1LQMB

Escherichia coli uracil-dna glycosylase complex with uracil-dna glycosylase inhibitor protein
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
82
structure length
82
Chain Sequence
NLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Domain closure and action of uracil DNA glycosylase (UDG): structures of new crystal forms containing the Escherichia coli enzyme and a comparative study of the known structures involving UDG.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords URACIL-DNA GLYCOSYLASE
total genus 19
structure length 82
sequence length 82
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2002-05-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.20 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Bacteriophage PBS2, uracil-glycosylase inhibitor 1lqmB00
1EUIC 1LQMB 1LQGC 2UGIA 4LYLB 2J8XB 2ZHXB 1UGIA 1UDII 1UGHI 2UUGC 1UUGB
chains in the Genus database with same CATH superfamily
1PYLA 1CH0A 2OOVC 4FMCA 4WHAA 1ROAA 1EA2A 1ULJB 3EBTA 1FGRA 3SX1A 1ULIB 1NB5I 3MYTA 1BVIA 2KAAA 4HM2B 8CHOA 1RNBA 2E2UA 3WA3A 1S723 3CCV3 2ZHXB 3RGAA 1JKGA 1YGEA 3F40A 1BNSA 4EC6A 1X1WA 1UGHI 4WP5A 2UUGC 3D3LA 1E3RA 1IYYA 1X1YA 4CJNA 5AIIA 4CCVA 1E3VA 4ORLA 2W9PA 1IVWA 5KP4A 1RRLA 3DGNA 4XM4A 1OHPA 4NHFA 1HU9A 1TTOA 3LTAA 4HM8B 2OOVA 3S5CA 1Q40B 1D6YA 1A90A 1WMOA 3MWZA 1PFPA 1ZGXA 3KCHA 5GSPA 3CD63 2W2CA 3NBBA 2H0GA 2RSXA 3HI7A 4HZBB 2MC8A 3LT8A 2GEXA 3Q2PA 8RNTA 3S67A 2JQ5A 1IVUA 1A2KA 3SEDA 1CYUA 2HMLB 1W4NA 4NPBA 1UI8A 4BTWA 2Q07A 1SIHA 1STFI 3KKGA 3NXJA 4RNTA 1V74A 3X41A 1BSBA 3ZFZA 2MF7A 3KE7A 5CF1A 1LXEA 3MPHA 1LOYA 2F99A 2H0IA 1I2FA 1MWSA 2Y74A 3BNEA 1IV7A 2GU1A 3F9SA 2SARA 3VF1A 1BUQA 1JBSA 2WOHA 4RNYA 2BT3A 1NNVA 3DUKA 1GD3A 3NV0A 3DGLA 3ROBA 3WOFB 2R41A 3SXXA 3DM8A 1DE3A 1NO3A 3CXC2 3JUOA 1UW1A 1IQ8A 3A5EA 2ZDJA 2GEYA 3KIIA 1X1XA 3OV4A 3D4AA 1EKMA 3D5IA 4RZMA 1FUWA 2CX0A 1VQO3 2YFJB 1IQXA 1BOXA 3RNTA 1IT8A 1W5ZA 1VQQA 2HMKB 2BMQB 3KSED 3X3ZA 5AEWB 1TU5A 2IUKA 2KF6A 6RNTA 3NHXA 1E97A 3CC73 2KF4A 1YNVX 2Z6BA 3BNCA 5FGOA 5BVBA 1AV4A 5AIGA 4TX4A 2K54A 1FUSA 1ASKA 1Q824 1UCIA 2W56A 3G6E3 1QAKA 2AAEA 1QJGA 1B2SA 3GSPA 5FW5A 3T8NA 3V92A 3BNBA 2RBIA 4EV2A 1V57A 4CDLA 3CCE3 3HOHA 3B7CA 1BRJA 1GS3A 2I9WA 1N8R4 1GY5A 1BIRA 3FSDA 1KSIA 4RNZA 1EG9B 5AIFA 4BTXA 1W00A 2OTJ3 1RJOA 5JBSA 5I97A 1RRHA 4FCZA 1JRQA 3GZXB 1MWUA 1O7MB 2UGIA 1BSAA 2CFLA 3DGMA 1A67A 3X3YA 1EQKA 2B24B 4L8OA 2KXGA 1IK3A 4AKYA 2OQEA 1MGWA 3MKIA 1GSPA 4WYKA 1JKGB 4J9AA 3M8CA 4LGQA 1VQ63 1FZUA 1K28A 1C54A 1AVKA 1BGSA 4RBNA 2OWPA 1JZDA 1US1A 1TRQA 1NDOB 4HM0B 3KZTA 4J8TA 3RDEA 1Q40A 3IPTA 2RCDA 1DETA 1JNQA 2F98A 3SOAA 1MWTA 2D1WA 3CCJ3 2O3OA 2P09A 1OACA 4WWUC 3X40A 1U5OA 5M19A 2CC3A 4XDWA 1O7HB 3Q90A 1BNIA 2ZA4A 2BU4A 4U13A 3N9HA 1DVDA 3ER7A 1V58A 4O2HA 2V1LA 1W02A 1O7PB 1I3IA 1OF5B 1B27A 3O8YA 3K7CA 1UCKA 2P38A 3EQQB 3CNXA 1OGZA 1SPUA 3LTDA 2W9QA 2XF3A 2GBXB 4L7KA 1M904 1RGCA 5CK6A 1GY6A 2AADA 2XEPA 5EQLA 3AMOA 1G96A 1BNEA 2W03A 1OF5A 1Q9EA 1K9M4 1J2BA 4N3VA 1B20A 1VQM3 1UUVB 1W6YA 2ML5A 3IMAB 1RGFA 3CMA3 1I3FA 3F8HA 3PGBA 1BRIA 3PS8A 4EW5A 5G2GA 5CF2A 4FCMA 3LXUX 4K1VA 3EX9A 3DZLA 3K63A 1N5HA 1LOVA 1BRSA 4FMDA 3WOEB 3SOYA 1W2B2 1LOWA 3GAXA 3WMDA 1BNJA 1RMSA 3A76A 1GMRA 1FYSA 1I70A 3F7SA 3JUQA 3OXAA 1ISKA 4HZ9B 2A15A 2H0HA 4BU4A 2GXFA 4HKVB 1OGXA 2HMMB 5KP3A 1UCJA 4HBRA 2IUJA 5IEPA 5DRVA 2L4VA 2W56B 4R9KA 4NREA 1OH0A 3FLJA 1GOVA 3K9MC 1JBRA 2LQVA 4GHOA 1SARA 3CCU3 1K734 1B21A 3LTBA 4N6TA 4XBXA 5HOHA 1RTUA 4HVNA 3FKAA 3LZAA 1B2UA 3CCM3 1F8NA 1JJ22 3CPOA 4BL3A 1RLSA 3G0KA 3G713 1IT7A 1HZ1A 3MHEA 2W04A 3JUNA 2WGOA 4XBTA 4K61A 3PZWA 1JV2B 3V99A 1RDSA 1RN7A 3EBYA 1W6GA 3AGOA 2CFGA 2K0MA 4Q53A 3D79A 4MEIA 1KC84 1B2MA 4LMIA 1VQ93 1VQ73 4KFEA 2CG0A 3JUMA 2CWVA 4KT3B 4HOHA 1JB4A 3UNLA 5BIRA 1AR0A 1IVXA 2C11A 2UX0A 2CHCA 4EBGA 2CFWA 1TUHA 2CFKA 1T5YA 3NUVA 3U97A 2BO9B 1G0TA 3OX9A 1IDPA 1JB2A 1T3BA 5LC6A 1BNRA 2WOFA 4HM7B 4KVHA 2XH9A 1C7HA 2IA7A 1W01A 2W6JH 2YFLB 3URPA 5RNTA 1RN1A 4R1KA 5IEOA 3ZG5A 3RGRA 3OWYA 4MMYB 5AIHA 1BUJA 2PZVA 2PNCA 2IYJA 3CCQ3 1ZS7A 2GU3A 1YJN3 1YGWA 3H51A 2BHMA 3AGNA 1BRKA 3ECFA 4LSOA 1LNIA 2FNQA 2IY2A 2CFDA 2BNGA 1JBTA 4KFDA 1Q42A 1LNHA 1PY3A 3EC9A 2CK3H 3NV0B 3EHCA 1TRPA 1EEJA 1OHOA 4QWTA 3T8UA 1M1K4 2WGQA 3WODG 4X2HA 3OWSA 3KSPA 1D6ZA 2O9UX 1MWRA 1QAFA 3MG3A 1KD14 2F5WA 3BU4A 5IG0A 1VZZA 2GBWB 1AVLA 3DH2A 4I4KA 4JF8A 4MJDA 1UGIA 1YJ93 3VGNA 1RGGA 2XRXB 3PCRA 1RKYA 3BIRA 3GZRA 6STDA 5IG3A 3S28A 1FGQA 2LYXA 3F8XA 2OQEC 2HMNB 3PYJA 1B2ZA 1SQWA 3NM7A 3WR2A 3K5TA 1I2GA 5AEUB 1MGRA 3MSOA 1VQP3 1BANA 3FF0A 1FGMA 7STDA 1BRNL 1NU3A 3L0RA 4BIRA 2HMOB 1UUGB 2GSPA 3PXMA 3FF2A 4G1MB 3KFQC 4O8SA 1RGAA 4X2OA 3DY5A 1QMAA 4LEHA 3Q3FA 1I2EA 2L1SA 3LTCA 3FG1A 3HIGA 1TFKA 2OCTA 1A2PA 3WDGB 9RNTA 1B3SA 3HK4A 3FCSB 1YIJ3 3G16A 1WTHA 1N8QA 1Q7HA 4AKZA 3GZBA 1ROVA 3S29A 2WO0A 3UL6A 3CC23 3CC43 2IMJA 4IPBA 3PCSA 3NX0A 1FGTA 1QVF2 3DGYA 3OWUA 3I0YA 4O02B 4EV5A 1YI23 3B8LA 1UCLA 4O3VA 4HM3B 3VSYA 3G4S3 1GY7A 2XFTA 4MMZB 1NB3I 4ZM8A 3DXOA 3FH1A 4FMBA 4PEJA 1GMPA 4HM4B 4R80A 3STDA 1YVSA 3GZYB 1T2IA 1VQK3 3CU3A 2YFIB 5D82A 1O7NB 3X3XA 1GMQA 3LH4A 1O7WB 2XFSA 1S5AA 2BIRA 3F7XA 2KF3A 3G8ZA 4STDA 5LC7A 2RNTA 3AHWA 1CEWI 2W0QA 3V98A 5EEOA 1HKXA 1VQ53 2CG1A 3KN4A 1D6UA 3UB1A 1CYVA 4WFOA 3N8BA 1RGLA 5BXQA 1YJW3 2BMOB 1RN4A 4KFFA 4R4KA 5IF6A 2CKFB 4H61A 3JVCA 1RNTA 5HGRA 1MNLA 1JZOA 1BSEA 4HM5B 4BTYA 2INXA 2SBLA 1M9GA 3H3HA 3K0ZA 2J8XB 1JN5A 2K3DA 3QK9A 1RGHA 3LOYA 2Z77A 3CPW2 1GD4A 1SIIA 3SLUA 4J5KA 1IQYA 1VQ43 3EF8A 1WMPA 3X42A 3OW22 4LZIA 1BRHA 1N9EA 2CWUA 1TJDA 4R9LA 3D9RA 3SVAA 5IG5A 2CX1A 3DGOA 1IVVA 2ML6A 2P05A 3NM2A 3WA2X 1U8CB 1FW7A 1STDA 4FCJA 2QEX3 2HOHA 4KZ1A 3EJVA 1I0VA 3JUPA 2CIUA 1LQMB 3GWRA 1FGOA 1LQGC 4HM1B 7GSPA 1K8A4 3FG3A 3HZPA 3NQZA 4GL6A 1N5PA 5IERA 1R4YA 2CW9A 3LYGA 2RFRA 1BNGA 4OUQA 1FUTA 3FZWA 1YHQ3 5BU4A 1W2ZA 4I5QA 2YX9A 2P0MA 4IT7A 1TIJA 4N6OB 4GSPA 5A0OB 3CCS3 1VQN3 1Q7Y4 1RHLA 4N6LA 3EE1A 3FG4A 4LYLB 3TDGA 1YIT3 1RCLA 5CLKA 3HIIA 1WMNA 2Z76A 4MMXB 1BNFA 4XB5A 2KCDA 2QA43 2Z7AA 3LT9A 2QGUA 1EUIC 5DREA 3I553 1RCKA 4N6MA 1UI7A 1A2VA 3BB9A 2OTL3 1BSCA 1Y4KA 1M1XB 5AI1A 2XGNA 1DMNA 2ZL8A 1KQS2 2FXTA 3BNDA 4WYKB 1DMMA 5JPPA 2C4BA 2CH9A 1IV9A 1DVCA 2FGTA 3MG2A 4GB5A 5AYSC 2XR8B 1LRAA 6GSPA 1GOYA 5G1KA 1TP6A 4JRFA 1RGKA 3I563 1B2XA 3EN8A 1Q814 5AYRB 1RSNA 1SJWA 4XBYA 3B4PA 5EVHA 4L8PA 2KF5A 3F14A 3NBJA 4ILFA 1BAOA 2E2VA 4N6UA 5ELJA 2XGLA 2XSHB 3UL5A 2R4IA 4HM6B 4K90B 4XDVA 5CXOA 3GRDA 3HX8A 1AY7A 1LOXA 1BRGA 1BSDA 1NWWA 2P0XA 3WHOA 2STDA 1W7CA 4AEQA 1VQL3 2B1XB 4HAAA 2Y73A 5M18A 3D5GA 2RGQA 1QALA 2CWTA 3NQYA 1DMQA 4H3UA 1NJI4 3B4OA 2BMRB 3E99A 3MG1A 4FMAA 1UUWB 2F4YA 3FGYA 5IW9A 4OVMA 1JB5A 5IENA 5ELUA 1I0XA 4N6NB 5M1AA 2F5MA 3AMOB 1CQSA 5KP1A 4N6V0 2KRTA 1X1UA 1ZX2A 3DMCA 3IJEB 4DKIA 2M7OA 1W6CA 1I8VA 3EN1B 1QVG2 1OCVA 3SYUA 4BL2A 1JN5B 1KWIA 5D83A 5STDA 5TGNA 4CPKA 1L5GB 3LMLA 1AQZA 1Z1SA 4EYCA 1OPYA 3UJMA 4EXRA 1O7GB 2JDIH 3S27A 4HYZA 2HMJB 3T0UA 1ZO2A 1YVBI 3CME3 7RNTA 1IU7A 3Q1CA 2D42A 1GOUA 1WNHA 2F56A 1N9JA 3NBRA 4OK0A 3ALAA 4IIAA 1FA3A 1TFOA 3BLZA 3EB8A 1OUNA 5JPUA 2QIYA 1VQ83 4K1UA 1DYUA 3AHSA 3N54B 1HYFA 5IG4A 1LVNA 1WQLB 2C10A 4J5GA 2E2TA 3CNMA 5D81A 5G1LA 1T2HA 1GYBA 2F86B 1G02A 1K41A 2XSOB 4FR9A 1Q864 1RGEA 3CCL3 3QRDA 3CCR3 1BU4A 3J7Yd 3ZG0A 1MOLA 1OHSA 1PU4A 3U1WA 1UDII 1R4CA 4HJLB
chains in the Genus database with same CATH topology
1EUIC 1LQMB 1LQGC 2UGIA 4LYLB 2J8XB 2ZHXB 1UGIA 1UDII 1UGHI 2UUGC 1UUGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EUI C;  1LQM B;  1LQG C;  2UGI A;  4LYL B;  2J8X B;  2ZHX B;  1UGI A;  1UDI I;  1UGH I;  2UUG C;  1UUG B; 
#chains in the Genus database with same CATH topology
 1PYL A;  1CH0 A;  2OOV C;  4FMC A;  4WHA A;  1ROA A;  1EA2 A;  1ULJ B;  3EBT A;  1FGR A;  3SX1 A;  1ULI B;  1NB5 I;  3MYT A;  1BVI A;  2KAA A;  4HM2 B;  8CHO A;  1RNB A;  2E2U A;  3WA3 A;  1S72 3;  3CCV 3;  2ZHX B;  3RGA A;  1JKG A;  1YGE A;  3F40 A;  1BNS A;  4EC6 A;  1X1W A;  1UGH I;  4WP5 A;  2UUG C;  3D3L A;  1E3R A;  1IYY A;  1X1Y A;  4CJN A;  5AII A;  4CCV A;  1E3V A;  4ORL A;  2W9P A;  1IVW A;  5KP4 A;  1RRL A;  3DGN A;  4XM4 A;  1OHP A;  4NHF A;  1HU9 A;  1TTO A;  3LTA A;  4HM8 B;  2OOV A;  3S5C A;  1Q40 B;  1D6Y A;  1A90 A;  1WMO A;  3MWZ A;  1PFP A;  1ZGX A;  3KCH A;  5GSP A;  3CD6 3;  2W2C A;  3NBB A;  2H0G A;  2RSX A;  3HI7 A;  4HZB B;  2MC8 A;  3LT8 A;  2GEX A;  3Q2P A;  8RNT A;  3S67 A;  2JQ5 A;  1IVU A;  1A2K A;  3SED A;  1CYU A;  2HML B;  1W4N A;  4NPB A;  1UI8 A;  4BTW A;  2Q07 A;  1SIH A;  1STF I;  3KKG A;  3NXJ A;  4RNT A;  1V74 A;  3X41 A;  1BSB A;  3ZFZ A;  2MF7 A;  3KE7 A;  5CF1 A;  1LXE A;  3MPH A;  1LOY A;  2F99 A;  2H0I A;  1I2F A;  1MWS A;  2Y74 A;  3BNE A;  1IV7 A;  2GU1 A;  3F9S A;  2SAR A;  3VF1 A;  1BUQ A;  1JBS A;  2WOH A;  4RNY A;  2BT3 A;  1NNV A;  3DUK A;  1GD3 A;  3NV0 A;  3DGL A;  3ROB A;  3WOF B;  2R41 A;  3SXX A;  3DM8 A;  1DE3 A;  1NO3 A;  3CXC 2;  3JUO A;  1UW1 A;  1IQ8 A;  3A5E A;  2ZDJ A;  2GEY A;  3KII A;  1X1X A;  3OV4 A;  3D4A A;  1EKM A;  3D5I A;  4RZM A;  1FUW A;  2CX0 A;  1VQO 3;  2YFJ B;  1IQX A;  1BOX A;  3RNT A;  1IT8 A;  1W5Z A;  1VQQ A;  2HMK B;  2BMQ B;  3KSE D;  3X3Z A;  5AEW B;  1TU5 A;  2IUK A;  2KF6 A;  6RNT A;  3NHX A;  1E97 A;  3CC7 3;  2KF4 A;  1YNV X;  2Z6B A;  3BNC A;  5FGO A;  5BVB A;  1AV4 A;  5AIG A;  4TX4 A;  2K54 A;  1FUS A;  1ASK A;  1Q82 4;  1UCI A;  2W56 A;  3G6E 3;  1QAK A;  2AAE A;  1QJG A;  1B2S A;  3GSP A;  5FW5 A;  3T8N A;  3V92 A;  3BNB A;  2RBI A;  4EV2 A;  1V57 A;  4CDL A;  3CCE 3;  3HOH A;  3B7C A;  1BRJ A;  1GS3 A;  2I9W A;  1N8R 4;  1GY5 A;  1BIR A;  3FSD A;  1KSI A;  4RNZ A;  1EG9 B;  5AIF A;  4BTX A;  1W00 A;  2OTJ 3;  1RJO A;  5JBS A;  5I97 A;  1RRH A;  4FCZ A;  1JRQ A;  3GZX B;  1MWU A;  1O7M B;  2UGI A;  1BSA A;  2CFL A;  3DGM A;  1A67 A;  3X3Y A;  1EQK A;  2B24 B;  4L8O A;  2KXG A;  1IK3 A;  4AKY A;  2OQE A;  1MGW A;  3MKI A;  1GSP A;  4WYK A;  1JKG B;  4J9A A;  3M8C A;  4LGQ A;  1VQ6 3;  1FZU A;  1K28 A;  1C54 A;  1AVK A;  1BGS A;  4RBN A;  2OWP A;  1JZD A;  1US1 A;  1TRQ A;  1NDO B;  4HM0 B;  3KZT A;  4J8T A;  3RDE A;  1Q40 A;  3IPT A;  2RCD A;  1DET A;  1JNQ A;  2F98 A;  3SOA A;  1MWT A;  2D1W A;  3CCJ 3;  2O3O A;  2P09 A;  1OAC A;  4WWU C;  3X40 A;  1U5O A;  5M19 A;  2CC3 A;  4XDW A;  1O7H B;  3Q90 A;  1BNI A;  2ZA4 A;  2BU4 A;  4U13 A;  3N9H A;  1DVD A;  3ER7 A;  1V58 A;  4O2H A;  2V1L A;  1W02 A;  1O7P B;  1I3I A;  1OF5 B;  1B27 A;  3O8Y A;  3K7C A;  1UCK A;  2P38 A;  3EQQ B;  3CNX A;  1OGZ A;  1SPU A;  3LTD A;  2W9Q A;  2XF3 A;  2GBX B;  4L7K A;  1M90 4;  1RGC A;  5CK6 A;  1GY6 A;  2AAD A;  2XEP A;  5EQL A;  3AMO A;  1G96 A;  1BNE A;  2W03 A;  1OF5 A;  1Q9E A;  1K9M 4;  1J2B A;  4N3V A;  1B20 A;  1VQM 3;  1UUV B;  1W6Y A;  2ML5 A;  3IMA B;  1RGF A;  3CMA 3;  1I3F A;  3F8H A;  3PGB A;  1BRI A;  3PS8 A;  4EW5 A;  5G2G A;  5CF2 A;  4FCM A;  3LXU X;  4K1V A;  3EX9 A;  3DZL A;  3K63 A;  1N5H A;  1LOV A;  1BRS A;  4FMD A;  3WOE B;  3SOY A;  1W2B 2;  1LOW A;  3GAX A;  3WMD A;  1BNJ A;  1RMS A;  3A76 A;  1GMR A;  1FYS A;  1I70 A;  3F7S A;  3JUQ A;  3OXA A;  1ISK A;  4HZ9 B;  2A15 A;  2H0H A;  4BU4 A;  2GXF A;  4HKV B;  1OGX A;  2HMM B;  5KP3 A;  1UCJ A;  4HBR A;  2IUJ A;  5IEP A;  5DRV A;  2L4V A;  2W56 B;  4R9K A;  4NRE A;  1OH0 A;  3FLJ A;  1GOV A;  3K9M C;  1JBR A;  2LQV A;  4GHO A;  1SAR A;  3CCU 3;  1K73 4;  1B21 A;  3LTB A;  4N6T A;  4XBX A;  5HOH A;  1RTU A;  4HVN A;  3FKA A;  3LZA A;  1B2U A;  3CCM 3;  1F8N A;  1JJ2 2;  3CPO A;  4BL3 A;  1RLS A;  3G0K A;  3G71 3;  1IT7 A;  1HZ1 A;  3MHE A;  2W04 A;  3JUN A;  2WGO A;  4XBT A;  4K61 A;  3PZW A;  1JV2 B;  3V99 A;  1RDS A;  1RN7 A;  3EBY A;  1W6G A;  3AGO A;  2CFG A;  2K0M A;  4Q53 A;  3D79 A;  4MEI A;  1KC8 4;  1B2M A;  4LMI A;  1VQ9 3;  1VQ7 3;  4KFE A;  2CG0 A;  3JUM A;  2CWV A;  4KT3 B;  4HOH A;  1JB4 A;  3UNL A;  5BIR A;  1AR0 A;  1IVX A;  2C11 A;  2UX0 A;  2CHC A;  4EBG A;  2CFW A;  1TUH A;  2CFK A;  1T5Y A;  3NUV A;  3U97 A;  2BO9 B;  1G0T A;  3OX9 A;  1IDP A;  1JB2 A;  1T3B A;  5LC6 A;  1BNR A;  2WOF A;  4HM7 B;  4KVH A;  2XH9 A;  1C7H A;  2IA7 A;  1W01 A;  2W6J H;  2YFL B;  3URP A;  5RNT A;  1RN1 A;  4R1K A;  5IEO A;  3ZG5 A;  3RGR A;  3OWY A;  4MMY B;  5AIH A;  1BUJ A;  2PZV A;  2PNC A;  2IYJ A;  3CCQ 3;  1ZS7 A;  2GU3 A;  1YJN 3;  1YGW A;  3H51 A;  2BHM A;  3AGN A;  1BRK A;  3ECF A;  4LSO A;  1LNI A;  2FNQ A;  2IY2 A;  2CFD A;  2BNG A;  1JBT A;  4KFD A;  1Q42 A;  1LNH A;  1PY3 A;  3EC9 A;  2CK3 H;  3NV0 B;  3EHC A;  1TRP A;  1EEJ A;  1OHO A;  4QWT A;  3T8U A;  1M1K 4;  2WGQ A;  3WOD G;  4X2H A;  3OWS A;  3KSP A;  1D6Z A;  2O9U X;  1MWR A;  1QAF A;  3MG3 A;  1KD1 4;  2F5W A;  3BU4 A;  5IG0 A;  1VZZ A;  2GBW B;  1AVL A;  3DH2 A;  4I4K A;  4JF8 A;  4MJD A;  1UGI A;  1YJ9 3;  3VGN A;  1RGG A;  2XRX B;  3PCR A;  1RKY A;  3BIR A;  3GZR A;  6STD A;  5IG3 A;  3S28 A;  1FGQ A;  2LYX A;  3F8X A;  2OQE C;  2HMN B;  3PYJ A;  1B2Z A;  1SQW A;  3NM7 A;  3WR2 A;  3K5T A;  1I2G A;  5AEU B;  1MGR A;  3MSO A;  1VQP 3;  1BAN A;  3FF0 A;  1FGM A;  7STD A;  1BRN L;  1NU3 A;  3L0R A;  4BIR A;  2HMO B;  1UUG B;  2GSP A;  3PXM A;  3FF2 A;  4G1M B;  3KFQ C;  4O8S A;  1RGA A;  4X2O A;  3DY5 A;  1QMA A;  4LEH A;  3Q3F A;  1I2E A;  2L1S A;  3LTC A;  3FG1 A;  3HIG A;  1TFK A;  2OCT A;  1A2P A;  3WDG B;  9RNT A;  1B3S A;  3HK4 A;  3FCS B;  1YIJ 3;  3G16 A;  1WTH A;  1N8Q A;  1Q7H A;  4AKZ A;  3GZB A;  1ROV A;  3S29 A;  2WO0 A;  3UL6 A;  3CC2 3;  3CC4 3;  2IMJ A;  4IPB A;  3PCS A;  3NX0 A;  1FGT A;  1QVF 2;  3DGY A;  3OWU A;  3I0Y A;  4O02 B;  4EV5 A;  1YI2 3;  3B8L A;  1UCL A;  4O3V A;  4HM3 B;  3VSY A;  3G4S 3;  1GY7 A;  2XFT A;  4MMZ B;  1NB3 I;  4ZM8 A;  3DXO A;  3FH1 A;  4FMB A;  4PEJ A;  1GMP A;  4HM4 B;  4R80 A;  3STD A;  1YVS A;  3GZY B;  1T2I A;  1VQK 3;  3CU3 A;  2YFI B;  5D82 A;  1O7N B;  3X3X A;  1GMQ A;  3LH4 A;  1O7W B;  2XFS A;  1S5A A;  2BIR A;  3F7X A;  2KF3 A;  3G8Z A;  4STD A;  5LC7 A;  2RNT A;  3AHW A;  1CEW I;  2W0Q A;  3V98 A;  5EEO A;  1HKX A;  1VQ5 3;  2CG1 A;  3KN4 A;  1D6U A;  3UB1 A;  1CYV A;  4WFO A;  3N8B A;  1RGL A;  5BXQ A;  1YJW 3;  2BMO B;  1RN4 A;  4KFF A;  4R4K A;  5IF6 A;  2CKF B;  4H61 A;  3JVC A;  1RNT A;  5HGR A;  1MNL A;  1JZO A;  1BSE A;  4HM5 B;  4BTY A;  2INX A;  2SBL A;  1M9G A;  3H3H A;  3K0Z A;  2J8X B;  1JN5 A;  2K3D A;  3QK9 A;  1RGH A;  3LOY A;  2Z77 A;  3CPW 2;  1GD4 A;  1SII A;  3SLU A;  4J5K A;  1IQY A;  1VQ4 3;  3EF8 A;  1WMP A;  3X42 A;  3OW2 2;  4LZI A;  1BRH A;  1N9E A;  2CWU A;  1TJD A;  4R9L A;  3D9R A;  3SVA A;  5IG5 A;  2CX1 A;  3DGO A;  1IVV A;  2ML6 A;  2P05 A;  3NM2 A;  3WA2 X;  1U8C B;  1FW7 A;  1STD A;  4FCJ A;  2QEX 3;  2HOH A;  4KZ1 A;  3EJV A;  1I0V A;  3JUP A;  2CIU A;  1LQM B;  3GWR A;  1FGO A;  1LQG C;  4HM1 B;  7GSP A;  1K8A 4;  3FG3 A;  3HZP A;  3NQZ A;  4GL6 A;  1N5P A;  5IER A;  1R4Y A;  2CW9 A;  3LYG A;  2RFR A;  1BNG A;  4OUQ A;  1FUT A;  3FZW A;  1YHQ 3;  5BU4 A;  1W2Z A;  4I5Q A;  2YX9 A;  2P0M A;  4IT7 A;  1TIJ A;  4N6O B;  4GSP A;  5A0O B;  3CCS 3;  1VQN 3;  1Q7Y 4;  1RHL A;  4N6L A;  3EE1 A;  3FG4 A;  4LYL B;  3TDG A;  1YIT 3;  1RCL A;  5CLK A;  3HII A;  1WMN A;  2Z76 A;  4MMX B;  1BNF A;  4XB5 A;  2KCD A;  2QA4 3;  2Z7A A;  3LT9 A;  2QGU A;  1EUI C;  5DRE A;  3I55 3;  1RCK A;  4N6M A;  1UI7 A;  1A2V A;  3BB9 A;  2OTL 3;  1BSC A;  1Y4K A;  1M1X B;  5AI1 A;  2XGN A;  1DMN A;  2ZL8 A;  1KQS 2;  2FXT A;  3BND A;  4WYK B;  1DMM A;  5JPP A;  2C4B A;  2CH9 A;  1IV9 A;  1DVC A;  2FGT A;  3MG2 A;  4GB5 A;  5AYS C;  2XR8 B;  1LRA A;  6GSP A;  1GOY A;  5G1K A;  1TP6 A;  4JRF A;  1RGK A;  3I56 3;  1B2X A;  3EN8 A;  1Q81 4;  5AYR B;  1RSN A;  1SJW A;  4XBY A;  3B4P A;  5EVH A;  4L8P A;  2KF5 A;  3F14 A;  3NBJ A;  4ILF A;  1BAO A;  2E2V A;  4N6U A;  5ELJ A;  2XGL A;  2XSH B;  3UL5 A;  2R4I A;  4HM6 B;  4K90 B;  4XDV A;  5CXO A;  3GRD A;  3HX8 A;  1AY7 A;  1LOX A;  1BRG A;  1BSD A;  1NWW A;  2P0X A;  3WHO A;  2STD A;  1W7C A;  4AEQ A;  1VQL 3;  2B1X B;  4HAA A;  2Y73 A;  5M18 A;  3D5G A;  2RGQ A;  1QAL A;  2CWT A;  3NQY A;  1DMQ A;  4H3U A;  1NJI 4;  3B4O A;  2BMR B;  3E99 A;  3MG1 A;  4FMA A;  1UUW B;  2F4Y A;  3FGY A;  5IW9 A;  4OVM A;  1JB5 A;  5IEN A;  5ELU A;  1I0X A;  4N6N B;  5M1A A;  2F5M A;  3AMO B;  1CQS A;  5KP1 A;  4N6V 0;  2KRT A;  1X1U A;  1ZX2 A;  3DMC A;  3IJE B;  4DKI A;  2M7O A;  1W6C A;  1I8V A;  3EN1 B;  1QVG 2;  1OCV A;  3SYU A;  4BL2 A;  1JN5 B;  1KWI A;  5D83 A;  5STD A;  5TGN A;  4CPK A;  1L5G B;  3LML A;  1AQZ A;  1Z1S A;  4EYC A;  1OPY A;  3UJM A;  4EXR A;  1O7G B;  2JDI H;  3S27 A;  4HYZ A;  2HMJ B;  3T0U A;  1ZO2 A;  1YVB I;  3CME 3;  7RNT A;  1IU7 A;  3Q1C A;  2D42 A;  1GOU A;  1WNH A;  2F56 A;  1N9J A;  3NBR A;  4OK0 A;  3ALA A;  4IIA A;  1FA3 A;  1TFO A;  3BLZ A;  3EB8 A;  1OUN A;  5JPU A;  2QIY A;  1VQ8 3;  4K1U A;  1DYU A;  3AHS A;  3N54 B;  1HYF A;  5IG4 A;  1LVN A;  1WQL B;  2C10 A;  4J5G A;  2E2T A;  3CNM A;  5D81 A;  5G1L A;  1T2H A;  1GYB A;  2F86 B;  1G02 A;  1K41 A;  2XSO B;  4FR9 A;  1Q86 4;  1RGE A;  3CCL 3;  3QRD A;  3CCR 3;  1BU4 A;  3J7Y d;  3ZG0 A;  1MOL A;  1OHS A;  1PU4 A;  3U1W A;  1UDI I;  1R4C A;  4HJL B; 
#chains in the Genus database with same CATH homology
 1EUI C;  1LQM B;  1LQG C;  2UGI A;  4LYL B;  2J8X B;  2ZHX B;  1UGI A;  1UDI I;  1UGH I;  2UUG C;  1UUG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...