4EW5A

C-terminal domain of inner membrane protein cigr from salmonella enterica.
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
102
structure length
102
Chain Sequence
HRKNGGKPDHVESDISYAVARQLAVNLGLTGYQSLPPGIAKNLARGKPLPPGIAKKTVPASMLGQLPYYPGYEWKIVGDNLVLIALSTAVVTAIINGVFDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title C-terminal domain of inner membrane protein CigR from Salmonella enterica.
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Membrane protein
molecule keywords CigR Protein
total genus 20
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.160 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, inner membrane protein cigr 4ew5A00
2L1SA 4EW5A
chains in the Genus database with same CATH superfamily
2WOFA 1TRPA 3MSOA 1W5ZA 3UNLA 3F7XA 2HMLB 3FLJA 2O3OA 3X3YA 1UI7A 1NB3I 4GHOA 1VQN3 1Y4KA 1T2HA 2WGOA 1RHLA 2LYXA 1STFI 4WFOA 3WMDA 3KE7A 4Q53A 4ZM8A 6STDA 1YVBI 2BHMA 2YX9A 1IQ8A 2IA7A 5IEPA 2K54A 1GOUA 1AV4A 5IG4A 3BU4A 3QRDA 3CMA3 1VZZA 1IU7A 1JV2B 1SJWA 5IEOA 5KP3A 4CPKA 3CCL3 3T8UA 2GEXA 1SIHA 3DGOA 3BNEA 2UGIA 2CG0A 6GSPA 1JN5B 3JUPA 2RCDA 4BTXA 3WA2X 1VQ83 2OOVA 1IQXA 1RN4A 1M904 1YNVX 2YFLB 3KIIA 3BNCA 3O8YA 4KZ1A 1UDII 3VSYA 1ZGXA 1QALA 4N3VA 3M8CA 1NJI4 4TX4A 1D6UA 1IVXA 1I3IA 2W9PA 3N9HA 3MPHA 5M19A 1FYSA 2XSHB 3HX8A 4N6UA 3DZLA 4I4KA 4HJLB 1GYBA 4HOHA 1O7NB 1SQWA 1LOWA 1DVCA 3TDGA 2K0MA 1Q814 1BNFA 2HMNB 3D5GA 4LYLB 1N8R4 1MWTA 1UCIA 3G8ZA 4HZBB 3NBRA 1LQGC 2O9UX 1ZX2A 2UX0A 4NPBA 4RNZA 4MMXB 1TFOA 5G1LA 1A90A 1BIRA 5ELJA 3SOYA 5CLKA 1X1YA 1BSCA 3CNMA 3LT9A 5CF1A 1Q824 1JBRA 1I0VA 1HKXA 2XSOB 1JB2A 2CWUA 4R80A 3D3LA 3EB8A 4FCMA 1B2UA 2AAEA 2R4IA 1KC84 1TRQA 1GD4A 2M7OA 3GAXA 3ECFA 5AIIA 4O02B 1B20A 1Q40A 2SBLA 3Q1CA 1TIJA 2IY2A 2BMRB 1PU4A 2D42A 3E99A 3GRDA 3BNDA 1VQL3 1GMQA 4R9KA 3T0UA 4N6OB 1Z1SA 4GL6A 1GY6A 1IVVA 1L5GB 2C4BA 1HU9A 2BMOB 3UL6A 5JPPA 3Q2PA 4XM4A 3I553 1I2FA 4MMYB 3B7CA 4L7KA 1OH0A 1OHPA 3JUMA 4HBRA 2GU3A 4GB5A 2MC8A 5IG3A 5G1KA 1FUSA 3RGRA 5BU4A 3CCV3 2F98A 4DKIA 1R4CA 1LOYA 1JB5A 1E3RA 1O7MB 1ULIB 5AIHA 3V99A 1PY3A 5IG0A 4MEIA 1JKGB 1NDOB 1OGXA 1W01A 2OQEA 3VF1A 1U5OA 2PNCA 3LYGA 1VQK3 1I3FA 3KZTA 1VQ43 3WOEB 5AYSC 1S5AA 4N6V0 1GMRA 8CHOA 1YJN3 1K28A 2OOVC 2P0MA 5IERA 3ROBA 1LQMB 1BSDA 2KCDA 2F4YA 2F86B 1STDA 3K7CA 1FGQA 3EJVA 3LTDA 2D1WA 3LZAA 5EQLA 1RCKA 1MNLA 1Q9EA 3I563 1V57A 1GY7A 4EV2A 4WWUC 1W4NA 1FUTA 1JBTA 1AVLA 4HM5B 4J5KA 3F14A 2CWVA 4OVMA 1FGRA 3CPOA 3DUKA 4QWTA 1F8NA 3FF0A 1G02A 2IUJA 1MWRA 1O7WB 3BLZA 2XF3A 4HAAA 4AEQA 1HZ1A 2H0HA 3OWYA 2W56B 3K0ZA 4MJDA 3D5IA 2W03A 3S28A 1RGLA 4JRFA 1BNIA 1I70A 1ZS7A 1BRKA 5BXQA 2P0XA 2OQEC 2JDIH 2CFLA 4K1UA 4MMZB 2QIYA 2XGNA 3DGYA 4HM3B 1RN1A 1IVWA 1Q7HA 1BVIA 1KQS2 3KKGA 5AIGA 3HOHA 1QAKA 5AEUB 3WA3A 1UCJA 2RBIA 1G0TA 2KF6A 3V98A 1UUWB 4K90B 3KFQC 2HMKB 3SXXA 3G6E3 3WHOA 1VQP3 2F99A 4LSOA 1NWWA 4HM4B 4IPBA 5CXOA 3AHWA 2Z6BA 1RN7A 2KAAA 1E3VA 1BRHA 4R4KA 1BGSA 3F7SA 4EBGA 2P09A 1W2ZA 5CF2A 2L4VA 1YJ93 1W2B2 1WTHA 3FCSB 4I5QA 1EUIC 1RGEA 3KSPA 3CU3A 1BOXA 1TUHA 1W6YA 5IW9A 3STDA 1O7HB 3DM8A 4HM6B 1K734 1JN5A 1NO3A 2W0QA 1C54A 5LC6A 4O8SA 2CWTA 3CCM3 3EE1A 2KF5A 1T2IA 3KSED 1LRAA 1BSBA 2H0IA 2XRXB 3K5TA 5AEWB 1K9M4 1LNHA 3JUNA 1OHOA 1LNIA 5KP1A 6RNTA 1QVG2 5IF6A 2I9WA 3RGAA 1M9GA 1YHQ3 1JKGA 1OGZA 1RGKA 3ZG0A 2L1SA 1N9JA 3NBJA 3NBBA 1ROVA 2BO9B 4G1MB 4CDLA 2GBXB 1LVNA 4XB5A 8RNTA 1AY7A 2P38A 3DGMA 1RKYA 1NB5I 3DY5A 3UJMA 1BNJA 1UGHI 1FUWA 3FG4A 2XR8B 3MG1A 5ELUA 5TGNA 1OPYA 2B1XB 2J8XB 3DGNA 3G16A 1B21A 4HM0B 3S5CA 1TU5A 1BUJA 4AKYA 1AQZA 4FMAA 5AYRB 2GU1A 3SX1A 3NX0A 3OV4A 3CC23 5LC7A 2W56A 5KP4A 4FMBA 4HVNA 3MG2A 7STDA 3X3ZA 3BNBA 4XBXA 1A2KA 1DYUA 3S67A 3LXUX 1BU4A 1QMAA 3URPA 2K3DA 1IT8A 1RCLA 3A76A 3EX9A 1RSNA 1RGCA 2BU4A 1IV9A 1BRJA 4XBTA 4EYCA 2FXTA 1SARA 1W00A 4PEJA 3ER7A 3MG3A 4NREA 3G713 3WODG 3IJEB 2CG1A 1VQO3 4J5GA 1OF5A 3OX9A 3U97A 2FNQA 3B4PA 2KF3A 3UB1A 3CCU3 7GSPA 4KFFA 4J8TA 5IG5A 1T3BA 1QAFA 2HOHA 1O7PB 4BL2A 1A2VA 3WDGB 2H0GA 1SIIA 3EHCA 3LH4A 4ORLA 1JRQA 3EQQB 3FGYA 1WNHA 4BU4A 1NNVA 1CQSA 2Z77A 2W6JH 1RRHA 2XFTA 1BRNL 1BRIA 1FW7A 2HMJB 3HZPA 5RNTA 3CC73 4CCVA 5HOHA 3LTBA 3FKAA 1RMSA 1OCVA 1FGMA 2ZL8A 2GSPA 3LTCA 1V58A 3JUQA 1BRSA 3EBTA 2CW9A 3JVCA 1Q42A 1W7CA 2UUGC 4NHFA 4XDVA 3SYUA 1Q7Y4 3S29A 4CJNA 1IYYA 1CYUA 1B2XA 2BNGA 1T5YA 2W04A 4KFDA 1W6GA 1IQYA 2XH9A 1WMNA 1OF5B 1JNQA 4KT3B 1I2GA 3GZRA 3G4S3 2KXGA 1YIJ3 1YJW3 1S723 4STDA 1G96A 4OUQA 4EV5A 3IPTA 3OWSA 1KD14 4LZIA 3N54B 4OK0A 3PXMA 4N6TA 2CKFB 3WOFB 2CFGA 2F56A 2LQVA 4FMDA 1B2MA 2OTL3 1RTUA 5D82A 3KN4A 1YGWA 3GSPA 3GZXB 4FCZA 3CD63 1FA3A 1B27A 1OHSA 1ROAA 1JZOA 3Q3FA 1RGFA 3IMAB 2CFWA 3K63A 1AR0A 1HYFA 2WGQA 2XGLA 1VQQA 3EN1B 1IDPA 4RZMA 2KRTA 1X1XA 4IIAA 1W6CA 3PCRA 4AKZA 3DXOA 5I97A 9RNTA 4H3UA 1BRGA 3GWRA 1QJGA 4U13A 4WYKB 3FG3A 2C11A 3NV0B 3NQZA 2YFJB 5JBSA 2Y74A 3LTAA 4K1VA 3F40A 1I0XA 1C7HA 1MGRA 3RDEA 1EG9B 5EEOA 5STDA 3SVAA 4FR9A 4XBYA 4O2HA 2V1LA 4X2OA 1LOVA 1N9EA 3GZBA 1VQ63 4FCJA 3H3HA 1B3SA 2WO0A 4H61A 2CH9A 2BT3A 2CC3A 1OUNA 2XEPA 5HGRA 2QGUA 4HZ9B 4KFEA 1CH0A 1RLSA 3FF2A 4WHAA 5FW5A 3FSDA 1RNTA 1TTOA 4LEHA 3VGNA 1IV7A 3NHXA 1RJOA 2F5WA 1IK3A 1EEJA 3HI7A 3DGLA 1JBSA 3SOAA 1DMNA 4N6MA 4R9LA 1WMPA 3F9SA 5IENA 3I0YA 1JJ22 1D6YA 3MWZA 1N8QA 1V74A 4HM7B 4WYKA 1BNRA 3OWUA 1ISKA 5AI1A 2CX0A 3N8BA 5GSPA 1LXEA 3CC43 2QEX3 1RGGA 4WP5A 3KCHA 1Q40B 3MYTA 5D81A 4HM1B 2QA43 1CEWI 1BAOA 1MGWA 1UCLA 1US1A 1ZO2A 1RDSA 3AHSA 3ALAA 3HK4A 5JPUA 3CCS3 3B8LA 1EKMA 2E2VA 1X1UA 2XFSA 5EVHA 3S27A 1UI8A 2B24B 2CIUA 1A2PA 1OACA 1FGOA 2ML5A 2ZDJA 3CNXA 3PZWA 4HYZA 5FGOA 3ZFZA 3CCQ3 1BSEA 1J2BA 2RGQA 1GMPA 1B2SA 1R4YA 3CCR3 5BIRA 3PGBA 1E97A 1QVF2 2KF4A 3NQYA 1DVDA 2FGTA 1YVSA 2A15A 4BL3A 4BTWA 1JB4A 1BNSA 3LT8A 3MHEA 1DE3A 3LOYA 3OXAA 2OTJ3 1RRLA 1BUQA 1BNGA 1MOLA 3H51A 1AVKA 1W02A 3BB9A 1WMOA 2Q07A 1VQ53 1IT7A 3BIRA 3AGNA 4LGQA 4BTYA 2Z76A 1MWSA 1UGIA 1D6ZA 1UUGB 2IMJA 3FZWA 1A67A 3Q90A 1UUVB 3EC9A 2ML6A 4O3VA 1K8A4 2IUKA 3NXJA 3UL5A 5BVBA 1CYVA 1B2ZA 2HMMB 1UW1A 4RNYA 1NU3A 1Q864 1UCKA 3EBYA 3NV0A 2BMQB 1EQKA 1N5HA 3MKIA 4BIRA 3F8XA 1N5PA 3EF8A 4IT7A 4GSPA 1LOXA 2OCTA 3A5EA 2PZVA 2GXFA 3CME3 1GOYA 7RNTA 2OWPA 3X41A 2GEYA 4J9AA 4EXRA 2CX1A 2AADA 3CCE3 3NM2A 1ASKA 2RNTA 3PYJA 3X3XA 3PCSA 3J7Yd 2E2UA 1WQLB 4L8OA 4X2HA 2Z7AA 3X40A 3ZG5A 1IVUA 3X42A 3AGOA 1GY5A 1DETA 1TJDA 1TP6A 2INXA 3K9MC 4K61A 3OW22 3CXC2 1RGHA 4HM2B 1DMMA 1KSIA 1YGEA 2CK3H 2HMOB 3QK9A 4N6NB 5CK6A 1EA2A 5D83A 1PYLA 3WR2A 4EC6A 5M18A 2F5MA 1X1WA 4RBNA 3AMOA 3B4OA 5G2GA 3SEDA 1GS3A 1RNBA 1ULJB 4R1KA 1FZUA 3CPW2 2R41A 1YIT3 4JF8A 3DH2A 3F8HA 4HM8B 2W2CA 1GOVA 1JZDA 5A0OB 2JQ5A 1BANA 2RSXA 4N6LA 1RGAA 4L8PA 2P05A 2C10A 4FMCA 1TFKA 1K41A 3D9RA 5DREA 3GZYB 3CCJ3 3LMLA 1BSAA 2BIRA 3HIGA 3FG1A 5M1AA 1BNEA 2IYJA 3G0KA 1VQ73 3NM7A 2CHCA 3PS8A 2SARA 2E2TA 1PFPA 1U8CB 1SPUA 3FH1A 3EN8A 3L0RA 4LMIA 5DRVA 4KVHA 1VQ93 2YFIB 1DMQA 3U1WA 2GBWB 3RNTA 3D79A 2ZHXB 2ZA4A 1I2EA 5AIFA 3SLUA 2Y73A 4XDWA 1M1K4 1GSPA 1O7GB 1MWUA 3AMOB 2CFDA 4RNTA 3JUOA 1KWIA 2CFKA 4HKVB 1VQM3 3NUVA 2WOHA 4ILFA 1I8VA 1GD3A 1FGTA 2W9QA 2MF7A 3D4AA 3T8NA 3V92A 4EW5A 3DMCA 2STDA 2RFRA 3HIIA 1YI23 1M1XB
chains in the Genus database with same CATH topology
2L1SA 4EW5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L1S A;  4EW5 A; 
#chains in the Genus database with same CATH topology
 2WOF A;  1TRP A;  3MSO A;  1W5Z A;  3UNL A;  3F7X A;  2HML B;  3FLJ A;  2O3O A;  3X3Y A;  1UI7 A;  1NB3 I;  4GHO A;  1VQN 3;  1Y4K A;  1T2H A;  2WGO A;  1RHL A;  2LYX A;  1STF I;  4WFO A;  3WMD A;  3KE7 A;  4Q53 A;  4ZM8 A;  6STD A;  1YVB I;  2BHM A;  2YX9 A;  1IQ8 A;  2IA7 A;  5IEP A;  2K54 A;  1GOU A;  1AV4 A;  5IG4 A;  3BU4 A;  3QRD A;  3CMA 3;  1VZZ A;  1IU7 A;  1JV2 B;  1SJW A;  5IEO A;  5KP3 A;  4CPK A;  3CCL 3;  3T8U A;  2GEX A;  1SIH A;  3DGO A;  3BNE A;  2UGI A;  2CG0 A;  6GSP A;  1JN5 B;  3JUP A;  2RCD A;  4BTX A;  3WA2 X;  1VQ8 3;  2OOV A;  1IQX A;  1RN4 A;  1M90 4;  1YNV X;  2YFL B;  3KII A;  3BNC A;  3O8Y A;  4KZ1 A;  1UDI I;  3VSY A;  1ZGX A;  1QAL A;  4N3V A;  3M8C A;  1NJI 4;  4TX4 A;  1D6U A;  1IVX A;  1I3I A;  2W9P A;  3N9H A;  3MPH A;  5M19 A;  1FYS A;  2XSH B;  3HX8 A;  4N6U A;  3DZL A;  4I4K A;  4HJL B;  1GYB A;  4HOH A;  1O7N B;  1SQW A;  1LOW A;  1DVC A;  3TDG A;  2K0M A;  1Q81 4;  1BNF A;  2HMN B;  3D5G A;  4LYL B;  1N8R 4;  1MWT A;  1UCI A;  3G8Z A;  4HZB B;  3NBR A;  1LQG C;  2O9U X;  1ZX2 A;  2UX0 A;  4NPB A;  4RNZ A;  4MMX B;  1TFO A;  5G1L A;  1A90 A;  1BIR A;  5ELJ A;  3SOY A;  5CLK A;  1X1Y A;  1BSC A;  3CNM A;  3LT9 A;  5CF1 A;  1Q82 4;  1JBR A;  1I0V A;  1HKX A;  2XSO B;  1JB2 A;  2CWU A;  4R80 A;  3D3L A;  3EB8 A;  4FCM A;  1B2U A;  2AAE A;  2R4I A;  1KC8 4;  1TRQ A;  1GD4 A;  2M7O A;  3GAX A;  3ECF A;  5AII A;  4O02 B;  1B20 A;  1Q40 A;  2SBL A;  3Q1C A;  1TIJ A;  2IY2 A;  2BMR B;  1PU4 A;  2D42 A;  3E99 A;  3GRD A;  3BND A;  1VQL 3;  1GMQ A;  4R9K A;  3T0U A;  4N6O B;  1Z1S A;  4GL6 A;  1GY6 A;  1IVV A;  1L5G B;  2C4B A;  1HU9 A;  2BMO B;  3UL6 A;  5JPP A;  3Q2P A;  4XM4 A;  3I55 3;  1I2F A;  4MMY B;  3B7C A;  4L7K A;  1OH0 A;  1OHP A;  3JUM A;  4HBR A;  2GU3 A;  4GB5 A;  2MC8 A;  5IG3 A;  5G1K A;  1FUS A;  3RGR A;  5BU4 A;  3CCV 3;  2F98 A;  4DKI A;  1R4C A;  1LOY A;  1JB5 A;  1E3R A;  1O7M B;  1ULI B;  5AIH A;  3V99 A;  1PY3 A;  5IG0 A;  4MEI A;  1JKG B;  1NDO B;  1OGX A;  1W01 A;  2OQE A;  3VF1 A;  1U5O A;  2PNC A;  3LYG A;  1VQK 3;  1I3F A;  3KZT A;  1VQ4 3;  3WOE B;  5AYS C;  1S5A A;  4N6V 0;  1GMR A;  8CHO A;  1YJN 3;  1K28 A;  2OOV C;  2P0M A;  5IER A;  3ROB A;  1LQM B;  1BSD A;  2KCD A;  2F4Y A;  2F86 B;  1STD A;  3K7C A;  1FGQ A;  3EJV A;  3LTD A;  2D1W A;  3LZA A;  5EQL A;  1RCK A;  1MNL A;  1Q9E A;  3I56 3;  1V57 A;  1GY7 A;  4EV2 A;  4WWU C;  1W4N A;  1FUT A;  1JBT A;  1AVL A;  4HM5 B;  4J5K A;  3F14 A;  2CWV A;  4OVM A;  1FGR A;  3CPO A;  3DUK A;  4QWT A;  1F8N A;  3FF0 A;  1G02 A;  2IUJ A;  1MWR A;  1O7W B;  3BLZ A;  2XF3 A;  4HAA A;  4AEQ A;  1HZ1 A;  2H0H A;  3OWY A;  2W56 B;  3K0Z A;  4MJD A;  3D5I A;  2W03 A;  3S28 A;  1RGL A;  4JRF A;  1BNI A;  1I70 A;  1ZS7 A;  1BRK A;  5BXQ A;  2P0X A;  2OQE C;  2JDI H;  2CFL A;  4K1U A;  4MMZ B;  2QIY A;  2XGN A;  3DGY A;  4HM3 B;  1RN1 A;  1IVW A;  1Q7H A;  1BVI A;  1KQS 2;  3KKG A;  5AIG A;  3HOH A;  1QAK A;  5AEU B;  3WA3 A;  1UCJ A;  2RBI A;  1G0T A;  2KF6 A;  3V98 A;  1UUW B;  4K90 B;  3KFQ C;  2HMK B;  3SXX A;  3G6E 3;  3WHO A;  1VQP 3;  2F99 A;  4LSO A;  1NWW A;  4HM4 B;  4IPB A;  5CXO A;  3AHW A;  2Z6B A;  1RN7 A;  2KAA A;  1E3V A;  1BRH A;  4R4K A;  1BGS A;  3F7S A;  4EBG A;  2P09 A;  1W2Z A;  5CF2 A;  2L4V A;  1YJ9 3;  1W2B 2;  1WTH A;  3FCS B;  4I5Q A;  1EUI C;  1RGE A;  3KSP A;  3CU3 A;  1BOX A;  1TUH A;  1W6Y A;  5IW9 A;  3STD A;  1O7H B;  3DM8 A;  4HM6 B;  1K73 4;  1JN5 A;  1NO3 A;  2W0Q A;  1C54 A;  5LC6 A;  4O8S A;  2CWT A;  3CCM 3;  3EE1 A;  2KF5 A;  1T2I A;  3KSE D;  1LRA A;  1BSB A;  2H0I A;  2XRX B;  3K5T A;  5AEW B;  1K9M 4;  1LNH A;  3JUN A;  1OHO A;  1LNI A;  5KP1 A;  6RNT A;  1QVG 2;  5IF6 A;  2I9W A;  3RGA A;  1M9G A;  1YHQ 3;  1JKG A;  1OGZ A;  1RGK A;  3ZG0 A;  2L1S A;  1N9J A;  3NBJ A;  3NBB A;  1ROV A;  2BO9 B;  4G1M B;  4CDL A;  2GBX B;  1LVN A;  4XB5 A;  8RNT A;  1AY7 A;  2P38 A;  3DGM A;  1RKY A;  1NB5 I;  3DY5 A;  3UJM A;  1BNJ A;  1UGH I;  1FUW A;  3FG4 A;  2XR8 B;  3MG1 A;  5ELU A;  5TGN A;  1OPY A;  2B1X B;  2J8X B;  3DGN A;  3G16 A;  1B21 A;  4HM0 B;  3S5C A;  1TU5 A;  1BUJ A;  4AKY A;  1AQZ A;  4FMA A;  5AYR B;  2GU1 A;  3SX1 A;  3NX0 A;  3OV4 A;  3CC2 3;  5LC7 A;  2W56 A;  5KP4 A;  4FMB A;  4HVN A;  3MG2 A;  7STD A;  3X3Z A;  3BNB A;  4XBX A;  1A2K A;  1DYU A;  3S67 A;  3LXU X;  1BU4 A;  1QMA A;  3URP A;  2K3D A;  1IT8 A;  1RCL A;  3A76 A;  3EX9 A;  1RSN A;  1RGC A;  2BU4 A;  1IV9 A;  1BRJ A;  4XBT A;  4EYC A;  2FXT A;  1SAR A;  1W00 A;  4PEJ A;  3ER7 A;  3MG3 A;  4NRE A;  3G71 3;  3WOD G;  3IJE B;  2CG1 A;  1VQO 3;  4J5G A;  1OF5 A;  3OX9 A;  3U97 A;  2FNQ A;  3B4P A;  2KF3 A;  3UB1 A;  3CCU 3;  7GSP A;  4KFF A;  4J8T A;  5IG5 A;  1T3B A;  1QAF A;  2HOH A;  1O7P B;  4BL2 A;  1A2V A;  3WDG B;  2H0G A;  1SII A;  3EHC A;  3LH4 A;  4ORL A;  1JRQ A;  3EQQ B;  3FGY A;  1WNH A;  4BU4 A;  1NNV A;  1CQS A;  2Z77 A;  2W6J H;  1RRH A;  2XFT A;  1BRN L;  1BRI A;  1FW7 A;  2HMJ B;  3HZP A;  5RNT A;  3CC7 3;  4CCV A;  5HOH A;  3LTB A;  3FKA A;  1RMS A;  1OCV A;  1FGM A;  2ZL8 A;  2GSP A;  3LTC A;  1V58 A;  3JUQ A;  1BRS A;  3EBT A;  2CW9 A;  3JVC A;  1Q42 A;  1W7C A;  2UUG C;  4NHF A;  4XDV A;  3SYU A;  1Q7Y 4;  3S29 A;  4CJN A;  1IYY A;  1CYU A;  1B2X A;  2BNG A;  1T5Y A;  2W04 A;  4KFD A;  1W6G A;  1IQY A;  2XH9 A;  1WMN A;  1OF5 B;  1JNQ A;  4KT3 B;  1I2G A;  3GZR A;  3G4S 3;  2KXG A;  1YIJ 3;  1YJW 3;  1S72 3;  4STD A;  1G96 A;  4OUQ A;  4EV5 A;  3IPT A;  3OWS A;  1KD1 4;  4LZI A;  3N54 B;  4OK0 A;  3PXM A;  4N6T A;  2CKF B;  3WOF B;  2CFG A;  2F56 A;  2LQV A;  4FMD A;  1B2M A;  2OTL 3;  1RTU A;  5D82 A;  3KN4 A;  1YGW A;  3GSP A;  3GZX B;  4FCZ A;  3CD6 3;  1FA3 A;  1B27 A;  1OHS A;  1ROA A;  1JZO A;  3Q3F A;  1RGF A;  3IMA B;  2CFW A;  3K63 A;  1AR0 A;  1HYF A;  2WGQ A;  2XGL A;  1VQQ A;  3EN1 B;  1IDP A;  4RZM A;  2KRT A;  1X1X A;  4IIA A;  1W6C A;  3PCR A;  4AKZ A;  3DXO A;  5I97 A;  9RNT A;  4H3U A;  1BRG A;  3GWR A;  1QJG A;  4U13 A;  4WYK B;  3FG3 A;  2C11 A;  3NV0 B;  3NQZ A;  2YFJ B;  5JBS A;  2Y74 A;  3LTA A;  4K1V A;  3F40 A;  1I0X A;  1C7H A;  1MGR A;  3RDE A;  1EG9 B;  5EEO A;  5STD A;  3SVA A;  4FR9 A;  4XBY A;  4O2H A;  2V1L A;  4X2O A;  1LOV A;  1N9E A;  3GZB A;  1VQ6 3;  4FCJ A;  3H3H A;  1B3S A;  2WO0 A;  4H61 A;  2CH9 A;  2BT3 A;  2CC3 A;  1OUN A;  2XEP A;  5HGR A;  2QGU A;  4HZ9 B;  4KFE A;  1CH0 A;  1RLS A;  3FF2 A;  4WHA A;  5FW5 A;  3FSD A;  1RNT A;  1TTO A;  4LEH A;  3VGN A;  1IV7 A;  3NHX A;  1RJO A;  2F5W A;  1IK3 A;  1EEJ A;  3HI7 A;  3DGL A;  1JBS A;  3SOA A;  1DMN A;  4N6M A;  4R9L A;  1WMP A;  3F9S A;  5IEN A;  3I0Y A;  1JJ2 2;  1D6Y A;  3MWZ A;  1N8Q A;  1V74 A;  4HM7 B;  4WYK A;  1BNR A;  3OWU A;  1ISK A;  5AI1 A;  2CX0 A;  3N8B A;  5GSP A;  1LXE A;  3CC4 3;  2QEX 3;  1RGG A;  4WP5 A;  3KCH A;  1Q40 B;  3MYT A;  5D81 A;  4HM1 B;  2QA4 3;  1CEW I;  1BAO A;  1MGW A;  1UCL A;  1US1 A;  1ZO2 A;  1RDS A;  3AHS A;  3ALA A;  3HK4 A;  5JPU A;  3CCS 3;  3B8L A;  1EKM A;  2E2V A;  1X1U A;  2XFS A;  5EVH A;  3S27 A;  1UI8 A;  2B24 B;  2CIU A;  1A2P A;  1OAC A;  1FGO A;  2ML5 A;  2ZDJ A;  3CNX A;  3PZW A;  4HYZ A;  5FGO A;  3ZFZ A;  3CCQ 3;  1BSE A;  1J2B A;  2RGQ A;  1GMP A;  1B2S A;  1R4Y A;  3CCR 3;  5BIR A;  3PGB A;  1E97 A;  1QVF 2;  2KF4 A;  3NQY A;  1DVD A;  2FGT A;  1YVS A;  2A15 A;  4BL3 A;  4BTW A;  1JB4 A;  1BNS A;  3LT8 A;  3MHE A;  1DE3 A;  3LOY A;  3OXA A;  2OTJ 3;  1RRL A;  1BUQ A;  1BNG A;  1MOL A;  3H51 A;  1AVK A;  1W02 A;  3BB9 A;  1WMO A;  2Q07 A;  1VQ5 3;  1IT7 A;  3BIR A;  3AGN A;  4LGQ A;  4BTY A;  2Z76 A;  1MWS A;  1UGI A;  1D6Z A;  1UUG B;  2IMJ A;  3FZW A;  1A67 A;  3Q90 A;  1UUV B;  3EC9 A;  2ML6 A;  4O3V A;  1K8A 4;  2IUK A;  3NXJ A;  3UL5 A;  5BVB A;  1CYV A;  1B2Z A;  2HMM B;  1UW1 A;  4RNY A;  1NU3 A;  1Q86 4;  1UCK A;  3EBY A;  3NV0 A;  2BMQ B;  1EQK A;  1N5H A;  3MKI A;  4BIR A;  3F8X A;  1N5P A;  3EF8 A;  4IT7 A;  4GSP A;  1LOX A;  2OCT A;  3A5E A;  2PZV A;  2GXF A;  3CME 3;  1GOY A;  7RNT A;  2OWP A;  3X41 A;  2GEY A;  4J9A A;  4EXR A;  2CX1 A;  2AAD A;  3CCE 3;  3NM2 A;  1ASK A;  2RNT A;  3PYJ A;  3X3X A;  3PCS A;  3J7Y d;  2E2U A;  1WQL B;  4L8O A;  4X2H A;  2Z7A A;  3X40 A;  3ZG5 A;  1IVU A;  3X42 A;  3AGO A;  1GY5 A;  1DET A;  1TJD A;  1TP6 A;  2INX A;  3K9M C;  4K61 A;  3OW2 2;  3CXC 2;  1RGH A;  4HM2 B;  1DMM A;  1KSI A;  1YGE A;  2CK3 H;  2HMO B;  3QK9 A;  4N6N B;  5CK6 A;  1EA2 A;  5D83 A;  1PYL A;  3WR2 A;  4EC6 A;  5M18 A;  2F5M A;  1X1W A;  4RBN A;  3AMO A;  3B4O A;  5G2G A;  3SED A;  1GS3 A;  1RNB A;  1ULJ B;  4R1K A;  1FZU A;  3CPW 2;  2R41 A;  1YIT 3;  4JF8 A;  3DH2 A;  3F8H A;  4HM8 B;  2W2C A;  1GOV A;  1JZD A;  5A0O B;  2JQ5 A;  1BAN A;  2RSX A;  4N6L A;  1RGA A;  4L8P A;  2P05 A;  2C10 A;  4FMC A;  1TFK A;  1K41 A;  3D9R A;  5DRE A;  3GZY B;  3CCJ 3;  3LML A;  1BSA A;  2BIR A;  3HIG A;  3FG1 A;  5M1A A;  1BNE A;  2IYJ A;  3G0K A;  1VQ7 3;  3NM7 A;  2CHC A;  3PS8 A;  2SAR A;  2E2T A;  1PFP A;  1U8C B;  1SPU A;  3FH1 A;  3EN8 A;  3L0R A;  4LMI A;  5DRV A;  4KVH A;  1VQ9 3;  2YFI B;  1DMQ A;  3U1W A;  2GBW B;  3RNT A;  3D79 A;  2ZHX B;  2ZA4 A;  1I2E A;  5AIF A;  3SLU A;  2Y73 A;  4XDW A;  1M1K 4;  1GSP A;  1O7G B;  1MWU A;  3AMO B;  2CFD A;  4RNT A;  3JUO A;  1KWI A;  2CFK A;  4HKV B;  1VQM 3;  3NUV A;  2WOH A;  4ILF A;  1I8V A;  1GD3 A;  1FGT A;  2W9Q A;  2MF7 A;  3D4A A;  3T8N A;  3V92 A;  4EW5 A;  3DMC A;  2STD A;  2RFR A;  3HII A;  1YI2 3;  1M1X B; 
#chains in the Genus database with same CATH homology
 2L1S A;  4EW5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...