4R4KA

Crystal structure of a cystatin-like protein (baccac_01506) from bacteroides caccae atcc 43185 at 1.69 a resolution
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
151
structure length
151
Chain Sequence
EIAQSGEDFKSFLDKFTSSAAFQYTRIKFPLKTPITLLADDGETEKTFPFTKEKWPLLDSETMKEERIEQEEGGIYVSKFTLNEPVHKVFEAGYEESEIDLRVEFEQAADGKWYVVDCYTGWYGYDLPIGELKQTIQQVKEENAAFKEIHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of a hypothetical protein (BACCAC_01506) from Bacteroides caccae ATCC 43185 at 1.69 A resolution
rcsb
source organism Bacteroides caccae
molecule tags Structural genomics, unknown function
total genus 44
structure length 151
sequence length 151
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.410 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4r4kA00
2ML5A 4R4KA 2ML6A
chains in the Genus database with same CATH superfamily
4BTWA 2OTJ3 4KT3B 1GS3A 1FGQA 4MJDA 1BNFA 4WHAA 1I3IA 3FG3A 3U97A 3NBBA 4U13A 3BB9A 3JUOA 3X3ZA 1TRQA 1TTOA 2W0QA 1JB5A 5AYSC 1OPYA 3RGAA 1I2EA 1JN5A 5LC6A 1BRHA 3KKGA 2BMQB 3FF0A 3BNBA 2CX0A 3GRDA 1FZUA 2CIUA 3LTCA 3AGNA 4KFFA 5FGOA 1FUTA 2I9WA 2XEPA 8RNTA 1I8VA 2GBWB 2RGQA 2P05A 2XGNA 5IG3A 1EG9B 3G0KA 4GSPA 2UGIA 3BNCA 5AEUB 3LH4A 4KFDA 3S27A 4Q53A 1N9JA 5KP4A 3OW22 1LVNA 3JUQA 1W00A 1JZOA 3LOYA 3NUVA 5TGNA 4XM4A 1LOVA 1ASKA 1I2FA 1BRSA 3EN8A 2QA43 1CYUA 5GSPA 2BNGA 4RNYA 1YJ93 1EA2A 2V1LA 2PNCA 1GMQA 4BTYA 5D81A 5KP3A 2B24B 1US1A 3SX1A 1UDII 2XH9A 1N5PA 4KVHA 2E2UA 2OQEC 5EEOA 2E2VA 3DGOA 1IYYA 1K8A4 1HKXA 3SVAA 1Q7Y4 1RCLA 4L7KA 1IT7A 2H0GA 4BL2A 2SARA 4EW5A 3CPW2 1I2GA 5AI1A 1GD3A 2J8XB 1JZDA 2Y74A 3G6E3 1DMNA 1RCKA 4HJLB 2GEYA 2CFGA 1BAOA 1RGHA 2W56B 2P09A 1BGSA 1A2PA 3JVCA 4DKIA 1UI7A 1UCIA 3DGNA 1K9M4 3EJVA 2Z76A 2W2CA 4K61A 3VGNA 4XDWA 3EQQB 4K1UA 8CHOA 1QVG2 3EX9A 1IQYA 3PZWA 1YIT3 1YGWA 1K41A 1QJGA 3LZAA 2STDA 1RNBA 1NDOB 1V58A 1AV4A 1RGFA 3CD63 4HKVB 1DVDA 4HZBB 1PU4A 3GZYB 3NV0A 1MGRA 4HM5B 1GSPA 2GU1A 4LZIA 4QWTA 1GMRA 1FA3A 1EEJA 4MMZB 3X40A 3LTBA 5M19A 5D83A 3V99A 3CNMA 1LNHA 4O2HA 3ZG5A 2Y73A 3D5GA 1FUSA 3NM7A 3GWRA 1VQN3 1GOVA 4XBXA 1SQWA 3MKIA 1E97A 1O7MB 2F86B 1A90A 2WO0A 1MWSA 1WMPA 2CWVA 1VQ53 3CCM3 2YFJB 3S67A 3GZRA 2CWTA 1TFOA 2MC8A 3FZWA 2F4YA 3DXOA 4FCMA 4WP5A 3X3YA 1BUQA 3AMOB 1BRJA 1YVBI 3PCSA 4HM3B 3UJMA 3WR2A 2BMOB 1Z1SA 3LYGA 1FW7A 1BVIA 1TJDA 2GSPA 4BU4A 4WFOA 3FSDA 5STDA 1QAKA 3KE7A 5M1AA 1J2BA 4K90B 1EKMA 1FGMA 5DREA 4R1KA 4AEQA 1O7HB 4J5KA 3PYJA 3IJEB 3NXJA 1HYFA 3K5TA 1ZGXA 2HMKB 3F8HA 2ZHXB 2ML6A 4HM8B 3VSYA 4HM6B 4N6LA 3CCS3 2K3DA 1B2SA 3B4OA 5RNTA 1RGGA 1YI23 1FGTA 1BSCA 1S723 5G1KA 1DE3A 1IVVA 1HU9A 1OH0A 3O8YA 4JRFA 2OWPA 1RGCA 2CKFB 3E99A 1VQP3 2XGLA 3B8LA 5IEOA 3ZG0A 1TFKA 1W6GA 2Q07A 3NHXA 4HBRA 2K54A 1N8R4 1BUJA 1OHPA 1SIIA 3Q3FA 1M9GA 1X1YA 4L8PA 1B2XA 2E2TA 1JN5B 3A5EA 1SJWA 4J9AA 3I0YA 4XBYA 1UCJA 2ZDJA 5ELUA 3D4AA 5FW5A 1JKGA 7STDA 1BSEA 1G96A 4NREA 1QAFA 6GSPA 2F5WA 1ROVA 2KF5A 2XR8B 3OX9A 1B2MA 3GZXB 1GY7A 1UCLA 1G02A 1BSDA 3N54B 1RTUA 3CXC2 1VQK3 3JUPA 3CMA3 1LXEA 4XBTA 1RKYA 2ML5A 3OWUA 1YJW3 1IVUA 1BNIA 1GOUA 4EV5A 3WOEB 1IVWA 3H51A 1BRKA 4IPBA 1X1XA 5KP1A 2JQ5A 3EBYA 3HI7A 4HVNA 1UUVB 3D9RA 4H3UA 1B2ZA 5IERA 1W2B2 1BNRA 3FG4A 1AVLA 2W03A 4O3VA 3CME3 7GSPA 3SYUA 4NHFA 1UW1A 3FGYA 1DMMA 1WQLB 5DRVA 4FCZA 3STDA 1I0XA 1O7WB 1AQZA 1RHLA 1MWRA 1LNIA 2HMJB 1LOWA 1M904 1MWTA 4STDA 1VQ73 1LQGC 1MOLA 1BRNL 2PZVA 1B2UA 2INXA 3EE1A 3FG1A 3A76A 1BNGA 4EC6A 1N9EA 3KIIA 3GSPA 4MMYB 1IK3A 4XB5A 4WWUC 2BO9B 1OHOA 3LTDA 3K7CA 3U1WA 2CW9A 1BRIA 1Q40A 2WGOA 3DGMA 3PXMA 1RSNA 5D82A 4BTXA 2C4BA 5JBSA 2HMNB 1V57A 2P0XA 1FUWA 1O7PB 5IENA 3WA3A 1CYVA 1TP6A 1DYUA 1W6YA 1OHSA 3NX0A 1L5GB 1OCVA 2A15A 3HIIA 4ORLA 1NWWA 2QIYA 3LXUX 2F99A 2KF6A 4RNZA 3RGRA 2L1SA 3FF2A 2OCTA 3BLZA 3K0ZA 1ISKA 1MGWA 4LEHA 4HM0B 2AAEA 1LOYA 3S5CA 1RNTA 2HMLB 3EC9A 1BRGA 1VQL3 3BNDA 4LMIA 2RFRA 1TUHA 2YX9A 4ILFA 4N6MA 3WDGB 4HZ9B 1UGHI 2O9UX 5LC7A 1NB3I 4WYKA 2CC3A 2IMJA 3MG2A 1JBSA 1DMQA 1M1K4 4R4KA 3G4S3 3K63A 3NV0B 1VQ43 3N9HA 1BANA 1W7CA 2W9PA 3BNEA 3KSPA 4KFEA 3WA2X 1N8QA 2RBIA 3SOYA 3MHEA 1FYSA 3BIRA 4RZMA 1X1UA 2SBLA 3LMLA 2KXGA 1NJI4 4H61A 2W04A 1T2HA 1OF5A 2ZL8A 4RBNA 2KAAA 4CDLA 3GAXA 1UUWB 1EQKA 4FCJA 7RNTA 3UL5A 3J7Yd 2BMRB 2CK3H 1KWIA 2XSOB 1STFI 1E3VA 1GY6A 2Z7AA 3CU3A 3IPTA 1R4YA 3EBTA 3UL6A 4CCVA 1GYBA 1A2KA 3WMDA 2K0MA 2WGQA 5EQLA 3OXAA 3CPOA 2IYJA 3AHWA 1FGOA 3CCE3 1RRHA 1C54A 3AHSA 4EBGA 1GOYA 1FGRA 2WOHA 3CCU3 1OACA 2D1WA 1YHQ3 1DETA 1BNJA 1OGXA 3LT9A 2UUGC 3NBJA 3PS8A 4AKYA 1GD4A 1W6CA 2KF4A 4N6NB 1NO3A 4N6UA 4HM1B 4HYZA 5CF1A 1JB4A 3T8UA 2D42A 1VQO3 5CXOA 3CC23 3PCRA 4GHOA 3MYTA 1N5HA 2M7OA 1RN1A 4HOHA 3MWZA 3OV4A 1O7GB 3S29A 5IW9A 4N6OB 5EVHA 1BOXA 1M1XB 1SIHA 3D3LA 4HM7B 1YVSA 1W02A 3URPA 3CCV3 1YGEA 3JUNA 3NBRA 1SARA 4BL3A 2OQEA 3PGBA 1CEWI 2RNTA 3UNLA 1VZZA 2CH9A 3MG3A 1Q42A 3B7CA 3IMAB 4JF8A 4IT7A 1ROAA 4R9LA 2QGUA 3HOHA 4R9KA 1JBRA 2FNQA 1Q9EA 3WHOA 5ELJA 1JKGB 1U5OA 2W9QA 5JPPA 2CFWA 1QALA 1IU7A 2CFKA 2IUJA 1LQMB 5IG4A 1B21A 4O8SA 1IQ8A 1YNVX 4MMXB 3HIGA 5IEPA 1T2IA 1MNLA 3HK4A 1GMPA 4FMAA 3OWYA 3RDEA 1W5ZA 4LYLB 2HMOB 4HM4B 1Q864 4KZ1A 1JNQA 1UGIA 3AGOA 3D5IA 1STDA 4N3VA 2H0HA 3KCHA 4OUQA 2MF7A 1C7HA 2QEX3 4IIAA 3DGYA 2XFSA 3F40A 3KN4A 3T0UA 5A0OB 1VQ93 1GY5A 2GU3A 3LTAA 5BU4A 3FKAA 2GEXA 1Q814 3QRDA 1W01A 3VF1A 3OWSA 1B3SA 2BHMA 3F8XA 4OK0A 1IV7A 3V92A 3CNXA 4L8OA 3F9SA 5JPUA 3SOAA 4RNTA 3ALAA 1IV9A 3JUMA 2KF3A 5AIGA 3D79A 3K9MC 3ECFA 2CHCA 3F7SA 1T3BA 3RNTA 1DVCA 1Q824 2LQVA 4K1VA 2Z6BA 1E3RA 1YJN3 4BIRA 4J5GA 2C11A 2IUKA 2O3OA 4PEJA 1Y4KA 1Q40B 4FMCA 3CCL3 3KSED 1BSBA 4GB5A 1NU3A 3WODG 1I70A 4G1MB 1RGEA 3CCQ3 3EF8A 5IG5A 5IG0A 3EN1B 2BT3A 5CLKA 3SLUA 3Q2PA 3Q1CA 2XSHB 1OUNA 3TDGA 1I3FA 1RRLA 1UCKA 3V98A 4O02B 3MG1A 4X2HA 1TU5A 4CJNA 1OGZA 1LRAA 3NQZA 4R80A 1TIJA 2OOVA 2IA7A 3G8ZA 1RJOA 2L4VA 3DZLA 2XRXB 4AKZA 1KQS2 1U8CB 1LOXA 1ULJB 3FLJA 2F98A 4LSOA 1AY7A 2GXFA 3CC73 1BNEA 1EUIC 3NM2A 5BXQA 1AVKA 4I4KA 3G16A 1KSIA 4ZM8A 9RNTA 5IF6A 5AYRB 5I97A 4WYKB 1BIRA 4XDVA 1VQ83 1R4CA 3ER7A 5AEWB 3HZPA 3CCJ3 1PY3A 1X1WA 3SEDA 1RN4A 1A67A 2F5MA 1UI8A 1UUGB 1W4NA 4N6TA 1V74A 3KZTA 3DGLA 2W56A 4FMDA 1I0VA 1NNVA 3QK9A 1IVXA 3DMCA 1D6UA 1ZO2A 1BSAA 4CPKA 4FR9A 1JRQA 2GBXB 1AR0A 5BVBA 1OF5B 1BU4A 1PFPA 1WMOA 2FGTA 4TX4A 3BU4A 1B20A 3MPHA 3S28A 1O7NB 3B4PA 3WOFB 2W6JH 1D6YA 5M18A 1K734 5CF2A 5BIRA 2HMMB 5G1LA 4I5QA 3L0RA 3DM8A 3I563 2XF3A 3MSOA 3DUKA 4FMBA 4J8TA 3F7XA 2RCDA 4EXRA 1KC84 2R4IA 2OTL3 1YIJ3 1JBTA 1K28A 1A2VA 1RLSA 4LGQA 1VQ63 1IQXA 3DH2A 2KRTA 1WTHA 2F56A 2R41A 3F14A 4X2OA 3SXXA 1ZX2A 1T5YA 3NQYA 1Q7HA 1IT8A 2CFDA 1RGAA 3Q90A 2WOFA 1RN7A 1SPUA 1VQM3 2P0MA 2ZA4A 2LYXA 1ULIB 3GZBA 4GL6A 3I553 5AIFA 6RNTA 2CWUA 5HGRA 3EHCA 2JDIH 3ZFZA 3FCSB 3UB1A 2FXTA 2UX0A 1CH0A 3LT8A 1WMNA 2BIRA 4MEIA 2C10A 1WNHA 4N6V0 1CQSA 1VQQA 1ZS7A 3T8NA 2KCDA 1IDPA 1D6ZA 3AMOA 1NB5I 2IY2A 2AADA 4OVMA 2Z77A 3FH1A 3H3HA 4HM2B 3KFQC 1S5AA 1RGLA 2B1XB 2CG0A 3M8CA 1QMAA 1RDSA 1HZ1A 3X41A 3CCR3 2RSXA 1JB2A 3N8BA 1JJ22 3CC43 1QVF2 1F8NA 1RMSA 2OOVC 4NPBA 5CK6A 3DY5A 5HOHA 4EYCA 1G0TA 4EV2A 2XFTA 3ROBA 1RGKA 1BNSA 4HAAA 2CG1A 2HOHA 1W2ZA 1TRPA 1MWUA 5AIHA 2CX1A 2H0IA 3HX8A 5G2GA 3X42A 5AIIA 3EB8A 6STDA 2BU4A 2YFIB 1B27A 1JV2B 1PYLA 2YFLB 1KD14 2CFLA 3X3XA 3G713 2P38A
chains in the Genus database with same CATH topology
4BTWA 2OTJ3 1GS3A 1FGQA 4MJDA 4WHAA 3FG3A 3U97A 3NBBA 4U13A 3BB9A 3JUOA 3X3ZA 3RGAA 2W0QA 1JB5A 5AYSC 1OPYA 1JN5A 5LC6A 3KKGA 2BMQB 3FF0A 3BNBA 3GRDA 2CIUA 3LTCA 4KFFA 5FGOA 2I9WA 2XEPA 2GBWB 2RGQA 2P05A 2XGNA 5IG3A 1EG9B 3G0KA 3BNCA 5AEUB 3LH4A 4KFDA 3S27A 4Q53A 1N9JA 5KP4A 3OW22 1LVNA 3JUQA 1W00A 3LOYA 3NUVA 5TGNA 4XM4A 1ASKA 3EN8A 2QA43 1CYUA 2BNGA 4RNYA 1YJ93 1EA2A 2V1LA 2PNCA 4BTYA 5D81A 5KP3A 2B24B 1US1A 3SX1A 2XH9A 1N5PA 4KVHA 2E2UA 2OQEC 5EEOA 2E2VA 3DGOA 1K8A4 1HKXA 3SVAA 1Q7Y4 4L7KA 1IT7A 3CPW2 5AI1A 1GD3A 2Y74A 3G6E3 1DMNA 4HJLB 2GEYA 2CFGA 2W56B 2P09A 3JVCA 1UI7A 3DGNA 1K9M4 3EJVA 2Z76A 2W2CA 4K61A 3VGNA 4XDWA 3EQQB 4K1UA 8CHOA 1QVG2 3EX9A 1IQYA 3PZWA 1YIT3 1K41A 1QJGA 3LZAA 2STDA 1NDOB 1AV4A 3CD63 4HKVB 1DVDA 4HZBB 1PU4A 3GZYB 3NV0A 4HM5B 2GU1A 4LZIA 4QWTA 1FA3A 4MMZB 3X40A 3LTBA 5D83A 3V99A 3CNMA 1LNHA 4O2HA 2Y73A 3NM7A 3GWRA 1VQN3 4XBXA 1SQWA 3MKIA 1E97A 1O7MB 2F86B 1A90A 2WO0A 1WMPA 2CWVA 1VQ53 3CCM3 2YFJB 3S67A 3GZRA 2CWTA 1TFOA 2MC8A 3FZWA 3DXOA 4FCMA 4WP5A 3X3YA 1BUQA 3AMOB 1YVBI 3PCSA 4HM3B 3UJMA 2BMOB 1Z1SA 3LYGA 4WFOA 3FSDA 5STDA 1QAKA 3KE7A 1J2BA 4K90B 1EKMA 1FGMA 5DREA 4R1KA 4AEQA 1O7HB 3PYJA 3IJEB 3NXJA 3K5TA 2HMKB 3F8HA 2ML6A 4HM8B 3VSYA 4HM6B 4N6LA 3CCS3 3B4OA 1YI23 1FGTA 1S723 1IVVA 1HU9A 1OH0A 3O8YA 4JRFA 2OWPA 2CKFB 3E99A 1VQP3 2XGLA 3B8LA 5IEOA 1TFKA 1W6GA 2Q07A 3NHXA 4HBRA 2K54A 1N8R4 1OHPA 1SIIA 1M9GA 4L8PA 2E2TA 1JN5B 4J9AA 1SJWA 4XBYA 3I0YA 5ELUA 2ZDJA 5FW5A 1JKGA 7STDA 4NREA 1G96A 1QAFA 1ROVA 2XR8B 3OX9A 3GZXB 1GY7A 3N54B 3CXC2 1VQK3 3JUPA 3CMA3 1LXEA 4XBTA 1RKYA 2ML5A 3OWUA 1YJW3 1IVUA 4EV5A 3WOEB 1IVWA 3H51A 5KP1A 4IPBA 2JQ5A 3EBYA 3HI7A 4HVNA 1UUVB 3D9RA 4H3UA 5IERA 1W2B2 3FG4A 1AVLA 2W03A 4O3VA 3CME3 4NHFA 1UW1A 3FGYA 1DMMA 1WQLB 5DRVA 4FCZA 3STDA 1O7WB 2HMJB 1M904 4STDA 1VQ73 1MOLA 2PZVA 3EE1A 2INXA 3FG1A 3A76A 4EC6A 1N9EA 3KIIA 4MMYB 1IK3A 4XB5A 4WWUC 2BO9B 1OHOA 3LTDA 3K7CA 3U1WA 2CW9A 1Q40A 2WGOA 3DGMA 3PXMA 5D82A 4BTXA 5JBSA 2HMNB 2P0XA 1FUWA 1O7PB 5IENA 3WA3A 1CYVA 1TP6A 1DYUA 1W6YA 1OHSA 3NX0A 1L5GB 1OCVA 2A15A 3HIIA 4ORLA 1NWWA 2QIYA 3LXUX 2F99A 3RGRA 4RNZA 3FF2A 2OCTA 3BLZA 3K0ZA 1ISKA 4LEHA 4HM0B 3S5CA 2HMLB 3EC9A 1VQL3 3BNDA 4LMIA 2RFRA 1TUHA 2YX9A 3WDGB 4N6MA 4HZ9B 5LC7A 2O9UX 1NB3I 4WYKA 2CC3A 2IMJA 3MG2A 1DMQA 1M1K4 4R4KA 3G4S3 3K63A 3NV0B 1VQ43 3N9HA 2W9PA 1W7CA 3BNEA 3WA2X 3KSPA 4KFEA 1N8QA 3SOYA 3MHEA 4RZMA 2SBLA 3LMLA 2KXGA 1NJI4 4H61A 2W04A 1OF5A 2ZL8A 4RBNA 4CDLA 3GAXA 1UUWB 1EQKA 4FCJA 3UL5A 3J7Yd 2BMRB 2CK3H 1KWIA 2XSOB 1STFI 1E3VA 1GY6A 2Z7AA 3CU3A 3IPTA 3UL6A 3EBTA 4CCVA 1GYBA 1A2KA 3WMDA 2K0MA 2WGQA 5EQLA 3OXAA 3CPOA 3CCE3 1FGOA 1RRHA 4EBGA 2WOHA 1FGRA 3CCU3 1OACA 2D1WA 1YHQ3 1OGXA 3LT9A 3NBJA 3PS8A 4AKYA 1GD4A 1W6CA 4N6NB 1NO3A 4N6UA 4HM1B 4HYZA 5CF1A 1JB4A 3T8UA 2D42A 1VQO3 5CXOA 3CC23 3PCRA 3MYTA 1N5HA 2M7OA 5IW9A 3S29A 3MWZA 3OV4A 1O7GB 4N6OB 5EVHA 1M1XB 1SIHA 3D3LA 3CCV3 4HM7B 1W02A 1YGEA 3JUNA 3NBRA 2OQEA 3PGBA 1CEWI 3UNLA 1VZZA 2CH9A 3MG3A 1Q42A 3B7CA 3IMAB 4JF8A 4IT7A 1ROAA 4R9LA 2QGUA 4R9KA 2FNQA 5ELJA 1JKGB 1U5OA 2W9QA 5JPPA 2CFWA 1QALA 1IU7A 2CFKA 2IUJA 5IG4A 4O8SA 1IQ8A 4MMXB 3HIGA 5IEPA 1MNLA 3HK4A 4FMAA 3OWYA 3RDEA 1W5ZA 2HMOB 4HM4B 1Q864 4KZ1A 1JNQA 1STDA 4N3VA 4OUQA 2MF7A 1C7HA 2QEX3 4IIAA 3T0UA 2XFSA 3F40A 3KN4A 5A0OB 1VQ93 1GY5A 2GU3A 3LTAA 3FKAA 2GEXA 1Q814 3QRDA 1W01A 3VF1A 3OWSA 2BHMA 3F8XA 4OK0A 1IV7A 3V92A 3CNXA 4L8OA 3F9SA 5JPUA 3SOAA 3ALAA 1IV9A 3JUMA 5AIGA 3K9MC 3ECFA 2CHCA 3F7SA 1DVCA 1Q824 2LQVA 4K1VA 2Z6BA 1E3RA 1YJN3 2C11A 2IUKA 2O3OA 4PEJA 1Y4KA 1Q40B 4FMCA 3CCL3 3KSED 4GB5A 1NU3A 3WODG 4G1MB 3CCQ3 3EF8A 5IG5A 5IG0A 3EN1B 2BT3A 5CLKA 3SLUA 3Q2PA 3Q1CA 2XSHB 1OUNA 3TDGA 1RRLA 3V98A 4O02B 3MG1A 4X2HA 1TU5A 1OGZA 3NQZA 4R80A 1TIJA 2OOVA 2IA7A 3G8ZA 1RJOA 2L4VA 3DZLA 2XRXB 4AKZA 1KQS2 1U8CB 1LOXA 1ULJB 3FLJA 2F98A 4LSOA 2GXFA 3CC73 5BXQA 3NM2A 1AVKA 4I4KA 3G16A 1KSIA 4ZM8A 5IF6A 5AYRB 5I97A 4WYKB 4XDVA 1VQ83 1R4CA 3ER7A 5AEWB 3HZPA 3CCJ3 3SEDA 1A67A 1UI8A 1W4NA 4N6TA 1V74A 3KZTA 3DGLA 2W56A 4FMDA 3QK9A 1IVXA 3DMCA 1D6UA 1ZO2A 4FR9A 1JRQA 2GBXB 1AR0A 5BVBA 1OF5B 1WMOA 1PFPA 2FGTA 4TX4A 3S28A 3MPHA 1O7NB 3B4PA 3WOFB 2W6JH 1D6YA 1K734 5CF2A 2HMMB 3L0RA 3DM8A 3I563 2XF3A 3MSOA 3DUKA 4FMBA 4J8TA 3F7XA 2RCDA 4EXRA 1KC84 2R4IA 2OTL3 1YIJ3 1K28A 1A2VA 4LGQA 1VQ63 1IQXA 2KRTA 1WTHA 4X2OA 3F14A 3SXXA 1ZX2A 1T5YA 3NQYA 3Q90A 1IT8A 2CFDA 1VQM3 2WOFA 1RN7A 1SPUA 2P0MA 2LYXA 1ULIB 3GZBA 4GL6A 3I553 5AIFA 2CWUA 5HGRA 3EHCA 2JDIH 3FCSB 3UB1A 2FXTA 2UX0A 3LT8A 1WMNA 4MEIA 2C10A 1WNHA 4N6V0 1CQSA 3T8NA 2KCDA 1IDPA 1D6ZA 3AMOA 1NB5I 4OVMA 2Z77A 3FH1A 3H3HA 4HM2B 3KFQC 1S5AA 2B1XB 2CG0A 3M8CA 1QMAA 3X41A 3CCR3 1JJ22 2RSXA 1JB2A 3N8BA 3CC43 1QVF2 1F8NA 2OOVC 5CK6A 3DY5A 4EYCA 4EV2A 2XFTA 3ROBA 2CG1A 1W2ZA 5AIHA 5G2GA 3X42A 3HX8A 5AIIA 3EB8A 6STDA 2YFIB 1KD14 1JV2B 2YFLB 2CFLA 3X3XA 3G713 2P38A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ML5 A;  4R4K A;  2ML6 A; 
#chains in the Genus database with same CATH topology
 4BTW A;  2OTJ 3;  4KT3 B;  1GS3 A;  1FGQ A;  4MJD A;  1BNF A;  4WHA A;  1I3I A;  3FG3 A;  3U97 A;  3NBB A;  4U13 A;  3BB9 A;  3JUO A;  3X3Z A;  1TRQ A;  1TTO A;  2W0Q A;  1JB5 A;  5AYS C;  1OPY A;  3RGA A;  1I2E A;  1JN5 A;  5LC6 A;  1BRH A;  3KKG A;  2BMQ B;  3FF0 A;  3BNB A;  2CX0 A;  3GRD A;  1FZU A;  2CIU A;  3LTC A;  3AGN A;  4KFF A;  5FGO A;  1FUT A;  2I9W A;  2XEP A;  8RNT A;  1I8V A;  2GBW B;  2RGQ A;  2P05 A;  2XGN A;  5IG3 A;  1EG9 B;  3G0K A;  4GSP A;  2UGI A;  3BNC A;  5AEU B;  3LH4 A;  4KFD A;  3S27 A;  4Q53 A;  1N9J A;  5KP4 A;  3OW2 2;  1LVN A;  3JUQ A;  1W00 A;  1JZO A;  3LOY A;  3NUV A;  5TGN A;  4XM4 A;  1LOV A;  1ASK A;  1I2F A;  1BRS A;  3EN8 A;  2QA4 3;  1CYU A;  5GSP A;  2BNG A;  4RNY A;  1YJ9 3;  1EA2 A;  2V1L A;  2PNC A;  1GMQ A;  4BTY A;  5D81 A;  5KP3 A;  2B24 B;  1US1 A;  3SX1 A;  1UDI I;  2XH9 A;  1N5P A;  4KVH A;  2E2U A;  2OQE C;  5EEO A;  2E2V A;  3DGO A;  1IYY A;  1K8A 4;  1HKX A;  3SVA A;  1Q7Y 4;  1RCL A;  4L7K A;  1IT7 A;  2H0G A;  4BL2 A;  2SAR A;  4EW5 A;  3CPW 2;  1I2G A;  5AI1 A;  1GD3 A;  2J8X B;  1JZD A;  2Y74 A;  3G6E 3;  1DMN A;  1RCK A;  4HJL B;  2GEY A;  2CFG A;  1BAO A;  1RGH A;  2W56 B;  2P09 A;  1BGS A;  1A2P A;  3JVC A;  4DKI A;  1UI7 A;  1UCI A;  3DGN A;  1K9M 4;  3EJV A;  2Z76 A;  2W2C A;  4K61 A;  3VGN A;  4XDW A;  3EQQ B;  4K1U A;  8CHO A;  1QVG 2;  3EX9 A;  1IQY A;  3PZW A;  1YIT 3;  1YGW A;  1K41 A;  1QJG A;  3LZA A;  2STD A;  1RNB A;  1NDO B;  1V58 A;  1AV4 A;  1RGF A;  3CD6 3;  4HKV B;  1DVD A;  4HZB B;  1PU4 A;  3GZY B;  3NV0 A;  1MGR A;  4HM5 B;  1GSP A;  2GU1 A;  4LZI A;  4QWT A;  1GMR A;  1FA3 A;  1EEJ A;  4MMZ B;  3X40 A;  3LTB A;  5M19 A;  5D83 A;  3V99 A;  3CNM A;  1LNH A;  4O2H A;  3ZG5 A;  2Y73 A;  3D5G A;  1FUS A;  3NM7 A;  3GWR A;  1VQN 3;  1GOV A;  4XBX A;  1SQW A;  3MKI A;  1E97 A;  1O7M B;  2F86 B;  1A90 A;  2WO0 A;  1MWS A;  1WMP A;  2CWV A;  1VQ5 3;  3CCM 3;  2YFJ B;  3S67 A;  3GZR A;  2CWT A;  1TFO A;  2MC8 A;  3FZW A;  2F4Y A;  3DXO A;  4FCM A;  4WP5 A;  3X3Y A;  1BUQ A;  3AMO B;  1BRJ A;  1YVB I;  3PCS A;  4HM3 B;  3UJM A;  3WR2 A;  2BMO B;  1Z1S A;  3LYG A;  1FW7 A;  1BVI A;  1TJD A;  2GSP A;  4BU4 A;  4WFO A;  3FSD A;  5STD A;  1QAK A;  3KE7 A;  5M1A A;  1J2B A;  4K90 B;  1EKM A;  1FGM A;  5DRE A;  4R1K A;  4AEQ A;  1O7H B;  4J5K A;  3PYJ A;  3IJE B;  3NXJ A;  1HYF A;  3K5T A;  1ZGX A;  2HMK B;  3F8H A;  2ZHX B;  2ML6 A;  4HM8 B;  3VSY A;  4HM6 B;  4N6L A;  3CCS 3;  2K3D A;  1B2S A;  3B4O A;  5RNT A;  1RGG A;  1YI2 3;  1FGT A;  1BSC A;  1S72 3;  5G1K A;  1DE3 A;  1IVV A;  1HU9 A;  1OH0 A;  3O8Y A;  4JRF A;  2OWP A;  1RGC A;  2CKF B;  3E99 A;  1VQP 3;  2XGL A;  3B8L A;  5IEO A;  3ZG0 A;  1TFK A;  1W6G A;  2Q07 A;  3NHX A;  4HBR A;  2K54 A;  1N8R 4;  1BUJ A;  1OHP A;  1SII A;  3Q3F A;  1M9G A;  1X1Y A;  4L8P A;  1B2X A;  2E2T A;  1JN5 B;  3A5E A;  1SJW A;  4J9A A;  3I0Y A;  4XBY A;  1UCJ A;  2ZDJ A;  5ELU A;  3D4A A;  5FW5 A;  1JKG A;  7STD A;  1BSE A;  1G96 A;  4NRE A;  1QAF A;  6GSP A;  2F5W A;  1ROV A;  2KF5 A;  2XR8 B;  3OX9 A;  1B2M A;  3GZX B;  1GY7 A;  1UCL A;  1G02 A;  1BSD A;  3N54 B;  1RTU A;  3CXC 2;  1VQK 3;  3JUP A;  3CMA 3;  1LXE A;  4XBT A;  1RKY A;  2ML5 A;  3OWU A;  1YJW 3;  1IVU A;  1BNI A;  1GOU A;  4EV5 A;  3WOE B;  1IVW A;  3H51 A;  1BRK A;  4IPB A;  1X1X A;  5KP1 A;  2JQ5 A;  3EBY A;  3HI7 A;  4HVN A;  1UUV B;  3D9R A;  4H3U A;  1B2Z A;  5IER A;  1W2B 2;  1BNR A;  3FG4 A;  1AVL A;  2W03 A;  4O3V A;  3CME 3;  7GSP A;  3SYU A;  4NHF A;  1UW1 A;  3FGY A;  1DMM A;  1WQL B;  5DRV A;  4FCZ A;  3STD A;  1I0X A;  1O7W B;  1AQZ A;  1RHL A;  1MWR A;  1LNI A;  2HMJ B;  1LOW A;  1M90 4;  1MWT A;  4STD A;  1VQ7 3;  1LQG C;  1MOL A;  1BRN L;  2PZV A;  1B2U A;  2INX A;  3EE1 A;  3FG1 A;  3A76 A;  1BNG A;  4EC6 A;  1N9E A;  3KII A;  3GSP A;  4MMY B;  1IK3 A;  4XB5 A;  4WWU C;  2BO9 B;  1OHO A;  3LTD A;  3K7C A;  3U1W A;  2CW9 A;  1BRI A;  1Q40 A;  2WGO A;  3DGM A;  3PXM A;  1RSN A;  5D82 A;  4BTX A;  2C4B A;  5JBS A;  2HMN B;  1V57 A;  2P0X A;  1FUW A;  1O7P B;  5IEN A;  3WA3 A;  1CYV A;  1TP6 A;  1DYU A;  1W6Y A;  1OHS A;  3NX0 A;  1L5G B;  1OCV A;  2A15 A;  3HII A;  4ORL A;  1NWW A;  2QIY A;  3LXU X;  2F99 A;  2KF6 A;  4RNZ A;  3RGR A;  2L1S A;  3FF2 A;  2OCT A;  3BLZ A;  3K0Z A;  1ISK A;  1MGW A;  4LEH A;  4HM0 B;  2AAE A;  1LOY A;  3S5C A;  1RNT A;  2HML B;  3EC9 A;  1BRG A;  1VQL 3;  3BND A;  4LMI A;  2RFR A;  1TUH A;  2YX9 A;  4ILF A;  4N6M A;  3WDG B;  4HZ9 B;  1UGH I;  2O9U X;  5LC7 A;  1NB3 I;  4WYK A;  2CC3 A;  2IMJ A;  3MG2 A;  1JBS A;  1DMQ A;  1M1K 4;  4R4K A;  3G4S 3;  3K63 A;  3NV0 B;  1VQ4 3;  3N9H A;  1BAN A;  1W7C A;  2W9P A;  3BNE A;  3KSP A;  4KFE A;  3WA2 X;  1N8Q A;  2RBI A;  3SOY A;  3MHE A;  1FYS A;  3BIR A;  4RZM A;  1X1U A;  2SBL A;  3LML A;  2KXG A;  1NJI 4;  4H61 A;  2W04 A;  1T2H A;  1OF5 A;  2ZL8 A;  4RBN A;  2KAA A;  4CDL A;  3GAX A;  1UUW B;  1EQK A;  4FCJ A;  7RNT A;  3UL5 A;  3J7Y d;  2BMR B;  2CK3 H;  1KWI A;  2XSO B;  1STF I;  1E3V A;  1GY6 A;  2Z7A A;  3CU3 A;  3IPT A;  1R4Y A;  3EBT A;  3UL6 A;  4CCV A;  1GYB A;  1A2K A;  3WMD A;  2K0M A;  2WGQ A;  5EQL A;  3OXA A;  3CPO A;  2IYJ A;  3AHW A;  1FGO A;  3CCE 3;  1RRH A;  1C54 A;  3AHS A;  4EBG A;  1GOY A;  1FGR A;  2WOH A;  3CCU 3;  1OAC A;  2D1W A;  1YHQ 3;  1DET A;  1BNJ A;  1OGX A;  3LT9 A;  2UUG C;  3NBJ A;  3PS8 A;  4AKY A;  1GD4 A;  1W6C A;  2KF4 A;  4N6N B;  1NO3 A;  4N6U A;  4HM1 B;  4HYZ A;  5CF1 A;  1JB4 A;  3T8U A;  2D42 A;  1VQO 3;  5CXO A;  3CC2 3;  3PCR A;  4GHO A;  3MYT A;  1N5H A;  2M7O A;  1RN1 A;  4HOH A;  3MWZ A;  3OV4 A;  1O7G B;  3S29 A;  5IW9 A;  4N6O B;  5EVH A;  1BOX A;  1M1X B;  1SIH A;  3D3L A;  4HM7 B;  1YVS A;  1W02 A;  3URP A;  3CCV 3;  1YGE A;  3JUN A;  3NBR A;  1SAR A;  4BL3 A;  2OQE A;  3PGB A;  1CEW I;  2RNT A;  3UNL A;  1VZZ A;  2CH9 A;  3MG3 A;  1Q42 A;  3B7C A;  3IMA B;  4JF8 A;  4IT7 A;  1ROA A;  4R9L A;  2QGU A;  3HOH A;  4R9K A;  1JBR A;  2FNQ A;  1Q9E A;  3WHO A;  5ELJ A;  1JKG B;  1U5O A;  2W9Q A;  5JPP A;  2CFW A;  1QAL A;  1IU7 A;  2CFK A;  2IUJ A;  1LQM B;  5IG4 A;  1B21 A;  4O8S A;  1IQ8 A;  1YNV X;  4MMX B;  3HIG A;  5IEP A;  1T2I A;  1MNL A;  3HK4 A;  1GMP A;  4FMA A;  3OWY A;  3RDE A;  1W5Z A;  4LYL B;  2HMO B;  4HM4 B;  1Q86 4;  4KZ1 A;  1JNQ A;  1UGI A;  3AGO A;  3D5I A;  1STD A;  4N3V A;  2H0H A;  3KCH A;  4OUQ A;  2MF7 A;  1C7H A;  2QEX 3;  4IIA A;  3DGY A;  2XFS A;  3F40 A;  3KN4 A;  3T0U A;  5A0O B;  1VQ9 3;  1GY5 A;  2GU3 A;  3LTA A;  5BU4 A;  3FKA A;  2GEX A;  1Q81 4;  3QRD A;  1W01 A;  3VF1 A;  3OWS A;  1B3S A;  2BHM A;  3F8X A;  4OK0 A;  1IV7 A;  3V92 A;  3CNX A;  4L8O A;  3F9S A;  5JPU A;  3SOA A;  4RNT A;  3ALA A;  1IV9 A;  3JUM A;  2KF3 A;  5AIG A;  3D79 A;  3K9M C;  3ECF A;  2CHC A;  3F7S A;  1T3B A;  3RNT A;  1DVC A;  1Q82 4;  2LQV A;  4K1V A;  2Z6B A;  1E3R A;  1YJN 3;  4BIR A;  4J5G A;  2C11 A;  2IUK A;  2O3O A;  4PEJ A;  1Y4K A;  1Q40 B;  4FMC A;  3CCL 3;  3KSE D;  1BSB A;  4GB5 A;  1NU3 A;  3WOD G;  1I70 A;  4G1M B;  1RGE A;  3CCQ 3;  3EF8 A;  5IG5 A;  5IG0 A;  3EN1 B;  2BT3 A;  5CLK A;  3SLU A;  3Q2P A;  3Q1C A;  2XSH B;  1OUN A;  3TDG A;  1I3F A;  1RRL A;  1UCK A;  3V98 A;  4O02 B;  3MG1 A;  4X2H A;  1TU5 A;  4CJN A;  1OGZ A;  1LRA A;  3NQZ A;  4R80 A;  1TIJ A;  2OOV A;  2IA7 A;  3G8Z A;  1RJO A;  2L4V A;  3DZL A;  2XRX B;  4AKZ A;  1KQS 2;  1U8C B;  1LOX A;  1ULJ B;  3FLJ A;  2F98 A;  4LSO A;  1AY7 A;  2GXF A;  3CC7 3;  1BNE A;  1EUI C;  3NM2 A;  5BXQ A;  1AVK A;  4I4K A;  3G16 A;  1KSI A;  4ZM8 A;  9RNT A;  5IF6 A;  5AYR B;  5I97 A;  4WYK B;  1BIR A;  4XDV A;  1VQ8 3;  1R4C A;  3ER7 A;  5AEW B;  3HZP A;  3CCJ 3;  1PY3 A;  1X1W A;  3SED A;  1RN4 A;  1A67 A;  2F5M A;  1UI8 A;  1UUG B;  1W4N A;  4N6T A;  1V74 A;  3KZT A;  3DGL A;  2W56 A;  4FMD A;  1I0V A;  1NNV A;  3QK9 A;  1IVX A;  3DMC A;  1D6U A;  1ZO2 A;  1BSA A;  4CPK A;  4FR9 A;  1JRQ A;  2GBX B;  1AR0 A;  5BVB A;  1OF5 B;  1BU4 A;  1PFP A;  1WMO A;  2FGT A;  4TX4 A;  3BU4 A;  1B20 A;  3MPH A;  3S28 A;  1O7N B;  3B4P A;  3WOF B;  2W6J H;  1D6Y A;  5M18 A;  1K73 4;  5CF2 A;  5BIR A;  2HMM B;  5G1L A;  4I5Q A;  3L0R A;  3DM8 A;  3I56 3;  2XF3 A;  3MSO A;  3DUK A;  4FMB A;  4J8T A;  3F7X A;  2RCD A;  4EXR A;  1KC8 4;  2R4I A;  2OTL 3;  1YIJ 3;  1JBT A;  1K28 A;  1A2V A;  1RLS A;  4LGQ A;  1VQ6 3;  1IQX A;  3DH2 A;  2KRT A;  1WTH A;  2F56 A;  2R41 A;  3F14 A;  4X2O A;  3SXX A;  1ZX2 A;  1T5Y A;  3NQY A;  1Q7H A;  1IT8 A;  2CFD A;  1RGA A;  3Q90 A;  2WOF A;  1RN7 A;  1SPU A;  1VQM 3;  2P0M A;  2ZA4 A;  2LYX A;  1ULI B;  3GZB A;  4GL6 A;  3I55 3;  5AIF A;  6RNT A;  2CWU A;  5HGR A;  3EHC A;  2JDI H;  3ZFZ A;  3FCS B;  3UB1 A;  2FXT A;  2UX0 A;  1CH0 A;  3LT8 A;  1WMN A;  2BIR A;  4MEI A;  2C10 A;  1WNH A;  4N6V 0;  1CQS A;  1VQQ A;  1ZS7 A;  3T8N A;  2KCD A;  1IDP A;  1D6Z A;  3AMO A;  1NB5 I;  2IY2 A;  2AAD A;  4OVM A;  2Z77 A;  3FH1 A;  3H3H A;  4HM2 B;  3KFQ C;  1S5A A;  1RGL A;  2B1X B;  2CG0 A;  3M8C A;  1QMA A;  1RDS A;  1HZ1 A;  3X41 A;  3CCR 3;  2RSX A;  1JB2 A;  3N8B A;  1JJ2 2;  3CC4 3;  1QVF 2;  1F8N A;  1RMS A;  2OOV C;  4NPB A;  5CK6 A;  3DY5 A;  5HOH A;  4EYC A;  1G0T A;  4EV2 A;  2XFT A;  3ROB A;  1RGK A;  1BNS A;  4HAA A;  2CG1 A;  2HOH A;  1W2Z A;  1TRP A;  1MWU A;  5AIH A;  2CX1 A;  2H0I A;  3HX8 A;  5G2G A;  3X42 A;  5AII A;  3EB8 A;  6STD A;  2BU4 A;  2YFI B;  1B27 A;  1JV2 B;  1PYL A;  2YFL B;  1KD1 4;  2CFL A;  3X3X A;  3G71 3;  2P38 A; 
#chains in the Genus database with same CATH homology
 4BTW A;  2OTJ 3;  1GS3 A;  1FGQ A;  4MJD A;  4WHA A;  3FG3 A;  3U97 A;  3NBB A;  4U13 A;  3BB9 A;  3JUO A;  3X3Z A;  3RGA A;  2W0Q A;  1JB5 A;  5AYS C;  1OPY A;  1JN5 A;  5LC6 A;  3KKG A;  2BMQ B;  3FF0 A;  3BNB A;  3GRD A;  2CIU A;  3LTC A;  4KFF A;  5FGO A;  2I9W A;  2XEP A;  2GBW B;  2RGQ A;  2P05 A;  2XGN A;  5IG3 A;  1EG9 B;  3G0K A;  3BNC A;  5AEU B;  3LH4 A;  4KFD A;  3S27 A;  4Q53 A;  1N9J A;  5KP4 A;  3OW2 2;  1LVN A;  3JUQ A;  1W00 A;  3LOY A;  3NUV A;  5TGN A;  4XM4 A;  1ASK A;  3EN8 A;  2QA4 3;  1CYU A;  2BNG A;  4RNY A;  1YJ9 3;  1EA2 A;  2V1L A;  2PNC A;  4BTY A;  5D81 A;  5KP3 A;  2B24 B;  1US1 A;  3SX1 A;  2XH9 A;  1N5P A;  4KVH A;  2E2U A;  2OQE C;  5EEO A;  2E2V A;  3DGO A;  1K8A 4;  1HKX A;  3SVA A;  1Q7Y 4;  4L7K A;  1IT7 A;  3CPW 2;  5AI1 A;  1GD3 A;  2Y74 A;  3G6E 3;  1DMN A;  4HJL B;  2GEY A;  2CFG A;  2W56 B;  2P09 A;  3JVC A;  1UI7 A;  3DGN A;  1K9M 4;  3EJV A;  2Z76 A;  2W2C A;  4K61 A;  3VGN A;  4XDW A;  3EQQ B;  4K1U A;  8CHO A;  1QVG 2;  3EX9 A;  1IQY A;  3PZW A;  1YIT 3;  1K41 A;  1QJG A;  3LZA A;  2STD A;  1NDO B;  1AV4 A;  3CD6 3;  4HKV B;  1DVD A;  4HZB B;  1PU4 A;  3GZY B;  3NV0 A;  4HM5 B;  2GU1 A;  4LZI A;  4QWT A;  1FA3 A;  4MMZ B;  3X40 A;  3LTB A;  5D83 A;  3V99 A;  3CNM A;  1LNH A;  4O2H A;  2Y73 A;  3NM7 A;  3GWR A;  1VQN 3;  4XBX A;  1SQW A;  3MKI A;  1E97 A;  1O7M B;  2F86 B;  1A90 A;  2WO0 A;  1WMP A;  2CWV A;  1VQ5 3;  3CCM 3;  2YFJ B;  3S67 A;  3GZR A;  2CWT A;  1TFO A;  2MC8 A;  3FZW A;  3DXO A;  4FCM A;  4WP5 A;  3X3Y A;  1BUQ A;  3AMO B;  1YVB I;  3PCS A;  4HM3 B;  3UJM A;  2BMO B;  1Z1S A;  3LYG A;  4WFO A;  3FSD A;  5STD A;  1QAK A;  3KE7 A;  1J2B A;  4K90 B;  1EKM A;  1FGM A;  5DRE A;  4R1K A;  4AEQ A;  1O7H B;  3PYJ A;  3IJE B;  3NXJ A;  3K5T A;  2HMK B;  3F8H A;  2ML6 A;  4HM8 B;  3VSY A;  4HM6 B;  4N6L A;  3CCS 3;  3B4O A;  1YI2 3;  1FGT A;  1S72 3;  1IVV A;  1HU9 A;  1OH0 A;  3O8Y A;  4JRF A;  2OWP A;  2CKF B;  3E99 A;  1VQP 3;  2XGL A;  3B8L A;  5IEO A;  1TFK A;  1W6G A;  2Q07 A;  3NHX A;  4HBR A;  2K54 A;  1N8R 4;  1OHP A;  1SII A;  1M9G A;  4L8P A;  2E2T A;  1JN5 B;  4J9A A;  1SJW A;  4XBY A;  3I0Y A;  5ELU A;  2ZDJ A;  5FW5 A;  1JKG A;  7STD A;  4NRE A;  1G96 A;  1QAF A;  1ROV A;  2XR8 B;  3OX9 A;  3GZX B;  1GY7 A;  3N54 B;  3CXC 2;  1VQK 3;  3JUP A;  3CMA 3;  1LXE A;  4XBT A;  1RKY A;  2ML5 A;  3OWU A;  1YJW 3;  1IVU A;  4EV5 A;  3WOE B;  1IVW A;  3H51 A;  5KP1 A;  4IPB A;  2JQ5 A;  3EBY A;  3HI7 A;  4HVN A;  1UUV B;  3D9R A;  4H3U A;  5IER A;  1W2B 2;  3FG4 A;  1AVL A;  2W03 A;  4O3V A;  3CME 3;  4NHF A;  1UW1 A;  3FGY A;  1DMM A;  1WQL B;  5DRV A;  4FCZ A;  3STD A;  1O7W B;  2HMJ B;  1M90 4;  4STD A;  1VQ7 3;  1MOL A;  2PZV A;  3EE1 A;  2INX A;  3FG1 A;  3A76 A;  4EC6 A;  1N9E A;  3KII A;  4MMY B;  1IK3 A;  4XB5 A;  4WWU C;  2BO9 B;  1OHO A;  3LTD A;  3K7C A;  3U1W A;  2CW9 A;  1Q40 A;  2WGO A;  3DGM A;  3PXM A;  5D82 A;  4BTX A;  5JBS A;  2HMN B;  2P0X A;  1FUW A;  1O7P B;  5IEN A;  3WA3 A;  1CYV A;  1TP6 A;  1DYU A;  1W6Y A;  1OHS A;  3NX0 A;  1L5G B;  1OCV A;  2A15 A;  3HII A;  4ORL A;  1NWW A;  2QIY A;  3LXU X;  2F99 A;  3RGR A;  4RNZ A;  3FF2 A;  2OCT A;  3BLZ A;  3K0Z A;  1ISK A;  4LEH A;  4HM0 B;  3S5C A;  2HML B;  3EC9 A;  1VQL 3;  3BND A;  4LMI A;  2RFR A;  1TUH A;  2YX9 A;  3WDG B;  4N6M A;  4HZ9 B;  5LC7 A;  2O9U X;  1NB3 I;  4WYK A;  2CC3 A;  2IMJ A;  3MG2 A;  1DMQ A;  1M1K 4;  4R4K A;  3G4S 3;  3K63 A;  3NV0 B;  1VQ4 3;  3N9H A;  2W9P A;  1W7C A;  3BNE A;  3WA2 X;  3KSP A;  4KFE A;  1N8Q A;  3SOY A;  3MHE A;  4RZM A;  2SBL A;  3LML A;  2KXG A;  1NJI 4;  4H61 A;  2W04 A;  1OF5 A;  2ZL8 A;  4RBN A;  4CDL A;  3GAX A;  1UUW B;  1EQK A;  4FCJ A;  3UL5 A;  3J7Y d;  2BMR B;  2CK3 H;  1KWI A;  2XSO B;  1STF I;  1E3V A;  1GY6 A;  2Z7A A;  3CU3 A;  3IPT A;  3UL6 A;  3EBT A;  4CCV A;  1GYB A;  1A2K A;  3WMD A;  2K0M A;  2WGQ A;  5EQL A;  3OXA A;  3CPO A;  3CCE 3;  1FGO A;  1RRH A;  4EBG A;  2WOH A;  1FGR A;  3CCU 3;  1OAC A;  2D1W A;  1YHQ 3;  1OGX A;  3LT9 A;  3NBJ A;  3PS8 A;  4AKY A;  1GD4 A;  1W6C A;  4N6N B;  1NO3 A;  4N6U A;  4HM1 B;  4HYZ A;  5CF1 A;  1JB4 A;  3T8U A;  2D42 A;  1VQO 3;  5CXO A;  3CC2 3;  3PCR A;  3MYT A;  1N5H A;  2M7O A;  5IW9 A;  3S29 A;  3MWZ A;  3OV4 A;  1O7G B;  4N6O B;  5EVH A;  1M1X B;  1SIH A;  3D3L A;  3CCV 3;  4HM7 B;  1W02 A;  1YGE A;  3JUN A;  3NBR A;  2OQE A;  3PGB A;  1CEW I;  3UNL A;  1VZZ A;  2CH9 A;  3MG3 A;  1Q42 A;  3B7C A;  3IMA B;  4JF8 A;  4IT7 A;  1ROA A;  4R9L A;  2QGU A;  4R9K A;  2FNQ A;  5ELJ A;  1JKG B;  1U5O A;  2W9Q A;  5JPP A;  2CFW A;  1QAL A;  1IU7 A;  2CFK A;  2IUJ A;  5IG4 A;  4O8S A;  1IQ8 A;  4MMX B;  3HIG A;  5IEP A;  1MNL A;  3HK4 A;  4FMA A;  3OWY A;  3RDE A;  1W5Z A;  2HMO B;  4HM4 B;  1Q86 4;  4KZ1 A;  1JNQ A;  1STD A;  4N3V A;  4OUQ A;  2MF7 A;  1C7H A;  2QEX 3;  4IIA A;  3T0U A;  2XFS A;  3F40 A;  3KN4 A;  5A0O B;  1VQ9 3;  1GY5 A;  2GU3 A;  3LTA A;  3FKA A;  2GEX A;  1Q81 4;  3QRD A;  1W01 A;  3VF1 A;  3OWS A;  2BHM A;  3F8X A;  4OK0 A;  1IV7 A;  3V92 A;  3CNX A;  4L8O A;  3F9S A;  5JPU A;  3SOA A;  3ALA A;  1IV9 A;  3JUM A;  5AIG A;  3K9M C;  3ECF A;  2CHC A;  3F7S A;  1DVC A;  1Q82 4;  2LQV A;  4K1V A;  2Z6B A;  1E3R A;  1YJN 3;  2C11 A;  2IUK A;  2O3O A;  4PEJ A;  1Y4K A;  1Q40 B;  4FMC A;  3CCL 3;  3KSE D;  4GB5 A;  1NU3 A;  3WOD G;  4G1M B;  3CCQ 3;  3EF8 A;  5IG5 A;  5IG0 A;  3EN1 B;  2BT3 A;  5CLK A;  3SLU A;  3Q2P A;  3Q1C A;  2XSH B;  1OUN A;  3TDG A;  1RRL A;  3V98 A;  4O02 B;  3MG1 A;  4X2H A;  1TU5 A;  1OGZ A;  3NQZ A;  4R80 A;  1TIJ A;  2OOV A;  2IA7 A;  3G8Z A;  1RJO A;  2L4V A;  3DZL A;  2XRX B;  4AKZ A;  1KQS 2;  1U8C B;  1LOX A;  1ULJ B;  3FLJ A;  2F98 A;  4LSO A;  2GXF A;  3CC7 3;  5BXQ A;  3NM2 A;  1AVK A;  4I4K A;  3G16 A;  1KSI A;  4ZM8 A;  5IF6 A;  5AYR B;  5I97 A;  4WYK B;  4XDV A;  1VQ8 3;  1R4C A;  3ER7 A;  5AEW B;  3HZP A;  3CCJ 3;  3SED A;  1A67 A;  1UI8 A;  1W4N A;  4N6T A;  1V74 A;  3KZT A;  3DGL A;  2W56 A;  4FMD A;  3QK9 A;  1IVX A;  3DMC A;  1D6U A;  1ZO2 A;  4FR9 A;  1JRQ A;  2GBX B;  1AR0 A;  5BVB A;  1OF5 B;  1WMO A;  1PFP A;  2FGT A;  4TX4 A;  3S28 A;  3MPH A;  1O7N B;  3B4P A;  3WOF B;  2W6J H;  1D6Y A;  1K73 4;  5CF2 A;  2HMM B;  3L0R A;  3DM8 A;  3I56 3;  2XF3 A;  3MSO A;  3DUK A;  4FMB A;  4J8T A;  3F7X A;  2RCD A;  4EXR A;  1KC8 4;  2R4I A;  2OTL 3;  1YIJ 3;  1K28 A;  1A2V A;  4LGQ A;  1VQ6 3;  1IQX A;  2KRT A;  1WTH A;  4X2O A;  3F14 A;  3SXX A;  1ZX2 A;  1T5Y A;  3NQY A;  3Q90 A;  1IT8 A;  2CFD A;  1VQM 3;  2WOF A;  1RN7 A;  1SPU A;  2P0M A;  2LYX A;  1ULI B;  3GZB A;  4GL6 A;  3I55 3;  5AIF A;  2CWU A;  5HGR A;  3EHC A;  2JDI H;  3FCS B;  3UB1 A;  2FXT A;  2UX0 A;  3LT8 A;  1WMN A;  4MEI A;  2C10 A;  1WNH A;  4N6V 0;  1CQS A;  3T8N A;  2KCD A;  1IDP A;  1D6Z A;  3AMO A;  1NB5 I;  4OVM A;  2Z77 A;  3FH1 A;  3H3H A;  4HM2 B;  3KFQ C;  1S5A A;  2B1X B;  2CG0 A;  3M8C A;  1QMA A;  3X41 A;  3CCR 3;  1JJ2 2;  2RSX A;  1JB2 A;  3N8B A;  3CC4 3;  1QVF 2;  1F8N A;  2OOV C;  5CK6 A;  3DY5 A;  4EYC A;  4EV2 A;  2XFT A;  3ROB A;  2CG1 A;  1W2Z A;  5AIH A;  5G2G A;  3X42 A;  3HX8 A;  5AII A;  3EB8 A;  6STD A;  2YFI B;  1KD1 4;  1JV2 B;  2YFL B;  2CFL A;  3X3X A;  3G71 3;  2P38 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...