1LQMB

Escherichia coli uracil-dna glycosylase complex with uracil-dna glycosylase inhibitor protein
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
82
structure length
82
Chain Sequence
NLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URACIL-DNA GLYCOSYLASE
publication title Domain closure and action of uracil DNA glycosylase (UDG): structures of new crystal forms containing the Escherichia coli enzyme and a comparative study of the known structures involving UDG.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
total genus 19
structure length 82
sequence length 82
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2002-05-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.20 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Bacteriophage PBS2, uracil-glycosylase inhibitor 1lqmB00
1UGHI 1LQGC 1UDII 4LYLB 2ZHXB 1UGIA 2J8XB 1LQMB 1EUIC 2UGIA 1UUGB 2UUGC
chains in the Genus database with same CATH superfamily
1N8R4 1RNBA 1MWSA 4IPBA 2WOFA 2SBLA 1TRPA 4R4KA 3GZBA 1T5YA 5JBSA 1HKXA 4MMYB 2HMLB 1RSNA 2B1XB 1J2BA 1YJW3 4RNTA 1IDPA 1OF5B 1TFOA 1BNFA 4XDVA 3BNBA 1W6GA 2FXTA 3PCSA 6STDA 1JB2A 4EV5A 1GD4A 1IT7A 2RBIA 3BNEA 1VQ43 1IVWA 2CFLA 1IK3A 2C11A 1W02A 2BIRA 1RGFA 1UCJA 1AVLA 1YGWA 4O2HA 4XBXA 3EN1B 2E2TA 2W56A 5G2GA 1BRIA 2XGNA 1IV7A 4RNZA 3FF0A 4BL3A 4N6OB 3VSYA 4FR9A 1N9JA 4WYKA 3LTCA 1K9M4 4K61A 2IYJA 4ZM8A 1JKGA 3JUOA 4J9AA 3WDGB 3RGRA 1NU3A 4CPKA 1M1XB 3CPOA 4N6LA 1BRSA 3EB8A 3IMAB 1CYVA 1UCKA 2PZVA 3DM8A 3CC23 1IV9A 2CFWA 3FCSB 4HM4B 1X1WA 1EKMA 2CFDA 1BNRA 3EBYA 3LTDA 5AI1A 5LC7A 1BUJA 2CX0A 1I0VA 3EHCA 1GOYA 3UJMA 4HM5B 1BANA 3G16A 1UCIA 4HM7B 1WMNA 3FG4A 3EJVA 4LSOA 1YVSA 1BSAA 1CH0A 3H3HA 1JZOA 1I0XA 3X3ZA 5AIHA 1A2KA 1BUQA 5EEOA 1ULJB 1I2GA 3AHSA 5JPUA 4TX4A 2GBWB 4FMBA 5G1KA 2H0GA 1BGSA 4XDWA 1V58A 3CCU3 2W9PA 2AAEA 1JB5A 3Q90A 1B27A 3EQQB 3X42A 4CDLA 1VQO3 4WP5A 3WHOA 1R4CA 1Q864 3AGOA 3U97A 4BTYA 1W6CA 1N9EA 1SJWA 1I2FA 2KF4A 1BRHA 1IVUA 3G0KA 1LQGC 3KN4A 4EW5A 1Q814 1O7PB 5AIFA 3L0RA 4L8OA 1MNLA 2PNCA 5IW9A 4N6MA 3NUVA 3MWZA 4XBTA 5IEPA 3S29A 1OF5A 1W7CA 2BU4A 1Q7Y4 2XRXB 3NBBA 4R80A 4K1UA 3CMA3 3HIIA 2BMQB 3AHWA 1BNGA 1UGHI 1RGEA 1FGQA 1K28A 3PGBA 3WODG 5IERA 1BSDA 4OK0A 3WMDA 1QVG2 4N3VA 1RCLA 2F99A 4PEJA 3MG2A 1IVVA 1B2SA 2ZHXB 2XH9A 3CCL3 4LEHA 3GAXA 4O02B 3PZWA 3KCHA 4FCMA 4I4KA 3FF2A 2P05A 3AGNA 1SARA 3DGMA 3LYGA 1AQZA 3SX1A 1KD14 2HMOB 4J5GA 7STDA 1RMSA 2GBXB 2K0MA 1FUSA 3KE7A 1AV4A 4XM4A 4K90B 3UNLA 5CF2A 3CC43 1GMQA 1VQP3 5IEOA 5GSPA 3Q3FA 1D6YA 1ZO2A 3NBJA 3I563 3N54B 2CW9A 4L7KA 2QA43 1A2VA 1RRHA 1TUHA 3SYUA 3PS8A 4QWTA 1TRQA 3M8CA 4EV2A 4O8SA 1VQL3 2WGOA 3OW22 1R4YA 1KC84 1BOXA 1GS3A 1OGZA 2GSPA 3HI7A 1RGGA 3F7SA 4XBYA 3X3XA 1UUGB 3RDEA 2W04A 4HJLB 1VQK3 2CHCA 1WMPA 5STDA 1DMQA 2E2VA 1PY3A 1B2ZA 1B2XA 3E99A 2GXFA 4N6UA 4X2HA 3SEDA 1LOYA 1NO3A 3HOHA 1W6YA 4RBNA 3ROBA 2E2UA 3EN8A 1IQ8A 1F8NA 3I0YA 3CCE3 4X2OA 1PYLA 3ECFA 1RCKA 2UGIA 1IVXA 3D5GA 3DGNA 2RGQA 4I5QA 1M904 3NQZA 1BRGA 3S5CA 3D4AA 3CCQ3 3CCS3 4KVHA 1JJ22 1JBRA 1I8VA 1BIRA 2CWUA 2CWTA 2R4IA 5CK6A 2CG1A 3WA2X 5BXQA 1HU9A 3PCRA 1B2MA 3EC9A 1W00A 3JUMA 1IYYA 1O7GB 4HOHA 1BNJA 5M1AA 1K8A4 1JBTA 4LZIA 1ROVA 1LXEA 4HM6B 3CU3A 1O7HB 2LYXA 2RFRA 3ZFZA 3B4OA 4OVMA 2K3DA 3OV4A 5IG0A 4GSPA 3PXMA 1T2IA 1AR0A 3AMOB 1C7HA 3DGLA 3MPHA 3G4S3 4AKYA 3WA3A 3FSDA 4EXRA 4HBRA 4R1KA 1VQQA 1FUTA 2YFLB 3LTBA 4K1VA 1QAKA 3CXC2 5AEWB 1W01A 1X1YA 2ZA4A 3KSPA 1VQ73 1OCVA 1YVBI 2XSHB 5KP3A 1NB5I 1EG9B 1RGKA 1JB4A 4MEIA 4R9KA 1E3RA 3NX0A 1B3SA 5LC6A 1GY5A 2HMNB 2UUGC 3MSOA 4BIRA 3CC73 2IY2A 1FA3A 3LZAA 2BMOB 3OWSA 4MMXB 1VQ83 1LQMB 1RGHA 1STFI 2ML5A 2GEXA 2F5WA 1BSCA 1GOUA 1TP6A 1FGOA 3O8YA 3RNTA 1C54A 3KZTA 1AVKA 3LT9A 3URPA 2OQEA 5D83A 2W2CA 3V98A 5RNTA 2OQEC 1WNHA 2KF5A 1A67A 3NQYA 3QK9A 3NXJA 2B24B 2W6JH 2HMMB 2OWPA 3T8UA 4EC6A 1I2EA 5IG3A 1JRQA 2IUKA 4IIAA 2YFJB 1Z1SA 1UI8A 3B8LA 3D9RA 1Q824 1T2HA 1EQKA 4ILFA 2P0XA 3SOYA 3Q2PA 1TTOA 4HZ9B 2IUJA 2JDIH 4O3VA 3I553 2A15A 4LGQA 3H51A 3NBRA 4ORLA 5BIRA 3GRDA 4FCZA 3B7CA 4STDA 4FCJA 5EVHA 2XF3A 1FUWA 3S67A 1GMPA 1BRNL 5I97A 1A90A 4HKVB 2STDA 3X40A 1DETA 2CX1A 3OX9A 1EEJA 2C4BA 1UGIA 1KQS2 1D6ZA 3FH1A 3DZLA 1WQLB 3MKIA 1NNVA 4AEQA 1W5ZA 1O7MB 3OXAA 1MWUA 1RRLA 1ASKA 3TDGA 2MF7A 1X1XA 1HZ1A 1Q7HA 4BL2A 1US1A 5A0OB 4CCVA 4R9LA 1OUNA 3G8ZA 1IT8A 1HYFA 5CXOA 5BU4A 2GU3A 1QJGA 2W0QA 2OTL3 5AIIA 4FMAA 1N8QA 3AMOA 3CME3 1VQM3 4KFDA 1G02A 3K63A 5IG4A 3A5EA 1Q9EA 3STDA 3LH4A 2CKFB 2ZL8A 1M1K4 1ISKA 2XSOB 1DE3A 2CWVA 1ZGXA 1MWRA 3B4PA 1RGCA 3F9SA 4GL6A 2GEYA 4NPBA 5AEUB 1PU4A 1Q40B 1YJN3 1YHQ3 3LT8A 1JN5B 1D6UA 5D82A 1NB3I 2QEX3 1EA2A 3NHXA 2AADA 2SARA 3ALAA 1E3VA 2HMKB 2MC8A 1WMOA 2Y74A 1GSPA 3D79A 1BNEA 1N5HA 3MG3A 4FMDA 4G1MB 4N6V0 4RZMA 1G96A 4J5KA 3G713 1I3FA 4BU4A 1RN7A 4GHOA 1BAOA 2KXGA 1YIJ3 1BSBA 1DMNA 1ZX2A 3HX8A 3RGAA 1S723 6RNTA 3DGYA 3N8BA 3D3LA 1DYUA 1OACA 4GB5A 1YIT3 2F56A 2KF6A 3KFQC 1NWWA 1MGRA 1BNIA 5CF1A 4IT7A 1Y4KA 1X1UA 3FKAA 4N6TA 4CJNA 3GZYB 2RSXA 5KP1A 1OH0A 2JQ5A 3F40A 2L1SA 3MHEA 5IF6A 1W2B2 5JPPA 1O7WB 1DVCA 1DMMA 1U5OA 3GZRA 5ELUA 1LNHA 2LQVA 1FW7A 1FGMA 1RGAA 2XR8B 3MG1A 3LXUX 4OUQA 2BO9B 1ULIB 3D5IA 1RJOA 3CNXA 1YJ93 1S5AA 1UUVB 3F8XA 3IPTA 4NHFA 3BNDA 1OPYA 1LVNA 3DY5A 2WOHA 3CCM3 1A2PA 4HM2B 4N6NB 1Q42A 4HM8B 2BMRB 1UW1A 2ZDJA 1RKYA 2Z7AA 2I9WA 2Z77A 1CEWI 3BU4A 3NV0B 4KT3B 5DREA 1CYUA 2M7OA 1JV2B 2L4VA 1NDOB 2W9QA 1BU4A 4MMZB 1O7NB 1CQSA 1SIIA 3BNCA 3FZWA 3JVCA 2F4YA 3CD63 4U13A 3WR2A 5AIGA 1QVF2 5D81A 1OHPA 1G0TA 1GYBA 1K41A 1YI23 1TU5A 1ROAA 8CHOA 2P38A 7RNTA 3OWYA 4RNYA 2WO0A 3DUKA 4WHAA 3DXOA 4XB5A 1LOVA 2FGTA 1GY7A 5ELJA 1FGTA 3BIRA 1TFKA 2KRTA 2V1LA 3IJEB 1QMAA 1RTUA 2ML6A 2C10A 2HOHA 1BRJA 4KFFA 1K734 1RN1A 3N9HA 2Y73A 2F86B 1MWTA 2Z76A 1JBSA 2OTJ3 1Q40A 3A76A 1JN5A 1YGEA 3GWRA 1B2UA 1TJDA 1VZZA 2O9UX 3JUQA 3K9MC 3Q1CA 4L8PA 3S28A 6GSPA 3UL5A 5AYRB 3SXXA 1QALA 1T3BA 3FG3A 2XFSA 3JUPA 3T8NA 2BNGA 3EF8A 3PYJA 1BRKA 1GMRA 4Q53A 2FNQA 2Z6BA 2D1WA 3V92A 2BT3A 2HMJB 4HVNA 2YFIB 3SLUA 3NM7A 4NREA 3VF1A 3J7Yd 3FG1A 5KP4A 2CH9A 1VQ63 3EX9A 3K7CA 4HM3B 1I70A 1OGXA 3HIGA 1AY7A 5HGRA 3GSPA 4AKZA 2IA7A 1IQYA 1B20A 1GOVA 4FMCA 2D42A 2INXA 1PFPA 1NJI4 2W03A 1KWIA 3CCJ3 3G6E3 3BB9A 3DMCA 4LMIA 1TIJA 3EBTA 3SOAA 1MOLA 2F5MA 2UX0A 4WFOA 2BHMA 3WOFB 1WTHA 4HM0B 1SIHA 4KFEA 1IQXA 1JNQA 3F7XA 1LNIA 1B21A 2GU1A 3FLJA 3X41A 1OHOA 3CCV3 1BSEA 1W2ZA 1GD3A 2RNTA 1KSIA 3EE1A 1VQ93 2OCTA 3GZXB 3NV0A 1FZUA 2R41A 3U1WA 2CIUA 4HYZA 3NM2A 7GSPA 8RNTA 3VGNA 2O3OA 3HK4A 1N5PA 3KIIA 5EQLA 3LTAA 5TGNA 2W56B 3DH2A 4WWUC 1RHLA 1RDSA 1RNTA 1ZS7A 2YX9A 2H0HA 2CG0A 2J8XB 1EUIC 4J8TA 3UB1A 3ZG0A 5CLKA 4BTWA 4JRFA 5FW5A 5M19A 4JF8A 1VQ53 1DVDA 3CPW2 4WYKB 3CCR3 4HM1B 3X3YA 1JKGB 2CK3H 3T0UA 1YNVX 5AYSC 4EBGA 3K5TA 1LOXA 1SPUA 1LOWA 1IU7A 1FYSA 4H61A 1L5GB 9RNTA 3KKGA 1W4NA 2IMJA 4LYLB 3S27A 1VQN3 1LRAA 5FGOA 1V57A 1V74A 3LOYA 3LMLA 1SQWA 2WGQA 2H0IA 4BTXA 3F14A 3ER7A 2RCDA 5DRVA 3WOEB 1OHSA 2KF3A 2XFTA 2XEPA 3F8HA 1FGRA 1UUWB 2F98A 3JUNA 5HOHA 1I3IA 1BVIA 5BVBA 3MYTA 2KCDA 2CFKA 3HZPA 5G1LA 2OOVA 1RLSA 2QIYA 3BLZA 4HZBB 1U8CB 1UI7A 4KZ1A 1RN4A 2OOVC 2Q07A 4MJDA 3FGYA 2CC3A 4EYCA 4HAAA 1M9GA 1UDII 1RGLA 1E97A 3K0ZA 4DKIA 3OWUA 2P0MA 2KAAA 5IENA 3QRDA 1BNSA 2XGLA 1MGWA 1UCLA 1GY6A 1QAFA 1STDA 2CFGA 2P09A 3CNMA 5IG5A 2QGUA 1JZDA 3KSED 4H3UA 3DGOA 3UL6A 3ZG5A 3SVAA 5M18A 2K54A 3V99A
chains in the Genus database with same CATH topology
1UGHI 1LQGC 1UDII 4LYLB 2ZHXB 1UGIA 2J8XB 1LQMB 1EUIC 2UGIA 1UUGB 2UUGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UGH I;  1LQG C;  1UDI I;  4LYL B;  2ZHX B;  1UGI A;  2J8X B;  1LQM B;  1EUI C;  2UGI A;  1UUG B;  2UUG C; 
#chains in the Genus database with same CATH topology
 1N8R 4;  1RNB A;  1MWS A;  4IPB A;  2WOF A;  2SBL A;  1TRP A;  4R4K A;  3GZB A;  1T5Y A;  5JBS A;  1HKX A;  4MMY B;  2HML B;  1RSN A;  2B1X B;  1J2B A;  1YJW 3;  4RNT A;  1IDP A;  1OF5 B;  1TFO A;  1BNF A;  4XDV A;  3BNB A;  1W6G A;  2FXT A;  3PCS A;  6STD A;  1JB2 A;  4EV5 A;  1GD4 A;  1IT7 A;  2RBI A;  3BNE A;  1VQ4 3;  1IVW A;  2CFL A;  1IK3 A;  2C11 A;  1W02 A;  2BIR A;  1RGF A;  1UCJ A;  1AVL A;  1YGW A;  4O2H A;  4XBX A;  3EN1 B;  2E2T A;  2W56 A;  5G2G A;  1BRI A;  2XGN A;  1IV7 A;  4RNZ A;  3FF0 A;  4BL3 A;  4N6O B;  3VSY A;  4FR9 A;  1N9J A;  4WYK A;  3LTC A;  1K9M 4;  4K61 A;  2IYJ A;  4ZM8 A;  1JKG A;  3JUO A;  4J9A A;  3WDG B;  3RGR A;  1NU3 A;  4CPK A;  1M1X B;  3CPO A;  4N6L A;  1BRS A;  3EB8 A;  3IMA B;  1CYV A;  1UCK A;  2PZV A;  3DM8 A;  3CC2 3;  1IV9 A;  2CFW A;  3FCS B;  4HM4 B;  1X1W A;  1EKM A;  2CFD A;  1BNR A;  3EBY A;  3LTD A;  5AI1 A;  5LC7 A;  1BUJ A;  2CX0 A;  1I0V A;  3EHC A;  1GOY A;  3UJM A;  4HM5 B;  1BAN A;  3G16 A;  1UCI A;  4HM7 B;  1WMN A;  3FG4 A;  3EJV A;  4LSO A;  1YVS A;  1BSA A;  1CH0 A;  3H3H A;  1JZO A;  1I0X A;  3X3Z A;  5AIH A;  1A2K A;  1BUQ A;  5EEO A;  1ULJ B;  1I2G A;  3AHS A;  5JPU A;  4TX4 A;  2GBW B;  4FMB A;  5G1K A;  2H0G A;  1BGS A;  4XDW A;  1V58 A;  3CCU 3;  2W9P A;  2AAE A;  1JB5 A;  3Q90 A;  1B27 A;  3EQQ B;  3X42 A;  4CDL A;  1VQO 3;  4WP5 A;  3WHO A;  1R4C A;  1Q86 4;  3AGO A;  3U97 A;  4BTY A;  1W6C A;  1N9E A;  1SJW A;  1I2F A;  2KF4 A;  1BRH A;  1IVU A;  3G0K A;  1LQG C;  3KN4 A;  4EW5 A;  1Q81 4;  1O7P B;  5AIF A;  3L0R A;  4L8O A;  1MNL A;  2PNC A;  5IW9 A;  4N6M A;  3NUV A;  3MWZ A;  4XBT A;  5IEP A;  3S29 A;  1OF5 A;  1W7C A;  2BU4 A;  1Q7Y 4;  2XRX B;  3NBB A;  4R80 A;  4K1U A;  3CMA 3;  3HII A;  2BMQ B;  3AHW A;  1BNG A;  1UGH I;  1RGE A;  1FGQ A;  1K28 A;  3PGB A;  3WOD G;  5IER A;  1BSD A;  4OK0 A;  3WMD A;  1QVG 2;  4N3V A;  1RCL A;  2F99 A;  4PEJ A;  3MG2 A;  1IVV A;  1B2S A;  2ZHX B;  2XH9 A;  3CCL 3;  4LEH A;  3GAX A;  4O02 B;  3PZW A;  3KCH A;  4FCM A;  4I4K A;  3FF2 A;  2P05 A;  3AGN A;  1SAR A;  3DGM A;  3LYG A;  1AQZ A;  3SX1 A;  1KD1 4;  2HMO B;  4J5G A;  7STD A;  1RMS A;  2GBX B;  2K0M A;  1FUS A;  3KE7 A;  1AV4 A;  4XM4 A;  4K90 B;  3UNL A;  5CF2 A;  3CC4 3;  1GMQ A;  1VQP 3;  5IEO A;  5GSP A;  3Q3F A;  1D6Y A;  1ZO2 A;  3NBJ A;  3I56 3;  3N54 B;  2CW9 A;  4L7K A;  2QA4 3;  1A2V A;  1RRH A;  1TUH A;  3SYU A;  3PS8 A;  4QWT A;  1TRQ A;  3M8C A;  4EV2 A;  4O8S A;  1VQL 3;  2WGO A;  3OW2 2;  1R4Y A;  1KC8 4;  1BOX A;  1GS3 A;  1OGZ A;  2GSP A;  3HI7 A;  1RGG A;  3F7S A;  4XBY A;  3X3X A;  1UUG B;  3RDE A;  2W04 A;  4HJL B;  1VQK 3;  2CHC A;  1WMP A;  5STD A;  1DMQ A;  2E2V A;  1PY3 A;  1B2Z A;  1B2X A;  3E99 A;  2GXF A;  4N6U A;  4X2H A;  3SED A;  1LOY A;  1NO3 A;  3HOH A;  1W6Y A;  4RBN A;  3ROB A;  2E2U A;  3EN8 A;  1IQ8 A;  1F8N A;  3I0Y A;  3CCE 3;  4X2O A;  1PYL A;  3ECF A;  1RCK A;  2UGI A;  1IVX A;  3D5G A;  3DGN A;  2RGQ A;  4I5Q A;  1M90 4;  3NQZ A;  1BRG A;  3S5C A;  3D4A A;  3CCQ 3;  3CCS 3;  4KVH A;  1JJ2 2;  1JBR A;  1I8V A;  1BIR A;  2CWU A;  2CWT A;  2R4I A;  5CK6 A;  2CG1 A;  3WA2 X;  5BXQ A;  1HU9 A;  3PCR A;  1B2M A;  3EC9 A;  1W00 A;  3JUM A;  1IYY A;  1O7G B;  4HOH A;  1BNJ A;  5M1A A;  1K8A 4;  1JBT A;  4LZI A;  1ROV A;  1LXE A;  4HM6 B;  3CU3 A;  1O7H B;  2LYX A;  2RFR A;  3ZFZ A;  3B4O A;  4OVM A;  2K3D A;  3OV4 A;  5IG0 A;  4GSP A;  3PXM A;  1T2I A;  1AR0 A;  3AMO B;  1C7H A;  3DGL A;  3MPH A;  3G4S 3;  4AKY A;  3WA3 A;  3FSD A;  4EXR A;  4HBR A;  4R1K A;  1VQQ A;  1FUT A;  2YFL B;  3LTB A;  4K1V A;  1QAK A;  3CXC 2;  5AEW B;  1W01 A;  1X1Y A;  2ZA4 A;  3KSP A;  1VQ7 3;  1OCV A;  1YVB I;  2XSH B;  5KP3 A;  1NB5 I;  1EG9 B;  1RGK A;  1JB4 A;  4MEI A;  4R9K A;  1E3R A;  3NX0 A;  1B3S A;  5LC6 A;  1GY5 A;  2HMN B;  2UUG C;  3MSO A;  4BIR A;  3CC7 3;  2IY2 A;  1FA3 A;  3LZA A;  2BMO B;  3OWS A;  4MMX B;  1VQ8 3;  1LQM B;  1RGH A;  1STF I;  2ML5 A;  2GEX A;  2F5W A;  1BSC A;  1GOU A;  1TP6 A;  1FGO A;  3O8Y A;  3RNT A;  1C54 A;  3KZT A;  1AVK A;  3LT9 A;  3URP A;  2OQE A;  5D83 A;  2W2C A;  3V98 A;  5RNT A;  2OQE C;  1WNH A;  2KF5 A;  1A67 A;  3NQY A;  3QK9 A;  3NXJ A;  2B24 B;  2W6J H;  2HMM B;  2OWP A;  3T8U A;  4EC6 A;  1I2E A;  5IG3 A;  1JRQ A;  2IUK A;  4IIA A;  2YFJ B;  1Z1S A;  1UI8 A;  3B8L A;  3D9R A;  1Q82 4;  1T2H A;  1EQK A;  4ILF A;  2P0X A;  3SOY A;  3Q2P A;  1TTO A;  4HZ9 B;  2IUJ A;  2JDI H;  4O3V A;  3I55 3;  2A15 A;  4LGQ A;  3H51 A;  3NBR A;  4ORL A;  5BIR A;  3GRD A;  4FCZ A;  3B7C A;  4STD A;  4FCJ A;  5EVH A;  2XF3 A;  1FUW A;  3S67 A;  1GMP A;  1BRN L;  5I97 A;  1A90 A;  4HKV B;  2STD A;  3X40 A;  1DET A;  2CX1 A;  3OX9 A;  1EEJ A;  2C4B A;  1UGI A;  1KQS 2;  1D6Z A;  3FH1 A;  3DZL A;  1WQL B;  3MKI A;  1NNV A;  4AEQ A;  1W5Z A;  1O7M B;  3OXA A;  1MWU A;  1RRL A;  1ASK A;  3TDG A;  2MF7 A;  1X1X A;  1HZ1 A;  1Q7H A;  4BL2 A;  1US1 A;  5A0O B;  4CCV A;  4R9L A;  1OUN A;  3G8Z A;  1IT8 A;  1HYF A;  5CXO A;  5BU4 A;  2GU3 A;  1QJG A;  2W0Q A;  2OTL 3;  5AII A;  4FMA A;  1N8Q A;  3AMO A;  3CME 3;  1VQM 3;  4KFD A;  1G02 A;  3K63 A;  5IG4 A;  3A5E A;  1Q9E A;  3STD A;  3LH4 A;  2CKF B;  2ZL8 A;  1M1K 4;  1ISK A;  2XSO B;  1DE3 A;  2CWV A;  1ZGX A;  1MWR A;  3B4P A;  1RGC A;  3F9S A;  4GL6 A;  2GEY A;  4NPB A;  5AEU B;  1PU4 A;  1Q40 B;  1YJN 3;  1YHQ 3;  3LT8 A;  1JN5 B;  1D6U A;  5D82 A;  1NB3 I;  2QEX 3;  1EA2 A;  3NHX A;  2AAD A;  2SAR A;  3ALA A;  1E3V A;  2HMK B;  2MC8 A;  1WMO A;  2Y74 A;  1GSP A;  3D79 A;  1BNE A;  1N5H A;  3MG3 A;  4FMD A;  4G1M B;  4N6V 0;  4RZM A;  1G96 A;  4J5K A;  3G71 3;  1I3F A;  4BU4 A;  1RN7 A;  4GHO A;  1BAO A;  2KXG A;  1YIJ 3;  1BSB A;  1DMN A;  1ZX2 A;  3HX8 A;  3RGA A;  1S72 3;  6RNT A;  3DGY A;  3N8B A;  3D3L A;  1DYU A;  1OAC A;  4GB5 A;  1YIT 3;  2F56 A;  2KF6 A;  3KFQ C;  1NWW A;  1MGR A;  1BNI A;  5CF1 A;  4IT7 A;  1Y4K A;  1X1U A;  3FKA A;  4N6T A;  4CJN A;  3GZY B;  2RSX A;  5KP1 A;  1OH0 A;  2JQ5 A;  3F40 A;  2L1S A;  3MHE A;  5IF6 A;  1W2B 2;  5JPP A;  1O7W B;  1DVC A;  1DMM A;  1U5O A;  3GZR A;  5ELU A;  1LNH A;  2LQV A;  1FW7 A;  1FGM A;  1RGA A;  2XR8 B;  3MG1 A;  3LXU X;  4OUQ A;  2BO9 B;  1ULI B;  3D5I A;  1RJO A;  3CNX A;  1YJ9 3;  1S5A A;  1UUV B;  3F8X A;  3IPT A;  4NHF A;  3BND A;  1OPY A;  1LVN A;  3DY5 A;  2WOH A;  3CCM 3;  1A2P A;  4HM2 B;  4N6N B;  1Q42 A;  4HM8 B;  2BMR B;  1UW1 A;  2ZDJ A;  1RKY A;  2Z7A A;  2I9W A;  2Z77 A;  1CEW I;  3BU4 A;  3NV0 B;  4KT3 B;  5DRE A;  1CYU A;  2M7O A;  1JV2 B;  2L4V A;  1NDO B;  2W9Q A;  1BU4 A;  4MMZ B;  1O7N B;  1CQS A;  1SII A;  3BNC A;  3FZW A;  3JVC A;  2F4Y A;  3CD6 3;  4U13 A;  3WR2 A;  5AIG A;  1QVF 2;  5D81 A;  1OHP A;  1G0T A;  1GYB A;  1K41 A;  1YI2 3;  1TU5 A;  1ROA A;  8CHO A;  2P38 A;  7RNT A;  3OWY A;  4RNY A;  2WO0 A;  3DUK A;  4WHA A;  3DXO A;  4XB5 A;  1LOV A;  2FGT A;  1GY7 A;  5ELJ A;  1FGT A;  3BIR A;  1TFK A;  2KRT A;  2V1L A;  3IJE B;  1QMA A;  1RTU A;  2ML6 A;  2C10 A;  2HOH A;  1BRJ A;  4KFF A;  1K73 4;  1RN1 A;  3N9H A;  2Y73 A;  2F86 B;  1MWT A;  2Z76 A;  1JBS A;  2OTJ 3;  1Q40 A;  3A76 A;  1JN5 A;  1YGE A;  3GWR A;  1B2U A;  1TJD A;  1VZZ A;  2O9U X;  3JUQ A;  3K9M C;  3Q1C A;  4L8P A;  3S28 A;  6GSP A;  3UL5 A;  5AYR B;  3SXX A;  1QAL A;  1T3B A;  3FG3 A;  2XFS A;  3JUP A;  3T8N A;  2BNG A;  3EF8 A;  3PYJ A;  1BRK A;  1GMR A;  4Q53 A;  2FNQ A;  2Z6B A;  2D1W A;  3V92 A;  2BT3 A;  2HMJ B;  4HVN A;  2YFI B;  3SLU A;  3NM7 A;  4NRE A;  3VF1 A;  3J7Y d;  3FG1 A;  5KP4 A;  2CH9 A;  1VQ6 3;  3EX9 A;  3K7C A;  4HM3 B;  1I70 A;  1OGX A;  3HIG A;  1AY7 A;  5HGR A;  3GSP A;  4AKZ A;  2IA7 A;  1IQY A;  1B20 A;  1GOV A;  4FMC A;  2D42 A;  2INX A;  1PFP A;  1NJI 4;  2W03 A;  1KWI A;  3CCJ 3;  3G6E 3;  3BB9 A;  3DMC A;  4LMI A;  1TIJ A;  3EBT A;  3SOA A;  1MOL A;  2F5M A;  2UX0 A;  4WFO A;  2BHM A;  3WOF B;  1WTH A;  4HM0 B;  1SIH A;  4KFE A;  1IQX A;  1JNQ A;  3F7X A;  1LNI A;  1B21 A;  2GU1 A;  3FLJ A;  3X41 A;  1OHO A;  3CCV 3;  1BSE A;  1W2Z A;  1GD3 A;  2RNT A;  1KSI A;  3EE1 A;  1VQ9 3;  2OCT A;  3GZX B;  3NV0 A;  1FZU A;  2R41 A;  3U1W A;  2CIU A;  4HYZ A;  3NM2 A;  7GSP A;  8RNT A;  3VGN A;  2O3O A;  3HK4 A;  1N5P A;  3KII A;  5EQL A;  3LTA A;  5TGN A;  2W56 B;  3DH2 A;  4WWU C;  1RHL A;  1RDS A;  1RNT A;  1ZS7 A;  2YX9 A;  2H0H A;  2CG0 A;  2J8X B;  1EUI C;  4J8T A;  3UB1 A;  3ZG0 A;  5CLK A;  4BTW A;  4JRF A;  5FW5 A;  5M19 A;  4JF8 A;  1VQ5 3;  1DVD A;  3CPW 2;  4WYK B;  3CCR 3;  4HM1 B;  3X3Y A;  1JKG B;  2CK3 H;  3T0U A;  1YNV X;  5AYS C;  4EBG A;  3K5T A;  1LOX A;  1SPU A;  1LOW A;  1IU7 A;  1FYS A;  4H61 A;  1L5G B;  9RNT A;  3KKG A;  1W4N A;  2IMJ A;  4LYL B;  3S27 A;  1VQN 3;  1LRA A;  5FGO A;  1V57 A;  1V74 A;  3LOY A;  3LML A;  1SQW A;  2WGQ A;  2H0I A;  4BTX A;  3F14 A;  3ER7 A;  2RCD A;  5DRV A;  3WOE B;  1OHS A;  2KF3 A;  2XFT A;  2XEP A;  3F8H A;  1FGR A;  1UUW B;  2F98 A;  3JUN A;  5HOH A;  1I3I A;  1BVI A;  5BVB A;  3MYT A;  2KCD A;  2CFK A;  3HZP A;  5G1L A;  2OOV A;  1RLS A;  2QIY A;  3BLZ A;  4HZB B;  1U8C B;  1UI7 A;  4KZ1 A;  1RN4 A;  2OOV C;  2Q07 A;  4MJD A;  3FGY A;  2CC3 A;  4EYC A;  4HAA A;  1M9G A;  1UDI I;  1RGL A;  1E97 A;  3K0Z A;  4DKI A;  3OWU A;  2P0M A;  2KAA A;  5IEN A;  3QRD A;  1BNS A;  2XGL A;  1MGW A;  1UCL A;  1GY6 A;  1QAF A;  1STD A;  2CFG A;  2P09 A;  3CNM A;  5IG5 A;  2QGU A;  1JZD A;  3KSE D;  4H3U A;  3DGO A;  3UL6 A;  3ZG5 A;  3SVA A;  5M18 A;  2K54 A;  3V99 A; 
#chains in the Genus database with same CATH homology
 1UGH I;  1LQG C;  1UDI I;  4LYL B;  2ZHX B;  1UGI A;  2J8X B;  1LQM B;  1EUI C;  2UGI A;  1UUG B;  2UUG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...