1LQMB

Escherichia coli uracil-dna glycosylase complex with uracil-dna glycosylase inhibitor protein
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
82
structure length
82
Chain Sequence
NLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords URACIL-DNA GLYCOSYLASE
publication title Domain closure and action of uracil DNA glycosylase (UDG): structures of new crystal forms containing the Escherichia coli enzyme and a comparative study of the known structures involving UDG.
pubmed doi rcsb
source organism Escherichia coli
total genus 19
structure length 82
sequence length 82
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2002-05-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.20 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Bacteriophage PBS2, uracil-glycosylase inhibitor 1lqmB00
1LQMB 1EUIC 1UDII 1UGIA 1UUGB 2UUGC 2UGIA 4LYLB 2J8XB 2ZHXB 1UGHI 1LQGC
chains in the Genus database with same CATH superfamily
3LTCA 2HMKB 2H0GA 4KT3B 1ZGXA 1VQM3 2OTJ3 3D3LA 1UUVB 5KP4A 3OW22 2PNCA 3EC9A 3AMOB 2KAAA 4FMBA 1R4YA 3AMOA 5STDA 3NM7A 5AIFA 5BIRA 2UX0A 5BVBA 3CCL3 3JUMA 4MMXB 3BNEA 3LT9A 4AKYA 2XR8B 3SVAA 1V58A 2Z77A 3D5IA 3LOYA 3CMA3 1W02A 2XF3A 1T3BA 3LMLA 3N8BA 4BL3A 2P09A 3MG2A 3UB1A 2Z76A 1ASKA 4K90B 3K0ZA 1N8R4 1S5AA 5EVHA 1BSCA 1FGOA 3NV0B 4IT7A 1IK3A 4HM1B 1A2VA 1VQ83 1Y4KA 5IG0A 1NWWA 5D83A 5G2GA 2BHMA 1JZOA 1YGWA 5GSPA 5D82A 5IERA 1IQYA 3A76A 2W6JH 3LXUX 5M19A 4RNYA 1W2B2 2GU3A 1BNSA 2XGLA 3FSDA 3MWZA 2XRXB 4I4KA 5D81A 1VQQA 1I3IA 1OHOA 2AAEA 1V74A 2YFJB 3VSYA 2I9WA 1FYSA 4CJNA 2F99A 5IG3A 1RGGA 1A90A 4NHFA 1UCJA 3X41A 1JBSA 4WYKB 2OTL3 3GWRA 4STDA 4DKIA 1RGEA 2ML5A 1WTHA 2ZDJA 3OWYA 1SIHA 1LNIA 2HMMB 3K63A 1BNIA 3PZWA 1QMAA 2KF3A 4HM5B 2L1SA 1WMNA 3CME3 1W6GA 2CFKA 1TTOA 2IY2A 3CNMA 1BGSA 3DH2A 4FMCA 4N3VA 1N9EA 3SOYA 1DVDA 1BRSA 3G713 4LSOA 2CWUA 1LOVA 5JPUA 3JVCA 3B4OA 1GD3A 1LOXA 1RDSA 1U8CB 5IENA 2XFSA 4HOHA 3CC23 1VQP3 4AEQA 1EUIC 3FLJA 3FKAA 1I0XA 4LEHA 3EQQB 1D6ZA 4R9LA 2J8XB 1QVF2 1NJI4 1UGHI 1OH0A 3ZG0A 3CPOA 1BANA 1BNRA 1MWSA 4MMZB 3MG1A 3NX0A 3MPHA 1GOUA 4WHAA 2WGOA 4EC6A 1K9M4 3I0YA 4O3VA 3UL5A 2CH9A 1B2ZA 1OCVA 1I2EA 1BRHA 1OHPA 1DVCA 1YJ93 3LTDA 5CXOA 3TDGA 4HM2B 1GOYA 4N6TA 5LC7A 1FGRA 5IEPA 1YNVX 1DMMA 3I563 3CCV3 4U13A 1B3SA 1BAOA 3ECFA 3BU4A 4GL6A 1O7NB 2CIUA 1Q824 1JBTA 2YX9A 3OV4A 2PZVA 2P05A 2KXGA 2UGIA 3ALAA 3GAXA 4KFDA 3CXC2 1TFOA 2JQ5A 4BU4A 4HM4B 3U1WA 4TX4A 3IJEB 1YJN3 3F7SA 5AEWB 1TFKA 1VQ43 3F7XA 3GZXB 3EHCA 2P0MA 3B8LA 1L5GB 4LGQA 1IVXA 1BRGA 3G8ZA 4CDLA 2Y74A 1UI7A 1W4NA 1EKMA 1OGXA 1ZX2A 4FCMA 1BUQA 1RSNA 2OQEA 7GSPA 1WMOA 2BT3A 3EN1B 3S5CA 1RJOA 3UL6A 4IPBA 3HIIA 1YGEA 1US1A 1UUWB 3B7CA 1YIJ3 1OACA 1I3FA 4LMIA 4XBXA 3QRDA 3NBBA 5M1AA 1JKGA 3PCSA 2LQVA 3D4AA 3E99A 3WOEB 1N8QA 3ZG5A 1ISKA 4JRFA 1Q7HA 1RGCA 3V92A 1MWRA 2FXTA 2OWPA 1W01A 4HZBB 4WWUC 5BU4A 3H3HA 5A0OB 1SIIA 1GY6A 4FMAA 1AVLA 3WHOA 2IA7A 1DYUA 2MF7A 4BTXA 5AYRB 3MHEA 1PFPA 2XFTA 1VQ93 1BNFA 2QEX3 1RN7A 1JNQA 2IYJA 1HKXA 3F40A 1STDA 1IDPA 3DGOA 3GRDA 1IV9A 3NXJA 1KC84 1G0TA 1K8A4 3I553 8CHOA 2GXFA 3FGYA 3L0RA 4GHOA 3SYUA 1BU4A 1BSAA 1M1K4 1BUJA 3OWSA 4R4KA 2BMQB 1JZDA 6STDA 5RNTA 1VQL3 1BRJA 2W56A 1AY7A 3AHWA 2XH9A 2CFGA 3FG3A 2XEPA 2W04A 1W6CA 2CX0A 1I70A 1C7HA 2YFLB 3FCSB 4HM3B 3WODG 3DGNA 3F8XA 1B27A 2R4IA 1I2GA 3IMAB 1DETA 2C4BA 2Z7AA 4KFEA 1Z1SA 3HI7A 5G1KA 3JUNA 1O7HB 4OVMA 4HYZA 2Y73A 7STDA 1G02A 1JRQA 2B24B 3EB8A 4BIRA 4OUQA 1MOLA 3EN8A 1T2IA 5AEUB 2KCDA 2OOVA 2B1XB 3CCQ3 2ZL8A 3K7CA 1X1XA 4EYCA 2AADA 2WO0A 4FMDA 1KD14 3X3YA 1VQ63 3HK4A 1W00A 1LNHA 3WMDA 3IPTA 5HOHA 1ZO2A 4MJDA 5LC6A 1I8VA 1TUHA 3HOHA 2P0XA 2CX1A 3OXAA 1FGQA 1Q40B 1LQGC 1O7PB 2CHCA 2HMNB 1Q40A 5CF1A 5HGRA 5FW5A 4HJLB 3M8CA 3RDEA 3NUVA 2C11A 1IVUA 2CFLA 3GZRA 3STDA 1ROVA 1EA2A 3K9MC 3WOFB 3U97A 3VF1A 1RGHA 3URPA 1UUGB 4XBTA 5AIGA 2F5WA 1NB3I 3BLZA 6RNTA 1UCIA 3JUQA 2BNGA 4R9KA 5ELJA 3EX9A 1UCKA 4HZ9B 1Q9EA 3SEDA 1A2PA 3AHSA 4EV5A 2SBLA 2JDIH 2HMOB 2V1LA 2RFRA 3EBTA 1STFI 1M904 3Q3FA 4EBGA 4WFOA 1VQ53 3KE7A 5ELUA 1W7CA 3G6E3 2KF4A 3G4S3 3HZPA 2IUJA 1RCKA 1B2UA 1DMQA 4HBRA 5IG4A 3F14A 1R4CA 1F8NA 4NREA 2F4YA 1FGTA 3AGNA 6GSPA 1AVKA 1VQK3 3BNBA 5CK6A 3EJVA 3Q2PA 4XDVA 1ULJB 5M18A 3CCR3 3MKIA 2QGUA 1RKYA 1FW7A 5IW9A 1NO3A 2IMJA 2GBWB 3DM8A 4HM7B 1VQO3 3NBRA 3V98A 1B21A 2W9PA 1GY7A 3BNCA 2XGNA 4J8TA 3S29A 4ZM8A 4N6LA 1X1UA 3GSPA 1GSPA 1QALA 4X2HA 1DE3A 2XSHB 3F8HA 1Q7Y4 2WOFA 5BXQA 1NU3A 2HOHA 1EG9B 2M7OA 2E2UA 3UNLA 1IU7A 1J2BA 3DY5A 1LXEA 3CNXA 5G1LA 1D6YA 4L8OA 1K41A 1N9JA 1CH0A 1IVVA 1CYVA 3SX1A 1CYUA 1DMNA 3QK9A 5DRVA 1K734 3ZFZA 1RRHA 3CCJ3 3PGBA 1I0VA 1OPYA 2D1WA 3JUOA 4EV2A 2O3OA 4H61A 5IEOA 2LYXA 1BNEA 4HM0B 1GMQA 3CCE3 2SARA 1Q42A 1GD4A 4ORLA 3DUKA 1E3VA 2A15A 4I5QA 1T2HA 1RNTA 8RNTA 3KZTA 1QAFA 1YVSA 1JKGB 1UI8A 5EQLA 1JN5B 1UDII 3D9RA 1W6YA 1JN5A 1IVWA 2GSPA 3KKGA 1Q814 3FF2A 3FG1A 3LTAA 2W2CA 1QJGA 5TGNA 1YJW3 3NM2A 2F86B 1JV2B 1I2FA 3WDGB 1AQZA 3N54B 1ZS7A 1GS3A 1GYBA 2P38A 4FCJA 3RGAA 3D79A 4R80A 1G96A 1WQLB 1PU4A 2R41A 5EEOA 2CFDA 3J7Yd 1E97A 2CC3A 4L8PA 3CC43 4ILFA 4HVNA 2Z6BA 3B4PA 3JUPA 3LZAA 5CF2A 1RNBA 2RBIA 3O8YA 3CCM3 3DXOA 3MYTA 1W5ZA 1MGWA 1MNLA 3SLUA 1O7GB 4HM8B 4FCZA 2F98A 1WNHA 5DREA 3WA2X 1NNVA 4XDWA 1A67A 2W56B 2STDA 3WR2A 3DGLA 3CCU3 2WOHA 4K1UA 1ULIB 3KFQC 3NQYA 4MMYB 5AI1A 3VGNA 1HYFA 2GU1A 5KP3A 1U5OA 4LZIA 4N6NB 4MEIA 1RN4A 3S28A 2QA43 4PEJA 5KP1A 3Q90A 3NQZA 3Q1CA 2E2TA 4O02B 4KFFA 1V57A 1PY3A 2GEYA 3BB9A 2QIYA 2K0MA 1BSBA 2BMRB 2RGQA 2UUGC 5FGOA 2Q07A 3KN4A 1GY5A 1JB4A 3DGMA 1B2XA 3FG4A 1FZUA 1BRKA 2CWVA 2RCDA 3FZWA 4K61A 1LRAA 2FNQA 4EW5A 4JF8A 1HU9A 1IYYA 1BSDA 1W2ZA 4G1MB 4XM4A 5JBSA 3OWUA 2HMLB 3KCHA 1AR0A 3PS8A 1HZ1A 3DZLA 4L7KA 1LOYA 3MSOA 1Q864 2CFWA 2CWTA 2K3DA 4N6OB 3A5EA 1ROAA 1KWIA 3NV0A 3LYGA 2GBXB 1RRLA 1YI23 1JJ22 2OCTA 4KVHA 2BIRA 1UCLA 1MWUA 4BL2A 3G16A 3UJMA 1YHQ3 3FH1A 4CPKA 1KSIA 2XSOB 3N9HA 1YVBI 1FUSA 3KSPA 3H51A 5AIHA 2CW9A 1C54A 4XBYA 4AKZA 1RHLA 4O8SA 4X2OA 4FR9A 3WA3A 1JB2A 4RBNA 4QWTA 3RGRA 2K54A 4K1VA 3EE1A 4IIAA 4WP5A 2W03A 4WYKA 1TIJA 1LOWA 2MC8A 1GOVA 9RNTA 1RGKA 1IT8A 1M9GA 2CKFB 3BNDA 2KF6A 4N6V0 2E2VA 1JB5A 1K28A 3LH4A 3RNTA 1YIT3 1QAKA 2YFIB 1UGIA 1NB5I 4LYLB 1MWTA 1RN1A 1N5HA 2HMJB 3CCS3 3D5GA 3GZBA 4RNTA 3FF0A 1BIRA 4RZMA 1MGRA 3DGYA 3OX9A 3LTBA 1RGLA 1KQS2 4BTWA 1BRNL 1QVG2 3F9SA 1GMPA 1OUNA 1VQ73 3ER7A 4KZ1A 3T0UA 4HM6B 1RGAA 2RSXA 2OQEC 1B2MA 1IQ8A 2BMOB 1VZZA 1OGZA 2H0HA 3KSED 1RGFA 3DMCA 1SQWA 1SPUA 3T8UA 2L4VA 3NHXA 1BOXA 3S27A 2RNTA 5JPPA 1CQSA 1LQMB 1O7MB 3T8NA 1FUTA 1FA3A 3G0KA 2IUKA 2ML6A 2FGTA 1RMSA 2CG0A 2ZA4A 3HIGA 5AIIA 2H0IA 4EXRA 1BNJA 1RLSA 1FGMA 4H3UA 1IQXA 3PCRA 1OF5B 4N6UA 4BTYA 2GEXA 3PYJA 1OF5A 4HAAA 1PYLA 3S67A 3K5TA 3CPW2 1BRIA 1SJWA 1TJDA 1CEWI 3NBJA 4J5GA 3X3XA 1X1YA 1EQKA 1M1XB 4XB5A 5AYSC 3X3ZA 1JBRA 3X40A 2INXA 4J5KA 1S723 3CU3A 3SXXA 4N6MA 3LT8A 4R1KA 1BSEA 2F5MA 4Q53A 4RNZA 1VQN3 1TRPA 4HKVB 5IG5A 1TRQA 4CCVA 3PXMA 2W9QA 1T5YA 1OHSA 1FUWA 3MG3A 3SOAA 2W0QA 3CD63 1E3RA 2CK3H 1D6UA 1N5PA 1UW1A 2F56A 3HX8A 1X1WA 2KRTA 3AGOA 3EF8A 1O7WB 1IT7A 2D42A 2BU4A 1RCLA 1RTUA 2WGQA 3GZYB 1SARA 2CG1A 1B20A 1BNGA 3EBYA 1AV4A 5CLKA 4O2HA 1NDOB 3CC73 2BO9B 1BVIA 1EEJA 1IV7A 2OOVC 3V99A 1LVNA 2KF5A 4GB5A 5I97A 1A2KA 2O9UX 1TU5A 1GMRA 4J9AA 5IF6A 3X42A 1B2SA 3KIIA 7RNTA 4NPBA 2C10A 4OK0A 4GSPA 2ZHXB 3BIRA 1TP6A 3ROBA 1WMPA
chains in the Genus database with same CATH topology
1LQMB 1EUIC 1UDII 1UGIA 1UUGB 2UUGC 2UGIA 4LYLB 2J8XB 2ZHXB 1UGHI 1LQGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LQM B;  1EUI C;  1UDI I;  1UGI A;  1UUG B;  2UUG C;  2UGI A;  4LYL B;  2J8X B;  2ZHX B;  1UGH I;  1LQG C; 
#chains in the Genus database with same CATH topology
 3LTC A;  2HMK B;  2H0G A;  4KT3 B;  1ZGX A;  1VQM 3;  2OTJ 3;  3D3L A;  1UUV B;  5KP4 A;  3OW2 2;  2PNC A;  3EC9 A;  3AMO B;  2KAA A;  4FMB A;  1R4Y A;  3AMO A;  5STD A;  3NM7 A;  5AIF A;  5BIR A;  2UX0 A;  5BVB A;  3CCL 3;  3JUM A;  4MMX B;  3BNE A;  3LT9 A;  4AKY A;  2XR8 B;  3SVA A;  1V58 A;  2Z77 A;  3D5I A;  3LOY A;  3CMA 3;  1W02 A;  2XF3 A;  1T3B A;  3LML A;  3N8B A;  4BL3 A;  2P09 A;  3MG2 A;  3UB1 A;  2Z76 A;  1ASK A;  4K90 B;  3K0Z A;  1N8R 4;  1S5A A;  5EVH A;  1BSC A;  1FGO A;  3NV0 B;  4IT7 A;  1IK3 A;  4HM1 B;  1A2V A;  1VQ8 3;  1Y4K A;  5IG0 A;  1NWW A;  5D83 A;  5G2G A;  2BHM A;  1JZO A;  1YGW A;  5GSP A;  5D82 A;  5IER A;  1IQY A;  3A76 A;  2W6J H;  3LXU X;  5M19 A;  4RNY A;  1W2B 2;  2GU3 A;  1BNS A;  2XGL A;  3FSD A;  3MWZ A;  2XRX B;  4I4K A;  5D81 A;  1VQQ A;  1I3I A;  1OHO A;  2AAE A;  1V74 A;  2YFJ B;  3VSY A;  2I9W A;  1FYS A;  4CJN A;  2F99 A;  5IG3 A;  1RGG A;  1A90 A;  4NHF A;  1UCJ A;  3X41 A;  1JBS A;  4WYK B;  2OTL 3;  3GWR A;  4STD A;  4DKI A;  1RGE A;  2ML5 A;  1WTH A;  2ZDJ A;  3OWY A;  1SIH A;  1LNI A;  2HMM B;  3K63 A;  1BNI A;  3PZW A;  1QMA A;  2KF3 A;  4HM5 B;  2L1S A;  1WMN A;  3CME 3;  1W6G A;  2CFK A;  1TTO A;  2IY2 A;  3CNM A;  1BGS A;  3DH2 A;  4FMC A;  4N3V A;  1N9E A;  3SOY A;  1DVD A;  1BRS A;  3G71 3;  4LSO A;  2CWU A;  1LOV A;  5JPU A;  3JVC A;  3B4O A;  1GD3 A;  1LOX A;  1RDS A;  1U8C B;  5IEN A;  2XFS A;  4HOH A;  3CC2 3;  1VQP 3;  4AEQ A;  1EUI C;  3FLJ A;  3FKA A;  1I0X A;  4LEH A;  3EQQ B;  1D6Z A;  4R9L A;  2J8X B;  1QVF 2;  1NJI 4;  1UGH I;  1OH0 A;  3ZG0 A;  3CPO A;  1BAN A;  1BNR A;  1MWS A;  4MMZ B;  3MG1 A;  3NX0 A;  3MPH A;  1GOU A;  4WHA A;  2WGO A;  4EC6 A;  1K9M 4;  3I0Y A;  4O3V A;  3UL5 A;  2CH9 A;  1B2Z A;  1OCV A;  1I2E A;  1BRH A;  1OHP A;  1DVC A;  1YJ9 3;  3LTD A;  5CXO A;  3TDG A;  4HM2 B;  1GOY A;  4N6T A;  5LC7 A;  1FGR A;  5IEP A;  1YNV X;  1DMM A;  3I56 3;  3CCV 3;  4U13 A;  1B3S A;  1BAO A;  3ECF A;  3BU4 A;  4GL6 A;  1O7N B;  2CIU A;  1Q82 4;  1JBT A;  2YX9 A;  3OV4 A;  2PZV A;  2P05 A;  2KXG A;  2UGI A;  3ALA A;  3GAX A;  4KFD A;  3CXC 2;  1TFO A;  2JQ5 A;  4BU4 A;  4HM4 B;  3U1W A;  4TX4 A;  3IJE B;  1YJN 3;  3F7S A;  5AEW B;  1TFK A;  1VQ4 3;  3F7X A;  3GZX B;  3EHC A;  2P0M A;  3B8L A;  1L5G B;  4LGQ A;  1IVX A;  1BRG A;  3G8Z A;  4CDL A;  2Y74 A;  1UI7 A;  1W4N A;  1EKM A;  1OGX A;  1ZX2 A;  4FCM A;  1BUQ A;  1RSN A;  2OQE A;  7GSP A;  1WMO A;  2BT3 A;  3EN1 B;  3S5C A;  1RJO A;  3UL6 A;  4IPB A;  3HII A;  1YGE A;  1US1 A;  1UUW B;  3B7C A;  1YIJ 3;  1OAC A;  1I3F A;  4LMI A;  4XBX A;  3QRD A;  3NBB A;  5M1A A;  1JKG A;  3PCS A;  2LQV A;  3D4A A;  3E99 A;  3WOE B;  1N8Q A;  3ZG5 A;  1ISK A;  4JRF A;  1Q7H A;  1RGC A;  3V92 A;  1MWR A;  2FXT A;  2OWP A;  1W01 A;  4HZB B;  4WWU C;  5BU4 A;  3H3H A;  5A0O B;  1SII A;  1GY6 A;  4FMA A;  1AVL A;  3WHO A;  2IA7 A;  1DYU A;  2MF7 A;  4BTX A;  5AYR B;  3MHE A;  1PFP A;  2XFT A;  1VQ9 3;  1BNF A;  2QEX 3;  1RN7 A;  1JNQ A;  2IYJ A;  1HKX A;  3F40 A;  1STD A;  1IDP A;  3DGO A;  3GRD A;  1IV9 A;  3NXJ A;  1KC8 4;  1G0T A;  1K8A 4;  3I55 3;  8CHO A;  2GXF A;  3FGY A;  3L0R A;  4GHO A;  3SYU A;  1BU4 A;  1BSA A;  1M1K 4;  1BUJ A;  3OWS A;  4R4K A;  2BMQ B;  1JZD A;  6STD A;  5RNT A;  1VQL 3;  1BRJ A;  2W56 A;  1AY7 A;  3AHW A;  2XH9 A;  2CFG A;  3FG3 A;  2XEP A;  2W04 A;  1W6C A;  2CX0 A;  1I70 A;  1C7H A;  2YFL B;  3FCS B;  4HM3 B;  3WOD G;  3DGN A;  3F8X A;  1B27 A;  2R4I A;  1I2G A;  3IMA B;  1DET A;  2C4B A;  2Z7A A;  4KFE A;  1Z1S A;  3HI7 A;  5G1K A;  3JUN A;  1O7H B;  4OVM A;  4HYZ A;  2Y73 A;  7STD A;  1G02 A;  1JRQ A;  2B24 B;  3EB8 A;  4BIR A;  4OUQ A;  1MOL A;  3EN8 A;  1T2I A;  5AEU B;  2KCD A;  2OOV A;  2B1X B;  3CCQ 3;  2ZL8 A;  3K7C A;  1X1X A;  4EYC A;  2AAD A;  2WO0 A;  4FMD A;  1KD1 4;  3X3Y A;  1VQ6 3;  3HK4 A;  1W00 A;  1LNH A;  3WMD A;  3IPT A;  5HOH A;  1ZO2 A;  4MJD A;  5LC6 A;  1I8V A;  1TUH A;  3HOH A;  2P0X A;  2CX1 A;  3OXA A;  1FGQ A;  1Q40 B;  1LQG C;  1O7P B;  2CHC A;  2HMN B;  1Q40 A;  5CF1 A;  5HGR A;  5FW5 A;  4HJL B;  3M8C A;  3RDE A;  3NUV A;  2C11 A;  1IVU A;  2CFL A;  3GZR A;  3STD A;  1ROV A;  1EA2 A;  3K9M C;  3WOF B;  3U97 A;  3VF1 A;  1RGH A;  3URP A;  1UUG B;  4XBT A;  5AIG A;  2F5W A;  1NB3 I;  3BLZ A;  6RNT A;  1UCI A;  3JUQ A;  2BNG A;  4R9K A;  5ELJ A;  3EX9 A;  1UCK A;  4HZ9 B;  1Q9E A;  3SED A;  1A2P A;  3AHS A;  4EV5 A;  2SBL A;  2JDI H;  2HMO B;  2V1L A;  2RFR A;  3EBT A;  1STF I;  1M90 4;  3Q3F A;  4EBG A;  4WFO A;  1VQ5 3;  3KE7 A;  5ELU A;  1W7C A;  3G6E 3;  2KF4 A;  3G4S 3;  3HZP A;  2IUJ A;  1RCK A;  1B2U A;  1DMQ A;  4HBR A;  5IG4 A;  3F14 A;  1R4C A;  1F8N A;  4NRE A;  2F4Y A;  1FGT A;  3AGN A;  6GSP A;  1AVK A;  1VQK 3;  3BNB A;  5CK6 A;  3EJV A;  3Q2P A;  4XDV A;  1ULJ B;  5M18 A;  3CCR 3;  3MKI A;  2QGU A;  1RKY A;  1FW7 A;  5IW9 A;  1NO3 A;  2IMJ A;  2GBW B;  3DM8 A;  4HM7 B;  1VQO 3;  3NBR A;  3V98 A;  1B21 A;  2W9P A;  1GY7 A;  3BNC A;  2XGN A;  4J8T A;  3S29 A;  4ZM8 A;  4N6L A;  1X1U A;  3GSP A;  1GSP A;  1QAL A;  4X2H A;  1DE3 A;  2XSH B;  3F8H A;  1Q7Y 4;  2WOF A;  5BXQ A;  1NU3 A;  2HOH A;  1EG9 B;  2M7O A;  2E2U A;  3UNL A;  1IU7 A;  1J2B A;  3DY5 A;  1LXE A;  3CNX A;  5G1L A;  1D6Y A;  4L8O A;  1K41 A;  1N9J A;  1CH0 A;  1IVV A;  1CYV A;  3SX1 A;  1CYU A;  1DMN A;  3QK9 A;  5DRV A;  1K73 4;  3ZFZ A;  1RRH A;  3CCJ 3;  3PGB A;  1I0V A;  1OPY A;  2D1W A;  3JUO A;  4EV2 A;  2O3O A;  4H61 A;  5IEO A;  2LYX A;  1BNE A;  4HM0 B;  1GMQ A;  3CCE 3;  2SAR A;  1Q42 A;  1GD4 A;  4ORL A;  3DUK A;  1E3V A;  2A15 A;  4I5Q A;  1T2H A;  1RNT A;  8RNT A;  3KZT A;  1QAF A;  1YVS A;  1JKG B;  1UI8 A;  5EQL A;  1JN5 B;  1UDI I;  3D9R A;  1W6Y A;  1JN5 A;  1IVW A;  2GSP A;  3KKG A;  1Q81 4;  3FF2 A;  3FG1 A;  3LTA A;  2W2C A;  1QJG A;  5TGN A;  1YJW 3;  3NM2 A;  2F86 B;  1JV2 B;  1I2F A;  3WDG B;  1AQZ A;  3N54 B;  1ZS7 A;  1GS3 A;  1GYB A;  2P38 A;  4FCJ A;  3RGA A;  3D79 A;  4R80 A;  1G96 A;  1WQL B;  1PU4 A;  2R41 A;  5EEO A;  2CFD A;  3J7Y d;  1E97 A;  2CC3 A;  4L8P A;  3CC4 3;  4ILF A;  4HVN A;  2Z6B A;  3B4P A;  3JUP A;  3LZA A;  5CF2 A;  1RNB A;  2RBI A;  3O8Y A;  3CCM 3;  3DXO A;  3MYT A;  1W5Z A;  1MGW A;  1MNL A;  3SLU A;  1O7G B;  4HM8 B;  4FCZ A;  2F98 A;  1WNH A;  5DRE A;  3WA2 X;  1NNV A;  4XDW A;  1A67 A;  2W56 B;  2STD A;  3WR2 A;  3DGL A;  3CCU 3;  2WOH A;  4K1U A;  1ULI B;  3KFQ C;  3NQY A;  4MMY B;  5AI1 A;  3VGN A;  1HYF A;  2GU1 A;  5KP3 A;  1U5O A;  4LZI A;  4N6N B;  4MEI A;  1RN4 A;  3S28 A;  2QA4 3;  4PEJ A;  5KP1 A;  3Q90 A;  3NQZ A;  3Q1C A;  2E2T A;  4O02 B;  4KFF A;  1V57 A;  1PY3 A;  2GEY A;  3BB9 A;  2QIY A;  2K0M A;  1BSB A;  2BMR B;  2RGQ A;  2UUG C;  5FGO A;  2Q07 A;  3KN4 A;  1GY5 A;  1JB4 A;  3DGM A;  1B2X A;  3FG4 A;  1FZU A;  1BRK A;  2CWV A;  2RCD A;  3FZW A;  4K61 A;  1LRA A;  2FNQ A;  4EW5 A;  4JF8 A;  1HU9 A;  1IYY A;  1BSD A;  1W2Z A;  4G1M B;  4XM4 A;  5JBS A;  3OWU A;  2HML B;  3KCH A;  1AR0 A;  3PS8 A;  1HZ1 A;  3DZL A;  4L7K A;  1LOY A;  3MSO A;  1Q86 4;  2CFW A;  2CWT A;  2K3D A;  4N6O B;  3A5E A;  1ROA A;  1KWI A;  3NV0 A;  3LYG A;  2GBX B;  1RRL A;  1YI2 3;  1JJ2 2;  2OCT A;  4KVH A;  2BIR A;  1UCL A;  1MWU A;  4BL2 A;  3G16 A;  3UJM A;  1YHQ 3;  3FH1 A;  4CPK A;  1KSI A;  2XSO B;  3N9H A;  1YVB I;  1FUS A;  3KSP A;  3H51 A;  5AIH A;  2CW9 A;  1C54 A;  4XBY A;  4AKZ A;  1RHL A;  4O8S A;  4X2O A;  4FR9 A;  3WA3 A;  1JB2 A;  4RBN A;  4QWT A;  3RGR A;  2K54 A;  4K1V A;  3EE1 A;  4IIA A;  4WP5 A;  2W03 A;  4WYK A;  1TIJ A;  1LOW A;  2MC8 A;  1GOV A;  9RNT A;  1RGK A;  1IT8 A;  1M9G A;  2CKF B;  3BND A;  2KF6 A;  4N6V 0;  2E2V A;  1JB5 A;  1K28 A;  3LH4 A;  3RNT A;  1YIT 3;  1QAK A;  2YFI B;  1UGI A;  1NB5 I;  4LYL B;  1MWT A;  1RN1 A;  1N5H A;  2HMJ B;  3CCS 3;  3D5G A;  3GZB A;  4RNT A;  3FF0 A;  1BIR A;  4RZM A;  1MGR A;  3DGY A;  3OX9 A;  3LTB A;  1RGL A;  1KQS 2;  4BTW A;  1BRN L;  1QVG 2;  3F9S A;  1GMP A;  1OUN A;  1VQ7 3;  3ER7 A;  4KZ1 A;  3T0U A;  4HM6 B;  1RGA A;  2RSX A;  2OQE C;  1B2M A;  1IQ8 A;  2BMO B;  1VZZ A;  1OGZ A;  2H0H A;  3KSE D;  1RGF A;  3DMC A;  1SQW A;  1SPU A;  3T8U A;  2L4V A;  3NHX A;  1BOX A;  3S27 A;  2RNT A;  5JPP A;  1CQS A;  1LQM B;  1O7M B;  3T8N A;  1FUT A;  1FA3 A;  3G0K A;  2IUK A;  2ML6 A;  2FGT A;  1RMS A;  2CG0 A;  2ZA4 A;  3HIG A;  5AII A;  2H0I A;  4EXR A;  1BNJ A;  1RLS A;  1FGM A;  4H3U A;  1IQX A;  3PCR A;  1OF5 B;  4N6U A;  4BTY A;  2GEX A;  3PYJ A;  1OF5 A;  4HAA A;  1PYL A;  3S67 A;  3K5T A;  3CPW 2;  1BRI A;  1SJW A;  1TJD A;  1CEW I;  3NBJ A;  4J5G A;  3X3X A;  1X1Y A;  1EQK A;  1M1X B;  4XB5 A;  5AYS C;  3X3Z A;  1JBR A;  3X40 A;  2INX A;  4J5K A;  1S72 3;  3CU3 A;  3SXX A;  4N6M A;  3LT8 A;  4R1K A;  1BSE A;  2F5M A;  4Q53 A;  4RNZ A;  1VQN 3;  1TRP A;  4HKV B;  5IG5 A;  1TRQ A;  4CCV A;  3PXM A;  2W9Q A;  1T5Y A;  1OHS A;  1FUW A;  3MG3 A;  3SOA A;  2W0Q A;  3CD6 3;  1E3R A;  2CK3 H;  1D6U A;  1N5P A;  1UW1 A;  2F56 A;  3HX8 A;  1X1W A;  2KRT A;  3AGO A;  3EF8 A;  1O7W B;  1IT7 A;  2D42 A;  2BU4 A;  1RCL A;  1RTU A;  2WGQ A;  3GZY B;  1SAR A;  2CG1 A;  1B20 A;  1BNG A;  3EBY A;  1AV4 A;  5CLK A;  4O2H A;  1NDO B;  3CC7 3;  2BO9 B;  1BVI A;  1EEJ A;  1IV7 A;  2OOV C;  3V99 A;  1LVN A;  2KF5 A;  4GB5 A;  5I97 A;  1A2K A;  2O9U X;  1TU5 A;  1GMR A;  4J9A A;  5IF6 A;  3X42 A;  1B2S A;  3KII A;  7RNT A;  4NPB A;  2C10 A;  4OK0 A;  4GSP A;  2ZHX B;  3BIR A;  1TP6 A;  3ROB A;  1WMP A; 
#chains in the Genus database with same CATH homology
 1LQM B;  1EUI C;  1UDI I;  1UGI A;  1UUG B;  2UUG C;  2UGI A;  4LYL B;  2J8X B;  2ZHX B;  1UGH I;  1LQG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...