 4LSOA 4N6OB 4OK0A 5M1AA 1E3VA 4HVNA 1D6ZA 4GSPA 1I0XA 4K1UA 2F4YA 1BRHA 1IVUA 3KCHA 5HOHA 1VQO3 1JN5A 2HMLB 3CCS3 4LGQA 3S29A 1WMPA 3KZTA 1RRHA 5BU4A 2CIUA 1IVWA 2OTL3 1FGOA 4G1MB 1UUWB 1B2UA 2W03A 4ILFA 5D82A 2IY2A 3UB1A 2CKFB 2XR8B 5FW5A 1FGRA 3BU4A 3IJEB 3MKIA 4O3VA 1K8A4 1IT8A 1Q40B 3VSYA 1W4NA 1YGEA 1IQXA 4OUQA 1JN5B 1MWRA 2W6JH 3EE1A 3S5CA 3HIGA 3NV0A 3M8CA 1SARA 2YX9A 2J8XB 4HOHA 3CME3 1VQ93 4EYCA 5DREA 1B2ZA 2K3DA 2F98A 5DRVA 3FF2A 1D6YA 2UUGC 1AVLA 3HZPA 1LVNA 2Y74A 1PFPA 3CPW2 1IV9A 3X3XA 1N8QA 2GU1A 2RCDA 2UX0A 5IENA 1MWTA 3NBBA 1N5HA 3IMAB 5ELJA 1A90A 4HM0B 3LTDA 1CH0A 4WYKB 1A67A 2KF5A 1IVVA 4NHFA 3B4OA 4I5QA 3EJVA 3FSDA 1JV2B 4U13A 3DGLA 5CLKA 3CCR3 1HYFA 1D6UA 4HM3B 5EEOA 1BOXA 1SQWA 3G16A 3S67A 1MGRA 2Y73A 1Y4KA 2HMNB 5IW9A 2BMOB 5IEPA 2AAEA 2CWVA 1BSEA 4N3VA 2F5WA 3D9RA 4WYKA 3ZG0A 1UDII 3MYTA 5G1LA 1VQ53 3LXUX 3ZFZA 1W00A 2FGTA 3CCV3 3OW22 1YJW3 3CNXA 1TUHA 3X40A 4BIRA 4XDVA 1DYUA 1DVDA 1V74A 4EV5A 4BL2A 2GEYA 2F56A 5AIGA 4N6NB 8CHOA 1G0TA 1QVF2 3EC9A 2JQ5A 3H3HA 3D5GA 2FXTA 3K7CA 4GL6A 4I4KA 4H61A 3EN1B 1OPYA 3OV4A 2A15A 2BO9B 1BNIA 4HM8B 3B4PA 1IK3A 2CK3H 3CCJ3 5G1KA 3LTAA 2CHCA 4IT7A 3CCL3 1US1A 3N54B 2IUJA 1BGSA 4CPKA 2E2UA 1LOVA 1JJ22 1YIT3 1VQM3 3LH4A 1M9GA 2W2CA 4OVMA 3B7CA 4XBTA 7GSPA 6STDA 1NO3A 3NM2A 3I563 1RN4A 1SPUA 3FH1A 3UNLA 1FUSA 2CFLA 3EF8A 2C10A 2Z7AA 4FMCA 1IU7A 1GS3A 9RNTA 1JNQA 4K61A 1OF5A 1NU3A 3GZYB 1PU4A 1JZOA 3I0YA 5CK6A 2XRXB 1BSAA 1G96A 1TRQA 4HKVB 8RNTA 3EB8A 1LOXA 1SIHA 3MHEA 6RNTA 3CC73 1O7WB 1S5AA 1O7HB 3X3YA 4L8PA 5IF6A 1TJDA 1B2XA 1A2KA 1BIRA 7STDA 2F86B 4L8OA 1DMMA 2CFGA 1OF5B 2P05A 3DH2A 5KP4A 3MWZA 1LNHA 4WWUC 3GZXB 1QVG2 2OTJ3 2W9PA 1GY7A 1M1XB 1BRJA 1PY3A 1QMAA 1CYVA 3E99A 1LNIA 4EW5A 1DMNA 1ZS7A 1RSNA 2K54A 1RNBA 1NWWA 2SARA 4NREA 5CF1A 1AVKA 1JB2A 1SJWA 1K734 3CPOA 5I97A 1MNLA 4LMIA 1ZGXA 1BUQA 4K1VA 1VQQA 3GAXA 1B27A 1GOUA 1O7NB 1OCVA 2H0GA 3TDGA 3U97A 3X3ZA 1JB4A 3J7Yd 3LT9A 3GRDA 1QALA 5ELUA 1RGKA 1YNVX 1S723 2OQEC 3RNTA 2XSOB 2MF7A 3BNCA 3NBJA 3JUNA 3FKAA 1RGGA 1K28A 1YVBI 2HMMB 5STDA 1IQYA 4WFOA 4LYLB 5RNTA 2WGOA 3LZAA 3BLZA 1W02A 3X42A 3ROBA 1RGHA 3SX1A 4XM4A 1WMNA 2Q07A 2H0IA 2K0MA 2O3OA 3Q2PA 3BNEA 3Q3FA 3AGOA 4XBYA 2CG1A 2KF4A 1EUIC 5LC6A 1T2HA 2CFKA 5A0OB 1GY6A 2JDIH 3G6E3 4HZBB 2QGUA 3BNBA 3ER7A 2STDA 4HM4B 2W04A 4H3UA 2HMKB 3FG4A 3RGAA 3KN4A 2CX0A 3GZRA 4O8SA 2Z77A 1QJGA 1N5PA 3DGNA 3GZBA 1W6CA 1C7HA 1JRQA 3F8XA 1I70A 1FGMA 1I3IA 1LRAA 2CH9A 3WA3A 1Q814 1UCKA 1GOYA 1BNFA 1AY7A 3F7XA 1TIJA 5AYSC 1OH0A 1FYSA 2F99A 1EKMA 2HMJB 3NQYA 3ZG5A 1J2BA 5D81A 4MMXB 4RBNA 4BTWA 2BMQB 2E2VA 2PZVA 1ISKA 4KFDA 1W7CA 3CCQ3 4R4KA 3WOFB 1I3FA 2I9WA 1BNJA 1ULJB 1ROVA 1GSPA 1KD14 1BAOA 3DGOA 5BVBA 4XB5A 3D5IA 5IG3A 2GXFA 1BANA 3GWRA 3CXC2 3O8YA 5BXQA 3SXXA 4ZM8A 1W2ZA 3Q90A 2AADA 2BIRA 2LYXA 3A5EA 1I0VA 1Q40A 3HIIA 3UL5A 3NBRA 4X2HA 3NX0A 1RDSA 4ORLA 2WGQA 4L7KA 1E97A 1OGXA 4KT3B 2P38A 5AIFA 1UCJA 5M19A 1NJI4 3FCSB 3X41A 1MWSA 2PNCA 2KF3A 1OACA 1FGTA 3F9SA 1GD4A 1AQZA
chains in the Genus database with same CATH topology
2XFSA 3T0UA 2OQEA 4BTXA 2P0MA 1RJOA 3KIIA 2OWPA 3ALAA 3WODG 3WA2X 3LOYA 5HGRA 3AMOA 1CEWI 3FLJA 1TU5A 2YFLB 2FNQA 1OHOA 4PEJA 3F14A 3H51A 3LYGA 1OHPA 4CDLA 1M904 3QRDA 1VQK3 4KZ1A 3LT8A 1M1K4 3T8NA 3MG3A 4J8TA 3SOAA 2M7OA 3PXMA 3G4S3 3PCSA 5TGNA 1K9M4 2IUKA 2KCDA 1Q864 4RZMA 1O7GB 1EG9B 1RKYA 1VZZA 2GEXA 4X2OA 2B24B 3L0RA 4N6MA 3CCM3 1HKXA 1WMOA 3KKGA 2XF3A 4IIAA 4XBXA 2XSHB 1JB5A 2IA7A 4MMYB 4R80A 1VQ73 3NXJA 4Q53A 3T8UA 1Z1SA 1O7PB 5LC7A 2QA43 2W9QA 2E2TA 4AKYA 1MOLA 1CYUA 3FG3A 5AI1A 3SEDA 2BHMA 4FCMA 5AIIA 3N9HA 3JUPA 3CCE3 2CFDA 3CNMA 5IERA 1E3RA 1Q824 4EBGA 1LXEA 3G713 3HK4A 3NHXA 3DZLA 2XFTA 3MPHA 1W6GA 2KXGA 3NV0B 1U8CB 1FUWA 2SBLA 1F8NA 3SLUA 3U1WA 4FMDA 3BNDA 3ECFA 1IDPA 1DMQA 2L4VA 3JUMA 4BTYA 1K41A 2W0QA 4N6UA 1R4CA 1RRLA 2GU3A 1EQKA 3JUOA 5JPPA 1KC84 4WHAA 2INXA 3PZWA 2OOVA 1IT7A 5AIHA 2YFIB 4RNZA 3SVAA 4FMAA 2KRTA 2HMOB 3PYJA 1EA2A 4HBRA 2CWTA 4CCVA 1A2VA 2R4IA 3OWYA 3WOEB 3CCU3 1FGQA 3KFQC 5KP3A 4MJDA 1VQL3 3DY5A 3NM7A 2XH9A 4XDWA 3EBTA 1AV4A 1OGZA 1CQSA 3FF0A 3G0KA 4HM1B 1STFI 2WO0A 4O2HA 4IPBA 1HU9A 1YJN3 2RGQA 5IG5A 4HZ9B 1Q7Y4 2CWUA 4JRFA 1VQN3 3STDA 2ZDJA 1WNHA 1W5ZA 1UI8A 3CC43 5IG0A 4KFFA 2C11A 2Z76A 3OWSA 1L5GB 3PS8A 4R1KA 2WOFA 3FZWA 1VQ83 3LMLA 4RNYA 4STDA 2RSXA 1YI23 2P09A 3DM8A 1N9JA 3OX9A 4GB5A 1NB3I 2V1LA 3S27A 3EHCA 1GY5A 1ROAA 4R9KA 3WDGB 3CD63 3IPTA 3K0ZA 1TFKA 2CW9A 4JF8A 1WTHA 3K9MC 4HJLB 1YJ93 2O9UX 1ASKA 5FGOA 2QEX3 3N8BA 1QAKA 1UI7A 1UW1A 4HM6B 4MEIA 5EQLA 5CXOA 3EQQB 4HM5B 1ZX2A 3I553 3S28A 1YHQ3 2BT3A 3MG2A 5IG4A 2CFWA 3KSPA 3BB9A 1GYBA 5JPUA 2RFRA 1STDA 2GBXB 1OHSA 1OUNA 3V92A 3CMA3 1VQ43 3NQZA 3B8LA 2CC3A 2BMRB 4LEHA 4EV2A 5EVHA 3LTCA 1GD3A 3QK9A 2MC8A 3MG1A 5KP1A 1N9EA 4R9LA 4WP5A 2CG0A 1TFOA 2ZL8A 2ML6A 3CU3A 3SOYA 3F8HA 1RN7A 3WMDA 3UL6A 3PCRA 3FGYA 4HM7B 3EBYA 1KSIA 3HI7A 1IQ8A 3FG1A 4N6TA 3VF1A 3UJMA 1U5OA 1YIJ3 1JKGA 2W56B 1N8R4 4O02B 1WQLB 1AR0A 3OXAA 3G8ZA 4QWTA 1VQ63 3K5TA 1UUVB 2OOVC 1DVCA 4HM2B 1FA3A 1W6YA 5AEUB 3CC23 2XGNA 4FCZA 3V98A 4LZIA 1ZO2A 5G2GA 2LQVA 2QIYA 2D1WA 4FR9A 3DMCA 3RGRA 3V99A 1IVXA 1ULIB 2ML5A 3JUQA 1SIIA 3F40A 3AMOB 1JKGB 2W56A 5CF2A 2BNGA 3D3LA 3DGMA 4TX4A 1W2B2 4K90B 3NUVA 1IV7A 2XGLA 3VGNA 5D83A 3OWUA 4MMZB 4HYZA 4EXRA 2OCTA 1VQP3 3HX8A 3DUKA 1KWIA 2D42A 2P0XA 2IMJA 3LTBA 3Q1CA 4AEQA 3EX9A 3F7SA 4J9AA 1TP6A 2XEPA 1KQS2 3RDEA 1NB5I 5AEWB 1W01A 3MSOA 2GBWB 4FCJA 1QAFA 2B1XB 2YFJB 4AKZA 3A76A 3DXOA 1T5YA 3K63A 3KSED 4FMBA 1NDOB 2Z6BA 4KFEA 4N6V0 3KE7A 5AYRB 5IEOA 3EN8A 4N6LA 3PGBA 4EC6A 1Q42A 5JBSA 3JVCA 4KVHA 1O7MB 2WOHA 4LSOA 4N6OB 4OK0A 1E3VA 4HVNA 1D6ZA 4K1UA 1IVUA 1VQO3 1JN5A 2HMLB 3CCS3 4LGQA 3S29A 1WMPA 3KZTA 1RRHA 2OTL3 2CIUA 1IVWA 1FGOA 4G1MB 1UUWB 2W03A 5D82A 3UB1A 2CKFB 2XR8B 5FW5A 1FGRA 3IJEB 3MKIA 4O3VA 1K8A4 1IT8A 1Q40B 3VSYA 1W4NA 1YGEA 1IQXA 4OUQA 1JN5B 3EE1A 2W6JH 3S5CA 3HIGA 3NV0A 3M8CA 2YX9A 1VQ93 3CME3 4EYCA 5DREA 2F98A 5DRVA 3FF2A 1D6YA 1AVLA 3HZPA 1LVNA 2Y74A 1PFPA 3CPW2 1IV9A 3X3XA 1N8QA 2GU1A 2RCDA 2UX0A 5IENA 3NBBA 1N5HA 3IMAB 5ELJA 1A90A 4HM0B 3LTDA 4WYKB 1A67A 1IVVA 4NHFA 3B4OA 3EJVA 3FSDA 1JV2B 4U13A 3DGLA 5CLKA 3CCR3 4HM3B 1D6UA 5EEOA 1SQWA 3G16A 3S67A 2Y73A 1Y4KA 2HMNB 5IW9A 2BMOB 5IEPA 2CWVA 4N3VA 3D9RA 4WYKA 3MYTA 1VQ53 3LXUX 1YJW3 1W00A 2FGTA 3CCV3 3OW22 3CNXA 1TUHA 3X40A 4XDVA 1DYUA 1DVDA 1V74A 4EV5A 2GEYA 5AIGA 8CHOA 4N6NB 1QVF2 3EC9A 2JQ5A 3H3HA 2FXTA 3K7CA 4GL6A 4I4KA 4H61A 3EN1B 1OPYA 3OV4A 2A15A 2BO9B 4HM8B 3B4PA 1IK3A 2CK3H 3CCJ3 3LTAA 2CHCA 4IT7A 3CCL3 1US1A 3N54B 2IUJA 2E2UA 1JJ22 1YIT3 1VQM3 3LH4A 1M9GA 2W2CA 4OVMA 3B7CA 4XBTA 3I563 6STDA 1NO3A 3NM2A 3FH1A 1SPUA 3UNLA 3EF8A 2CFLA 2C10A 2Z7AA 4FMCA 1IU7A 1GS3A 1JNQA 4K61A 1OF5A 1NU3A 3GZYB 1PU4A 3I0YA 5CK6A 2XRXB 1G96A 4HKVB 3EB8A 1LOXA 1SIHA 3MHEA 3CC73 1O7WB 1S5AA 1O7HB 3X3YA 4L8PA 5IF6A 1A2KA 7STDA 2F86B 4L8OA 1DMMA 2CFGA 1OF5B 2P05A 5KP4A 3MWZA 1LNHA 4WWUC 3GZXB 1QVG2 2OTJ3 2W9PA 1GY7A 1M1XB 1QMAA 1CYVA 3E99A 1DMNA 2K54A 1NWWA 4NREA 5CF1A 1AVKA 1JB2A 1SJWA 1K734 3CPOA 5I97A 1MNLA 4LMIA 1BUQA 4K1VA 3GAXA 1O7NB 3TDGA 1OCVA 3U97A 3X3ZA 1JB4A 3J7Yd 3LT9A 3GRDA 1QALA 5ELUA 1S723 2OQEC 2XSOB 2MF7A 3BNCA 3NBJA 3JUNA 3FKAA 1K28A 1YVBI 2HMMB 5STDA 1IQYA 4WFOA 2WGOA 3LZAA 3BLZA 1W02A 3X42A 3ROBA 3SX1A 4XM4A 1WMNA 2Q07A 3Q2PA 2K0MA 2O3OA 3BNEA 4XBYA 2CG1A 5LC6A 2CFKA 5A0OB 3G6E3 1GY6A 2JDIH 4HZBB 2QGUA 3BNBA 3ER7A 2STDA 4HM4B 2W04A 4H3UA 2HMKB 3FG4A 3RGAA 3KN4A 3GZRA 4O8SA 2Z77A 1QJGA 1N5PA 3DGNA 3GZBA 1W6CA 1C7HA 1JRQA 3F8XA 1FGMA 2CH9A 3WA3A 1Q814 3F7XA 1TIJA 5AYSC 1OH0A 2F99A 1EKMA 2HMJB 3NQYA 1J2BA 5D81A 4MMXB 4RBNA 4BTWA 2BMQB 2E2VA 2PZVA 1ISKA 4KFDA 1W7CA 3CCQ3 4R4KA 3WOFB 2I9WA 1ULJB 1ROVA 1KD14 3DGOA 5BVBA 4XB5A 5IG3A 2GXFA 3GWRA 3CXC2 3O8YA 5BXQA 3SXXA 4ZM8A 1W2ZA 3Q90A 2LYXA 1Q40A 3HIIA 3UL5A 3NBRA 4X2HA 3NX0A 4ORLA 2WGQA 4L7KA 1E97A 1OGXA 2P38A 5AIFA 1NJI4 3FCSB 3X41A 2PNCA 1OACA 1FGTA 3F9SA 1GD4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ML6 A;  4R4K A;  2ML5 A; 
#chains in the Genus database with same CATH topology
 1RLS A;  2XFS A;  3T0U A;  5BIR A;  1RGE A;  5M18 A;  2OQE A;  4BTX A;  1JBT A;  2P0M A;  1RJO A;  3KII A;  2OWP A;  3ALA A;  3WOD G;  3WA2 X;  3LOY A;  5HGR A;  3AMO A;  1CEW I;  3FLJ A;  4BL3 A;  1RHL A;  1BNG A;  1TU5 A;  1TTO A;  2YFL B;  2FNQ A;  1OHO A;  4PEJ A;  3F14 A;  3H51 A;  2HOH A;  1OHP A;  3LYG A;  4CDL A;  1M90 4;  3QRD A;  1HZ1 A;  1VQK 3;  1BRK A;  4KZ1 A;  3LT8 A;  1M1K 4;  3T8N A;  1I8V A;  1I2G A;  3MG3 A;  1X1U A;  4J8T A;  3SOA A;  2M7O A;  3PXM A;  3G4S 3;  3PCS A;  5TGN A;  1K9M 4;  2IUK A;  2IYJ A;  2KCD A;  1Q86 4;  2KF6 A;  1O7G B;  2ZA4 A;  4RZM A;  1EG9 B;  1RKY A;  1VZZ A;  2GEX A;  4X2O A;  5GSP A;  2B24 B;  3L0R A;  4N6M A;  1NNV A;  3CD6 3;  6GSP A;  2RBI A;  3CCM 3;  1HKX A;  1BSC A;  1WMO A;  3KKG A;  2CX1 A;  2XF3 A;  4IIA A;  4XBX A;  2XSH B;  1GMQ A;  1JB5 A;  1BUJ A;  2IA7 A;  4MMY B;  1FW7 A;  1Q9E A;  4R80 A;  1VQ7 3;  3NXJ A;  4Q53 A;  3T8U A;  4J5G A;  1Z1S A;  1O7P B;  3BIR A;  5LC7 A;  2QA4 3;  3HOH A;  2W9Q A;  2E2T A;  4AKY A;  2F5M A;  1LQM B;  1MOL A;  1CYU A;  3FG3 A;  5AI1 A;  3SED A;  2BHM A;  4FCM A;  5AII A;  3N9H A;  3JUP A;  3CCE 3;  2CFD A;  3CNM A;  5IER A;  1E3R A;  1Q82 4;  4EBG A;  1LXE A;  2GSP A;  3G71 3;  2L1S A;  3HK4 A;  3NHX A;  3DZL A;  2XFT A;  3MPH A;  1W6G A;  2KXG A;  3NV0 B;  1U8C B;  1FUW A;  1MWU A;  2SBL A;  3DGY A;  1F8N A;  3GSP A;  3SLU A;  4FMD A;  1BSB A;  3BND A;  3U1W A;  1BVI A;  3ECF A;  1B21 A;  3WHO A;  1RCL A;  1UCL A;  1IDP A;  2KAA A;  1DMQ A;  2L4V A;  3JUM A;  4BTY A;  1K41 A;  2W0Q A;  4N6U A;  3AHW A;  1R4C A;  1RRL A;  2GU3 A;  1EQK A;  3JUO A;  1GMR A;  1PYL A;  5JPP A;  4WHA A;  1KC8 4;  2INX A;  3PZW A;  2OOV A;  1IT7 A;  5AIH A;  2YFI B;  4RNZ A;  3SVA A;  7RNT A;  4FMA A;  2KRT A;  2HMO B;  3PYJ A;  1EA2 A;  4HBR A;  2CWT A;  4CCV A;  1B2M A;  1A2V A;  2R4I A;  1UUG B;  3OWY A;  3WOE B;  3CCU 3;  1FGQ A;  1MGW A;  3KFQ C;  4MJD A;  5KP3 A;  3DY5 A;  1VQL 3;  1C54 A;  3NM7 A;  1X1Y A;  2XH9 A;  4XDW A;  3URP A;  1AV4 A;  1OGZ A;  3EBT A;  1CQS A;  1RGA A;  1X1X A;  3WR2 A;  3AHS A;  3FF0 A;  1BRS A;  3G0K A;  4HM1 B;  1STF I;  2WO0 A;  1BSD A;  4O2H A;  2H0H A;  1V58 A;  1BU4 A;  1HU9 A;  1A2P A;  2RGQ A;  1UGI A;  4HZ9 B;  4IPB A;  2CWU A;  5IG5 A;  4JRF A;  1YJN 3;  1Q7Y 4;  1VQN 3;  1V57 A;  3STD A;  1I2F A;  2ZDJ A;  1UCI A;  1WNH A;  1W5Z A;  1UI8 A;  1BNE A;  3CC4 3;  5IG0 A;  4KFF A;  1RCK A;  2C11 A;  2Z76 A;  3OWS A;  1L5G B;  3PS8 A;  4CJN A;  1UGH I;  4R1K A;  2WOF A;  3FZW A;  1VQ8 3;  4RNT A;  3LML A;  2R41 A;  4RNY A;  4STD A;  2RSX A;  1YI2 3;  1FUT A;  2P09 A;  3DM8 A;  1N9J A;  3OX9 A;  3AGN A;  4J5K A;  4GB5 A;  1NB3 I;  2V1L A;  1EEJ A;  3S27 A;  1B2S A;  1GY5 A;  1ROA A;  2BU4 A;  1G02 A;  3EHC A;  4R9K A;  2C4B A;  3WDG B;  3IPT A;  1RTU A;  4NPB A;  1Q7H A;  3K0Z A;  1TFK A;  2CW9 A;  4JF8 A;  1WTH A;  4GHO A;  1IYY A;  3K9M C;  4HJL B;  1YJ9 3;  1T3B A;  2O9U X;  1ASK A;  1RGF A;  5FGO A;  2QEX 3;  3N8B A;  1X1W A;  1QAK A;  1UI7 A;  1UW1 A;  2RNT A;  4HM6 B;  1RGL A;  4MEI A;  5EQL A;  5CXO A;  3EQQ B;  4HM5 B;  1ZX2 A;  3I55 3;  3S28 A;  1YHQ 3;  2BT3 A;  3MG2 A;  5IG4 A;  1B3S A;  2CFW A;  3D4A A;  3KSP A;  3BB9 A;  1GYB A;  5JPU A;  2RFR A;  3D79 A;  1STD A;  1T2I A;  1OHS A;  1OUN A;  2GBX B;  3V92 A;  3CMA 3;  1VQ4 3;  3NQZ A;  3B8L A;  2CC3 A;  2BMR B;  4LEH A;  2ZHX B;  5EVH A;  3LTC A;  1GD3 A;  1JZD A;  3QK9 A;  1LOW A;  2MC8 A;  3MG1 A;  4EV2 A;  1N9E A;  5KP1 A;  4R9L A;  4WP5 A;  2CG0 A;  4BU4 A;  1TFO A;  2ZL8 A;  2ML6 A;  3CU3 A;  3SOY A;  3F8H A;  1RN7 A;  3WMD A;  3UL6 A;  3PCR A;  3FGY A;  4HM7 B;  3EBY A;  1R4Y A;  1KSI A;  3HI7 A;  1IQ8 A;  3FG1 A;  1DE3 A;  4N6T A;  3VF1 A;  3UJM A;  1I2E A;  1BRI A;  1U5O A;  1JKG A;  2W56 B;  4DKI A;  1YIJ 3;  1N8R 4;  4O02 B;  1WQL B;  1AR0 A;  3OXA A;  3G8Z A;  4QWT A;  1VQ6 3;  3K5T A;  1UUV B;  2OOV C;  1DVC A;  4HM2 B;  1BNR A;  1LQG C;  1GOV A;  1FA3 A;  4HAA A;  1W6Y A;  1FZU A;  5AEU B;  3CC2 3;  2XGN A;  4FCZ A;  3V98 A;  4LZI A;  1ZO2 A;  5G2G A;  3SYU A;  2LQV A;  2QIY A;  2D1W A;  4FR9 A;  1BRN L;  1GMP A;  3DMC A;  3RGR A;  1YVS A;  1IVX A;  1ULI B;  3V99 A;  2ML5 A;  3JUQ A;  1SII A;  3F40 A;  3AMO B;  1JKG B;  2W56 A;  5CF2 A;  2BNG A;  1RN1 A;  1JBS A;  1TRP A;  3D3L A;  3DGM A;  4TX4 A;  1W2B 2;  4K90 B;  3NUV A;  1IV7 A;  2XGL A;  3VGN A;  1JBR A;  5D83 A;  3OWU A;  4MMZ B;  4HYZ A;  4EXR A;  2OCT A;  1VQP 3;  3HX8 A;  3DUK A;  1KWI A;  2D42 A;  2P0X A;  1B20 A;  2IMJ A;  1DET A;  3LTB A;  3Q1C A;  4AEQ A;  3EX9 A;  3F7S A;  4J9A A;  1TP6 A;  1BNS A;  2XEP A;  1KQS 2;  3RDE A;  1NB5 I;  5AEW B;  1W01 A;  1RGC A;  2GBW B;  3MSO A;  4FCJ A;  1QAF A;  2B1X B;  2YFJ B;  4AKZ A;  3A76 A;  1YGW A;  1T5Y A;  3DXO A;  3K63 A;  3KSE D;  4FMB A;  1BRG A;  1NDO B;  1RMS A;  2Z6B A;  4KFE A;  4N6V 0;  3KE7 A;  1LOY A;  5AYR B;  3EN8 A;  5IEO A;  4N6L A;  3PGB A;  4EC6 A;  1Q42 A;  1RNT A;  2UGI A;  5JBS A;  3JVC A;  4KVH A;  1O7M B;  2WOH A;  4LSO A;  4N6O B;  4OK0 A;  5M1A A;  1E3V A;  4HVN A;  1D6Z A;  4GSP A;  1I0X A;  4K1U A;  2F4Y A;  1BRH A;  1IVU A;  3KCH A;  5HOH A;  1VQO 3;  1JN5 A;  2HML B;  3CCS 3;  4LGQ A;  3S29 A;  1WMP A;  3KZT A;  1RRH A;  5BU4 A;  2CIU A;  1IVW A;  2OTL 3;  1FGO A;  4G1M B;  1UUW B;  1B2U A;  2W03 A;  4ILF A;  5D82 A;  2IY2 A;  3UB1 A;  2CKF B;  2XR8 B;  5FW5 A;  1FGR A;  3BU4 A;  3IJE B;  3MKI A;  4O3V A;  1K8A 4;  1IT8 A;  1Q40 B;  3VSY A;  1W4N A;  1YGE A;  1IQX A;  4OUQ A;  1JN5 B;  1MWR A;  2W6J H;  3EE1 A;  3S5C A;  3HIG A;  3NV0 A;  3M8C A;  1SAR A;  2YX9 A;  2J8X B;  4HOH A;  3CME 3;  1VQ9 3;  4EYC A;  5DRE A;  1B2Z A;  2K3D A;  2F98 A;  5DRV A;  3FF2 A;  1D6Y A;  2UUG C;  1AVL A;  3HZP A;  1LVN A;  2Y74 A;  1PFP A;  3CPW 2;  1IV9 A;  3X3X A;  1N8Q A;  2GU1 A;  2RCD A;  2UX0 A;  5IEN A;  1MWT A;  3NBB A;  1N5H A;  3IMA B;  5ELJ A;  1A90 A;  4HM0 B;  3LTD A;  1CH0 A;  4WYK B;  1A67 A;  2KF5 A;  1IVV A;  4NHF A;  3B4O A;  4I5Q A;  3EJV A;  3FSD A;  1JV2 B;  4U13 A;  3DGL A;  5CLK A;  3CCR 3;  1HYF A;  1D6U A;  4HM3 B;  5EEO A;  1BOX A;  1SQW A;  3G16 A;  3S67 A;  1MGR A;  2Y73 A;  1Y4K A;  2HMN B;  5IW9 A;  2BMO B;  5IEP A;  2AAE A;  2CWV A;  1BSE A;  4N3V A;  2F5W A;  3D9R A;  4WYK A;  3ZG0 A;  1UDI I;  3MYT A;  5G1L A;  1VQ5 3;  3LXU X;  3ZFZ A;  1W00 A;  2FGT A;  3CCV 3;  3OW2 2;  1YJW 3;  3CNX A;  1TUH A;  3X40 A;  4BIR A;  4XDV A;  1DYU A;  1DVD A;  1V74 A;  4EV5 A;  4BL2 A;  2GEY A;  2F56 A;  5AIG A;  4N6N B;  8CHO A;  1G0T A;  1QVF 2;  3EC9 A;  2JQ5 A;  3H3H A;  3D5G A;  2FXT A;  3K7C A;  4GL6 A;  4I4K A;  4H61 A;  3EN1 B;  1OPY A;  3OV4 A;  2A15 A;  2BO9 B;  1BNI A;  4HM8 B;  3B4P A;  1IK3 A;  2CK3 H;  3CCJ 3;  5G1K A;  3LTA A;  2CHC A;  4IT7 A;  3CCL 3;  1US1 A;  3N54 B;  2IUJ A;  1BGS A;  4CPK A;  2E2U A;  1LOV A;  1JJ2 2;  1YIT 3;  1VQM 3;  3LH4 A;  1M9G A;  2W2C A;  4OVM A;  3B7C A;  4XBT A;  7GSP A;  6STD A;  1NO3 A;  3NM2 A;  3I56 3;  1RN4 A;  1SPU A;  3FH1 A;  3UNL A;  1FUS A;  2CFL A;  3EF8 A;  2C10 A;  2Z7A A;  4FMC A;  1IU7 A;  1GS3 A;  9RNT A;  1JNQ A;  4K61 A;  1OF5 A;  1NU3 A;  3GZY B;  1PU4 A;  1JZO A;  3I0Y A;  5CK6 A;  2XRX B;  1BSA A;  1G96 A;  1TRQ A;  4HKV B;  8RNT A;  3EB8 A;  1LOX A;  1SIH A;  3MHE A;  6RNT A;  3CC7 3;  1O7W B;  1S5A A;  1O7H B;  3X3Y A;  4L8P A;  5IF6 A;  1TJD A;  1B2X A;  1A2K A;  1BIR A;  7STD A;  2F86 B;  4L8O A;  1DMM A;  2CFG A;  1OF5 B;  2P05 A;  3DH2 A;  5KP4 A;  3MWZ A;  1LNH A;  4WWU C;  3GZX B;  1QVG 2;  2OTJ 3;  2W9P A;  1GY7 A;  1M1X B;  1BRJ A;  1PY3 A;  1QMA A;  1CYV A;  3E99 A;  1LNI A;  4EW5 A;  1DMN A;  1ZS7 A;  1RSN A;  2K54 A;  1RNB A;  1NWW A;  2SAR A;  4NRE A;  5CF1 A;  1AVK A;  1JB2 A;  1SJW A;  1K73 4;  3CPO A;  5I97 A;  1MNL A;  4LMI A;  1ZGX A;  1BUQ A;  4K1V A;  1VQQ A;  3GAX A;  1B27 A;  1GOU A;  1O7N B;  1OCV A;  2H0G A;  3TDG A;  3U97 A;  3X3Z A;  1JB4 A;  3J7Y d;  3LT9 A;  3GRD A;  1QAL A;  5ELU A;  1RGK A;  1YNV X;  1S72 3;  2OQE C;  3RNT A;  2XSO B;  2MF7 A;  3BNC A;  3NBJ A;  3JUN A;  3FKA A;  1RGG A;  1K28 A;  1YVB I;  2HMM B;  5STD A;  1IQY A;  4WFO A;  4LYL B;  5RNT A;  2WGO A;  3LZA A;  3BLZ A;  1W02 A;  3X42 A;  3ROB A;  1RGH A;  3SX1 A;  4XM4 A;  1WMN A;  2Q07 A;  2H0I A;  2K0M A;  2O3O A;  3Q2P A;  3BNE A;  3Q3F A;  3AGO A;  4XBY A;  2CG1 A;  2KF4 A;  1EUI C;  5LC6 A;  1T2H A;  2CFK A;  5A0O B;  1GY6 A;  2JDI H;  3G6E 3;  4HZB B;  2QGU A;  3BNB A;  3ER7 A;  2STD A;  4HM4 B;  2W04 A;  4H3U A;  2HMK B;  3FG4 A;  3RGA A;  3KN4 A;  2CX0 A;  3GZR A;  4O8S A;  2Z77 A;  1QJG A;  1N5P A;  3DGN A;  3GZB A;  1W6C A;  1C7H A;  1JRQ A;  3F8X A;  1I70 A;  1FGM A;  1I3I A;  1LRA A;  2CH9 A;  3WA3 A;  1Q81 4;  1UCK A;  1GOY A;  1BNF A;  1AY7 A;  3F7X A;  1TIJ A;  5AYS C;  1OH0 A;  1FYS A;  2F99 A;  1EKM A;  2HMJ B;  3NQY A;  3ZG5 A;  1J2B A;  5D81 A;  4MMX B;  4RBN A;  4BTW A;  2BMQ B;  2E2V A;  2PZV A;  1ISK A;  4KFD A;  1W7C A;  3CCQ 3;  4R4K A;  3WOF B;  1I3F A;  2I9W A;  1BNJ A;  1ULJ B;  1ROV A;  1GSP A;  1KD1 4;  1BAO A;  3DGO A;  5BVB A;  4XB5 A;  3D5I A;  5IG3 A;  2GXF A;  1BAN A;  3GWR A;  3CXC 2;  3O8Y A;  5BXQ A;  3SXX A;  4ZM8 A;  1W2Z A;  3Q90 A;  2AAD A;  2BIR A;  2LYX A;  3A5E A;  1I0V A;  1Q40 A;  3HII A;  3UL5 A;  3NBR A;  4X2H A;  3NX0 A;  1RDS A;  4ORL A;  2WGQ A;  4L7K A;  1E97 A;  1OGX A;  4KT3 B;  2P38 A;  5AIF A;  1UCJ A;  5M19 A;  1NJI 4;  3FCS B;  3X41 A;  1MWS A;  2PNC A;  2KF3 A;  1OAC A;  1FGT A;  3F9S A;  1GD4 A;  1AQZ A; 
#chains in the Genus database with same CATH homology
 2XFS A;  3T0U A;  2OQE A;  4BTX A;  2P0M A;  1RJO A;  3KII A;  2OWP A;  3ALA A;  3WOD G;  3WA2 X;  3LOY A;  5HGR A;  3AMO A;  1CEW I;  3FLJ A;  1TU5 A;  2YFL B;  2FNQ A;  1OHO A;  4PEJ A;  3F14 A;  3H51 A;  3LYG A;  1OHP A;  4CDL A;  1M90 4;  3QRD A;  1VQK 3;  4KZ1 A;  3LT8 A;  1M1K 4;  3T8N A;  3MG3 A;  4J8T A;  3SOA A;  2M7O A;  3PXM A;  3G4S 3;  3PCS A;  5TGN A;  1K9M 4;  2IUK A;  2KCD A;  1Q86 4;  4RZM A;  1O7G B;  1EG9 B;  1RKY A;  1VZZ A;  2GEX A;  4X2O A;  2B24 B;  3L0R A;  4N6M A;  3CCM 3;  1HKX A;  1WMO A;  3KKG A;  2XF3 A;  4IIA A;  4XBX A;  2XSH B;  1JB5 A;  2IA7 A;  4MMY B;  4R80 A;  1VQ7 3;  3NXJ A;  4Q53 A;  3T8U A;  1Z1S A;  1O7P B;  5LC7 A;  2QA4 3;  2W9Q A;  2E2T A;  4AKY A;  1MOL A;  1CYU A;  3FG3 A;  5AI1 A;  3SED A;  2BHM A;  4FCM A;  5AII A;  3N9H A;  3JUP A;  3CCE 3;  2CFD A;  3CNM A;  5IER A;  1E3R A;  1Q82 4;  4EBG A;  1LXE A;  3G71 3;  3HK4 A;  3NHX A;  3DZL A;  2XFT A;  3MPH A;  1W6G A;  2KXG A;  3NV0 B;  1U8C B;  1FUW A;  2SBL A;  1F8N A;  3SLU A;  3U1W A;  4FMD A;  3BND A;  3ECF A;  1IDP A;  1DMQ A;  2L4V A;  3JUM A;  4BTY A;  1K41 A;  2W0Q A;  4N6U A;  1R4C A;  1RRL A;  2GU3 A;  1EQK A;  3JUO A;  5JPP A;  1KC8 4;  4WHA A;  2INX A;  3PZW A;  2OOV A;  1IT7 A;  5AIH A;  2YFI B;  4RNZ A;  3SVA A;  4FMA A;  2KRT A;  2HMO B;  3PYJ A;  1EA2 A;  4HBR A;  2CWT A;  4CCV A;  1A2V A;  2R4I A;  3OWY A;  3WOE B;  3CCU 3;  1FGQ A;  3KFQ C;  5KP3 A;  4MJD A;  1VQL 3;  3DY5 A;  3NM7 A;  2XH9 A;  4XDW A;  3EBT A;  1AV4 A;  1OGZ A;  1CQS A;  3FF0 A;  3G0K A;  4HM1 B;  1STF I;  2WO0 A;  4O2H A;  4IPB A;  1HU9 A;  1YJN 3;  2RGQ A;  5IG5 A;  4HZ9 B;  1Q7Y 4;  2CWU A;  4JRF A;  1VQN 3;  3STD A;  2ZDJ A;  1WNH A;  1W5Z A;  1UI8 A;  3CC4 3;  5IG0 A;  4KFF A;  2C11 A;  2Z76 A;  3OWS A;  1L5G B;  3PS8 A;  4R1K A;  2WOF A;  3FZW A;  1VQ8 3;  3LML A;  4RNY A;  4STD A;  2RSX A;  1YI2 3;  2P09 A;  3DM8 A;  1N9J A;  3OX9 A;  4GB5 A;  1NB3 I;  2V1L A;  3S27 A;  3EHC A;  1GY5 A;  1ROA A;  4R9K A;  3WDG B;  3CD6 3;  3IPT A;  3K0Z A;  1TFK A;  2CW9 A;  4JF8 A;  1WTH A;  3K9M C;  4HJL B;  1YJ9 3;  2O9U X;  1ASK A;  5FGO A;  2QEX 3;  3N8B A;  1QAK A;  1UI7 A;  1UW1 A;  4HM6 B;  4MEI A;  5EQL A;  5CXO A;  3EQQ B;  4HM5 B;  1ZX2 A;  3I55 3;  3S28 A;  1YHQ 3;  2BT3 A;  3MG2 A;  5IG4 A;  2CFW A;  3KSP A;  3BB9 A;  1GYB A;  5JPU A;  2RFR A;  1STD A;  2GBX B;  1OHS A;  1OUN A;  3V92 A;  3CMA 3;  1VQ4 3;  3NQZ A;  3B8L A;  2CC3 A;  2BMR B;  4LEH A;  4EV2 A;  5EVH A;  3LTC A;  1GD3 A;  3QK9 A;  2MC8 A;  3MG1 A;  5KP1 A;  1N9E A;  4R9L A;  4WP5 A;  2CG0 A;  1TFO A;  2ZL8 A;  2ML6 A;  3CU3 A;  3SOY A;  3F8H A;  1RN7 A;  3WMD A;  3UL6 A;  3PCR A;  3FGY A;  4HM7 B;  3EBY A;  1KSI A;  3HI7 A;  1IQ8 A;  3FG1 A;  4N6T A;  3VF1 A;  3UJM A;  1U5O A;  1YIJ 3;  1JKG A;  2W56 B;  1N8R 4;  4O02 B;  1WQL B;  1AR0 A;  3OXA A;  3G8Z A;  4QWT A;  1VQ6 3;  3K5T A;  1UUV B;  2OOV C;  1DVC A;  4HM2 B;  1FA3 A;  1W6Y A;  5AEU B;  3CC2 3;  2XGN A;  4FCZ A;  3V98 A;  4LZI A;  1ZO2 A;  5G2G A;  2LQV A;  2QIY A;  2D1W A;  4FR9 A;  3DMC A;  3RGR A;  3V99 A;  1IVX A;  1ULI B;  2ML5 A;  3JUQ A;  1SII A;  3F40 A;  3AMO B;  1JKG B;  2W56 A;  5CF2 A;  2BNG A;  3D3L A;  3DGM A;  4TX4 A;  1W2B 2;  4K90 B;  3NUV A;  1IV7 A;  2XGL A;  3VGN A;  5D83 A;  3OWU A;  4MMZ B;  4HYZ A;  4EXR A;  2OCT A;  1VQP 3;  3HX8 A;  3DUK A;  1KWI A;  2D42 A;  2P0X A;  2IMJ A;  3LTB A;  3Q1C A;  4AEQ A;  3EX9 A;  3F7S A;  4J9A A;  1TP6 A;  2XEP A;  1KQS 2;  3RDE A;  1NB5 I;  5AEW B;  1W01 A;  3MSO A;  2GBW B;  4FCJ A;  1QAF A;  2B1X B;  2YFJ B;  4AKZ A;  3A76 A;  3DXO A;  1T5Y A;  3K63 A;  3KSE D;  4FMB A;  1NDO B;  2Z6B A;  4KFE A;  4N6V 0;  3KE7 A;  5AYR B;  5IEO A;  3EN8 A;  4N6L A;  3PGB A;  4EC6 A;  1Q42 A;  5JBS A;  3JVC A;  4KVH A;  1O7M B;  2WOH A;  4LSO A;  4N6O B;  4OK0 A;  1E3V A;  4HVN A;  1D6Z A;  4K1U A;  1IVU A;  1VQO 3;  1JN5 A;  2HML B;  3CCS 3;  4LGQ A;  3S29 A;  1WMP A;  3KZT A;  1RRH A;  2OTL 3;  2CIU A;  1IVW A;  1FGO A;  4G1M B;  1UUW B;  2W03 A;  5D82 A;  3UB1 A;  2CKF B;  2XR8 B;  5FW5 A;  1FGR A;  3IJE B;  3MKI A;  4O3V A;  1K8A 4;  1IT8 A;  1Q40 B;  3VSY A;  1W4N A;  1YGE A;  1IQX A;  4OUQ A;  1JN5 B;  3EE1 A;  2W6J H;  3S5C A;  3HIG A;  3NV0 A;  3M8C A;  2YX9 A;  1VQ9 3;  3CME 3;  4EYC A;  5DRE A;  2F98 A;  5DRV A;  3FF2 A;  1D6Y A;  1AVL A;  3HZP A;  1LVN A;  2Y74 A;  1PFP A;  3CPW 2;  1IV9 A;  3X3X A;  1N8Q A;  2GU1 A;  2RCD A;  2UX0 A;  5IEN A;  3NBB A;  1N5H A;  3IMA B;  5ELJ A;  1A90 A;  4HM0 B;  3LTD A;  4WYK B;  1A67 A;  1IVV A;  4NHF A;  3B4O A;  3EJV A;  3FSD A;  1JV2 B;  4U13 A;  3DGL A;  5CLK A;  3CCR 3;  4HM3 B;  1D6U A;  5EEO A;  1SQW A;  3G16 A;  3S67 A;  2Y73 A;  1Y4K A;  2HMN B;  5IW9 A;  2BMO B;  5IEP A;  2CWV A;  4N3V A;  3D9R A;  4WYK A;  3MYT A;  1VQ5 3;  3LXU X;  1YJW 3;  1W00 A;  2FGT A;  3CCV 3;  3OW2 2;  3CNX A;  1TUH A;  3X40 A;  4XDV A;  1DYU A;  1DVD A;  1V74 A;  4EV5 A;  2GEY A;  5AIG A;  8CHO A;  4N6N B;  1QVF 2;  3EC9 A;  2JQ5 A;  3H3H A;  2FXT A;  3K7C A;  4GL6 A;  4I4K A;  4H61 A;  3EN1 B;  1OPY A;  3OV4 A;  2A15 A;  2BO9 B;  4HM8 B;  3B4P A;  1IK3 A;  2CK3 H;  3CCJ 3;  3LTA A;  2CHC A;  4IT7 A;  3CCL 3;  1US1 A;  3N54 B;  2IUJ A;  2E2U A;  1JJ2 2;  1YIT 3;  1VQM 3;  3LH4 A;  1M9G A;  2W2C A;  4OVM A;  3B7C A;  4XBT A;  3I56 3;  6STD A;  1NO3 A;  3NM2 A;  3FH1 A;  1SPU A;  3UNL A;  3EF8 A;  2CFL A;  2C10 A;  2Z7A A;  4FMC A;  1IU7 A;  1GS3 A;  1JNQ A;  4K61 A;  1OF5 A;  1NU3 A;  3GZY B;  1PU4 A;  3I0Y A;  5CK6 A;  2XRX B;  1G96 A;  4HKV B;  3EB8 A;  1LOX A;  1SIH A;  3MHE A;  3CC7 3;  1O7W B;  1S5A A;  1O7H B;  3X3Y A;  4L8P A;  5IF6 A;  1A2K A;  7STD A;  2F86 B;  4L8O A;  1DMM A;  2CFG A;  1OF5 B;  2P05 A;  5KP4 A;  3MWZ A;  1LNH A;  4WWU C;  3GZX B;  1QVG 2;  2OTJ 3;  2W9P A;  1GY7 A;  1M1X B;  1QMA A;  1CYV A;  3E99 A;  1DMN A;  2K54 A;  1NWW A;  4NRE A;  5CF1 A;  1AVK A;  1JB2 A;  1SJW A;  1K73 4;  3CPO A;  5I97 A;  1MNL A;  4LMI A;  1BUQ A;  4K1V A;  3GAX A;  1O7N B;  3TDG A;  1OCV A;  3U97 A;  3X3Z A;  1JB4 A;  3J7Y d;  3LT9 A;  3GRD A;  1QAL A;  5ELU A;  1S72 3;  2OQE C;  2XSO B;  2MF7 A;  3BNC A;  3NBJ A;  3JUN A;  3FKA A;  1K28 A;  1YVB I;  2HMM B;  5STD A;  1IQY A;  4WFO A;  2WGO A;  3LZA A;  3BLZ A;  1W02 A;  3X42 A;  3ROB A;  3SX1 A;  4XM4 A;  1WMN A;  2Q07 A;  3Q2P A;  2K0M A;  2O3O A;  3BNE A;  4XBY A;  2CG1 A;  5LC6 A;  2CFK A;  5A0O B;  3G6E 3;  1GY6 A;  2JDI H;  4HZB B;  2QGU A;  3BNB A;  3ER7 A;  2STD A;  4HM4 B;  2W04 A;  4H3U A;  2HMK B;  3FG4 A;  3RGA A;  3KN4 A;  3GZR A;  4O8S A;  2Z77 A;  1QJG A;  1N5P A;  3DGN A;  3GZB A;  1W6C A;  1C7H A;  1JRQ A;  3F8X A;  1FGM A;  2CH9 A;  3WA3 A;  1Q81 4;  3F7X A;  1TIJ A;  5AYS C;  1OH0 A;  2F99 A;  1EKM A;  2HMJ B;  3NQY A;  1J2B A;  5D81 A;  4MMX B;  4RBN A;  4BTW A;  2BMQ B;  2E2V A;  2PZV A;  1ISK A;  4KFD A;  1W7C A;  3CCQ 3;  4R4K A;  3WOF B;  2I9W A;  1ULJ B;  1ROV A;  1KD1 4;  3DGO A;  5BVB A;  4XB5 A;  5IG3 A;  2GXF A;  3GWR A;  3CXC 2;  3O8Y A;  5BXQ A;  3SXX A;  4ZM8 A;  1W2Z A;  3Q90 A;  2LYX A;  1Q40 A;  3HII A;  3UL5 A;  3NBR A;  4X2H A;  3NX0 A;  4ORL A;  2WGQ A;  4L7K A;  1E97 A;  1OGX A;  2P38 A;  5AIF A;  1NJI 4;  3FCS B;  3X41 A;  2PNC A;  1OAC A;  1FGT A;  3F9S A;  1GD4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...