4R4KA

Crystal structure of a cystatin-like protein (baccac_01506) from bacteroides caccae atcc 43185 at 1.69 a resolution
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
151
structure length
151
Chain Sequence
b'EIAQSGEDFKSFLDKFTSSAAFQYTRIKFPLKTPITLLADDGETEKTFPFTKEKWPLLDSETMKEERIEQEEGGIYVSKFTLNEPVHKVFEAGYEESEIDLRVEFEQAADGKWYVVDCYTGWYGYDLPIGELKQTIQQVKEENAAFKEIHP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
molecule tags Structural genomics, unknown function
source organism Bacteroides caccae
publication title Crystal structure of a hypothetical protein (BACCAC_01506) from Bacteroides caccae ATCC 43185 at 1.69 A resolution
rcsb
total genus 44
structure length 151
sequence length 151
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.410 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4r4kA00
4R4KA 2ML5A 2ML6A
chains in the Genus database with same CATH superfamily
3HI7A 3ZG5A 1K28A 1YJ93 1RNBA 1W01A 1W4NA 2RSXA 1FZUA 1B27A 3QK9A 1CQSA 5BU4A 1FGQA 1CH0A 3FH1A 1UCLA 3AGOA 1BRGA 1I70A 4HKVB 3CPW2 4J5KA 2BMOB 1VZZA 1VQK3 4JRFA 3LXUX 3S27A 2IUJA 2STDA 4GB5A 5AIHA 1QAFA 5IF6A 1I0XA 1BRSA 3I0YA 5IG5A 1SQWA 4BTWA 2H0HA 1EA2A 1GY5A 2GU1A 1K8A4 4O2HA 5IW9A 1GD4A 4HJLB 3LT9A 3I563 3PYJA 3RGAA 4LEHA 4LYLB 3K63A 1LNHA 3UB1A 3OV4A 3OXAA 5EEOA 1JNQA 3CMA3 2IA7A 1UCKA 4U13A 3X40A 3D9RA 1M1XB 2W9QA 2KRTA 1BRIA 4NPBA 4QWTA 2GU3A 9RNTA 1RN1A 3EBYA 1Q814 1LRAA 4GSPA 3RNTA 1BNIA 2Q07A 3GWRA 3AHSA 2Z6BA 3KSPA 4IPBA 2BHMA 1FGMA 4L7KA 1IV9A 5CXOA 3X3ZA 3FKAA 1SARA 1ROAA 3K7CA 4FMAA 1BNJA 1JKGB 1RN7A 1RCLA 2YFJB 2HMNB 3Q90A 4O8SA 3S5CA 3S28A 4CPKA 2IMJA 4N6NB 3T8NA 4HOHA 3LTCA 5AEUB 3GZBA 3PCSA 1W6GA 3LMLA 1W6CA 3X3XA 1B3SA 3LTDA 5M18A 5RNTA 1TUHA 1UI8A 1AY7A 1BRHA 1US1A 1YIJ3 2E2UA 1GMQA 3KE7A 4AKZA 4CJNA 4LZIA 1LOWA 2ZA4A 3F40A 4FMBA 5G1LA 1BU4A 1DYUA 3MG3A 3X41A 3EHCA 1GOVA 2M7OA 1NB5I 1I8VA 1IK3A 1GOYA 1BRJA 1Q40A 1BNFA 1RMSA 3CCJ3 1KC84 4GHOA 1DMMA 3X3YA 1OHPA 5CLKA 1Q824 1OHSA 3F7XA 3AGNA 4H3UA 3MKIA 5BIRA 1Q7Y4 3IPTA 1PYLA 3DGYA 4O02B 4N6MA 4LSOA 1V58A 1NB3I 2WOHA 2I9WA 4ZM8A 1N9JA 7GSPA 2JDIH 1EKMA 1LOVA 5AIFA 2E2TA 1BGSA 2HMOB 3G8ZA 5G2GA 3F7SA 1W5ZA 1YNVX 1RTUA 3NUVA 3KCHA 1NJI4 4HM4B 4WYKA 1DVCA 2W04A 2FNQA 3OWYA 3JVCA 2KF6A 1F8NA 1MGRA 4MMXB 3WR2A 3NBJA 3CME3 3WOEB 1ROVA 3MG2A 3BLZA 3S29A 1HZ1A 2ZHXB 3LT8A 4HM5B 2FXTA 2BMRB 3WA3A 3G6E3 1AVLA 2AAEA 1BRNL 1ZS7A 1RLSA 4RNYA 2P0XA 1BSEA 3AMOA 2B1XB 3LOYA 1KSIA 5DRVA 2IY2A 1TFOA 4GL6A 3CCM3 3N9HA 3SXXA 1FUWA 1D6ZA 5AEWB 1TRPA 5ELUA 3CCU3 1L5GB 2W56B 1CYUA 3EN8A 3FGYA 4AEQA 4FCJA 4XBYA 4OVMA 1IVWA 4K90B 5LC6A 1FA3A 4HZBB 4KFDA 1QAKA 1JZOA 1JRQA 2Z77A 3MYTA 4N6LA 3WOFB 2UGIA 1K734 1ISKA 3A5EA 1UUVB 1STDA 4JF8A 1TJDA 1W02A 3CCL3 2Z7AA 2A15A 1MWSA 2KXGA 2W6JH 3H3HA 1SPUA 3BB9A 3WODG 2L4VA 4EV5A 3T0UA 1IV7A 1QVF2 2XEPA 1VQQA 4EW5A 4X2HA 2WOFA 1RGHA 4O3VA 1RGAA 1ULIB 3OW22 2CG0A 1O7HB 1UCIA 3CPOA 1K41A 1IQ8A 1FGTA 1GYBA 2RFRA 1RSNA 1W2ZA 6GSPA 2HMJB 1OHOA 2OQEC 1UGHI 1DMNA 3RDEA 3VF1A 2XH9A 1YVSA 1QJGA 5CF1A 1TP6A 2D42A 2FGTA 7STDA 1A2VA 2P38A 3CC73 2F5MA 1YJW3 8RNTA 1S723 3L0RA 3FG3A 1YHQ3 1T3BA 3BU4A 1GSPA 1RGEA 1V74A 2E2VA 3DZLA 4MEIA 1ASKA 3SEDA 3DMCA 2RGQA 4EYCA 1WMOA 2W9PA 3ECFA 2YFIB 3RGRA 1HU9A 2QEX3 1FW7A 4ILFA 3B4OA 4L8OA 4XBTA 1Q9EA 1M9GA 2F56A 3KN4A 1IT8A 5BVBA 3HZPA 1FGRA 2HMLB 2BMQB 3CCS3 4XBXA 3DM8A 1VQ73 1WTHA 2BT3A 4N3VA 3LTBA 1TIJA 2W0QA 1B2ZA 1T5YA 2D1WA 3M8CA 2HOHA 4J8TA 2L1SA 2LQVA 3PGBA 1FUTA 3G16A 3LTAA 1C7HA 3SYUA 4DKIA 2CFDA 3FG4A 4CCVA 2QIYA 3GSPA 1S5AA 2Z76A 3HOHA 3EB8A 1B21A 1TU5A 5M19A 2KAAA 5A0OB 3NBRA 2RBIA 3Q2PA 1RKYA 2C11A 1AVKA 3D5GA 1MNLA 5G1KA 1G96A 5GSPA 5EVHA 1VQ83 3HX8A 3NHXA 3MSOA 1BANA 4HVNA 1BIRA 1UDII 2R41A 2WGOA 4R9LA 1VQM3 1RNTA 2QGUA 3D3LA 4N6V0 2BNGA 4RNTA 1UW1A 1BSAA 3K5TA 2BO9B 1KQS2 4KFEA 1W6YA 4G1MB 2CWUA 1NNVA 3DGMA 4BIRA 2GBWB 2XFTA 4N6OB 3J7Yd 2XGNA 1GD3A 5IG4A 3CXC2 5FGOA 2C4BA 3FSDA 4EXRA 2RNTA 5KP1A 1GY7A 1O7NB 1RHLA 3FLJA 2ML6A 4KVHA 5IG0A 1OACA 4HM3B 4OUQA 1J2BA 4WFOA 3ALAA 4STDA 2CFWA 3DH2A 4WWUC 3ROBA 1BSCA 4HAAA 1IU7A 1GMRA 2JQ5A 4FR9A 1MWUA 3WDGB 4RBNA 1BOXA 2QA43 2OOVA 1SIHA 3EE1A 1IVXA 2BIRA 1JN5A 1YGWA 1O7GB 2CC3A 4N6UA 1DETA 3DUKA 4MMYB 5IENA 5BXQA 2OTJ3 3MHEA 1K9M4 1C54A 3F14A 2HMKB 2KF5A 1OCVA 1MWRA 1Y4KA 1Z1SA 3EBTA 3Q3FA 1B2SA 4R1KA 1UI7A 4MJDA 3D5IA 3BNBA 5KP4A 4RNZA 5AYRB 2KF3A 3SX1A 2KF4A 3O8YA 5D83A 2GEXA 1OUNA 3SOYA 4AKYA 3K9MC 1DE3A 1B20A 4HZ9B 2V1LA 4WP5A 3CC23 1WQLB 2ZL8A 2YFLB 1IVUA 3JUMA 2BU4A 2F98A 3UJMA 1IVVA 4BU4A 5CF2A 3BNDA 1BUJA 3K0ZA 1BNSA 2K3DA 3DGLA 3EX9A 3HIGA 1I2FA 4EC6A 1V57A 2CK3H 3NX0A 1EUIC 2CFKA 1SJWA 1RGFA 3NXJA 3GZYB 1I3FA 1RGKA 2C10A 4HM1B 4BL2A 1QVG2 4MMZB 3G0KA 3B4PA 3JUNA 4XDWA 4IT7A 1AR0A 1GOUA 1RGCA 1VQL3 4I4KA 3NV0B 2GXFA 3S67A 1RRHA 2CWTA 3UL6A 2Y74A 2OQEA 2AADA 5HOHA 3CNMA 2P0MA 3DGOA 3FZWA 1E3VA 3SOAA 3GRDA 1W00A 1M1K4 4K1VA 3KIIA 3X42A 1UUWB 3B7CA 5LC7A 1YJN3 1JZDA 1A90A 4EV2A 4X2OA 1DVDA 1BNGA 2K54A 1N8R4 1RJOA 2IUKA 1FYSA 1I2GA 1IDPA 1QALA 1NDOB 1M904 2H0IA 4H61A 5I97A 2F99A 1JBRA 3AHWA 3F8HA 2PZVA 3WHOA 1ZX2A 1RDSA 4LMIA 3OWUA 1WMPA 1JV2B 3GAXA 3IMAB 2GSPA 3BNCA 4R4KA 2ML5A 1A67A 2MF7A 3EQQB 3JUPA 3GZRA 4HM7B 1BSDA 2F4YA 2XRXB 4J5GA 1OGZA 5AYSC 4HM2B 1BNRA 2UX0A 3QRDA 3V99A 1O7WB 1JBSA 1UGIA 2W2CA 1MOLA 4N6TA 3ER7A 4K1UA 3G713 1BRKA 1KD14 2CH9A 1JBTA 1NO3A 1X1YA 1Q40B 4IIAA 3H51A 3SVAA 1NWWA 1N5PA 1WNHA 4WHAA 5IG3A 3CC43 4Q53A 2GBXB 2B24B 4BL3A 2CHCA 1N8QA 1T2HA 2OWPA 2YX9A 4I5QA 1PY3A 1JKGA 1NU3A 1AV4A 1IQYA 2CX1A 3FF0A 3OWSA 4BTXA 1BVIA 2H0GA 1GS3A 2XSOB 5EQLA 5M1AA 3ZG0A 1W7CA 1X1WA 3KSED 1TTOA 1LOXA 4NREA 1JN5B 4HM0B 4HM6B 4ORLA 3UNLA 1VQ43 4R80A 1UCJA 1JB5A 3KKGA 1MGWA 3DY5A 3MWZA 2W03A 1W2B2 1Q864 3TDGA 1IQXA 2CKFB 5CK6A 3UL5A 1TFKA 1B2UA 1YGEA 3KZTA 1GY6A 5D82A 3DGNA 3PZWA 4FCMA 3URPA 1TRQA 1O7PB 1N9EA 6RNTA 1E3RA 2F5WA 1ULJB 2ZDJA 4HM8B 1G0TA 3EC9A 5DREA 4KT3B 1LNIA 3D4AA 3LYGA 2R4IA 2XGLA 5AIIA 1ZO2A 3D79A 4KFFA 3VGNA 3CCE3 3NV0A 1X1UA 3CCV3 4K61A 1BUQA 2P09A 1RN4A 3CU3A 2SBLA 1RRLA 3NBBA 3I553 1Q7HA 1N5HA 1T2IA 1CEWI 4HBRA 4OK0A 3V98A 1FGOA 1R4CA 1E97A 3FG1A 3FCSB 1WMNA 2PNCA 2WO0A 5JPPA 5IEPA 2CIUA 4XDVA 3LZAA 3WMDA 1YIT3 3EF8A 2K0MA 4J9AA 2CFGA 5JBSA 1A2KA 1VQP3 1EQKA 2OCTA 1OGXA 3F8XA 3CD63 1YI23 1SIIA 1MWTA 1LVNA 2Y73A 1LXEA 3JUQA 2INXA 3MPHA 3CCQ3 3Q1CA 3BNEA 1A2PA 1HYFA 5STDA 4XM4A 3N8BA 2WGQA 3GZXB 3U97A 4FMDA 1IYYA 1BNEA 1OF5A 3MG1A 4FMCA 3DXOA 2CFLA 1VQ63 3HK4A 3F9SA 1B2XA 5D81A 4CDLA 3EN1B 4EBGA 1QMAA 2O9UX 1VQN3 3STDA 1VQ53 1KWIA 1R4YA 1RCKA 3JUOA 3A76A 3NM7A 4PEJA 1UUGB 2CX0A 3B8LA 4TX4A 2P05A 4BTYA 3ZFZA 1CYVA 4HYZA 1D6YA 1JB4A 2HMMB 3WA2X 3AMOB 1X1XA 5IEOA 2SARA 2CW9A 3U1WA 1AQZA 1BSBA 6STDA 2OOVC 5JPUA 3V92A 1VQ93 1U8CB 3PCRA 3LH4A 1B2MA 5FW5A 2MC8A 1Q42A 1G02A 3NM2A 1FUSA 4LGQA 2XFSA 3T8UA 7RNTA 3E99A 1HKXA 4FCZA 4RZMA 3BIRA 1PU4A 5AIGA 4WYKB 1I0VA 1PFPA 1D6UA 2RCDA 4XB5A 2XSHB 5AI1A 2UUGC 4KZ1A 2CG1A 1O7MB 5KP3A 2XR8B 3EJVA 2IYJA 1DMQA 2KCDA 5HGRA 2O3OA 1IT7A 1I3IA 1ZGXA 1RGLA 1EG9B 3PXMA 1RGGA 1YVBI 1I2EA 8CHOA 3G4S3 2LYXA 4NHFA 3CCR3 2CWVA 3OX9A 3KFQC 5IERA 3PS8A 1JB2A 1GMPA 3IJEB 2W56A 1BAOA 3CNXA 1JJ22 1OH0A 1EEJA 3HIIA 3NQYA 2OTL3 1OF5B 4L8PA 2J8XB 3NQZA 4R9KA 3FF2A 2XF3A 5ELJA 3SLUA 2GEYA 1LQGC 1U5OA 3N54B 5TGNA 1LOYA 2F86B 1STFI 3VSYA 1VQO3 1OPYA 1LQMB
chains in the Genus database with same CATH topology
3HI7A 1K28A 1W01A 1W4NA 2RSXA 3QK9A 1CQSA 1FGQA 3FH1A 4HKVB 3CPW2 2BMOB 1VZZA 1VQK3 4JRFA 3LXUX 3S27A 2IUJA 2STDA 4GB5A 5AIHA 1QAFA 5IF6A 3I0YA 5IG5A 1SQWA 4BTWA 1EA2A 1GY5A 2GU1A 1K8A4 4O2HA 5IW9A 1GD4A 4HJLB 3LT9A 3I563 3PYJA 3RGAA 4LEHA 3K63A 1LNHA 3UB1A 3OV4A 3OXAA 5EEOA 1JNQA 3CMA3 2IA7A 4U13A 3X40A 3D9RA 1M1XB 2W9QA 2KRTA 4QWTA 2GU3A 3EBYA 1Q814 2Q07A 3GWRA 2Z6BA 3KSPA 4IPBA 2BHMA 1FGMA 4L7KA 1IV9A 5CXOA 3X3ZA 3FKAA 3K7CA 1ROAA 4FMAA 1JKGB 1RN7A 2YFJB 3Q90A 2HMNB 3S28A 4O8SA 3S5CA 2IMJA 4N6NB 3T8NA 5AEUB 3LTCA 3GZBA 3PCSA 1W6GA 3LMLA 1W6CA 3X3XA 3LTDA 1TUHA 1UI8A 1US1A 1YIJ3 2E2UA 3KE7A 4AKZA 4LZIA 3F40A 4FMBA 1DYUA 3MG3A 3X41A 3EHCA 2M7OA 1NB5I 1IK3A 1Q40A 3CCJ3 1KC84 1DMMA 3X3YA 1OHPA 5CLKA 1Q824 1OHSA 3F7XA 4H3UA 3MKIA 1Q7Y4 3IPTA 4O02B 4N6MA 4LSOA 2WOHA 1NB3I 2I9WA 4ZM8A 1N9JA 2JDIH 1EKMA 5AIFA 2E2TA 3G8ZA 2HMOB 5G2GA 3F7SA 1W5ZA 3NUVA 1NJI4 4HM4B 4WYKA 1DVCA 2W04A 2FNQA 3OWYA 3JVCA 4MMXB 1F8NA 3CME3 3NBJA 3WOEB 1ROVA 3MG2A 3BLZA 3S29A 4HM5B 3LT8A 2FXTA 2BMRB 3WA3A 3G6E3 1AVLA 4RNYA 2P0XA 3AMOA 2B1XB 3LOYA 1KSIA 5DRVA 1TFOA 4GL6A 3CCM3 3N9HA 3SXXA 1FUWA 1D6ZA 5AEWB 5ELUA 3CCU3 1L5GB 2W56B 1CYUA 3EN8A 3FGYA 4AEQA 4FCJA 4XBYA 4OVMA 1IVWA 4K90B 5LC6A 1FA3A 4HZBB 4KFDA 1QAKA 3MYTA 1JRQA 2Z77A 4N6LA 3WOFB 1K734 1ISKA 1UUVB 1STDA 4JF8A 1W02A 3CCL3 2Z7AA 2A15A 2KXGA 2W6JH 3H3HA 1SPUA 3BB9A 3WODG 2L4VA 4EV5A 3T0UA 1IV7A 1QVF2 2XEPA 4X2HA 2WOFA 3OW22 4O3VA 1ULIB 2CG0A 1O7HB 3CPOA 1K41A 1IQ8A 1FGTA 1GYBA 2RFRA 1W2ZA 2HMJB 1OHOA 2OQEC 1DMNA 3RDEA 3VF1A 2XH9A 1QJGA 5CF1A 1TP6A 2D42A 2FGTA 7STDA 1A2VA 2P38A 3CC73 1YJW3 1S723 3L0RA 3FG3A 1YHQ3 3DZLA 2E2VA 1V74A 4MEIA 1ASKA 3SEDA 3DMCA 2RGQA 4EYCA 1WMOA 2W9PA 3ECFA 2YFIB 3RGRA 1HU9A 2QEX3 3B4OA 4L8OA 4XBTA 1M9GA 3KN4A 1IT8A 5BVBA 3HZPA 1FGRA 2HMLB 2BMQB 3CCS3 4XBXA 3DM8A 1VQ73 1WTHA 2BT3A 4N3VA 3LTBA 1TIJA 2W0QA 1T5YA 2D1WA 3M8CA 4J8TA 2LQVA 3PGBA 3G16A 3LTAA 1C7HA 2CFDA 3FG4A 4CCVA 2QIYA 1S5AA 2Z76A 3EB8A 1TU5A 5A0OB 3NBRA 3Q2PA 1RKYA 2C11A 1AVKA 1MNLA 1G96A 5EVHA 1VQ83 3HX8A 3NHXA 3MSOA 4HVNA 1VQM3 4R9LA 1YJ93 2WGOA 2QGUA 3D3LA 4N6V0 2BNGA 1UW1A 3K5TA 2BO9B 1KQS2 4KFEA 1W6YA 4G1MB 2CWUA 3DGMA 2GBWB 2XFTA 4N6OB 3J7Yd 2XGNA 1GD3A 5IG4A 3CXC2 5FGOA 4EXRA 3FSDA 5KP1A 1GY7A 1O7NB 3FLJA 4KVHA 2ML6A 5IG0A 1OACA 4HM3B 4OUQA 1J2BA 4WFOA 3ALAA 4STDA 2CFWA 4WWUC 3ROBA 1IU7A 2JQ5A 4FR9A 3WDGB 4RBNA 2QA43 2OOVA 1SIHA 3EE1A 1IVXA 1JN5A 1O7GB 2CC3A 4N6UA 3DUKA 4MMYB 5IENA 2OTJ3 5BXQA 3MHEA 1K9M4 3F14A 2HMKB 1OCVA 1Y4KA 1Z1SA 3EBTA 4R1KA 1UI7A 4MJDA 3BNBA 5KP4A 4RNZA 5AYRB 3SX1A 3O8YA 5D83A 2GEXA 1OUNA 3SOYA 4AKYA 3K9MC 4HZ9B 2V1LA 4WP5A 3CC23 1WQLB 2ZL8A 2YFLB 1IVUA 3JUMA 5CF2A 2F98A 3UJMA 1IVVA 3BNDA 3K0ZA 3DGLA 3EX9A 3HIGA 4EC6A 2CK3H 3NX0A 2CFKA 1SJWA 3NXJA 3GZYB 1QVG2 2C10A 4HM1B 4MMZB 3G0KA 3B4PA 3JUNA 4XDWA 4IT7A 1AR0A 1VQL3 4I4KA 3NV0B 2GXFA 3S67A 1RRHA 2CWTA 3UL6A 2Y74A 2OQEA 3CNMA 2P0MA 3DGOA 3FZWA 1E3VA 3SOAA 3GRDA 1W00A 1M1K4 4K1VA 3KIIA 3X42A 1UUWB 3B7CA 5LC7A 1YJN3 1A90A 4EV2A 4X2OA 1DVDA 2K54A 1N8R4 1RJOA 2IUKA 1IDPA 1QALA 1NDOB 1M904 4H61A 5I97A 2F99A 3F8HA 2PZVA 1ZX2A 4LMIA 3OWUA 1WMPA 1JV2B 3GAXA 3IMAB 3BNCA 4R4KA 2ML5A 1A67A 2MF7A 3EQQB 3JUPA 3GZRA 4HM7B 2XRXB 1OGZA 5AYSC 4HM2B 2UX0A 3QRDA 3V99A 1O7WB 2W2CA 1MOLA 4N6TA 3ER7A 4K1UA 3G713 1KD14 2CH9A 1NO3A 1Q40B 4IIAA 3H51A 3SVAA 1NWWA 1N5PA 1WNHA 4WHAA 5IG3A 3CC43 4Q53A 2GBXB 2B24B 2CHCA 1N8QA 2OWPA 2YX9A 1JKGA 1NU3A 1AV4A 1IQYA 3FF0A 3OWSA 4BTXA 1GS3A 2XSOB 5EQLA 1W7CA 3KSED 1LOXA 4NREA 1JN5B 4HM0B 4HM6B 4ORLA 3UNLA 1VQ43 4R80A 1JB5A 3KKGA 3DY5A 3MWZA 2W03A 1W2B2 1Q864 3TDGA 1IQXA 2CKFB 5CK6A 3UL5A 1TFKA 1YGEA 3KZTA 1GY6A 5D82A 3DGNA 3PZWA 4FCMA 1O7PB 1N9EA 1E3RA 1ULJB 2ZDJA 4HM8B 3EC9A 5DREA 3VGNA 5AIIA 3LYGA 2R4IA 2XGLA 1ZO2A 4KFFA 3CCE3 3NV0A 3CCV3 4K61A 1BUQA 2P09A 3CU3A 2SBLA 1RRLA 3NBBA 3I553 1N5HA 1CEWI 4HBRA 4OK0A 3V98A 1FGOA 1R4CA 1E97A 3FG1A 3FCSB 1WMNA 2PNCA 2WO0A 5JPPA 5IEPA 2CIUA 4XDVA 3LZAA 3WMDA 1YIT3 3EF8A 2K0MA 4J9AA 2CFGA 5JBSA 1A2KA 1VQP3 1EQKA 2OCTA 1OGXA 3F8XA 3CD63 1YI23 1SIIA 1LVNA 2Y73A 1LXEA 3JUQA 2INXA 3MPHA 3CCQ3 3Q1CA 3BNEA 5STDA 4XM4A 3N8BA 2WGQA 3GZXB 3U97A 4FMDA 3MG1A 1OF5A 4FMCA 3DXOA 2CFLA 1VQ63 3HK4A 3F9SA 5D81A 4CDLA 3EN1B 4EBGA 1QMAA 2O9UX 1VQN3 3STDA 1VQ53 1KWIA 3JUOA 3A76A 3NM7A 4PEJA 4TX4A 4BTYA 3B8LA 2P05A 1CYVA 4HYZA 1D6YA 1JB4A 2HMMB 3WA2X 3AMOB 5IEOA 2CW9A 3U1WA 6STDA 2OOVC 5JPUA 3V92A 1VQ93 1U8CB 3PCRA 3LH4A 5FW5A 2MC8A 1Q42A 3NM2A 4LGQA 2XFSA 3T8UA 3E99A 1HKXA 4FCZA 4RZMA 1PU4A 5AIGA 4WYKB 1PFPA 1D6UA 2RCDA 4XB5A 2XSHB 5AI1A 4KZ1A 2CG1A 1O7MB 5KP3A 2XR8B 3EJVA 1DMQA 2KCDA 5HGRA 2O3OA 1IT7A 1EG9B 3PXMA 1YVBI 8CHOA 3G4S3 2LYXA 4NHFA 3CCR3 2CWVA 3OX9A 3KFQC 5IERA 3PS8A 1JB2A 3IJEB 2W56A 3CNXA 1JJ22 1OH0A 3HIIA 3NQYA 2OTL3 1OF5B 4L8PA 3NQZA 4R9KA 3FF2A 2XF3A 5ELJA 3SLUA 2GEYA 1U5OA 3N54B 5TGNA 2F86B 1STFI 3VSYA 1VQO3 1OPYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R4K A;  2ML5 A;  2ML6 A; 
#chains in the Genus database with same CATH topology
 3HI7 A;  3ZG5 A;  1K28 A;  1YJ9 3;  1RNB A;  1W01 A;  1W4N A;  2RSX A;  1FZU A;  1B27 A;  3QK9 A;  1CQS A;  5BU4 A;  1FGQ A;  1CH0 A;  3FH1 A;  1UCL A;  3AGO A;  1BRG A;  1I70 A;  4HKV B;  3CPW 2;  4J5K A;  2BMO B;  1VZZ A;  1VQK 3;  4JRF A;  3LXU X;  3S27 A;  2IUJ A;  2STD A;  4GB5 A;  5AIH A;  1QAF A;  5IF6 A;  1I0X A;  1BRS A;  3I0Y A;  5IG5 A;  1SQW A;  4BTW A;  2H0H A;  1EA2 A;  1GY5 A;  2GU1 A;  1K8A 4;  4O2H A;  5IW9 A;  1GD4 A;  4HJL B;  3LT9 A;  3I56 3;  3PYJ A;  3RGA A;  4LEH A;  4LYL B;  3K63 A;  1LNH A;  3UB1 A;  3OV4 A;  3OXA A;  5EEO A;  1JNQ A;  3CMA 3;  2IA7 A;  1UCK A;  4U13 A;  3X40 A;  3D9R A;  1M1X B;  2W9Q A;  2KRT A;  1BRI A;  4NPB A;  4QWT A;  2GU3 A;  9RNT A;  1RN1 A;  3EBY A;  1Q81 4;  1LRA A;  4GSP A;  3RNT A;  1BNI A;  2Q07 A;  3GWR A;  3AHS A;  2Z6B A;  3KSP A;  4IPB A;  2BHM A;  1FGM A;  4L7K A;  1IV9 A;  5CXO A;  3X3Z A;  3FKA A;  1SAR A;  1ROA A;  3K7C A;  4FMA A;  1BNJ A;  1JKG B;  1RN7 A;  1RCL A;  2YFJ B;  2HMN B;  3Q90 A;  4O8S A;  3S5C A;  3S28 A;  4CPK A;  2IMJ A;  4N6N B;  3T8N A;  4HOH A;  3LTC A;  5AEU B;  3GZB A;  3PCS A;  1W6G A;  3LML A;  1W6C A;  3X3X A;  1B3S A;  3LTD A;  5M18 A;  5RNT A;  1TUH A;  1UI8 A;  1AY7 A;  1BRH A;  1US1 A;  1YIJ 3;  2E2U A;  1GMQ A;  3KE7 A;  4AKZ A;  4CJN A;  4LZI A;  1LOW A;  2ZA4 A;  3F40 A;  4FMB A;  5G1L A;  1BU4 A;  1DYU A;  3MG3 A;  3X41 A;  3EHC A;  1GOV A;  2M7O A;  1NB5 I;  1I8V A;  1IK3 A;  1GOY A;  1BRJ A;  1Q40 A;  1BNF A;  1RMS A;  3CCJ 3;  1KC8 4;  4GHO A;  1DMM A;  3X3Y A;  1OHP A;  5CLK A;  1Q82 4;  1OHS A;  3F7X A;  3AGN A;  4H3U A;  3MKI A;  5BIR A;  1Q7Y 4;  3IPT A;  1PYL A;  3DGY A;  4O02 B;  4N6M A;  4LSO A;  1V58 A;  1NB3 I;  2WOH A;  2I9W A;  4ZM8 A;  1N9J A;  7GSP A;  2JDI H;  1EKM A;  1LOV A;  5AIF A;  2E2T A;  1BGS A;  2HMO B;  3G8Z A;  5G2G A;  3F7S A;  1W5Z A;  1YNV X;  1RTU A;  3NUV A;  3KCH A;  1NJI 4;  4HM4 B;  4WYK A;  1DVC A;  2W04 A;  2FNQ A;  3OWY A;  3JVC A;  2KF6 A;  1F8N A;  1MGR A;  4MMX B;  3WR2 A;  3NBJ A;  3CME 3;  3WOE B;  1ROV A;  3MG2 A;  3BLZ A;  3S29 A;  1HZ1 A;  2ZHX B;  3LT8 A;  4HM5 B;  2FXT A;  2BMR B;  3WA3 A;  3G6E 3;  1AVL A;  2AAE A;  1BRN L;  1ZS7 A;  1RLS A;  4RNY A;  2P0X A;  1BSE A;  3AMO A;  2B1X B;  3LOY A;  1KSI A;  5DRV A;  2IY2 A;  1TFO A;  4GL6 A;  3CCM 3;  3N9H A;  3SXX A;  1FUW A;  1D6Z A;  5AEW B;  1TRP A;  5ELU A;  3CCU 3;  1L5G B;  2W56 B;  1CYU A;  3EN8 A;  3FGY A;  4AEQ A;  4FCJ A;  4XBY A;  4OVM A;  1IVW A;  4K90 B;  5LC6 A;  1FA3 A;  4HZB B;  4KFD A;  1QAK A;  1JZO A;  1JRQ A;  2Z77 A;  3MYT A;  4N6L A;  3WOF B;  2UGI A;  1K73 4;  1ISK A;  3A5E A;  1UUV B;  1STD A;  4JF8 A;  1TJD A;  1W02 A;  3CCL 3;  2Z7A A;  2A15 A;  1MWS A;  2KXG A;  2W6J H;  3H3H A;  1SPU A;  3BB9 A;  3WOD G;  2L4V A;  4EV5 A;  3T0U A;  1IV7 A;  1QVF 2;  2XEP A;  1VQQ A;  4EW5 A;  4X2H A;  2WOF A;  1RGH A;  4O3V A;  1RGA A;  1ULI B;  3OW2 2;  2CG0 A;  1O7H B;  1UCI A;  3CPO A;  1K41 A;  1IQ8 A;  1FGT A;  1GYB A;  2RFR A;  1RSN A;  1W2Z A;  6GSP A;  2HMJ B;  1OHO A;  2OQE C;  1UGH I;  1DMN A;  3RDE A;  3VF1 A;  2XH9 A;  1YVS A;  1QJG A;  5CF1 A;  1TP6 A;  2D42 A;  2FGT A;  7STD A;  1A2V A;  2P38 A;  3CC7 3;  2F5M A;  1YJW 3;  8RNT A;  1S72 3;  3L0R A;  3FG3 A;  1YHQ 3;  1T3B A;  3BU4 A;  1GSP A;  1RGE A;  1V74 A;  2E2V A;  3DZL A;  4MEI A;  1ASK A;  3SED A;  3DMC A;  2RGQ A;  4EYC A;  1WMO A;  2W9P A;  3ECF A;  2YFI B;  3RGR A;  1HU9 A;  2QEX 3;  1FW7 A;  4ILF A;  3B4O A;  4L8O A;  4XBT A;  1Q9E A;  1M9G A;  2F56 A;  3KN4 A;  1IT8 A;  5BVB A;  3HZP A;  1FGR A;  2HML B;  2BMQ B;  3CCS 3;  4XBX A;  3DM8 A;  1VQ7 3;  1WTH A;  2BT3 A;  4N3V A;  3LTB A;  1TIJ A;  2W0Q A;  1B2Z A;  1T5Y A;  2D1W A;  3M8C A;  2HOH A;  4J8T A;  2L1S A;  2LQV A;  3PGB A;  1FUT A;  3G16 A;  3LTA A;  1C7H A;  3SYU A;  4DKI A;  2CFD A;  3FG4 A;  4CCV A;  2QIY A;  3GSP A;  1S5A A;  2Z76 A;  3HOH A;  3EB8 A;  1B21 A;  1TU5 A;  5M19 A;  2KAA A;  5A0O B;  3NBR A;  2RBI A;  3Q2P A;  1RKY A;  2C11 A;  1AVK A;  3D5G A;  1MNL A;  5G1K A;  1G96 A;  5GSP A;  5EVH A;  1VQ8 3;  3HX8 A;  3NHX A;  3MSO A;  1BAN A;  4HVN A;  1BIR A;  1UDI I;  2R41 A;  2WGO A;  4R9L A;  1VQM 3;  1RNT A;  2QGU A;  3D3L A;  4N6V 0;  2BNG A;  4RNT A;  1UW1 A;  1BSA A;  3K5T A;  2BO9 B;  1KQS 2;  4KFE A;  1W6Y A;  4G1M B;  2CWU A;  1NNV A;  3DGM A;  4BIR A;  2GBW B;  2XFT A;  4N6O B;  3J7Y d;  2XGN A;  1GD3 A;  5IG4 A;  3CXC 2;  5FGO A;  2C4B A;  3FSD A;  4EXR A;  2RNT A;  5KP1 A;  1GY7 A;  1O7N B;  1RHL A;  3FLJ A;  2ML6 A;  4KVH A;  5IG0 A;  1OAC A;  4HM3 B;  4OUQ A;  1J2B A;  4WFO A;  3ALA A;  4STD A;  2CFW A;  3DH2 A;  4WWU C;  3ROB A;  1BSC A;  4HAA A;  1IU7 A;  1GMR A;  2JQ5 A;  4FR9 A;  1MWU A;  3WDG B;  4RBN A;  1BOX A;  2QA4 3;  2OOV A;  1SIH A;  3EE1 A;  1IVX A;  2BIR A;  1JN5 A;  1YGW A;  1O7G B;  2CC3 A;  4N6U A;  1DET A;  3DUK A;  4MMY B;  5IEN A;  5BXQ A;  2OTJ 3;  3MHE A;  1K9M 4;  1C54 A;  3F14 A;  2HMK B;  2KF5 A;  1OCV A;  1MWR A;  1Y4K A;  1Z1S A;  3EBT A;  3Q3F A;  1B2S A;  4R1K A;  1UI7 A;  4MJD A;  3D5I A;  3BNB A;  5KP4 A;  4RNZ A;  5AYR B;  2KF3 A;  3SX1 A;  2KF4 A;  3O8Y A;  5D83 A;  2GEX A;  1OUN A;  3SOY A;  4AKY A;  3K9M C;  1DE3 A;  1B20 A;  4HZ9 B;  2V1L A;  4WP5 A;  3CC2 3;  1WQL B;  2ZL8 A;  2YFL B;  1IVU A;  3JUM A;  2BU4 A;  2F98 A;  3UJM A;  1IVV A;  4BU4 A;  5CF2 A;  3BND A;  1BUJ A;  3K0Z A;  1BNS A;  2K3D A;  3DGL A;  3EX9 A;  3HIG A;  1I2F A;  4EC6 A;  1V57 A;  2CK3 H;  3NX0 A;  1EUI C;  2CFK A;  1SJW A;  1RGF A;  3NXJ A;  3GZY B;  1I3F A;  1RGK A;  2C10 A;  4HM1 B;  4BL2 A;  1QVG 2;  4MMZ B;  3G0K A;  3B4P A;  3JUN A;  4XDW A;  4IT7 A;  1AR0 A;  1GOU A;  1RGC A;  1VQL 3;  4I4K A;  3NV0 B;  2GXF A;  3S67 A;  1RRH A;  2CWT A;  3UL6 A;  2Y74 A;  2OQE A;  2AAD A;  5HOH A;  3CNM A;  2P0M A;  3DGO A;  3FZW A;  1E3V A;  3SOA A;  3GRD A;  1W00 A;  1M1K 4;  4K1V A;  3KII A;  3X42 A;  1UUW B;  3B7C A;  5LC7 A;  1YJN 3;  1JZD A;  1A90 A;  4EV2 A;  4X2O A;  1DVD A;  1BNG A;  2K54 A;  1N8R 4;  1RJO A;  2IUK A;  1FYS A;  1I2G A;  1IDP A;  1QAL A;  1NDO B;  1M90 4;  2H0I A;  4H61 A;  5I97 A;  2F99 A;  1JBR A;  3AHW A;  3F8H A;  2PZV A;  3WHO A;  1ZX2 A;  1RDS A;  4LMI A;  3OWU A;  1WMP A;  1JV2 B;  3GAX A;  3IMA B;  2GSP A;  3BNC A;  4R4K A;  2ML5 A;  1A67 A;  2MF7 A;  3EQQ B;  3JUP A;  3GZR A;  4HM7 B;  1BSD A;  2F4Y A;  2XRX B;  4J5G A;  1OGZ A;  5AYS C;  4HM2 B;  1BNR A;  2UX0 A;  3QRD A;  3V99 A;  1O7W B;  1JBS A;  1UGI A;  2W2C A;  1MOL A;  4N6T A;  3ER7 A;  4K1U A;  3G71 3;  1BRK A;  1KD1 4;  2CH9 A;  1JBT A;  1NO3 A;  1X1Y A;  1Q40 B;  4IIA A;  3H51 A;  3SVA A;  1NWW A;  1N5P A;  1WNH A;  4WHA A;  5IG3 A;  3CC4 3;  4Q53 A;  2GBX B;  2B24 B;  4BL3 A;  2CHC A;  1N8Q A;  1T2H A;  2OWP A;  2YX9 A;  4I5Q A;  1PY3 A;  1JKG A;  1NU3 A;  1AV4 A;  1IQY A;  2CX1 A;  3FF0 A;  3OWS A;  4BTX A;  1BVI A;  2H0G A;  1GS3 A;  2XSO B;  5EQL A;  5M1A A;  3ZG0 A;  1W7C A;  1X1W A;  3KSE D;  1TTO A;  1LOX A;  4NRE A;  1JN5 B;  4HM0 B;  4HM6 B;  4ORL A;  3UNL A;  1VQ4 3;  4R80 A;  1UCJ A;  1JB5 A;  3KKG A;  1MGW A;  3DY5 A;  3MWZ A;  2W03 A;  1W2B 2;  1Q86 4;  3TDG A;  1IQX A;  2CKF B;  5CK6 A;  3UL5 A;  1TFK A;  1B2U A;  1YGE A;  3KZT A;  1GY6 A;  5D82 A;  3DGN A;  3PZW A;  4FCM A;  3URP A;  1TRQ A;  1O7P B;  1N9E A;  6RNT A;  1E3R A;  2F5W A;  1ULJ B;  2ZDJ A;  4HM8 B;  1G0T A;  3EC9 A;  5DRE A;  4KT3 B;  1LNI A;  3D4A A;  3LYG A;  2R4I A;  2XGL A;  5AII A;  1ZO2 A;  3D79 A;  4KFF A;  3VGN A;  3CCE 3;  3NV0 A;  1X1U A;  3CCV 3;  4K61 A;  1BUQ A;  2P09 A;  1RN4 A;  3CU3 A;  2SBL A;  1RRL A;  3NBB A;  3I55 3;  1Q7H A;  1N5H A;  1T2I A;  1CEW I;  4HBR A;  4OK0 A;  3V98 A;  1FGO A;  1R4C A;  1E97 A;  3FG1 A;  3FCS B;  1WMN A;  2PNC A;  2WO0 A;  5JPP A;  5IEP A;  2CIU A;  4XDV A;  3LZA A;  3WMD A;  1YIT 3;  3EF8 A;  2K0M A;  4J9A A;  2CFG A;  5JBS A;  1A2K A;  1VQP 3;  1EQK A;  2OCT A;  1OGX A;  3F8X A;  3CD6 3;  1YI2 3;  1SII A;  1MWT A;  1LVN A;  2Y73 A;  1LXE A;  3JUQ A;  2INX A;  3MPH A;  3CCQ 3;  3Q1C A;  3BNE A;  1A2P A;  1HYF A;  5STD A;  4XM4 A;  3N8B A;  2WGQ A;  3GZX B;  3U97 A;  4FMD A;  1IYY A;  1BNE A;  1OF5 A;  3MG1 A;  4FMC A;  3DXO A;  2CFL A;  1VQ6 3;  3HK4 A;  3F9S A;  1B2X A;  5D81 A;  4CDL A;  3EN1 B;  4EBG A;  1QMA A;  2O9U X;  1VQN 3;  3STD A;  1VQ5 3;  1KWI A;  1R4Y A;  1RCK A;  3JUO A;  3A76 A;  3NM7 A;  4PEJ A;  1UUG B;  2CX0 A;  3B8L A;  4TX4 A;  2P05 A;  4BTY A;  3ZFZ A;  1CYV A;  4HYZ A;  1D6Y A;  1JB4 A;  2HMM B;  3WA2 X;  3AMO B;  1X1X A;  5IEO A;  2SAR A;  2CW9 A;  3U1W A;  1AQZ A;  1BSB A;  6STD A;  2OOV C;  5JPU A;  3V92 A;  1VQ9 3;  1U8C B;  3PCR A;  3LH4 A;  1B2M A;  5FW5 A;  2MC8 A;  1Q42 A;  1G02 A;  3NM2 A;  1FUS A;  4LGQ A;  2XFS A;  3T8U A;  7RNT A;  3E99 A;  1HKX A;  4FCZ A;  4RZM A;  3BIR A;  1PU4 A;  5AIG A;  4WYK B;  1I0V A;  1PFP A;  1D6U A;  2RCD A;  4XB5 A;  2XSH B;  5AI1 A;  2UUG C;  4KZ1 A;  2CG1 A;  1O7M B;  5KP3 A;  2XR8 B;  3EJV A;  2IYJ A;  1DMQ A;  2KCD A;  5HGR A;  2O3O A;  1IT7 A;  1I3I A;  1ZGX A;  1RGL A;  1EG9 B;  3PXM A;  1RGG A;  1YVB I;  1I2E A;  8CHO A;  3G4S 3;  2LYX A;  4NHF A;  3CCR 3;  2CWV A;  3OX9 A;  3KFQ C;  5IER A;  3PS8 A;  1JB2 A;  1GMP A;  3IJE B;  2W56 A;  1BAO A;  3CNX A;  1JJ2 2;  1OH0 A;  1EEJ A;  3HII A;  3NQY A;  2OTL 3;  1OF5 B;  4L8P A;  2J8X B;  3NQZ A;  4R9K A;  3FF2 A;  2XF3 A;  5ELJ A;  3SLU A;  2GEY A;  1LQG C;  1U5O A;  3N54 B;  5TGN A;  1LOY A;  2F86 B;  1STF I;  3VSY A;  1VQO 3;  1OPY A;  1LQM B; 
#chains in the Genus database with same CATH homology
 3HI7 A;  1K28 A;  1W01 A;  1W4N A;  2RSX A;  3QK9 A;  1CQS A;  1FGQ A;  3FH1 A;  4HKV B;  3CPW 2;  2BMO B;  1VZZ A;  1VQK 3;  4JRF A;  3LXU X;  3S27 A;  2IUJ A;  2STD A;  4GB5 A;  5AIH A;  1QAF A;  5IF6 A;  3I0Y A;  5IG5 A;  1SQW A;  4BTW A;  1EA2 A;  1GY5 A;  2GU1 A;  1K8A 4;  4O2H A;  5IW9 A;  1GD4 A;  4HJL B;  3LT9 A;  3I56 3;  3PYJ A;  3RGA A;  4LEH A;  3K63 A;  1LNH A;  3UB1 A;  3OV4 A;  3OXA A;  5EEO A;  1JNQ A;  3CMA 3;  2IA7 A;  4U13 A;  3X40 A;  3D9R A;  1M1X B;  2W9Q A;  2KRT A;  4QWT A;  2GU3 A;  3EBY A;  1Q81 4;  2Q07 A;  3GWR A;  2Z6B A;  3KSP A;  4IPB A;  2BHM A;  1FGM A;  4L7K A;  1IV9 A;  5CXO A;  3X3Z A;  3FKA A;  3K7C A;  1ROA A;  4FMA A;  1JKG B;  1RN7 A;  2YFJ B;  3Q90 A;  2HMN B;  3S28 A;  4O8S A;  3S5C A;  2IMJ A;  4N6N B;  3T8N A;  5AEU B;  3LTC A;  3GZB A;  3PCS A;  1W6G A;  3LML A;  1W6C A;  3X3X A;  3LTD A;  1TUH A;  1UI8 A;  1US1 A;  1YIJ 3;  2E2U A;  3KE7 A;  4AKZ A;  4LZI A;  3F40 A;  4FMB A;  1DYU A;  3MG3 A;  3X41 A;  3EHC A;  2M7O A;  1NB5 I;  1IK3 A;  1Q40 A;  3CCJ 3;  1KC8 4;  1DMM A;  3X3Y A;  1OHP A;  5CLK A;  1Q82 4;  1OHS A;  3F7X A;  4H3U A;  3MKI A;  1Q7Y 4;  3IPT A;  4O02 B;  4N6M A;  4LSO A;  2WOH A;  1NB3 I;  2I9W A;  4ZM8 A;  1N9J A;  2JDI H;  1EKM A;  5AIF A;  2E2T A;  3G8Z A;  2HMO B;  5G2G A;  3F7S A;  1W5Z A;  3NUV A;  1NJI 4;  4HM4 B;  4WYK A;  1DVC A;  2W04 A;  2FNQ A;  3OWY A;  3JVC A;  4MMX B;  1F8N A;  3CME 3;  3NBJ A;  3WOE B;  1ROV A;  3MG2 A;  3BLZ A;  3S29 A;  4HM5 B;  3LT8 A;  2FXT A;  2BMR B;  3WA3 A;  3G6E 3;  1AVL A;  4RNY A;  2P0X A;  3AMO A;  2B1X B;  3LOY A;  1KSI A;  5DRV A;  1TFO A;  4GL6 A;  3CCM 3;  3N9H A;  3SXX A;  1FUW A;  1D6Z A;  5AEW B;  5ELU A;  3CCU 3;  1L5G B;  2W56 B;  1CYU A;  3EN8 A;  3FGY A;  4AEQ A;  4FCJ A;  4XBY A;  4OVM A;  1IVW A;  4K90 B;  5LC6 A;  1FA3 A;  4HZB B;  4KFD A;  1QAK A;  3MYT A;  1JRQ A;  2Z77 A;  4N6L A;  3WOF B;  1K73 4;  1ISK A;  1UUV B;  1STD A;  4JF8 A;  1W02 A;  3CCL 3;  2Z7A A;  2A15 A;  2KXG A;  2W6J H;  3H3H A;  1SPU A;  3BB9 A;  3WOD G;  2L4V A;  4EV5 A;  3T0U A;  1IV7 A;  1QVF 2;  2XEP A;  4X2H A;  2WOF A;  3OW2 2;  4O3V A;  1ULI B;  2CG0 A;  1O7H B;  3CPO A;  1K41 A;  1IQ8 A;  1FGT A;  1GYB A;  2RFR A;  1W2Z A;  2HMJ B;  1OHO A;  2OQE C;  1DMN A;  3RDE A;  3VF1 A;  2XH9 A;  1QJG A;  5CF1 A;  1TP6 A;  2D42 A;  2FGT A;  7STD A;  1A2V A;  2P38 A;  3CC7 3;  1YJW 3;  1S72 3;  3L0R A;  3FG3 A;  1YHQ 3;  3DZL A;  2E2V A;  1V74 A;  4MEI A;  1ASK A;  3SED A;  3DMC A;  2RGQ A;  4EYC A;  1WMO A;  2W9P A;  3ECF A;  2YFI B;  3RGR A;  1HU9 A;  2QEX 3;  3B4O A;  4L8O A;  4XBT A;  1M9G A;  3KN4 A;  1IT8 A;  5BVB A;  3HZP A;  1FGR A;  2HML B;  2BMQ B;  3CCS 3;  4XBX A;  3DM8 A;  1VQ7 3;  1WTH A;  2BT3 A;  4N3V A;  3LTB A;  1TIJ A;  2W0Q A;  1T5Y A;  2D1W A;  3M8C A;  4J8T A;  2LQV A;  3PGB A;  3G16 A;  3LTA A;  1C7H A;  2CFD A;  3FG4 A;  4CCV A;  2QIY A;  1S5A A;  2Z76 A;  3EB8 A;  1TU5 A;  5A0O B;  3NBR A;  3Q2P A;  1RKY A;  2C11 A;  1AVK A;  1MNL A;  1G96 A;  5EVH A;  1VQ8 3;  3HX8 A;  3NHX A;  3MSO A;  4HVN A;  1VQM 3;  4R9L A;  1YJ9 3;  2WGO A;  2QGU A;  3D3L A;  4N6V 0;  2BNG A;  1UW1 A;  3K5T A;  2BO9 B;  1KQS 2;  4KFE A;  1W6Y A;  4G1M B;  2CWU A;  3DGM A;  2GBW B;  2XFT A;  4N6O B;  3J7Y d;  2XGN A;  1GD3 A;  5IG4 A;  3CXC 2;  5FGO A;  4EXR A;  3FSD A;  5KP1 A;  1GY7 A;  1O7N B;  3FLJ A;  4KVH A;  2ML6 A;  5IG0 A;  1OAC A;  4HM3 B;  4OUQ A;  1J2B A;  4WFO A;  3ALA A;  4STD A;  2CFW A;  4WWU C;  3ROB A;  1IU7 A;  2JQ5 A;  4FR9 A;  3WDG B;  4RBN A;  2QA4 3;  2OOV A;  1SIH A;  3EE1 A;  1IVX A;  1JN5 A;  1O7G B;  2CC3 A;  4N6U A;  3DUK A;  4MMY B;  5IEN A;  2OTJ 3;  5BXQ A;  3MHE A;  1K9M 4;  3F14 A;  2HMK B;  1OCV A;  1Y4K A;  1Z1S A;  3EBT A;  4R1K A;  1UI7 A;  4MJD A;  3BNB A;  5KP4 A;  4RNZ A;  5AYR B;  3SX1 A;  3O8Y A;  5D83 A;  2GEX A;  1OUN A;  3SOY A;  4AKY A;  3K9M C;  4HZ9 B;  2V1L A;  4WP5 A;  3CC2 3;  1WQL B;  2ZL8 A;  2YFL B;  1IVU A;  3JUM A;  5CF2 A;  2F98 A;  3UJM A;  1IVV A;  3BND A;  3K0Z A;  3DGL A;  3EX9 A;  3HIG A;  4EC6 A;  2CK3 H;  3NX0 A;  2CFK A;  1SJW A;  3NXJ A;  3GZY B;  1QVG 2;  2C10 A;  4HM1 B;  4MMZ B;  3G0K A;  3B4P A;  3JUN A;  4XDW A;  4IT7 A;  1AR0 A;  1VQL 3;  4I4K A;  3NV0 B;  2GXF A;  3S67 A;  1RRH A;  2CWT A;  3UL6 A;  2Y74 A;  2OQE A;  3CNM A;  2P0M A;  3DGO A;  3FZW A;  1E3V A;  3SOA A;  3GRD A;  1W00 A;  1M1K 4;  4K1V A;  3KII A;  3X42 A;  1UUW B;  3B7C A;  5LC7 A;  1YJN 3;  1A90 A;  4EV2 A;  4X2O A;  1DVD A;  2K54 A;  1N8R 4;  1RJO A;  2IUK A;  1IDP A;  1QAL A;  1NDO B;  1M90 4;  4H61 A;  5I97 A;  2F99 A;  3F8H A;  2PZV A;  1ZX2 A;  4LMI A;  3OWU A;  1WMP A;  1JV2 B;  3GAX A;  3IMA B;  3BNC A;  4R4K A;  2ML5 A;  1A67 A;  2MF7 A;  3EQQ B;  3JUP A;  3GZR A;  4HM7 B;  2XRX B;  1OGZ A;  5AYS C;  4HM2 B;  2UX0 A;  3QRD A;  3V99 A;  1O7W B;  2W2C A;  1MOL A;  4N6T A;  3ER7 A;  4K1U A;  3G71 3;  1KD1 4;  2CH9 A;  1NO3 A;  1Q40 B;  4IIA A;  3H51 A;  3SVA A;  1NWW A;  1N5P A;  1WNH A;  4WHA A;  5IG3 A;  3CC4 3;  4Q53 A;  2GBX B;  2B24 B;  2CHC A;  1N8Q A;  2OWP A;  2YX9 A;  1JKG A;  1NU3 A;  1AV4 A;  1IQY A;  3FF0 A;  3OWS A;  4BTX A;  1GS3 A;  2XSO B;  5EQL A;  1W7C A;  3KSE D;  1LOX A;  4NRE A;  1JN5 B;  4HM0 B;  4HM6 B;  4ORL A;  3UNL A;  1VQ4 3;  4R80 A;  1JB5 A;  3KKG A;  3DY5 A;  3MWZ A;  2W03 A;  1W2B 2;  1Q86 4;  3TDG A;  1IQX A;  2CKF B;  5CK6 A;  3UL5 A;  1TFK A;  1YGE A;  3KZT A;  1GY6 A;  5D82 A;  3DGN A;  3PZW A;  4FCM A;  1O7P B;  1N9E A;  1E3R A;  1ULJ B;  2ZDJ A;  4HM8 B;  3EC9 A;  5DRE A;  3VGN A;  5AII A;  3LYG A;  2R4I A;  2XGL A;  1ZO2 A;  4KFF A;  3CCE 3;  3NV0 A;  3CCV 3;  4K61 A;  1BUQ A;  2P09 A;  3CU3 A;  2SBL A;  1RRL A;  3NBB A;  3I55 3;  1N5H A;  1CEW I;  4HBR A;  4OK0 A;  3V98 A;  1FGO A;  1R4C A;  1E97 A;  3FG1 A;  3FCS B;  1WMN A;  2PNC A;  2WO0 A;  5JPP A;  5IEP A;  2CIU A;  4XDV A;  3LZA A;  3WMD A;  1YIT 3;  3EF8 A;  2K0M A;  4J9A A;  2CFG A;  5JBS A;  1A2K A;  1VQP 3;  1EQK A;  2OCT A;  1OGX A;  3F8X A;  3CD6 3;  1YI2 3;  1SII A;  1LVN A;  2Y73 A;  1LXE A;  3JUQ A;  2INX A;  3MPH A;  3CCQ 3;  3Q1C A;  3BNE A;  5STD A;  4XM4 A;  3N8B A;  2WGQ A;  3GZX B;  3U97 A;  4FMD A;  3MG1 A;  1OF5 A;  4FMC A;  3DXO A;  2CFL A;  1VQ6 3;  3HK4 A;  3F9S A;  5D81 A;  4CDL A;  3EN1 B;  4EBG A;  1QMA A;  2O9U X;  1VQN 3;  3STD A;  1VQ5 3;  1KWI A;  3JUO A;  3A76 A;  3NM7 A;  4PEJ A;  4TX4 A;  4BTY A;  3B8L A;  2P05 A;  1CYV A;  4HYZ A;  1D6Y A;  1JB4 A;  2HMM B;  3WA2 X;  3AMO B;  5IEO A;  2CW9 A;  3U1W A;  6STD A;  2OOV C;  5JPU A;  3V92 A;  1VQ9 3;  1U8C B;  3PCR A;  3LH4 A;  5FW5 A;  2MC8 A;  1Q42 A;  3NM2 A;  4LGQ A;  2XFS A;  3T8U A;  3E99 A;  1HKX A;  4FCZ A;  4RZM A;  1PU4 A;  5AIG A;  4WYK B;  1PFP A;  1D6U A;  2RCD A;  4XB5 A;  2XSH B;  5AI1 A;  4KZ1 A;  2CG1 A;  1O7M B;  5KP3 A;  2XR8 B;  3EJV A;  1DMQ A;  2KCD A;  5HGR A;  2O3O A;  1IT7 A;  1EG9 B;  3PXM A;  1YVB I;  8CHO A;  3G4S 3;  2LYX A;  4NHF A;  3CCR 3;  2CWV A;  3OX9 A;  3KFQ C;  5IER A;  3PS8 A;  1JB2 A;  3IJE B;  2W56 A;  3CNX A;  1JJ2 2;  1OH0 A;  3HII A;  3NQY A;  2OTL 3;  1OF5 B;  4L8P A;  3NQZ A;  4R9K A;  3FF2 A;  2XF3 A;  5ELJ A;  3SLU A;  2GEY A;  1U5O A;  3N54 B;  5TGN A;  2F86 B;  1STF I;  3VSY A;  1VQO 3;  1OPY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...