4R4KA

Crystal structure of a cystatin-like protein (baccac_01506) from bacteroides caccae atcc 43185 at 1.69 a resolution
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
151
structure length
151
Chain Sequence
b'EIAQSGEDFKSFLDKFTSSAAFQYTRIKFPLKTPITLLADDGETEKTFPFTKEKWPLLDSETMKEERIEQEEGGIYVSKFTLNEPVHKVFEAGYEESEIDLRVEFEQAADGKWYVVDCYTGWYGYDLPIGELKQTIQQVKEENAAFKEIHP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of a hypothetical protein (BACCAC_01506) from Bacteroides caccae ATCC 43185 at 1.69 A resolution
rcsb
source organism Bacteroides caccae
molecule tags Structural genomics, unknown function
total genus 44
structure length 151
sequence length 151
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.410 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4r4kA00
2ML6A 4R4KA 2ML5A
chains in the Genus database with same CATH superfamily
4K61A 3NBJA 1DMQA 3G0KA 2D42A 1D6UA 1NB3I 3NBRA 1W01A 1MGRA 1X1XA 1VQQA 5BIRA 3QK9A 1B21A 3GZYB 4LSOA 1CYVA 3NV0B 3EF8A 1O7MB 1BNEA 3I553 1KC84 1GS3A 1IVWA 2IA7A 4LEHA 1TIJA 1JKGA 3FLJA 5A0OB 2QA43 1OHOA 2UGIA 1IQ8A 2F98A 5BXQA 1BAOA 2WOFA 4K90B 4LYLB 4BTWA 4FCJA 4JF8A 5EVHA 1SIHA 1NU3A 1OH0A 2WOHA 4ZM8A 2RGQA 1C7HA 1BNSA 2CH9A 3DM8A 4QWTA 4I5QA 1ZS7A 1R4CA 3Q90A 1YI23 1G02A 1OPYA 1RGGA 5CF2A 1ROAA 1DMMA 1DETA 1ZGXA 1A2VA 3S28A 1VQ73 1MWSA 1WMNA 2GBXB 3KN4A 1X1WA 4HVNA 1N8QA 1RRHA 1GY5A 1SARA 4HJLB 1YGWA 1EG9B 5FGOA 4LMIA 2F4YA 7GSPA 2CFLA 5IF6A 1AVKA 4CJNA 3KFQC 4HM0B 5IW9A 2RCDA 1BSCA 1RGCA 2XGLA 3V99A 1QMAA 1G0TA 2WO0A 1LOWA 4GL6A 3SLUA 1JJ22 3ECFA 2K54A 3NM7A 2OQEA 1IVXA 2F5MA 1PY3A 1T3BA 5IG4A 3UJMA 3HIIA 1LNIA 1EKMA 1PFPA 3DGLA 3CXC2 3NQZA 4HBRA 1K28A 1QVG2 1BGSA 3I0YA 4BIRA 3EHCA 1FGTA 1VZZA 4MMYB 4U13A 1JN5A 3X41A 4L7KA 2GEYA 1B20A 3GZBA 1N8R4 1LXEA 1LVNA 2WGOA 1IQXA 2MF7A 5AI1A 2FXTA 1WTHA 4KFDA 2YFIB 3GZXB 2Z6BA 3CPW2 1RGKA 3CCQ3 1AQZA 2BMRB 1JZDA 3ZG0A 1YGEA 1TTOA 4STDA 1LOYA 3BNEA 4XBXA 1QJGA 1JBTA 3EBYA 1N5PA 1US1A 2ML5A 2ZHXB 1UUWB 3X3YA 1VQ83 1BRSA 2CX1A 1GMPA 1K8A4 1NO3A 3OW22 3NV0A 2F56A 3FCSB 3SVAA 3K0ZA 1UI8A 1E97A 3BNDA 1RMSA 2H0IA 3NUVA 1X1UA 5D83A 3B8LA 3EN1B 3DGOA 4FMBA 4FR9A 2C10A 1RNTA 1BSDA 2BMQB 3H3HA 2F86B 3X3XA 1WMOA 1AVLA 1SIIA 1Z1SA 1EA2A 1RGFA 3D4AA 1M904 5CK6A 1D6ZA 5RNTA 3FF0A 3PCSA 4FMDA 1ROVA 4EW5A 3BLZA 3RNTA 3NX0A 4EBGA 1Q9EA 2Z7AA 3CCR3 2W9PA 3DGMA 1K9M4 1ZO2A 1UUGB 3UL6A 1HU9A 4K1UA 3CPOA 5IEOA 3CCS3 2LYXA 2W0QA 2XFTA 3AGOA 2OTJ3 1CEWI 1O7GB 3OWYA 4HM4B 3CCL3 1A90A 2OTL3 2BU4A 3DGYA 3HX8A 1MWTA 3UB1A 1SQWA 5G1KA 4R9KA 1BUJA 1BNGA 1STDA 2CIUA 1V58A 3I563 3F9SA 3TDGA 1LQMB 1VQP3 3DZLA 1YJN3 1HYFA 2KCDA 1YNVX 2M7OA 2HMNB 2KAAA 3D3LA 3WDGB 4KFFA 3S67A 3CC43 1E3RA 1UW1A 1T2IA 3F40A 3Q1CA 1BSBA 5LC7A 1VQK3 4AEQA 1A67A 1RGEA 1W6GA 4O02B 1JNQA 3WR2A 1TRPA 3T0UA 1RJOA 3EC9A 4XBYA 2Y73A 2W56B 2XGNA 2E2UA 1W00A 2R4IA 5G2GA 4MMXB 3EQQB 4R80A 3OV4A 1OGZA 1OCVA 2W03A 1V74A 2W9QA 3Q2PA 1PU4A 3GSPA 1RTUA 3HI7A 3LH4A 4HM3B 3BB9A 5AYSC 4N6UA 1Q824 1LOVA 3WA3A 3UL5A 2OQEC 4Q53A 7RNTA 5D81A 4CPKA 1RNBA 1Q7Y4 1GMQA 1JB2A 4O2HA 1F8NA 4WYKB 2GSPA 1BNFA 4RNYA 2CFKA 3MSOA 3B4PA 3V92A 4PEJA 1JBSA 1FZUA 1W7CA 4WP5A 2P05A 4FMAA 5G1LA 1EEJA 4MEIA 3IPTA 3URPA 4XDWA 2PNCA 1WQLB 4H3UA 3FKAA 1FYSA 1BRJA 1ULJB 1LRAA 3OWSA 4J8TA 1A2KA 1TUHA 1AY7A 1IVUA 3CNXA 2P0XA 3LMLA 3EX9A 1BSEA 3PXMA 1W5ZA 2STDA 3J7Yd 1JV2B 4NHFA 4HM7B 3EE1A 5BU4A 7STDA 1IU7A 3ZFZA 4I4KA 2QEX3 2GBWB 1SPUA 5AIFA 1S723 4HYZA 5ELJA 3CCV3 2QGUA 2GU3A 1A2PA 1BNJA 1B2XA 1JB4A 3AMOB 1IV9A 2OWPA 4LZIA 1IVVA 3GZRA 2E2TA 3DH2A 4K1VA 3JUPA 1FGRA 1GY6A 2GU1A 3U1WA 1BRIA 2KF4A 3EBTA 4GSPA 3FZWA 1OF5B 1VQM3 1M9GA 3ER7A 2CFDA 3LT9A 5IERA 1FUSA 1GOVA 2C11A 3CC73 1I2FA 4HM5B 1QAFA 1MNLA 1YJW3 1GOYA 8RNTA 4H61A 2H0HA 4MMZB 3CCJ3 1NWWA 5ELUA 1BANA 2UX0A 1I0VA 5M18A 1Q40B 1UGHI 4FCZA 3CMA3 3PCRA 1UCKA 3K63A 1VQL3 1QAKA 1X1YA 1DYUA 4J9AA 3MWZA 3LZAA 3N9HA 1JB5A 1W2ZA 1NDOB 4XDVA 1JBRA 2YFJB 3FG1A 4ILFA 5M1AA 1W4NA 4BL3A 1G96A 4BL2A 2OCTA 2BIRA 3KE7A 1BRGA 2W56A 5KP3A 4LGQA 2CFGA 2O3OA 1ZX2A 1FA3A 1Q814 3RDEA 1O7WB 5IG5A 2AAEA 2OOVA 1OHSA 5KP4A 1FW7A 3PGBA 2O9UX 3MYTA 1GD4A 3DGNA 1TRQA 1W6YA 1DE3A 5LC6A 4IIAA 4WHAA 1Q864 2B1XB 4HM6B 2BHMA 2HMKB 2CK3H 3KCHA 3FG4A 3L0RA 3PS8A 4WYKA 5AYRB 1C54A 3ALAA 1NJI4 1I3IA 3U97A 1YHQ3 1TFKA 3SX1A 3VGNA 1RDSA 2KF5A 3V98A 1HKXA 1T2HA 2H0GA 1KWIA 3BIRA 3FGYA 5IG0A 1IDPA 4CDLA 2L4VA 2WGQA 4XM4A 1RSNA 1IT8A 2HMOB 2KRTA 3F8XA 1GD3A 4N6NB 3T8UA 1I2GA 4XB5A 4N3VA 2F5WA 2CG1A 1UDII 4EV2A 3G6E3 4BU4A 1FUWA 3HZPA 3O8YA 1AR0A 1OGXA 2GXFA 9RNTA 5DRVA 1E3VA 1RN7A 3BNBA 1BRNL 4HM2B 3LTAA 2PZVA 1RGLA 3JVCA 5IENA 1VQ63 4HOHA 4OK0A 2XR8B 1Y4KA 2XF3A 4JRFA 3PZWA 3AMOA 2I9WA 3G8ZA 4HKVB 4FCMA 3CC23 3MG1A 1Q7HA 1MWUA 1M1K4 1IV7A 3GWRA 4N6TA 2UUGC 3JUQA 3CME3 4G1MB 4R9LA 1K734 1KQS2 1AV4A 3CD63 1YVBI 3VSYA 2P09A 4ORLA 3DUKA 1M1XB 6GSPA 1OHPA 1UI7A 2A15A 3LTBA 3CCE3 1PYLA 3Q3FA 4N6MA 2K3DA 1K41A 1BSAA 1STFI 1NB5I 4RNZA 5STDA 1OUNA 4KT3B 1DMNA 1O7PB 4XBTA 4R4KA 5IG3A 3EJVA 5JBSA 4WFOA 1BRKA 3ROBA 2Z76A 3GAXA 2D1WA 3FH1A 5CXOA 3RGAA 1YJ93 3STDA 1I70A 4N6OB 4AKZA 4NPBA 1B2ZA 1KSIA 1OACA 3F7XA 3M8CA 2E2VA 4HZBB 4IPBA 2RBIA 2KF6A 2SARA 2CKFB 2BMOB 4X2HA 1MOLA 2LQVA 2RFRA 2RSXA 3AHWA 1UCLA 4MJDA 3S5CA 1VQ43 2CFWA 5HOHA 1CH0A 1LQGC 2IY2A 3X42A 1TU5A 3NQYA 1RCKA 4N6LA 2QIYA 2CWUA 3FSDA 2R41A 3CCM3 2HOHA 1QVF2 3K5TA 1RGAA 4AKYA 8CHOA 5JPPA 2XSHB 1UCIA 3S29A 3G4S3 1BIRA 1VQ53 3MPHA 3MKIA 1N5HA 2JQ5A 3QRDA 2P38A 1MGWA 1GYBA 2INXA 1GOUA 5HGRA 3G16A 3WA2X 3MG3A 4TX4A 4HAAA 1GY7A 4FMCA 2CW9A 3IMAB 4KZ1A 3T8NA 6RNTA 1RHLA 1KD14 1DVDA 1I0XA 3OWUA 3RGRA 2W2CA 3X3ZA 1TJDA 3SOYA 3CCU3 1ULIB 2Y74A 1FGMA 1U8CB 3N8BA 1ASKA 4BTXA 1RCLA 2OOVC 1YIJ3 2K0MA 1RLSA 3KZTA 1IQYA 5KP1A 1NNVA 1FGQA 2J8XB 3LXUX 1T5YA 2BO9B 5CLKA 1B2MA 2ZL8A 3LYGA 4GB5A 3WOEB 1WNHA 4OVMA 3WHOA 4EC6A 3DMCA 3HOHA 5AIIA 5AEUB 1GMRA 1W6CA 3FG3A 1O7HB 3F14A 1BRHA 1V57A 1L5GB 5BVBA 1BOXA 3N54B 3CNMA 3OX9A 2FNQA 5AIGA 1SJWA 1Q42A 3LTDA 3NM2A 4HM1B 3EN8A 2IUJA 3F7SA 4R1KA 2ML6A 2HMMB 1I2EA 1R4YA 2F99A 1UUVB 2KXGA 4HM8B 5FW5A 3LTCA 2W6JH 4EV5A 2CWVA 2XSOB 5AEWB 5DREA 1DVCA 5JPUA 2CHCA 3F8HA 1JRQA 2C4BA 2CX0A 3WODG 1FUTA 5EEOA 3EB8A 1O7NB 2B24B 2Z77A 3DY5A 2HMJB 1CYUA 1JKGB 2KF3A 3KSPA 3NXJA 5IEPA 1B3SA 3JUOA 2YX9A 3G713 2FGTA 5D82A 3A5EA 1RN1A 4L8OA 2AADA 1BU4A 1N9EA 3NBBA 4RNTA 3SYUA 3KIIA 1LOXA 4DKIA 4RZMA 4EXRA 3DXOA 4GHOA 4OUQA 3HIGA 1J2BA 3KKGA 1IYYA 2GEXA 3HK4A 4J5GA 4NREA 3ZG5A 3BU4A 1D6YA 3GRDA 1GSPA 1I3FA 1MWRA 3D5GA 2ZA4A 2XEPA 3LT8A 2SBLA 2IYJA 1RRLA 4O8SA 2V1LA 2ZDJA 1YVSA 3WMDA 5AIHA 1BVIA 4EYCA 1BUQA 5I97A 3B4OA 2L1SA 4X2OA 1B27A 3WOFB 1UGIA 2XRXB 4CCVA 1QALA 1U5OA 4KFEA 1JZOA 3B7CA 2Q07A 1RGHA 3NHXA 5M19A 1RKYA 5GSPA 4WWUC 3JUMA 3KSED 1ISKA 4O3VA 3X40A 3E99A 3CU3A 4RBNA 5EQLA 2BT3A 6STDA 1BNIA 5CF1A 1RN4A 3MHEA 3OXAA 3D79A 2MC8A 3MG2A 1UCJA 3K9MC 2BNGA 3VF1A 2W04A 3H51A 1OF5A 2CWTA 1HZ1A 3D9RA 3FF2A 1CQSA 4J5KA 2XH9A 1EUIC 1I8VA 3SEDA 3UNLA 2IMJA 2CG0A 3SXXA 4BTYA 4IT7A 4KVHA 1B2UA 3PYJA 1VQ93 3K7CA 1FGOA 1JN5B 1EQKA 1YIT3 1WMPA 3AHSA 3A76A 3LOYA 1N9JA 2CC3A 4N6V0 2JDIH 1LNHA 2RNTA 1TP6A 3D5IA 3IJEB 3S27A 1Q40A 2XFSA 4L8PA 2IUKA 5TGNA 3BNCA 3SOAA 1BNRA 1S5AA 1IT7A 1VQO3 1B2SA 3AGNA 4HZ9B 2HMLB 2P0MA 1VQN3 1IK3A 3JUNA 2YFLB 1W02A 1W2B2 1TFOA
chains in the Genus database with same CATH topology
4K61A 3NBJA 1DMQA 3G0KA 2D42A 1D6UA 1NB3I 3NBRA 1W01A 3QK9A 3GZYB 4LSOA 1CYVA 3NV0B 3EF8A 1O7MB 3I553 1KC84 1GS3A 1IVWA 2IA7A 4LEHA 1TIJA 1JKGA 3FLJA 5A0OB 2QA43 1OHOA 1IQ8A 2F98A 5BXQA 2WOFA 4K90B 4BTWA 4FCJA 4JF8A 5EVHA 1SIHA 1NU3A 1OH0A 2WOHA 4ZM8A 2RGQA 1C7HA 2CH9A 3DM8A 4QWTA 1R4CA 3Q90A 1YI23 1OPYA 5CF2A 1ROAA 1DMMA 1A2VA 3S28A 1VQ73 1WMNA 2GBXB 3KN4A 4HVNA 1N8QA 1RRHA 1GY5A 4HJLB 1EG9B 5FGOA 4LMIA 2CFLA 5IF6A 1AVKA 3KFQC 4HM0B 5IW9A 2RCDA 2XGLA 3V99A 1QMAA 2WO0A 4GL6A 3SLUA 1JJ22 3ECFA 2K54A 3NM7A 2OQEA 1IVXA 5IG4A 3UJMA 3HIIA 1EKMA 1PFPA 3DGLA 3CXC2 3NQZA 4HBRA 1K28A 1QVG2 3I0YA 3EHCA 1FGTA 1VZZA 4MMYB 4U13A 1JN5A 3X41A 4L7KA 2GEYA 3GZBA 1N8R4 1LXEA 1LVNA 2WGOA 1IQXA 2MF7A 5AI1A 2FXTA 1WTHA 4KFDA 2YFIB 3GZXB 2Z6BA 3CPW2 3CCQ3 2BMRB 1YGEA 4STDA 3BNEA 4XBXA 1QJGA 3EBYA 1N5PA 1US1A 2ML5A 1VQ83 1UUWB 3X3YA 1K8A4 1NO3A 3OW22 3NV0A 3FCSB 3SVAA 3K0ZA 1UI8A 1E97A 3BNDA 3NUVA 5D83A 3B8LA 3EN1B 3DGOA 4FMBA 4FR9A 2C10A 2BMQB 3H3HA 2F86B 3X3XA 1WMOA 1AVLA 1SIIA 1Z1SA 1EA2A 1M904 5CK6A 1D6ZA 3FF0A 3PCSA 4FMDA 1ROVA 3BLZA 3NX0A 4EBGA 2Z7AA 3CCR3 2W9PA 3DGMA 1K9M4 1ZO2A 3UL6A 1HU9A 4K1UA 3CPOA 5IEOA 3CCS3 2LYXA 2W0QA 2XFTA 2OTJ3 1CEWI 1O7GB 3OWYA 4HM4B 3CCL3 1A90A 2OTL3 3HX8A 3UB1A 1SQWA 4R9KA 1STDA 2CIUA 3I563 3F9SA 3TDGA 1VQP3 3DZLA 1YJN3 2KCDA 2M7OA 2HMNB 3D3LA 3WDGB 4KFFA 3S67A 3CC43 1E3RA 1UW1A 3F40A 3Q1CA 1VQK3 5LC7A 4AEQA 1A67A 1W6GA 4O02B 1JNQA 3T0UA 1RJOA 3EC9A 4XBYA 2Y73A 2W56B 2XGNA 2E2UA 1W00A 2R4IA 5G2GA 4MMXB 3EQQB 4R80A 3OV4A 1OGZA 1OCVA 2W03A 1V74A 2W9QA 3Q2PA 1PU4A 4HM3B 3HI7A 3LH4A 3BB9A 5AYSC 4N6UA 1Q824 3WA3A 3UL5A 2OQEC 4Q53A 5D81A 1Q7Y4 1JB2A 4O2HA 1F8NA 4WYKB 4RNYA 3V92A 2CFKA 3MSOA 3B4PA 4PEJA 1W7CA 4WP5A 2P05A 4FMAA 4MEIA 3IPTA 4XDWA 2PNCA 1WQLB 4H3UA 3FKAA 1ULJB 3OWSA 4J8TA 1A2KA 1TUHA 1IVUA 3CNXA 3PXMA 2P0XA 3LMLA 3EX9A 1W5ZA 2STDA 3J7Yd 1JV2B 4NHFA 4HM7B 3EE1A 7STDA 2QEX3 1IU7A 4I4KA 2GBWB 1SPUA 5AIFA 1S723 4HYZA 5ELJA 3CCV3 2QGUA 2GU3A 3AMOB 1JB4A 1IV9A 2OWPA 4LZIA 1IVVA 3GZRA 2E2TA 4K1VA 3JUPA 1FGRA 1GY6A 2GU1A 3U1WA 3EBTA 3FZWA 1OF5B 1VQM3 1M9GA 3ER7A 2CFDA 3LT9A 5IERA 2C11A 3CC73 4HM5B 1QAFA 1MNLA 1YJW3 4H61A 4MMZB 3CCJ3 1NWWA 5ELUA 2UX0A 1Q40B 4FCZA 3CMA3 3PCRA 3K63A 1VQL3 1QAKA 1DYUA 4J9AA 3MWZA 3LZAA 3N9HA 1JB5A 1W2ZA 1NDOB 4XDVA 2YFJB 3FG1A 1W4NA 1G96A 2OCTA 3KE7A 2W56A 5KP3A 4LGQA 2CFGA 2O3OA 1ZX2A 1FA3A 1Q814 3RDEA 1O7WB 5IG5A 2OOVA 1OHSA 5KP4A 3PGBA 2O9UX 3MYTA 1GD4A 3DGNA 1W6YA 5LC6A 4IIAA 4WHAA 1Q864 2B1XB 4HM6B 2BHMA 2HMKB 2CK3H 3L0RA 3FG4A 3PS8A 4WYKA 5AYRB 3ALAA 1NJI4 3U97A 1YHQ3 1TFKA 3SX1A 3VGNA 3V98A 1HKXA 1KWIA 3FGYA 5IG0A 1IDPA 4CDLA 2L4VA 2WGQA 4XM4A 1IT8A 2HMOB 2KRTA 3F8XA 1GD3A 4N6NB 3T8UA 4XB5A 4N3VA 4EV2A 2CG1A 3G6E3 1FUWA 3HZPA 3O8YA 1AR0A 1OGXA 2GXFA 5DRVA 1E3VA 1RN7A 3BNBA 4HM2B 3LTAA 2PZVA 1VQ63 3JVCA 5IENA 4OK0A 2XR8B 1Y4KA 2XF3A 4JRFA 3PZWA 3AMOA 2I9WA 3G8ZA 4HKVB 4FCMA 3CC23 3MG1A 1M1K4 1IV7A 3GWRA 4N6TA 3JUQA 3CME3 4G1MB 4R9LA 1K734 1KQS2 1AV4A 3CD63 1YVBI 3VSYA 2P09A 4ORLA 3DUKA 1M1XB 1OHPA 1UI7A 2A15A 3LTBA 3CCE3 4N6MA 1NB5I 1K41A 1STFI 4RNZA 5STDA 1OUNA 1DMNA 1O7PB 4XBTA 4R4KA 5IG3A 3EJVA 5JBSA 4WFOA 3ROBA 2Z76A 3GAXA 2D1WA 3FH1A 5CXOA 3RGAA 1YJ93 3STDA 4N6OB 4AKZA 4HZBB 1KSIA 1OACA 3F7XA 3M8CA 2E2VA 4IPBA 2CKFB 2BMOB 4X2HA 1MOLA 2LQVA 2RFRA 2RSXA 4MJDA 3S5CA 1VQ43 2CFWA 3X42A 1TU5A 3NQYA 4N6LA 2QIYA 2CWUA 3FSDA 3CCM3 1QVF2 3K5TA 4AKYA 8CHOA 5JPPA 2XSHB 3S29A 3G4S3 1VQ53 3MPHA 3MKIA 1N5HA 2JQ5A 3QRDA 2P38A 2INXA 1GYBA 5HGRA 3G16A 3WA2X 3MG3A 4TX4A 1GY7A 4FMCA 2CW9A 3IMAB 4KZ1A 3T8NA 1KD14 1DVDA 3RGRA 3OWUA 2W2CA 3X3ZA 3SOYA 3CCU3 1ULIB 2Y74A 1FGMA 1U8CB 3N8BA 1ASKA 4BTXA 2OOVC 1YIJ3 2K0MA 3KZTA 5KP1A 1IQYA 1FGQA 3LXUX 1T5YA 2BO9B 5CLKA 2ZL8A 3LYGA 4GB5A 3WOEB 1WNHA 4OVMA 4EC6A 3DMCA 5AIIA 5AEUB 1W6CA 3FG3A 1O7HB 3F14A 1L5GB 5BVBA 3N54B 3CNMA 3OX9A 2FNQA 5AIGA 1SJWA 1Q42A 3LTDA 3NM2A 4HM1B 3EN8A 2IUJA 3F7SA 4R1KA 2ML6A 2HMMB 2F99A 1UUVB 2KXGA 4HM8B 5FW5A 3LTCA 2W6JH 4EV5A 2CWVA 2XSOB 5AEWB 5DREA 1DVCA 5JPUA 2CHCA 3F8HA 1JRQA 3WODG 5EEOA 3EB8A 1O7NB 2B24B 2Z77A 3DY5A 2HMJB 1CYUA 1JKGB 3KSPA 3NXJA 5IEPA 3JUOA 2YX9A 3G713 2FGTA 5D82A 4L8OA 1N9EA 3NBBA 3KIIA 1LOXA 4RZMA 4EXRA 3DXOA 4OUQA 3HIGA 1J2BA 3KKGA 2GEXA 3HK4A 4NREA 1D6YA 3GRDA 2XEPA 3LT8A 2SBLA 1RRLA 4O8SA 2V1LA 2ZDJA 3WMDA 5AIHA 4EYCA 1BUQA 5I97A 3B4OA 4X2OA 3WOFB 2XRXB 4CCVA 1QALA 1U5OA 4KFEA 3B7CA 2Q07A 3NHXA 1RKYA 4WWUC 3JUMA 3KSED 1ISKA 4O3VA 3X40A 3E99A 3CU3A 4RBNA 5EQLA 2BT3A 6STDA 5CF1A 3MHEA 3OXAA 2MC8A 3MG2A 3K9MC 2BNGA 3VF1A 2W04A 3H51A 1OF5A 2CWTA 3D9RA 3FF2A 1CQSA 2XH9A 3SEDA 3UNLA 2IMJA 2CG0A 3SXXA 4BTYA 4IT7A 4KVHA 3PYJA 1VQ93 3K7CA 1FGOA 1JN5B 1EQKA 1YIT3 1WMPA 3A76A 3LOYA 1N9JA 2CC3A 4N6V0 2JDIH 1LNHA 1TP6A 3IJEB 3S27A 1Q40A 2XFSA 4L8PA 2IUKA 5TGNA 3BNCA 3SOAA 1S5AA 1IT7A 1VQO3 4HZ9B 2HMLB 2P0MA 1VQN3 1IK3A 3JUNA 2YFLB 1W02A 1W2B2 1TFOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ML6 A;  4R4K A;  2ML5 A; 
#chains in the Genus database with same CATH topology
 4K61 A;  3NBJ A;  1DMQ A;  3G0K A;  2D42 A;  1D6U A;  1NB3 I;  3NBR A;  1W01 A;  1MGR A;  1X1X A;  1VQQ A;  5BIR A;  3QK9 A;  1B21 A;  3GZY B;  4LSO A;  1CYV A;  3NV0 B;  3EF8 A;  1O7M B;  1BNE A;  3I55 3;  1KC8 4;  1GS3 A;  1IVW A;  2IA7 A;  4LEH A;  1TIJ A;  1JKG A;  3FLJ A;  5A0O B;  2QA4 3;  1OHO A;  2UGI A;  1IQ8 A;  2F98 A;  5BXQ A;  1BAO A;  2WOF A;  4K90 B;  4LYL B;  4BTW A;  4FCJ A;  4JF8 A;  5EVH A;  1SIH A;  1NU3 A;  1OH0 A;  2WOH A;  4ZM8 A;  2RGQ A;  1C7H A;  1BNS A;  2CH9 A;  3DM8 A;  4QWT A;  4I5Q A;  1ZS7 A;  1R4C A;  3Q90 A;  1YI2 3;  1G02 A;  1OPY A;  1RGG A;  5CF2 A;  1ROA A;  1DMM A;  1DET A;  1ZGX A;  1A2V A;  3S28 A;  1VQ7 3;  1MWS A;  1WMN A;  2GBX B;  3KN4 A;  1X1W A;  4HVN A;  1N8Q A;  1RRH A;  1GY5 A;  1SAR A;  4HJL B;  1YGW A;  1EG9 B;  5FGO A;  4LMI A;  2F4Y A;  7GSP A;  2CFL A;  5IF6 A;  1AVK A;  4CJN A;  3KFQ C;  4HM0 B;  5IW9 A;  2RCD A;  1BSC A;  1RGC A;  2XGL A;  3V99 A;  1QMA A;  1G0T A;  2WO0 A;  1LOW A;  4GL6 A;  3SLU A;  1JJ2 2;  3ECF A;  2K54 A;  3NM7 A;  2OQE A;  1IVX A;  2F5M A;  1PY3 A;  1T3B A;  5IG4 A;  3UJM A;  3HII A;  1LNI A;  1EKM A;  1PFP A;  3DGL A;  3CXC 2;  3NQZ A;  4HBR A;  1K28 A;  1QVG 2;  1BGS A;  3I0Y A;  4BIR A;  3EHC A;  1FGT A;  1VZZ A;  4MMY B;  4U13 A;  1JN5 A;  3X41 A;  4L7K A;  2GEY A;  1B20 A;  3GZB A;  1N8R 4;  1LXE A;  1LVN A;  2WGO A;  1IQX A;  2MF7 A;  5AI1 A;  2FXT A;  1WTH A;  4KFD A;  2YFI B;  3GZX B;  2Z6B A;  3CPW 2;  1RGK A;  3CCQ 3;  1AQZ A;  2BMR B;  1JZD A;  3ZG0 A;  1YGE A;  1TTO A;  4STD A;  1LOY A;  3BNE A;  4XBX A;  1QJG A;  1JBT A;  3EBY A;  1N5P A;  1US1 A;  2ML5 A;  2ZHX B;  1UUW B;  3X3Y A;  1VQ8 3;  1BRS A;  2CX1 A;  1GMP A;  1K8A 4;  1NO3 A;  3OW2 2;  3NV0 A;  2F56 A;  3FCS B;  3SVA A;  3K0Z A;  1UI8 A;  1E97 A;  3BND A;  1RMS A;  2H0I A;  3NUV A;  1X1U A;  5D83 A;  3B8L A;  3EN1 B;  3DGO A;  4FMB A;  4FR9 A;  2C10 A;  1RNT A;  1BSD A;  2BMQ B;  3H3H A;  2F86 B;  3X3X A;  1WMO A;  1AVL A;  1SII A;  1Z1S A;  1EA2 A;  1RGF A;  3D4A A;  1M90 4;  5CK6 A;  1D6Z A;  5RNT A;  3FF0 A;  3PCS A;  4FMD A;  1ROV A;  4EW5 A;  3BLZ A;  3RNT A;  3NX0 A;  4EBG A;  1Q9E A;  2Z7A A;  3CCR 3;  2W9P A;  3DGM A;  1K9M 4;  1ZO2 A;  1UUG B;  3UL6 A;  1HU9 A;  4K1U A;  3CPO A;  5IEO A;  3CCS 3;  2LYX A;  2W0Q A;  2XFT A;  3AGO A;  2OTJ 3;  1CEW I;  1O7G B;  3OWY A;  4HM4 B;  3CCL 3;  1A90 A;  2OTL 3;  2BU4 A;  3DGY A;  3HX8 A;  1MWT A;  3UB1 A;  1SQW A;  5G1K A;  4R9K A;  1BUJ A;  1BNG A;  1STD A;  2CIU A;  1V58 A;  3I56 3;  3F9S A;  3TDG A;  1LQM B;  1VQP 3;  3DZL A;  1YJN 3;  1HYF A;  2KCD A;  1YNV X;  2M7O A;  2HMN B;  2KAA A;  3D3L A;  3WDG B;  4KFF A;  3S67 A;  3CC4 3;  1E3R A;  1UW1 A;  1T2I A;  3F40 A;  3Q1C A;  1BSB A;  5LC7 A;  1VQK 3;  4AEQ A;  1A67 A;  1RGE A;  1W6G A;  4O02 B;  1JNQ A;  3WR2 A;  1TRP A;  3T0U A;  1RJO A;  3EC9 A;  4XBY A;  2Y73 A;  2W56 B;  2XGN A;  2E2U A;  1W00 A;  2R4I A;  5G2G A;  4MMX B;  3EQQ B;  4R80 A;  3OV4 A;  1OGZ A;  1OCV A;  2W03 A;  1V74 A;  2W9Q A;  3Q2P A;  1PU4 A;  3GSP A;  1RTU A;  3HI7 A;  3LH4 A;  4HM3 B;  3BB9 A;  5AYS C;  4N6U A;  1Q82 4;  1LOV A;  3WA3 A;  3UL5 A;  2OQE C;  4Q53 A;  7RNT A;  5D81 A;  4CPK A;  1RNB A;  1Q7Y 4;  1GMQ A;  1JB2 A;  4O2H A;  1F8N A;  4WYK B;  2GSP A;  1BNF A;  4RNY A;  2CFK A;  3MSO A;  3B4P A;  3V92 A;  4PEJ A;  1JBS A;  1FZU A;  1W7C A;  4WP5 A;  2P05 A;  4FMA A;  5G1L A;  1EEJ A;  4MEI A;  3IPT A;  3URP A;  4XDW A;  2PNC A;  1WQL B;  4H3U A;  3FKA A;  1FYS A;  1BRJ A;  1ULJ B;  1LRA A;  3OWS A;  4J8T A;  1A2K A;  1TUH A;  1AY7 A;  1IVU A;  3CNX A;  2P0X A;  3LML A;  3EX9 A;  1BSE A;  3PXM A;  1W5Z A;  2STD A;  3J7Y d;  1JV2 B;  4NHF A;  4HM7 B;  3EE1 A;  5BU4 A;  7STD A;  1IU7 A;  3ZFZ A;  4I4K A;  2QEX 3;  2GBW B;  1SPU A;  5AIF A;  1S72 3;  4HYZ A;  5ELJ A;  3CCV 3;  2QGU A;  2GU3 A;  1A2P A;  1BNJ A;  1B2X A;  1JB4 A;  3AMO B;  1IV9 A;  2OWP A;  4LZI A;  1IVV A;  3GZR A;  2E2T A;  3DH2 A;  4K1V A;  3JUP A;  1FGR A;  1GY6 A;  2GU1 A;  3U1W A;  1BRI A;  2KF4 A;  3EBT A;  4GSP A;  3FZW A;  1OF5 B;  1VQM 3;  1M9G A;  3ER7 A;  2CFD A;  3LT9 A;  5IER A;  1FUS A;  1GOV A;  2C11 A;  3CC7 3;  1I2F A;  4HM5 B;  1QAF A;  1MNL A;  1YJW 3;  1GOY A;  8RNT A;  4H61 A;  2H0H A;  4MMZ B;  3CCJ 3;  1NWW A;  5ELU A;  1BAN A;  2UX0 A;  1I0V A;  5M18 A;  1Q40 B;  1UGH I;  4FCZ A;  3CMA 3;  3PCR A;  1UCK A;  3K63 A;  1VQL 3;  1QAK A;  1X1Y A;  1DYU A;  4J9A A;  3MWZ A;  3LZA A;  3N9H A;  1JB5 A;  1W2Z A;  1NDO B;  4XDV A;  1JBR A;  2YFJ B;  3FG1 A;  4ILF A;  5M1A A;  1W4N A;  4BL3 A;  1G96 A;  4BL2 A;  2OCT A;  2BIR A;  3KE7 A;  1BRG A;  2W56 A;  5KP3 A;  4LGQ A;  2CFG A;  2O3O A;  1ZX2 A;  1FA3 A;  1Q81 4;  3RDE A;  1O7W B;  5IG5 A;  2AAE A;  2OOV A;  1OHS A;  5KP4 A;  1FW7 A;  3PGB A;  2O9U X;  3MYT A;  1GD4 A;  3DGN A;  1TRQ A;  1W6Y A;  1DE3 A;  5LC6 A;  4IIA A;  4WHA A;  1Q86 4;  2B1X B;  4HM6 B;  2BHM A;  2HMK B;  2CK3 H;  3KCH A;  3FG4 A;  3L0R A;  3PS8 A;  4WYK A;  5AYR B;  1C54 A;  3ALA A;  1NJI 4;  1I3I A;  3U97 A;  1YHQ 3;  1TFK A;  3SX1 A;  3VGN A;  1RDS A;  2KF5 A;  3V98 A;  1HKX A;  1T2H A;  2H0G A;  1KWI A;  3BIR A;  3FGY A;  5IG0 A;  1IDP A;  4CDL A;  2L4V A;  2WGQ A;  4XM4 A;  1RSN A;  1IT8 A;  2HMO B;  2KRT A;  3F8X A;  1GD3 A;  4N6N B;  3T8U A;  1I2G A;  4XB5 A;  4N3V A;  2F5W A;  2CG1 A;  1UDI I;  4EV2 A;  3G6E 3;  4BU4 A;  1FUW A;  3HZP A;  3O8Y A;  1AR0 A;  1OGX A;  2GXF A;  9RNT A;  5DRV A;  1E3V A;  1RN7 A;  3BNB A;  1BRN L;  4HM2 B;  3LTA A;  2PZV A;  1RGL A;  3JVC A;  5IEN A;  1VQ6 3;  4HOH A;  4OK0 A;  2XR8 B;  1Y4K A;  2XF3 A;  4JRF A;  3PZW A;  3AMO A;  2I9W A;  3G8Z A;  4HKV B;  4FCM A;  3CC2 3;  3MG1 A;  1Q7H A;  1MWU A;  1M1K 4;  1IV7 A;  3GWR A;  4N6T A;  2UUG C;  3JUQ A;  3CME 3;  4G1M B;  4R9L A;  1K73 4;  1KQS 2;  1AV4 A;  3CD6 3;  1YVB I;  3VSY A;  2P09 A;  4ORL A;  3DUK A;  1M1X B;  6GSP A;  1OHP A;  1UI7 A;  2A15 A;  3LTB A;  3CCE 3;  1PYL A;  3Q3F A;  4N6M A;  2K3D A;  1K41 A;  1BSA A;  1STF I;  1NB5 I;  4RNZ A;  5STD A;  1OUN A;  4KT3 B;  1DMN A;  1O7P B;  4XBT A;  4R4K A;  5IG3 A;  3EJV A;  5JBS A;  4WFO A;  1BRK A;  3ROB A;  2Z76 A;  3GAX A;  2D1W A;  3FH1 A;  5CXO A;  3RGA A;  1YJ9 3;  3STD A;  1I70 A;  4N6O B;  4AKZ A;  4NPB A;  1B2Z A;  1KSI A;  1OAC A;  3F7X A;  3M8C A;  2E2V A;  4HZB B;  4IPB A;  2RBI A;  2KF6 A;  2SAR A;  2CKF B;  2BMO B;  4X2H A;  1MOL A;  2LQV A;  2RFR A;  2RSX A;  3AHW A;  1UCL A;  4MJD A;  3S5C A;  1VQ4 3;  2CFW A;  5HOH A;  1CH0 A;  1LQG C;  2IY2 A;  3X42 A;  1TU5 A;  3NQY A;  1RCK A;  4N6L A;  2QIY A;  2CWU A;  3FSD A;  2R41 A;  3CCM 3;  2HOH A;  1QVF 2;  3K5T A;  1RGA A;  4AKY A;  8CHO A;  5JPP A;  2XSH B;  1UCI A;  3S29 A;  3G4S 3;  1BIR A;  1VQ5 3;  3MPH A;  3MKI A;  1N5H A;  2JQ5 A;  3QRD A;  2P38 A;  1MGW A;  1GYB A;  2INX A;  1GOU A;  5HGR A;  3G16 A;  3WA2 X;  3MG3 A;  4TX4 A;  4HAA A;  1GY7 A;  4FMC A;  2CW9 A;  3IMA B;  4KZ1 A;  3T8N A;  6RNT A;  1RHL A;  1KD1 4;  1DVD A;  1I0X A;  3OWU A;  3RGR A;  2W2C A;  3X3Z A;  1TJD A;  3SOY A;  3CCU 3;  1ULI B;  2Y74 A;  1FGM A;  1U8C B;  3N8B A;  1ASK A;  4BTX A;  1RCL A;  2OOV C;  1YIJ 3;  2K0M A;  1RLS A;  3KZT A;  1IQY A;  5KP1 A;  1NNV A;  1FGQ A;  2J8X B;  3LXU X;  1T5Y A;  2BO9 B;  5CLK A;  1B2M A;  2ZL8 A;  3LYG A;  4GB5 A;  3WOE B;  1WNH A;  4OVM A;  3WHO A;  4EC6 A;  3DMC A;  3HOH A;  5AII A;  5AEU B;  1GMR A;  1W6C A;  3FG3 A;  1O7H B;  3F14 A;  1BRH A;  1V57 A;  1L5G B;  5BVB A;  1BOX A;  3N54 B;  3CNM A;  3OX9 A;  2FNQ A;  5AIG A;  1SJW A;  1Q42 A;  3LTD A;  3NM2 A;  4HM1 B;  3EN8 A;  2IUJ A;  3F7S A;  4R1K A;  2ML6 A;  2HMM B;  1I2E A;  1R4Y A;  2F99 A;  1UUV B;  2KXG A;  4HM8 B;  5FW5 A;  3LTC A;  2W6J H;  4EV5 A;  2CWV A;  2XSO B;  5AEW B;  5DRE A;  1DVC A;  5JPU A;  2CHC A;  3F8H A;  1JRQ A;  2C4B A;  2CX0 A;  3WOD G;  1FUT A;  5EEO A;  3EB8 A;  1O7N B;  2B24 B;  2Z77 A;  3DY5 A;  2HMJ B;  1CYU A;  1JKG B;  2KF3 A;  3KSP A;  3NXJ A;  5IEP A;  1B3S A;  3JUO A;  2YX9 A;  3G71 3;  2FGT A;  5D82 A;  3A5E A;  1RN1 A;  4L8O A;  2AAD A;  1BU4 A;  1N9E A;  3NBB A;  4RNT A;  3SYU A;  3KII A;  1LOX A;  4DKI A;  4RZM A;  4EXR A;  3DXO A;  4GHO A;  4OUQ A;  3HIG A;  1J2B A;  3KKG A;  1IYY A;  2GEX A;  3HK4 A;  4J5G A;  4NRE A;  3ZG5 A;  3BU4 A;  1D6Y A;  3GRD A;  1GSP A;  1I3F A;  1MWR A;  3D5G A;  2ZA4 A;  2XEP A;  3LT8 A;  2SBL A;  2IYJ A;  1RRL A;  4O8S A;  2V1L A;  2ZDJ A;  1YVS A;  3WMD A;  5AIH A;  1BVI A;  4EYC A;  1BUQ A;  5I97 A;  3B4O A;  2L1S A;  4X2O A;  1B27 A;  3WOF B;  1UGI A;  2XRX B;  4CCV A;  1QAL A;  1U5O A;  4KFE A;  1JZO A;  3B7C A;  2Q07 A;  1RGH A;  3NHX A;  5M19 A;  1RKY A;  5GSP A;  4WWU C;  3JUM A;  3KSE D;  1ISK A;  4O3V A;  3X40 A;  3E99 A;  3CU3 A;  4RBN A;  5EQL A;  2BT3 A;  6STD A;  1BNI A;  5CF1 A;  1RN4 A;  3MHE A;  3OXA A;  3D79 A;  2MC8 A;  3MG2 A;  1UCJ A;  3K9M C;  2BNG A;  3VF1 A;  2W04 A;  3H51 A;  1OF5 A;  2CWT A;  1HZ1 A;  3D9R A;  3FF2 A;  1CQS A;  4J5K A;  2XH9 A;  1EUI C;  1I8V A;  3SED A;  3UNL A;  2IMJ A;  2CG0 A;  3SXX A;  4BTY A;  4IT7 A;  4KVH A;  1B2U A;  3PYJ A;  1VQ9 3;  3K7C A;  1FGO A;  1JN5 B;  1EQK A;  1YIT 3;  1WMP A;  3AHS A;  3A76 A;  3LOY A;  1N9J A;  2CC3 A;  4N6V 0;  2JDI H;  1LNH A;  2RNT A;  1TP6 A;  3D5I A;  3IJE B;  3S27 A;  1Q40 A;  2XFS A;  4L8P A;  2IUK A;  5TGN A;  3BNC A;  3SOA A;  1BNR A;  1S5A A;  1IT7 A;  1VQO 3;  1B2S A;  3AGN A;  4HZ9 B;  2HML B;  2P0M A;  1VQN 3;  1IK3 A;  3JUN A;  2YFL B;  1W02 A;  1W2B 2;  1TFO A; 
#chains in the Genus database with same CATH homology
 4K61 A;  3NBJ A;  1DMQ A;  3G0K A;  2D42 A;  1D6U A;  1NB3 I;  3NBR A;  1W01 A;  3QK9 A;  3GZY B;  4LSO A;  1CYV A;  3NV0 B;  3EF8 A;  1O7M B;  3I55 3;  1KC8 4;  1GS3 A;  1IVW A;  2IA7 A;  4LEH A;  1TIJ A;  1JKG A;  3FLJ A;  5A0O B;  2QA4 3;  1OHO A;  1IQ8 A;  2F98 A;  5BXQ A;  2WOF A;  4K90 B;  4BTW A;  4FCJ A;  4JF8 A;  5EVH A;  1SIH A;  1NU3 A;  1OH0 A;  2WOH A;  4ZM8 A;  2RGQ A;  1C7H A;  2CH9 A;  3DM8 A;  4QWT A;  1R4C A;  3Q90 A;  1YI2 3;  1OPY A;  5CF2 A;  1ROA A;  1DMM A;  1A2V A;  3S28 A;  1VQ7 3;  1WMN A;  2GBX B;  3KN4 A;  4HVN A;  1N8Q A;  1RRH A;  1GY5 A;  4HJL B;  1EG9 B;  5FGO A;  4LMI A;  2CFL A;  5IF6 A;  1AVK A;  3KFQ C;  4HM0 B;  5IW9 A;  2RCD A;  2XGL A;  3V99 A;  1QMA A;  2WO0 A;  4GL6 A;  3SLU A;  1JJ2 2;  3ECF A;  2K54 A;  3NM7 A;  2OQE A;  1IVX A;  5IG4 A;  3UJM A;  3HII A;  1EKM A;  1PFP A;  3DGL A;  3CXC 2;  3NQZ A;  4HBR A;  1K28 A;  1QVG 2;  3I0Y A;  3EHC A;  1FGT A;  1VZZ A;  4MMY B;  4U13 A;  1JN5 A;  3X41 A;  4L7K A;  2GEY A;  3GZB A;  1N8R 4;  1LXE A;  1LVN A;  2WGO A;  1IQX A;  2MF7 A;  5AI1 A;  2FXT A;  1WTH A;  4KFD A;  2YFI B;  3GZX B;  2Z6B A;  3CPW 2;  3CCQ 3;  2BMR B;  1YGE A;  4STD A;  3BNE A;  4XBX A;  1QJG A;  3EBY A;  1N5P A;  1US1 A;  2ML5 A;  1VQ8 3;  1UUW B;  3X3Y A;  1K8A 4;  1NO3 A;  3OW2 2;  3NV0 A;  3FCS B;  3SVA A;  3K0Z A;  1UI8 A;  1E97 A;  3BND A;  3NUV A;  5D83 A;  3B8L A;  3EN1 B;  3DGO A;  4FMB A;  4FR9 A;  2C10 A;  2BMQ B;  3H3H A;  2F86 B;  3X3X A;  1WMO A;  1AVL A;  1SII A;  1Z1S A;  1EA2 A;  1M90 4;  5CK6 A;  1D6Z A;  3FF0 A;  3PCS A;  4FMD A;  1ROV A;  3BLZ A;  3NX0 A;  4EBG A;  2Z7A A;  3CCR 3;  2W9P A;  3DGM A;  1K9M 4;  1ZO2 A;  3UL6 A;  1HU9 A;  4K1U A;  3CPO A;  5IEO A;  3CCS 3;  2LYX A;  2W0Q A;  2XFT A;  2OTJ 3;  1CEW I;  1O7G B;  3OWY A;  4HM4 B;  3CCL 3;  1A90 A;  2OTL 3;  3HX8 A;  3UB1 A;  1SQW A;  4R9K A;  1STD A;  2CIU A;  3I56 3;  3F9S A;  3TDG A;  1VQP 3;  3DZL A;  1YJN 3;  2KCD A;  2M7O A;  2HMN B;  3D3L A;  3WDG B;  4KFF A;  3S67 A;  3CC4 3;  1E3R A;  1UW1 A;  3F40 A;  3Q1C A;  1VQK 3;  5LC7 A;  4AEQ A;  1A67 A;  1W6G A;  4O02 B;  1JNQ A;  3T0U A;  1RJO A;  3EC9 A;  4XBY A;  2Y73 A;  2W56 B;  2XGN A;  2E2U A;  1W00 A;  2R4I A;  5G2G A;  4MMX B;  3EQQ B;  4R80 A;  3OV4 A;  1OGZ A;  1OCV A;  2W03 A;  1V74 A;  2W9Q A;  3Q2P A;  1PU4 A;  4HM3 B;  3HI7 A;  3LH4 A;  3BB9 A;  5AYS C;  4N6U A;  1Q82 4;  3WA3 A;  3UL5 A;  2OQE C;  4Q53 A;  5D81 A;  1Q7Y 4;  1JB2 A;  4O2H A;  1F8N A;  4WYK B;  4RNY A;  3V92 A;  2CFK A;  3MSO A;  3B4P A;  4PEJ A;  1W7C A;  4WP5 A;  2P05 A;  4FMA A;  4MEI A;  3IPT A;  4XDW A;  2PNC A;  1WQL B;  4H3U A;  3FKA A;  1ULJ B;  3OWS A;  4J8T A;  1A2K A;  1TUH A;  1IVU A;  3CNX A;  3PXM A;  2P0X A;  3LML A;  3EX9 A;  1W5Z A;  2STD A;  3J7Y d;  1JV2 B;  4NHF A;  4HM7 B;  3EE1 A;  7STD A;  2QEX 3;  1IU7 A;  4I4K A;  2GBW B;  1SPU A;  5AIF A;  1S72 3;  4HYZ A;  5ELJ A;  3CCV 3;  2QGU A;  2GU3 A;  3AMO B;  1JB4 A;  1IV9 A;  2OWP A;  4LZI A;  1IVV A;  3GZR A;  2E2T A;  4K1V A;  3JUP A;  1FGR A;  1GY6 A;  2GU1 A;  3U1W A;  3EBT A;  3FZW A;  1OF5 B;  1VQM 3;  1M9G A;  3ER7 A;  2CFD A;  3LT9 A;  5IER A;  2C11 A;  3CC7 3;  4HM5 B;  1QAF A;  1MNL A;  1YJW 3;  4H61 A;  4MMZ B;  3CCJ 3;  1NWW A;  5ELU A;  2UX0 A;  1Q40 B;  4FCZ A;  3CMA 3;  3PCR A;  3K63 A;  1VQL 3;  1QAK A;  1DYU A;  4J9A A;  3MWZ A;  3LZA A;  3N9H A;  1JB5 A;  1W2Z A;  1NDO B;  4XDV A;  2YFJ B;  3FG1 A;  1W4N A;  1G96 A;  2OCT A;  3KE7 A;  2W56 A;  5KP3 A;  4LGQ A;  2CFG A;  2O3O A;  1ZX2 A;  1FA3 A;  1Q81 4;  3RDE A;  1O7W B;  5IG5 A;  2OOV A;  1OHS A;  5KP4 A;  3PGB A;  2O9U X;  3MYT A;  1GD4 A;  3DGN A;  1W6Y A;  5LC6 A;  4IIA A;  4WHA A;  1Q86 4;  2B1X B;  4HM6 B;  2BHM A;  2HMK B;  2CK3 H;  3L0R A;  3FG4 A;  3PS8 A;  4WYK A;  5AYR B;  3ALA A;  1NJI 4;  3U97 A;  1YHQ 3;  1TFK A;  3SX1 A;  3VGN A;  3V98 A;  1HKX A;  1KWI A;  3FGY A;  5IG0 A;  1IDP A;  4CDL A;  2L4V A;  2WGQ A;  4XM4 A;  1IT8 A;  2HMO B;  2KRT A;  3F8X A;  1GD3 A;  4N6N B;  3T8U A;  4XB5 A;  4N3V A;  4EV2 A;  2CG1 A;  3G6E 3;  1FUW A;  3HZP A;  3O8Y A;  1AR0 A;  1OGX A;  2GXF A;  5DRV A;  1E3V A;  1RN7 A;  3BNB A;  4HM2 B;  3LTA A;  2PZV A;  1VQ6 3;  3JVC A;  5IEN A;  4OK0 A;  2XR8 B;  1Y4K A;  2XF3 A;  4JRF A;  3PZW A;  3AMO A;  2I9W A;  3G8Z A;  4HKV B;  4FCM A;  3CC2 3;  3MG1 A;  1M1K 4;  1IV7 A;  3GWR A;  4N6T A;  3JUQ A;  3CME 3;  4G1M B;  4R9L A;  1K73 4;  1KQS 2;  1AV4 A;  3CD6 3;  1YVB I;  3VSY A;  2P09 A;  4ORL A;  3DUK A;  1M1X B;  1OHP A;  1UI7 A;  2A15 A;  3LTB A;  3CCE 3;  4N6M A;  1NB5 I;  1K41 A;  1STF I;  4RNZ A;  5STD A;  1OUN A;  1DMN A;  1O7P B;  4XBT A;  4R4K A;  5IG3 A;  3EJV A;  5JBS A;  4WFO A;  3ROB A;  2Z76 A;  3GAX A;  2D1W A;  3FH1 A;  5CXO A;  3RGA A;  1YJ9 3;  3STD A;  4N6O B;  4AKZ A;  4HZB B;  1KSI A;  1OAC A;  3F7X A;  3M8C A;  2E2V A;  4IPB A;  2CKF B;  2BMO B;  4X2H A;  1MOL A;  2LQV A;  2RFR A;  2RSX A;  4MJD A;  3S5C A;  1VQ4 3;  2CFW A;  3X42 A;  1TU5 A;  3NQY A;  4N6L A;  2QIY A;  2CWU A;  3FSD A;  3CCM 3;  1QVF 2;  3K5T A;  4AKY A;  8CHO A;  5JPP A;  2XSH B;  3S29 A;  3G4S 3;  1VQ5 3;  3MPH A;  3MKI A;  1N5H A;  2JQ5 A;  3QRD A;  2P38 A;  2INX A;  1GYB A;  5HGR A;  3G16 A;  3WA2 X;  3MG3 A;  4TX4 A;  1GY7 A;  4FMC A;  2CW9 A;  3IMA B;  4KZ1 A;  3T8N A;  1KD1 4;  1DVD A;  3RGR A;  3OWU A;  2W2C A;  3X3Z A;  3SOY A;  3CCU 3;  1ULI B;  2Y74 A;  1FGM A;  1U8C B;  3N8B A;  1ASK A;  4BTX A;  2OOV C;  1YIJ 3;  2K0M A;  3KZT A;  5KP1 A;  1IQY A;  1FGQ A;  3LXU X;  1T5Y A;  2BO9 B;  5CLK A;  2ZL8 A;  3LYG A;  4GB5 A;  3WOE B;  1WNH A;  4OVM A;  4EC6 A;  3DMC A;  5AII A;  5AEU B;  1W6C A;  3FG3 A;  1O7H B;  3F14 A;  1L5G B;  5BVB A;  3N54 B;  3CNM A;  3OX9 A;  2FNQ A;  5AIG A;  1SJW A;  1Q42 A;  3LTD A;  3NM2 A;  4HM1 B;  3EN8 A;  2IUJ A;  3F7S A;  4R1K A;  2ML6 A;  2HMM B;  2F99 A;  1UUV B;  2KXG A;  4HM8 B;  5FW5 A;  3LTC A;  2W6J H;  4EV5 A;  2CWV A;  2XSO B;  5AEW B;  5DRE A;  1DVC A;  5JPU A;  2CHC A;  3F8H A;  1JRQ A;  3WOD G;  5EEO A;  3EB8 A;  1O7N B;  2B24 B;  2Z77 A;  3DY5 A;  2HMJ B;  1CYU A;  1JKG B;  3KSP A;  3NXJ A;  5IEP A;  3JUO A;  2YX9 A;  3G71 3;  2FGT A;  5D82 A;  4L8O A;  1N9E A;  3NBB A;  3KII A;  1LOX A;  4RZM A;  4EXR A;  3DXO A;  4OUQ A;  3HIG A;  1J2B A;  3KKG A;  2GEX A;  3HK4 A;  4NRE A;  1D6Y A;  3GRD A;  2XEP A;  3LT8 A;  2SBL A;  1RRL A;  4O8S A;  2V1L A;  2ZDJ A;  3WMD A;  5AIH A;  4EYC A;  1BUQ A;  5I97 A;  3B4O A;  4X2O A;  3WOF B;  2XRX B;  4CCV A;  1QAL A;  1U5O A;  4KFE A;  3B7C A;  2Q07 A;  3NHX A;  1RKY A;  4WWU C;  3JUM A;  3KSE D;  1ISK A;  4O3V A;  3X40 A;  3E99 A;  3CU3 A;  4RBN A;  5EQL A;  2BT3 A;  6STD A;  5CF1 A;  3MHE A;  3OXA A;  2MC8 A;  3MG2 A;  3K9M C;  2BNG A;  3VF1 A;  2W04 A;  3H51 A;  1OF5 A;  2CWT A;  3D9R A;  3FF2 A;  1CQS A;  2XH9 A;  3SED A;  3UNL A;  2IMJ A;  2CG0 A;  3SXX A;  4BTY A;  4IT7 A;  4KVH A;  3PYJ A;  1VQ9 3;  3K7C A;  1FGO A;  1JN5 B;  1EQK A;  1YIT 3;  1WMP A;  3A76 A;  3LOY A;  1N9J A;  2CC3 A;  4N6V 0;  2JDI H;  1LNH A;  1TP6 A;  3IJE B;  3S27 A;  1Q40 A;  2XFS A;  4L8P A;  2IUK A;  5TGN A;  3BNC A;  3SOA A;  1S5A A;  1IT7 A;  1VQO 3;  4HZ9 B;  2HML B;  2P0M A;  1VQN 3;  1IK3 A;  3JUN A;  2YFL B;  1W02 A;  1W2B 2;  1TFO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...