4EW5A

C-terminal domain of inner membrane protein cigr from salmonella enterica.
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
102
structure length
102
Chain Sequence
HRKNGGKPDHVESDISYAVARQLAVNLGLTGYQSLPPGIAKNLARGKPLPPGIAKKTVPASMLGQLPYYPGYEWKIVGDNLVLIALSTAVVTAIINGVFDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CigR Protein
publication title C-terminal domain of inner membrane protein CigR from Salmonella enterica.
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Membrane protein
total genus 20
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.160 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, inner membrane protein cigr 4ew5A00
4EW5A 2L1SA
chains in the Genus database with same CATH superfamily
3BB9A 4J5GA 2KAAA 4N6LA 5EEOA 4NREA 2QEX3 1WMPA 2GSPA 2C10A 3DGLA 1JZDA 3HK4A 1X1WA 2W2CA 2LYXA 3U97A 2W03A 3GAXA 3LZAA 1LXEA 3PZWA 1EEJA 1W2ZA 1UI8A 4H3UA 4FR9A 1KD14 3T8NA 2AADA 3D5IA 1CEWI 4AEQA 2QGUA 1UDII 2ZDJA 1KSIA 3I553 1SIHA 3WA3A 4HM7B 1BVIA 1Y4KA 3F40A 3MYTA 4O3VA 3I563 1O7PB 1BGSA 4O2HA 3Q2PA 1RMSA 1X1XA 3PYJA 1I3FA 1LNHA 1W00A 4L8OA 1LOVA 4HJLB 2INXA 1YJ93 4FCZA 1YNVX 1LQGC 4XDWA 1US1A 4MEIA 5BXQA 2OCTA 3DUKA 3JUOA 3OWUA 5KP3A 1QALA 2XGLA 1A2PA 4OK0A 4BTYA 3KCHA 1Q9EA 2GBWB 3EBTA 5BVBA 4K1UA 2KCDA 1BUQA 4GHOA 1T2IA 1MWRA 3V98A 3FG3A 1GD4A 5A0OB 1BUJA 3NM7A 4L7KA 5AYRB 5IF6A 2XFTA 3FGYA 1WNHA 1V74A 1GYBA 5DREA 1OPYA 3S29A 1JZOA 2RBIA 4EV5A 2UX0A 3CPOA 2JQ5A 3NV0A 5AEWB 7STDA 1GOYA 5JPPA 1TP6A 2K0MA 1SJWA 1PY3A 1VQN3 3N8BA 1GD3A 4HKVB 4RNZA 1E3VA 3MG1A 1B27A 1ASKA 4WP5A 5RNTA 6GSPA 1FYSA 3FLJA 1YJN3 1W6CA 3WDGB 3CNMA 1JRQA 3AHWA 1VQQA 4HM3B 4TX4A 5IW9A 4HZBB 4FCMA 1LNIA 3UL5A 1HYFA 4STDA 1O7NB 2WOFA 1R4YA 1YHQ3 1LOXA 4KVHA 4RNTA 5CF1A 5CXOA 1K734 1A67A 2QIYA 2IY2A 4KFEA 4OUQA 4R9LA 4GB5A 1IV9A 3JUQA 1BRHA 4R9KA 1QVG2 4Q53A 2IA7A 3CCM3 3WODG 2BMQB 1BNGA 1SARA 4EBGA 4FMBA 4CDLA 1CYVA 3V99A 1BRSA 3NXJA 3K9MC 4WHAA 2Z7AA 3FZWA 7RNTA 1RGAA 2CWVA 4X2HA 2I9WA 2R41A 1BANA 2HMNB 2OQEA 3CCR3 3CXC2 1ULIB 1X1UA 3OXAA 1RGCA 3X40A 3K63A 3F8XA 3CC23 3JUNA 1CQSA 1BNSA 3WOFB 1BNFA 4HM8B 5FW5A 1UGIA 2STDA 3LT9A 4J9AA 2AAEA 5BIRA 1QMAA 2FXTA 3QK9A 1BRIA 3AHSA 5AYSC 1RNTA 1JB2A 3E99A 2OTL3 2L4VA 4BU4A 3G8ZA 3MG3A 1JN5B 4PEJA 2IYJA 1R4CA 1ROVA 3CCS3 1TRQA 3U1WA 2RFRA 3HIIA 2KF5A 3B4OA 2HOHA 4EC6A 2CG1A 1AVKA 1MWSA 4BTWA 3FH1A 3WA2X 2HMKB 3KFQC 3NX0A 2HMLB 3LTDA 1BSDA 3JVCA 1JBRA 8CHOA 4QWTA 5AIIA 1UUGB 1LQMB 3SXXA 1W7CA 3RDEA 1VQ73 2GEYA 3NQYA 2XSOB 3MG2A 3PGBA 3LTCA 2BMOB 1BRKA 3NV0B 2H0IA 4GL6A 5IG0A 1YJW3 4HM6B 3RGRA 1BAOA 1N9EA 5TGNA 3X3ZA 1ULJB 4LZIA 4RBNA 3ROBA 4KT3B 3KE7A 3SX1A 4HM2B 3FF0A 1VQM3 5IEPA 3DGOA 1JKGA 1ZX2A 1UCKA 1STDA 1B2XA 3DGMA 1FZUA 3MKIA 1KQS2 1GMQA 1UCJA 1K28A 2BIRA 1RGLA 1L5GB 2F5WA 2E2TA 3BIRA 1F8NA 2WGOA 3F8HA 4NHFA 2WOHA 4J5KA 5IENA 1VQ53 2CW9A 2RNTA 1Q864 3NBRA 1HU9A 3F7XA 3FF2A 3LH4A 3G4S3 2LQVA 1YI23 1IDPA 2PNCA 3FCSB 3I0YA 3KZTA 4MMXB 2MC8A 1AV4A 2ML6A 3UB1A 2P38A 3CNXA 3DGNA 5D81A 4DKIA 8RNTA 2BU4A 3GZYB 2H0HA 3EBYA 1BIRA 2SBLA 1DVDA 4HAAA 1RN7A 4XBXA 2D1WA 2D42A 3A5EA 4N6TA 4O02B 1JBTA 3BLZA 1RCKA 3EQQB 3NHXA 5KP4A 2BMRB 4XM4A 1I3IA 3VF1A 1VQL3 2KF3A 3NUVA 2YX9A 5ELJA 1I2FA 4RZMA 3X3XA 2FNQA 4BL2A 1KC84 3O8YA 3UNLA 6STDA 1DYUA 3FSDA 1WQLB 2SARA 3G0KA 3Q90A 3F7SA 1NB5I 1BNRA 1SQWA 9RNTA 3ALAA 3URPA 2JDIH 1W6GA 3KSPA 1T5YA 2Z6BA 3OV4A 5M19A 1JNQA 1RKYA 3EC9A 2F98A 1MWTA 1O7WB 2ZHXB 1G0TA 3G6E3 5HOHA 1D6ZA 1IYYA 1B2SA 3OWYA 2H0GA 1OF5B 4O8SA 4BIRA 3HIGA 3CMA3 1DE3A 1GMPA 2F99A 3G16A 3UL6A 1E3RA 3NBBA 2Q07A 4H61A 3OW22 2CKFB 4XBTA 4U13A 1WMNA 1RRHA 4K90B 1BNEA 2F5MA 3NBJA 1DMNA 4MMYB 2CFWA 1EUIC 1GSPA 5LC6A 2MF7A 2Y73A 1I8VA 3B8LA 1OHOA 4BL3A 2QA43 4IT7A 2W0QA 4I4KA 1S5AA 1QJGA 3EJVA 1OUNA 1Q40A 3VSYA 2BNGA 2XR8B 3S27A 3N9HA 3CCL3 4WYKA 1I0XA 5AI1A 1YIT3 5BU4A 3ZG5A 5HGRA 1ZO2A 3BNCA 5ELUA 5G1LA 3CCE3 1V58A 1KWIA 1LOWA 4G1MB 3FKAA 3ZG0A 1BNJA 1IT7A 2ML5A 4CCVA 2OQEC 2ZA4A 3S28A 1YVSA 1NWWA 3FG1A 1W4NA 1V57A 3AMOA 4LMIA 1Q824 3FG4A 3SVAA 3LTBA 3D5GA 3D79A 1TJDA 1RN4A 1D6YA 1MGRA 1AR0A 2CX0A 3MHEA 5CK6A 1BNIA 4ORLA 3DXOA 1QAFA 1VQ43 1C7HA 1B3SA 3EN8A 3GSPA 3DMCA 1TUHA 1RGFA 3J7Yd 3STDA 4LYLB 1RGGA 1QAKA 2B24B 5STDA 1K9M4 2W9PA 1EG9B 3H51A 4NPBA 2CFKA 3EF8A 4OVMA 3WHOA 5CF2A 2FGTA 1JJ22 4N6OB 1B21A 1W6YA 1HKXA 2CIUA 3PCSA 4HZ9B 5AEUB 1IU7A 1N5PA 3IMAB 1K41A 1N9JA 1N8R4 2KF6A 2CFLA 2B1XB 1VZZA 3SLUA 1AY7A 1IQ8A 1C54A 1W02A 1FGTA 3F14A 4XB5A 2YFJB 1DVCA 3LOYA 2A15A 2K3DA 3JUMA 1GMRA 3D4AA 2BO9B 1M1K4 1ISKA 1BRNL 3AGOA 1YGWA 3G713 1NJI4 2RGQA 5FGOA 1FA3A 1LOYA 4WWUC 3CU3A 1UCIA 3DH2A 2KF4A 3CCJ3 3RGAA 1IVUA 2BT3A 1UI7A 1BRGA 2M7OA 1AVLA 2O9UX 2P05A 1B2UA 2Z76A 4X2OA 4CPKA 6RNTA 3CCU3 3OWSA 1CH0A 3HX8A 5EVHA 1DMQA 3X41A 3UJMA 1RLSA 1IQYA 1IVWA 4HM0B 2GBXB 1A2VA 5CLKA 1JBSA 3KIIA 1T2HA 4HBRA 2C4BA 1OGZA 2Z77A 5IG5A 3TDGA 3X3YA 1EKMA 3CCQ3 1I0VA 4GSPA 3WR2A 2UGIA 1LRAA 3IJEB 5AIHA 4AKYA 1FGQA 3D9RA 2W04A 3CCV3 4HM1B 2W9QA 2XSHB 4R4KA 3T8UA 5M18A 1TU5A 2XEPA 1GOVA 4L8PA 5IERA 2PZVA 4K61A 1O7MB 1RDSA 3RNTA 2Y74A 1I2GA 2YFIB 4HM5B 1QVF2 3DY5A 1K8A4 3LMLA 3AGNA 4R80A 1OCVA 2K54A 3JUPA 2OOVA 3NM2A 1NB3I 1ZS7A 4LSOA 1IT8A 1WTHA 3LYGA 1TFKA 3CD63 5AIFA 3KN4A 4LGQA 3L0RA 3QRDA 1O7GB 1B2MA 1MGWA 1U8CB 2CWTA 2UUGC 1B2ZA 1RNBA 4XDVA 1PU4A 3BU4A 3WMDA 4EYCA 1SPUA 3IPTA 4FMDA 5IG3A 3T0UA 1EA2A 4ILFA 1GOUA 1RN1A 3Q3FA 2C11A 1I2EA 2W6JH 2P09A 4JRFA 1EQKA 1O7HB 5KP1A 3WOEB 1M904 3SYUA 3GWRA 1SIIA 1JB4A 3DZLA 3HZPA 4HOHA 2YFLB 4N6NB 4ZM8A 1RSNA 1JN5A 2BHMA 1FGRA 5M1AA 3K7CA 2CX1A 3B4PA 1VQO3 4FMAA 3S5CA 1TIJA 3GZRA 1X1YA 1N8QA 1UUVB 1B20A 1IVVA 4R1KA 1E97A 4KZ1A 1JB5A 3CPW2 2ZL8A 1RGEA 1BU4A 3EX9A 1YGEA 1Q7Y4 1BOXA 3S67A 3MSOA 5I97A 1NO3A 1UW1A 1HZ1A 4MJDA 5LC7A 5IEOA 3NQZA 1RTUA 2HMMB 5JPUA 1M9GA 3V92A 4N3VA 1BRJA 4EXRA 1RRLA 2E2UA 3EB8A 2W56A 4AKZA 1J2BA 1IK3A 4J8TA 1NDOB 1STFI 1OHSA 4FCJA 1JKGB 1U5OA 2XRXB 1S723 1W2B2 3M8CA 3H3HA 3DM8A 1GS3A 1OGXA 4KFFA 4WFOA 4MMZB 2CC3A 3SOYA 4I5QA 3BNBA 3ZFZA 3K5TA 3CME3 3HOHA 3KKGA 3GRDA 1Q42A 2F4YA 1A90A 1N5HA 2GEXA 3SEDA 1Q814 1DETA 1Z1SA 4N6MA 1W01A 1G02A 3LT8A 3OX9A 1WMOA 1NU3A 1IQXA 1Q7HA 1FGOA 4CJNA 3CC43 2XH9A 1I70A 4K1VA 2XF3A 2J8XB 3Q1CA 4KFDA 1VQ83 1BSCA 1T3BA 3B7CA 1D6UA 3LTAA 3SOAA 5AIGA 1IV7A 4HM4B 1VQK3 4IPBA 3X42A 1VQ93 2IMJA 3DGYA 2RSXA 3CC73 1AQZA 3MPHA 4EW5A 2IUKA 2CFDA 4XBYA 4HYZA 5D83A 3K0ZA 1RCLA 5IG4A 2L1SA 3EN1B 2XFSA 4RNYA 1OHPA 1FGMA 1G96A 5GSPA 1RGKA 1PYLA 2CG0A 2E2VA 1FW7A 2GU3A 4JF8A 1GY5A 3F9SA 3EHCA 7GSPA 3BNDA 1VQ63 1YVBI 3D3LA 2P0MA 2CFGA 2GXFA 3N54B 2XGNA 1RHLA 1JV2B 3PXMA 4N6UA 2GU1A 1GY7A 2RCDA 2WGQA 4HVNA 4BTXA 3HI7A 3BNEA 1LVNA 1ROAA 1TFOA 1UGHI 2HMOB 2P0XA 1BSBA 1GY6A 1FUSA 1OF5A 2CHCA 2WO0A 3EE1A 4IIAA 2CK3H 2F86B 1OACA 1PFPA 5G1KA 1IVXA 3KSED 1OH0A 5EQLA 1UUWB 2KRTA 3GZXB 3VGNA 2CWUA 1ZGXA 2V1LA 1MNLA 1TTOA 1MWUA 3PS8A 1Q40B 1CYUA 2F56A 1UCLA 3ER7A 2OWPA 4FMCA 4WYKB 2R4IA 4LEHA 5DRVA 1DMMA 2W56B 2OTJ3 1MOLA 5G2GA 1VQP3 3LXUX 1RJOA 3GZBA 3PCRA 1FUWA 3A76A 2OOVC 1BSAA 2IUJA 3MWZA 1BSEA 3ECFA 4N6V0 1YIJ3 3AMOB 1A2KA 5JBSA 2HMJB 4EV2A 1W5ZA 2KXGA 1M1XB 2CH9A 1FUTA 5D82A 1RGHA 2O3OA 1NNVA 1TRPA
chains in the Genus database with same CATH topology
4EW5A 2L1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EW5 A;  2L1S A; 
#chains in the Genus database with same CATH topology
 3BB9 A;  4J5G A;  2KAA A;  4N6L A;  5EEO A;  4NRE A;  2QEX 3;  1WMP A;  2GSP A;  2C10 A;  3DGL A;  1JZD A;  3HK4 A;  1X1W A;  2W2C A;  2LYX A;  3U97 A;  2W03 A;  3GAX A;  3LZA A;  1LXE A;  3PZW A;  1EEJ A;  1W2Z A;  1UI8 A;  4H3U A;  4FR9 A;  1KD1 4;  3T8N A;  2AAD A;  3D5I A;  1CEW I;  4AEQ A;  2QGU A;  1UDI I;  2ZDJ A;  1KSI A;  3I55 3;  1SIH A;  3WA3 A;  4HM7 B;  1BVI A;  1Y4K A;  3F40 A;  3MYT A;  4O3V A;  3I56 3;  1O7P B;  1BGS A;  4O2H A;  3Q2P A;  1RMS A;  1X1X A;  3PYJ A;  1I3F A;  1LNH A;  1W00 A;  4L8O A;  1LOV A;  4HJL B;  2INX A;  1YJ9 3;  4FCZ A;  1YNV X;  1LQG C;  4XDW A;  1US1 A;  4MEI A;  5BXQ A;  2OCT A;  3DUK A;  3JUO A;  3OWU A;  5KP3 A;  1QAL A;  2XGL A;  1A2P A;  4OK0 A;  4BTY A;  3KCH A;  1Q9E A;  2GBW B;  3EBT A;  5BVB A;  4K1U A;  2KCD A;  1BUQ A;  4GHO A;  1T2I A;  1MWR A;  3V98 A;  3FG3 A;  1GD4 A;  5A0O B;  1BUJ A;  3NM7 A;  4L7K A;  5AYR B;  5IF6 A;  2XFT A;  3FGY A;  1WNH A;  1V74 A;  1GYB A;  5DRE A;  1OPY A;  3S29 A;  1JZO A;  2RBI A;  4EV5 A;  2UX0 A;  3CPO A;  2JQ5 A;  3NV0 A;  5AEW B;  7STD A;  1GOY A;  5JPP A;  1TP6 A;  2K0M A;  1SJW A;  1PY3 A;  1VQN 3;  3N8B A;  1GD3 A;  4HKV B;  4RNZ A;  1E3V A;  3MG1 A;  1B27 A;  1ASK A;  4WP5 A;  5RNT A;  6GSP A;  1FYS A;  3FLJ A;  1YJN 3;  1W6C A;  3WDG B;  3CNM A;  1JRQ A;  3AHW A;  1VQQ A;  4HM3 B;  4TX4 A;  5IW9 A;  4HZB B;  4FCM A;  1LNI A;  3UL5 A;  1HYF A;  4STD A;  1O7N B;  2WOF A;  1R4Y A;  1YHQ 3;  1LOX A;  4KVH A;  4RNT A;  5CF1 A;  5CXO A;  1K73 4;  1A67 A;  2QIY A;  2IY2 A;  4KFE A;  4OUQ A;  4R9L A;  4GB5 A;  1IV9 A;  3JUQ A;  1BRH A;  4R9K A;  1QVG 2;  4Q53 A;  2IA7 A;  3CCM 3;  3WOD G;  2BMQ B;  1BNG A;  1SAR A;  4EBG A;  4FMB A;  4CDL A;  1CYV A;  3V99 A;  1BRS A;  3NXJ A;  3K9M C;  4WHA A;  2Z7A A;  3FZW A;  7RNT A;  1RGA A;  2CWV A;  4X2H A;  2I9W A;  2R41 A;  1BAN A;  2HMN B;  2OQE A;  3CCR 3;  3CXC 2;  1ULI B;  1X1U A;  3OXA A;  1RGC A;  3X40 A;  3K63 A;  3F8X A;  3CC2 3;  3JUN A;  1CQS A;  1BNS A;  3WOF B;  1BNF A;  4HM8 B;  5FW5 A;  1UGI A;  2STD A;  3LT9 A;  4J9A A;  2AAE A;  5BIR A;  1QMA A;  2FXT A;  3QK9 A;  1BRI A;  3AHS A;  5AYS C;  1RNT A;  1JB2 A;  3E99 A;  2OTL 3;  2L4V A;  4BU4 A;  3G8Z A;  3MG3 A;  1JN5 B;  4PEJ A;  2IYJ A;  1R4C A;  1ROV A;  3CCS 3;  1TRQ A;  3U1W A;  2RFR A;  3HII A;  2KF5 A;  3B4O A;  2HOH A;  4EC6 A;  2CG1 A;  1AVK A;  1MWS A;  4BTW A;  3FH1 A;  3WA2 X;  2HMK B;  3KFQ C;  3NX0 A;  2HML B;  3LTD A;  1BSD A;  3JVC A;  1JBR A;  8CHO A;  4QWT A;  5AII A;  1UUG B;  1LQM B;  3SXX A;  1W7C A;  3RDE A;  1VQ7 3;  2GEY A;  3NQY A;  2XSO B;  3MG2 A;  3PGB A;  3LTC A;  2BMO B;  1BRK A;  3NV0 B;  2H0I A;  4GL6 A;  5IG0 A;  1YJW 3;  4HM6 B;  3RGR A;  1BAO A;  1N9E A;  5TGN A;  3X3Z A;  1ULJ B;  4LZI A;  4RBN A;  3ROB A;  4KT3 B;  3KE7 A;  3SX1 A;  4HM2 B;  3FF0 A;  1VQM 3;  5IEP A;  3DGO A;  1JKG A;  1ZX2 A;  1UCK A;  1STD A;  1B2X A;  3DGM A;  1FZU A;  3MKI A;  1KQS 2;  1GMQ A;  1UCJ A;  1K28 A;  2BIR A;  1RGL A;  1L5G B;  2F5W A;  2E2T A;  3BIR A;  1F8N A;  2WGO A;  3F8H A;  4NHF A;  2WOH A;  4J5K A;  5IEN A;  1VQ5 3;  2CW9 A;  2RNT A;  1Q86 4;  3NBR A;  1HU9 A;  3F7X A;  3FF2 A;  3LH4 A;  3G4S 3;  2LQV A;  1YI2 3;  1IDP A;  2PNC A;  3FCS B;  3I0Y A;  3KZT A;  4MMX B;  2MC8 A;  1AV4 A;  2ML6 A;  3UB1 A;  2P38 A;  3CNX A;  3DGN A;  5D81 A;  4DKI A;  8RNT A;  2BU4 A;  3GZY B;  2H0H A;  3EBY A;  1BIR A;  2SBL A;  1DVD A;  4HAA A;  1RN7 A;  4XBX A;  2D1W A;  2D42 A;  3A5E A;  4N6T A;  4O02 B;  1JBT A;  3BLZ A;  1RCK A;  3EQQ B;  3NHX A;  5KP4 A;  2BMR B;  4XM4 A;  1I3I A;  3VF1 A;  1VQL 3;  2KF3 A;  3NUV A;  2YX9 A;  5ELJ A;  1I2F A;  4RZM A;  3X3X A;  2FNQ A;  4BL2 A;  1KC8 4;  3O8Y A;  3UNL A;  6STD A;  1DYU A;  3FSD A;  1WQL B;  2SAR A;  3G0K A;  3Q90 A;  3F7S A;  1NB5 I;  1BNR A;  1SQW A;  9RNT A;  3ALA A;  3URP A;  2JDI H;  1W6G A;  3KSP A;  1T5Y A;  2Z6B A;  3OV4 A;  5M19 A;  1JNQ A;  1RKY A;  3EC9 A;  2F98 A;  1MWT A;  1O7W B;  2ZHX B;  1G0T A;  3G6E 3;  5HOH A;  1D6Z A;  1IYY A;  1B2S A;  3OWY A;  2H0G A;  1OF5 B;  4O8S A;  4BIR A;  3HIG A;  3CMA 3;  1DE3 A;  1GMP A;  2F99 A;  3G16 A;  3UL6 A;  1E3R A;  3NBB A;  2Q07 A;  4H61 A;  3OW2 2;  2CKF B;  4XBT A;  4U13 A;  1WMN A;  1RRH A;  4K90 B;  1BNE A;  2F5M A;  3NBJ A;  1DMN A;  4MMY B;  2CFW A;  1EUI C;  1GSP A;  5LC6 A;  2MF7 A;  2Y73 A;  1I8V A;  3B8L A;  1OHO A;  4BL3 A;  2QA4 3;  4IT7 A;  2W0Q A;  4I4K A;  1S5A A;  1QJG A;  3EJV A;  1OUN A;  1Q40 A;  3VSY A;  2BNG A;  2XR8 B;  3S27 A;  3N9H A;  3CCL 3;  4WYK A;  1I0X A;  5AI1 A;  1YIT 3;  5BU4 A;  3ZG5 A;  5HGR A;  1ZO2 A;  3BNC A;  5ELU A;  5G1L A;  3CCE 3;  1V58 A;  1KWI A;  1LOW A;  4G1M B;  3FKA A;  3ZG0 A;  1BNJ A;  1IT7 A;  2ML5 A;  4CCV A;  2OQE C;  2ZA4 A;  3S28 A;  1YVS A;  1NWW A;  3FG1 A;  1W4N A;  1V57 A;  3AMO A;  4LMI A;  1Q82 4;  3FG4 A;  3SVA A;  3LTB A;  3D5G A;  3D79 A;  1TJD A;  1RN4 A;  1D6Y A;  1MGR A;  1AR0 A;  2CX0 A;  3MHE A;  5CK6 A;  1BNI A;  4ORL A;  3DXO A;  1QAF A;  1VQ4 3;  1C7H A;  1B3S A;  3EN8 A;  3GSP A;  3DMC A;  1TUH A;  1RGF A;  3J7Y d;  3STD A;  4LYL B;  1RGG A;  1QAK A;  2B24 B;  5STD A;  1K9M 4;  2W9P A;  1EG9 B;  3H51 A;  4NPB A;  2CFK A;  3EF8 A;  4OVM A;  3WHO A;  5CF2 A;  2FGT A;  1JJ2 2;  4N6O B;  1B21 A;  1W6Y A;  1HKX A;  2CIU A;  3PCS A;  4HZ9 B;  5AEU B;  1IU7 A;  1N5P A;  3IMA B;  1K41 A;  1N9J A;  1N8R 4;  2KF6 A;  2CFL A;  2B1X B;  1VZZ A;  3SLU A;  1AY7 A;  1IQ8 A;  1C54 A;  1W02 A;  1FGT A;  3F14 A;  4XB5 A;  2YFJ B;  1DVC A;  3LOY A;  2A15 A;  2K3D A;  3JUM A;  1GMR A;  3D4A A;  2BO9 B;  1M1K 4;  1ISK A;  1BRN L;  3AGO A;  1YGW A;  3G71 3;  1NJI 4;  2RGQ A;  5FGO A;  1FA3 A;  1LOY A;  4WWU C;  3CU3 A;  1UCI A;  3DH2 A;  2KF4 A;  3CCJ 3;  3RGA A;  1IVU A;  2BT3 A;  1UI7 A;  1BRG A;  2M7O A;  1AVL A;  2O9U X;  2P05 A;  1B2U A;  2Z76 A;  4X2O A;  4CPK A;  6RNT A;  3CCU 3;  3OWS A;  1CH0 A;  3HX8 A;  5EVH A;  1DMQ A;  3X41 A;  3UJM A;  1RLS A;  1IQY A;  1IVW A;  4HM0 B;  2GBX B;  1A2V A;  5CLK A;  1JBS A;  3KII A;  1T2H A;  4HBR A;  2C4B A;  1OGZ A;  2Z77 A;  5IG5 A;  3TDG A;  3X3Y A;  1EKM A;  3CCQ 3;  1I0V A;  4GSP A;  3WR2 A;  2UGI A;  1LRA A;  3IJE B;  5AIH A;  4AKY A;  1FGQ A;  3D9R A;  2W04 A;  3CCV 3;  4HM1 B;  2W9Q A;  2XSH B;  4R4K A;  3T8U A;  5M18 A;  1TU5 A;  2XEP A;  1GOV A;  4L8P A;  5IER A;  2PZV A;  4K61 A;  1O7M B;  1RDS A;  3RNT A;  2Y74 A;  1I2G A;  2YFI B;  4HM5 B;  1QVF 2;  3DY5 A;  1K8A 4;  3LML A;  3AGN A;  4R80 A;  1OCV A;  2K54 A;  3JUP A;  2OOV A;  3NM2 A;  1NB3 I;  1ZS7 A;  4LSO A;  1IT8 A;  1WTH A;  3LYG A;  1TFK A;  3CD6 3;  5AIF A;  3KN4 A;  4LGQ A;  3L0R A;  3QRD A;  1O7G B;  1B2M A;  1MGW A;  1U8C B;  2CWT A;  2UUG C;  1B2Z A;  1RNB A;  4XDV A;  1PU4 A;  3BU4 A;  3WMD A;  4EYC A;  1SPU A;  3IPT A;  4FMD A;  5IG3 A;  3T0U A;  1EA2 A;  4ILF A;  1GOU A;  1RN1 A;  3Q3F A;  2C11 A;  1I2E A;  2W6J H;  2P09 A;  4JRF A;  1EQK A;  1O7H B;  5KP1 A;  3WOE B;  1M90 4;  3SYU A;  3GWR A;  1SII A;  1JB4 A;  3DZL A;  3HZP A;  4HOH A;  2YFL B;  4N6N B;  4ZM8 A;  1RSN A;  1JN5 A;  2BHM A;  1FGR A;  5M1A A;  3K7C A;  2CX1 A;  3B4P A;  1VQO 3;  4FMA A;  3S5C A;  1TIJ A;  3GZR A;  1X1Y A;  1N8Q A;  1UUV B;  1B20 A;  1IVV A;  4R1K A;  1E97 A;  4KZ1 A;  1JB5 A;  3CPW 2;  2ZL8 A;  1RGE A;  1BU4 A;  3EX9 A;  1YGE A;  1Q7Y 4;  1BOX A;  3S67 A;  3MSO A;  5I97 A;  1NO3 A;  1UW1 A;  1HZ1 A;  4MJD A;  5LC7 A;  5IEO A;  3NQZ A;  1RTU A;  2HMM B;  5JPU A;  1M9G A;  3V92 A;  4N3V A;  1BRJ A;  4EXR A;  1RRL A;  2E2U A;  3EB8 A;  2W56 A;  4AKZ A;  1J2B A;  1IK3 A;  4J8T A;  1NDO B;  1STF I;  1OHS A;  4FCJ A;  1JKG B;  1U5O A;  2XRX B;  1S72 3;  1W2B 2;  3M8C A;  3H3H A;  3DM8 A;  1GS3 A;  1OGX A;  4KFF A;  4WFO A;  4MMZ B;  2CC3 A;  3SOY A;  4I5Q A;  3BNB A;  3ZFZ A;  3K5T A;  3CME 3;  3HOH A;  3KKG A;  3GRD A;  1Q42 A;  2F4Y A;  1A90 A;  1N5H A;  2GEX A;  3SED A;  1Q81 4;  1DET A;  1Z1S A;  4N6M A;  1W01 A;  1G02 A;  3LT8 A;  3OX9 A;  1WMO A;  1NU3 A;  1IQX A;  1Q7H A;  1FGO A;  4CJN A;  3CC4 3;  2XH9 A;  1I70 A;  4K1V A;  2XF3 A;  2J8X B;  3Q1C A;  4KFD A;  1VQ8 3;  1BSC A;  1T3B A;  3B7C A;  1D6U A;  3LTA A;  3SOA A;  5AIG A;  1IV7 A;  4HM4 B;  1VQK 3;  4IPB A;  3X42 A;  1VQ9 3;  2IMJ A;  3DGY A;  2RSX A;  3CC7 3;  1AQZ A;  3MPH A;  4EW5 A;  2IUK A;  2CFD A;  4XBY A;  4HYZ A;  5D83 A;  3K0Z A;  1RCL A;  5IG4 A;  2L1S A;  3EN1 B;  2XFS A;  4RNY A;  1OHP A;  1FGM A;  1G96 A;  5GSP A;  1RGK A;  1PYL A;  2CG0 A;  2E2V A;  1FW7 A;  2GU3 A;  4JF8 A;  1GY5 A;  3F9S A;  3EHC A;  7GSP A;  3BND A;  1VQ6 3;  1YVB I;  3D3L A;  2P0M A;  2CFG A;  2GXF A;  3N54 B;  2XGN A;  1RHL A;  1JV2 B;  3PXM A;  4N6U A;  2GU1 A;  1GY7 A;  2RCD A;  2WGQ A;  4HVN A;  4BTX A;  3HI7 A;  3BNE A;  1LVN A;  1ROA A;  1TFO A;  1UGH I;  2HMO B;  2P0X A;  1BSB A;  1GY6 A;  1FUS A;  1OF5 A;  2CHC A;  2WO0 A;  3EE1 A;  4IIA A;  2CK3 H;  2F86 B;  1OAC A;  1PFP A;  5G1K A;  1IVX A;  3KSE D;  1OH0 A;  5EQL A;  1UUW B;  2KRT A;  3GZX B;  3VGN A;  2CWU A;  1ZGX A;  2V1L A;  1MNL A;  1TTO A;  1MWU A;  3PS8 A;  1Q40 B;  1CYU A;  2F56 A;  1UCL A;  3ER7 A;  2OWP A;  4FMC A;  4WYK B;  2R4I A;  4LEH A;  5DRV A;  1DMM A;  2W56 B;  2OTJ 3;  1MOL A;  5G2G A;  1VQP 3;  3LXU X;  1RJO A;  3GZB A;  3PCR A;  1FUW A;  3A76 A;  2OOV C;  1BSA A;  2IUJ A;  3MWZ A;  1BSE A;  3ECF A;  4N6V 0;  1YIJ 3;  3AMO B;  1A2K A;  5JBS A;  2HMJ B;  4EV2 A;  1W5Z A;  2KXG A;  1M1X B;  2CH9 A;  1FUT A;  5D82 A;  1RGH A;  2O3O A;  1NNV A;  1TRP A; 
#chains in the Genus database with same CATH homology
 4EW5 A;  2L1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...