4EW5A

C-terminal domain of inner membrane protein cigr from salmonella enterica.
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
102
structure length
102
Chain Sequence
HRKNGGKPDHVESDISYAVARQLAVNLGLTGYQSLPPGIAKNLARGKPLPPGIAKKTVPASMLGQLPYYPGYEWKIVGDNLVLIALSTAVVTAIINGVFDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords CigR Protein
publication title C-terminal domain of inner membrane protein CigR from Salmonella enterica.
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
total genus 20
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.160 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, inner membrane protein cigr 4ew5A00
2L1SA 4EW5A
chains in the Genus database with same CATH superfamily
1JKGB 1LXEA 4K1VA 4BL2A 5FGOA 1I2GA 4HVNA 2HOHA 1TU5A 4HOHA 1M1K4 3ROBA 4N6LA 3NXJA 1IV9A 3URPA 2W0QA 1B3SA 1UGIA 5DRVA 2GSPA 3MWZA 3WA2X 2B24B 3BNCA 3LH4A 1NU3A 3SYUA 3CMA3 1NO3A 1HZ1A 3M8CA 3B8LA 1J2BA 2GBWB 3NUVA 3IJEB 4EW5A 4U13A 2QEX3 1BNRA 1W2ZA 3RGRA 4R80A 2BIRA 1QVG2 1N5PA 3BNEA 3SOAA 3F14A 4BIRA 5G1LA 3WHOA 3PXMA 1GS3A 2XFSA 1G96A 2OOVC 3F7XA 2ZL8A 1V57A 1N9EA 3CNXA 3PYJA 4QWTA 1KSIA 3EN1B 4XB5A 1B2XA 4XM4A 1UI7A 3Q90A 2INXA 1Q864 2O3OA 1VQL3 1JKGA 1RRLA 3E99A 1Q7HA 4JRFA 1UI8A 1Q824 5KP3A 2IY2A 1I3FA 1VQM3 1JB4A 1BRGA 1DVDA 1MWUA 1N9JA 2CFKA 1BNEA 1DE3A 2L1SA 4N6UA 4EC6A 3LT8A 2JQ5A 1D6UA 1NNVA 1BNSA 3OWSA 5G1KA 1PFPA 4IIAA 3UL5A 3EC9A 1Q9EA 1X1UA 4K90B 4O3VA 4GB5A 4AKYA 5BIRA 3G713 3FCSB 1A90A 3SXXA 1A2KA 3G6E3 1IQXA 1BNJA 1OUNA 1D6ZA 4I4KA 4RBNA 3CC23 1MGRA 3HX8A 2AAEA 3D3LA 2GEXA 1BSBA 1RGKA 3WODG 1BRKA 1W01A 1W6YA 3KE7A 3AGNA 3F8XA 3NM2A 1JBTA 4J5GA 1OGZA 1LOYA 4HBRA 1RSNA 4J5KA 3NQZA 1S5AA 1ROAA 4ILFA 1GOUA 8RNTA 1I0VA 3EX9A 1VQ43 3MKIA 4HM2B 3HIGA 1GOYA 4OK0A 3CCL3 1UUGB 3ALAA 3K63A 3F7SA 3CCU3 4XBTA 1Q40B 1YGWA 2OQEA 3UJMA 3DGLA 4HM3B 3KN4A 2K54A 2LQVA 3NV0B 1K734 1KC84 3DZLA 2H0HA 3N8BA 5AEWB 1VQN3 4FMAA 1NB5I 1O7MB 1X1YA 4PEJA 5DREA 5CF2A 5D81A 3BLZA 1OPYA 3X41A 4CJNA 5IENA 7STDA 2RCDA 4N6NB 1FGOA 1RHLA 2OCTA 1I8VA 5IG3A 2CG0A 1TRPA 1YVSA 4HYZA 4HM6B 1Q42A 4ORLA 5LC7A 2V1LA 1A2PA 3NX0A 1FUSA 1T5YA 3KSPA 2B1XB 4N6V0 3F9SA 5CLKA 1FGMA 3WA3A 1X1XA 3G16A 4R4KA 3EBTA 3FH1A 2KF4A 2FXTA 2Y74A 2UUGC 2Q07A 1JV2B 4TX4A 4EXRA 2RFRA 1BRIA 3NM7A 2CFWA 1UUVB 4LGQA 2CX0A 3CCM3 3IMAB 1QVF2 3NHXA 4EBGA 3CC73 1M1XB 4N6MA 1W00A 1NDOB 3AGOA 1B21A 3D4AA 3G4S3 4IT7A 1GY5A 1UCKA 2KRTA 3RGAA 4HM1B 1WMNA 4HM7B 1EA2A 1RTUA 3CU3A 5FW5A 3BIRA 3MPHA 2P05A 1Q40A 7GSPA 1IT7A 1YIJ3 5AYSC 4MMZB 1DETA 2MF7A 1RGEA 3NV0A 5KP1A 4MEIA 1KQS2 4L8OA 4NHFA 2CKFB 2LYXA 4EYCA 3K5TA 1DYUA 1KWIA 1ROVA 1UDII 1VQ73 1LNIA 3BU4A 1RNTA 1C54A 3BNDA 4XBYA 5HGRA 2ML5A 4Q53A 2XSOB 1IVWA 1FYSA 3V92A 5HOHA 1WNHA 3Q1CA 1LVNA 2Y73A 1DVCA 1G0TA 5ELJA 1ZO2A 3WDGB 1IU7A 3ZG5A 5IEPA 1SQWA 2BMOB 4BL3A 1BIRA 4H61A 1QAKA 3JUPA 4R9KA 4FCMA 1GD3A 1VQQA 1S723 4RNZA 3FGYA 1RCKA 2A15A 1LNHA 4CCVA 3OX9A 3CXC2 4STDA 1CYUA 2P0XA 3KFQC 1Q814 2CC3A 4N6TA 1TRQA 1GMPA 1BNFA 1OHPA 3IPTA 1I2FA 4HM0B 5EVHA 3JUQA 2CHCA 1MWSA 5D82A 5IEOA 4WHAA 2Z6BA 4LMIA 1BRJA 1IQ8A 4FCZA 3DY5A 1YNVX 1MGWA 2QIYA 1YJW3 3LTDA 2OTJ3 4MJDA 2C4BA 3AMOB 3LT9A 2JDIH 3KZTA 5IG4A 3MG3A 2IUJA 3I553 1Z1SA 2HMOB 1ZS7A 5IF6A 3K0ZA 1W6GA 1E3VA 4KFEA 2YFIB 1YIT3 3NQYA 1AVKA 1RGHA 2XH9A 4FMBA 4GSPA 3HZPA 1GY6A 2WGOA 2W04A 4FCJA 2HMKB 1K41A 2RSXA 1UCJA 4OVMA 3DH2A 2Z7AA 3HIIA 2W56B 1NB3I 3CD63 1SJWA 1A67A 1BRHA 1ULJB 3LTBA 1AY7A 1X1WA 1K8A4 1RGCA 2IMJA 3PGBA 5AI1A 3CPW2 4K61A 1STDA 1RRHA 1PYLA 3X40A 5TGNA 1AV4A 2GXFA 2KF5A 3H3HA 4HJLB 2F5MA 1VZZA 5M19A 1YI23 3HK4A 1YJN3 3S27A 1TUHA 1CH0A 3CPOA 3I0YA 2IYJA 4BU4A 1BU4A 3ECFA 5BVBA 3FF0A 4FMCA 3B4OA 1FA3A 4DKIA 1WMPA 1VQP3 3X3XA 1BSEA 1ZX2A 3EBYA 3A76A 3LTCA 3WMDA 1N5HA 3LMLA 2J8XB 3NBRA 1L5GB 1FGTA 1RN4A 2XGNA 2WOFA 2BHMA 4WYKB 5JPUA 3DUKA 2BMRB 2Z77A 3AMOA 2CK3H 1M904 1DMMA 1BNGA 1VQK3 4NPBA 1JBRA 1RN7A 1SIHA 1SIIA 3NBBA 4J9AA 4RNTA 1B2MA 3GZBA 4N6OB 1YVBI 3Q3FA 2W2CA 2K3DA 3S67A 3PCRA 1LOXA 1JB5A 2ZA4A 4X2OA 3H51A 4OUQA 3MG1A 4ZM8A 2L4VA 2KXGA 3T8UA 2SBLA 4RNYA 1YJ93 1O7WB 1TTOA 1O7HB 3AHSA 4KZ1A 2CFGA 1BRSA 3UNLA 1I70A 3FZWA 5AIIA 1MNLA 4KFFA 5IW9A 1YGEA 1BOXA 2XGLA 4JF8A 1BNIA 2GU3A 5M1AA 1B2SA 1JJ22 1IYYA 3CCS3 2YFLB 1B20A 1N8QA 1SPUA 3EJVA 1W02A 2FGTA 2STDA 3GZXB 4LSOA 3DGYA 2O9UX 3ZG0A 1CYVA 1MOLA 3K7CA 3S28A 2R4IA 4IPBA 3X3ZA 3X3YA 3FLJA 6STDA 1E97A 1T3BA 1RGFA 3F40A 3KIIA 3MG2A 2F99A 4LEHA 2OOVA 3SEDA 3X42A 1VQ63 4WYKA 1QALA 3EF8A 2OTL3 1GYBA 4RZMA 4XBXA 5JBSA 2YX9A 4O02B 5EEOA 1OACA 1UW1A 3GSPA 1W6CA 1O7PB 2IA7A 4LZIA 1RGGA 3DM8A 2FNQA 4HM5B 1LOWA 3U1WA 2BMQB 1A2VA 3WR2A 4AKZA 2I9WA 3JVCA 5GSPA 2QGUA 1V74A 1IVXA 2MC8A 1C7HA 1YHQ3 4J8TA 3FSDA 4EV5A 3V99A 3FF2A 2PZVA 5D83A 3JUNA 1OHOA 1PU4A 2R41A 3OXAA 1AVLA 1OCVA 1VQO3 3CCQ3 2WOHA 1IQYA 2BNGA 3N9HA 5ELUA 1RGAA 1OGXA 3T8NA 1RNBA 1W7CA 1I3IA 4HM4B 1RCLA 2ZHXB 1BGSA 3MYTA 3RNTA 3LTAA 2BT3A 2H0IA 3GWRA 1LRAA 2C10A 2KCDA 1MWRA 3Q2PA 2Z76A 1RLSA 2XSHB 1BSAA 3SOYA 1BANA 2RBIA 2YFJB 1IDPA 2CWTA 3AHWA 1EUIC 5IERA 2F5WA 1NWWA 5KP4A 2SARA 4L8PA 1G02A 3JUOA 1K28A 1SARA 3A5EA 3LYGA 1B2UA 1CEWI 1GMRA 5AYRB 2BO9B 2OQEC 1NJI4 4HM8B 1EKMA 2W9PA 1QAFA 3ER7A 1RMSA 1EG9B 2CH9A 2RNTA 3K9MC 5CF1A 1T2HA 3GZRA 1VQ83 3PCSA 1BSCA 1IT8A 1JZDA 2WGQA 2XF3A 3DXOA 5A0OB 1IK3A 4GL6A 1LOVA 4I5QA 1JBSA 3EN8A 3QK9A 4G1MB 3N54B 1EEJA 1U8CB 4XDVA 3B4PA 3JUMA 2D42A 3CCV3 3HOHA 2CIUA 1GSPA 3BB9A 1D6YA 1IVUA 2OWPA 1BUJA 2KAAA 5RNTA 1PY3A 1BVIA 7RNTA 1LQMB 2P09A 2CG1A 2UGIA 2F98A 2E2UA 3QRDA 5CK6A 4EV2A 1K9M4 3S5CA 1GD4A 1UCLA 4X2HA 3DMCA 3U97A 3KCHA 3DGNA 3OWUA 1GMQA 5M18A 2XFTA 1LQGC 3PZWA 1OH0A 4H3UA 3GZYB 3EE1A 1I0XA 2RGQA 5LC6A 4KT3B 3D9RA 1STFI 4K1UA 2XR8B 3MSOA 1VQ93 2K0MA 1BSDA 1M9GA 2P38A 4NREA 1Q7Y4 4MMXB 1WQLB 1VQ53 1TFKA 3PS8A 2GBXB 4XDWA 5I97A 1RDSA 2GEYA 1UGHI 2F4YA 4R9LA 5IG5A 4L7KA 2KF3A 3FG3A 3FG4A 2F56A 1RJOA 1HYFA 2KF6A 3G0KA 2CW9A 4KFDA 3OWYA 3S29A 1I2EA 4BTYA 1GY7A 2HMNB 1W5ZA 1HKXA 1WTHA 1TIJA 3CNMA 1RN1A 2W6JH 2E2TA 1T2IA 3L0RA 2M7OA 1UUWB 2CWVA 3SX1A 1B27A 1JN5B 2D1WA 2W56A 4O8SA 3WOFB 9RNTA 1FUTA 4HAAA 5BXQA 8CHOA 1BRNL 1AR0A 5STDA 3CC43 1ISKA 2XRXB 5JPPA 3V98A 3ZFZA 2ML6A 2W9QA 1OF5B 2BU4A 3DGMA 3F8HA 5CXOA 3VSYA 4WP5A 4BTWA 2HMLB 4KVHA 3LXUX 4CDLA 1AQZA 2E2VA 4WWUC 4WFOA 2F86B 2W03A 3MHEA 1RGLA 3STDA 3BNBA 2P0MA 3O8YA 3D79A 1E3RA 3SLUA 1JRQA 3FG1A 1R4CA 5EQLA 1R4YA 1GOVA 3J7Yd 4O2HA 1N8R4 3GRDA 1US1A 1TJDA 1OHSA 3VF1A 1ASKA 1B2ZA 1MWTA 2PNCA 1FGQA 3KSED 3LZAA 2CX1A 4GHOA 4FR9A 4N3VA 1ZGXA 1QJGA 2CFDA 1Y4KA 3KKGA 4MMYB 1DMNA 2GU1A 1ULIB 1JB2A 1WMOA 2ZDJA 3NBJA 2IUKA 2QA43 1BAOA 3HI7A 1EQKA 1V58A 3TDGA 4HZ9B 3FKAA 3UB1A 6RNTA 2UX0A 5AIGA 5AIFA 1JNQA 1U5OA 3RDEA 3VGNA 4AEQA 3OV4A 3EQQB 1RKYA 2AADA 4HKVB 1O7GB 3CCR3 3LOYA 3CCE3 1IVVA 1JN5A 1JZOA 1QMAA 4HZBB 1BUQA 1FGRA 1IV7A 2HMJB 2HMMB 4LYLB 5G2GA 3T0UA 1HU9A 1UCIA 2CFLA 2H0GA 3G8ZA 3WOEB 1DMQA 5IG0A 3I563 1OF5A 6GSPA 5BU4A 3B7CA 3CME3 3UL6A 1F8NA 2CWUA 4R1KA 5AIHA 1TP6A 3EHCA 3CCJ3 1W2B2 2XEPA 3SVAA 1FW7A 1O7NB 3GAXA 1W4NA 5AEUB 1KD14 3D5IA 2C11A 4FMDA 1FZUA 1TFOA 3EB8A 3D5GA 4BTXA 2WO0A 4CPKA 3DGOA 3OW22 1FUWA 1CQSA
chains in the Genus database with same CATH topology
2L1SA 4EW5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L1S A;  4EW5 A; 
#chains in the Genus database with same CATH topology
 1JKG B;  1LXE A;  4K1V A;  4BL2 A;  5FGO A;  1I2G A;  4HVN A;  2HOH A;  1TU5 A;  4HOH A;  1M1K 4;  3ROB A;  4N6L A;  3NXJ A;  1IV9 A;  3URP A;  2W0Q A;  1B3S A;  1UGI A;  5DRV A;  2GSP A;  3MWZ A;  3WA2 X;  2B24 B;  3BNC A;  3LH4 A;  1NU3 A;  3SYU A;  3CMA 3;  1NO3 A;  1HZ1 A;  3M8C A;  3B8L A;  1J2B A;  2GBW B;  3NUV A;  3IJE B;  4EW5 A;  4U13 A;  2QEX 3;  1BNR A;  1W2Z A;  3RGR A;  4R80 A;  2BIR A;  1QVG 2;  1N5P A;  3BNE A;  3SOA A;  3F14 A;  4BIR A;  5G1L A;  3WHO A;  3PXM A;  1GS3 A;  2XFS A;  1G96 A;  2OOV C;  3F7X A;  2ZL8 A;  1V57 A;  1N9E A;  3CNX A;  3PYJ A;  4QWT A;  1KSI A;  3EN1 B;  4XB5 A;  1B2X A;  4XM4 A;  1UI7 A;  3Q90 A;  2INX A;  1Q86 4;  2O3O A;  1VQL 3;  1JKG A;  1RRL A;  3E99 A;  1Q7H A;  4JRF A;  1UI8 A;  1Q82 4;  5KP3 A;  2IY2 A;  1I3F A;  1VQM 3;  1JB4 A;  1BRG A;  1DVD A;  1MWU A;  1N9J A;  2CFK A;  1BNE A;  1DE3 A;  2L1S A;  4N6U A;  4EC6 A;  3LT8 A;  2JQ5 A;  1D6U A;  1NNV A;  1BNS A;  3OWS A;  5G1K A;  1PFP A;  4IIA A;  3UL5 A;  3EC9 A;  1Q9E A;  1X1U A;  4K90 B;  4O3V A;  4GB5 A;  4AKY A;  5BIR A;  3G71 3;  3FCS B;  1A90 A;  3SXX A;  1A2K A;  3G6E 3;  1IQX A;  1BNJ A;  1OUN A;  1D6Z A;  4I4K A;  4RBN A;  3CC2 3;  1MGR A;  3HX8 A;  2AAE A;  3D3L A;  2GEX A;  1BSB A;  1RGK A;  3WOD G;  1BRK A;  1W01 A;  1W6Y A;  3KE7 A;  3AGN A;  3F8X A;  3NM2 A;  1JBT A;  4J5G A;  1OGZ A;  1LOY A;  4HBR A;  1RSN A;  4J5K A;  3NQZ A;  1S5A A;  1ROA A;  4ILF A;  1GOU A;  8RNT A;  1I0V A;  3EX9 A;  1VQ4 3;  3MKI A;  4HM2 B;  3HIG A;  1GOY A;  4OK0 A;  3CCL 3;  1UUG B;  3ALA A;  3K63 A;  3F7S A;  3CCU 3;  4XBT A;  1Q40 B;  1YGW A;  2OQE A;  3UJM A;  3DGL A;  4HM3 B;  3KN4 A;  2K54 A;  2LQV A;  3NV0 B;  1K73 4;  1KC8 4;  3DZL A;  2H0H A;  3N8B A;  5AEW B;  1VQN 3;  4FMA A;  1NB5 I;  1O7M B;  1X1Y A;  4PEJ A;  5DRE A;  5CF2 A;  5D81 A;  3BLZ A;  1OPY A;  3X41 A;  4CJN A;  5IEN A;  7STD A;  2RCD A;  4N6N B;  1FGO A;  1RHL A;  2OCT A;  1I8V A;  5IG3 A;  2CG0 A;  1TRP A;  1YVS A;  4HYZ A;  4HM6 B;  1Q42 A;  4ORL A;  5LC7 A;  2V1L A;  1A2P A;  3NX0 A;  1FUS A;  1T5Y A;  3KSP A;  2B1X B;  4N6V 0;  3F9S A;  5CLK A;  1FGM A;  3WA3 A;  1X1X A;  3G16 A;  4R4K A;  3EBT A;  3FH1 A;  2KF4 A;  2FXT A;  2Y74 A;  2UUG C;  2Q07 A;  1JV2 B;  4TX4 A;  4EXR A;  2RFR A;  1BRI A;  3NM7 A;  2CFW A;  1UUV B;  4LGQ A;  2CX0 A;  3CCM 3;  3IMA B;  1QVF 2;  3NHX A;  4EBG A;  3CC7 3;  1M1X B;  4N6M A;  1W00 A;  1NDO B;  3AGO A;  1B21 A;  3D4A A;  3G4S 3;  4IT7 A;  1GY5 A;  1UCK A;  2KRT A;  3RGA A;  4HM1 B;  1WMN A;  4HM7 B;  1EA2 A;  1RTU A;  3CU3 A;  5FW5 A;  3BIR A;  3MPH A;  2P05 A;  1Q40 A;  7GSP A;  1IT7 A;  1YIJ 3;  5AYS C;  4MMZ B;  1DET A;  2MF7 A;  1RGE A;  3NV0 A;  5KP1 A;  4MEI A;  1KQS 2;  4L8O A;  4NHF A;  2CKF B;  2LYX A;  4EYC A;  3K5T A;  1DYU A;  1KWI A;  1ROV A;  1UDI I;  1VQ7 3;  1LNI A;  3BU4 A;  1RNT A;  1C54 A;  3BND A;  4XBY A;  5HGR A;  2ML5 A;  4Q53 A;  2XSO B;  1IVW A;  1FYS A;  3V92 A;  5HOH A;  1WNH A;  3Q1C A;  1LVN A;  2Y73 A;  1DVC A;  1G0T A;  5ELJ A;  1ZO2 A;  3WDG B;  1IU7 A;  3ZG5 A;  5IEP A;  1SQW A;  2BMO B;  4BL3 A;  1BIR A;  4H61 A;  1QAK A;  3JUP A;  4R9K A;  4FCM A;  1GD3 A;  1VQQ A;  1S72 3;  4RNZ A;  3FGY A;  1RCK A;  2A15 A;  1LNH A;  4CCV A;  3OX9 A;  3CXC 2;  4STD A;  1CYU A;  2P0X A;  3KFQ C;  1Q81 4;  2CC3 A;  4N6T A;  1TRQ A;  1GMP A;  1BNF A;  1OHP A;  3IPT A;  1I2F A;  4HM0 B;  5EVH A;  3JUQ A;  2CHC A;  1MWS A;  5D82 A;  5IEO A;  4WHA A;  2Z6B A;  4LMI A;  1BRJ A;  1IQ8 A;  4FCZ A;  3DY5 A;  1YNV X;  1MGW A;  2QIY A;  1YJW 3;  3LTD A;  2OTJ 3;  4MJD A;  2C4B A;  3AMO B;  3LT9 A;  2JDI H;  3KZT A;  5IG4 A;  3MG3 A;  2IUJ A;  3I55 3;  1Z1S A;  2HMO B;  1ZS7 A;  5IF6 A;  3K0Z A;  1W6G A;  1E3V A;  4KFE A;  2YFI B;  1YIT 3;  3NQY A;  1AVK A;  1RGH A;  2XH9 A;  4FMB A;  4GSP A;  3HZP A;  1GY6 A;  2WGO A;  2W04 A;  4FCJ A;  2HMK B;  1K41 A;  2RSX A;  1UCJ A;  4OVM A;  3DH2 A;  2Z7A A;  3HII A;  2W56 B;  1NB3 I;  3CD6 3;  1SJW A;  1A67 A;  1BRH A;  1ULJ B;  3LTB A;  1AY7 A;  1X1W A;  1K8A 4;  1RGC A;  2IMJ A;  3PGB A;  5AI1 A;  3CPW 2;  4K61 A;  1STD A;  1RRH A;  1PYL A;  3X40 A;  5TGN A;  1AV4 A;  2GXF A;  2KF5 A;  3H3H A;  4HJL B;  2F5M A;  1VZZ A;  5M19 A;  1YI2 3;  3HK4 A;  1YJN 3;  3S27 A;  1TUH A;  1CH0 A;  3CPO A;  3I0Y A;  2IYJ A;  4BU4 A;  1BU4 A;  3ECF A;  5BVB A;  3FF0 A;  4FMC A;  3B4O A;  1FA3 A;  4DKI A;  1WMP A;  1VQP 3;  3X3X A;  1BSE A;  1ZX2 A;  3EBY A;  3A76 A;  3LTC A;  3WMD A;  1N5H A;  3LML A;  2J8X B;  3NBR A;  1L5G B;  1FGT A;  1RN4 A;  2XGN A;  2WOF A;  2BHM A;  4WYK B;  5JPU A;  3DUK A;  2BMR B;  2Z77 A;  3AMO A;  2CK3 H;  1M90 4;  1DMM A;  1BNG A;  1VQK 3;  4NPB A;  1JBR A;  1RN7 A;  1SIH A;  1SII A;  3NBB A;  4J9A A;  4RNT A;  1B2M A;  3GZB A;  4N6O B;  1YVB I;  3Q3F A;  2W2C A;  2K3D A;  3S67 A;  3PCR A;  1LOX A;  1JB5 A;  2ZA4 A;  4X2O A;  3H51 A;  4OUQ A;  3MG1 A;  4ZM8 A;  2L4V A;  2KXG A;  3T8U A;  2SBL A;  4RNY A;  1YJ9 3;  1O7W B;  1TTO A;  1O7H B;  3AHS A;  4KZ1 A;  2CFG A;  1BRS A;  3UNL A;  1I70 A;  3FZW A;  5AII A;  1MNL A;  4KFF A;  5IW9 A;  1YGE A;  1BOX A;  2XGL A;  4JF8 A;  1BNI A;  2GU3 A;  5M1A A;  1B2S A;  1JJ2 2;  1IYY A;  3CCS 3;  2YFL B;  1B20 A;  1N8Q A;  1SPU A;  3EJV A;  1W02 A;  2FGT A;  2STD A;  3GZX B;  4LSO A;  3DGY A;  2O9U X;  3ZG0 A;  1CYV A;  1MOL A;  3K7C A;  3S28 A;  2R4I A;  4IPB A;  3X3Z A;  3X3Y A;  3FLJ A;  6STD A;  1E97 A;  1T3B A;  1RGF A;  3F40 A;  3KII A;  3MG2 A;  2F99 A;  4LEH A;  2OOV A;  3SED A;  3X42 A;  1VQ6 3;  4WYK A;  1QAL A;  3EF8 A;  2OTL 3;  1GYB A;  4RZM A;  4XBX A;  5JBS A;  2YX9 A;  4O02 B;  5EEO A;  1OAC A;  1UW1 A;  3GSP A;  1W6C A;  1O7P B;  2IA7 A;  4LZI A;  1RGG A;  3DM8 A;  2FNQ A;  4HM5 B;  1LOW A;  3U1W A;  2BMQ B;  1A2V A;  3WR2 A;  4AKZ A;  2I9W A;  3JVC A;  5GSP A;  2QGU A;  1V74 A;  1IVX A;  2MC8 A;  1C7H A;  1YHQ 3;  4J8T A;  3FSD A;  4EV5 A;  3V99 A;  3FF2 A;  2PZV A;  5D83 A;  3JUN A;  1OHO A;  1PU4 A;  2R41 A;  3OXA A;  1AVL A;  1OCV A;  1VQO 3;  3CCQ 3;  2WOH A;  1IQY A;  2BNG A;  3N9H A;  5ELU A;  1RGA A;  1OGX A;  3T8N A;  1RNB A;  1W7C A;  1I3I A;  4HM4 B;  1RCL A;  2ZHX B;  1BGS A;  3MYT A;  3RNT A;  3LTA A;  2BT3 A;  2H0I A;  3GWR A;  1LRA A;  2C10 A;  2KCD A;  1MWR A;  3Q2P A;  2Z76 A;  1RLS A;  2XSH B;  1BSA A;  3SOY A;  1BAN A;  2RBI A;  2YFJ B;  1IDP A;  2CWT A;  3AHW A;  1EUI C;  5IER A;  2F5W A;  1NWW A;  5KP4 A;  2SAR A;  4L8P A;  1G02 A;  3JUO A;  1K28 A;  1SAR A;  3A5E A;  3LYG A;  1B2U A;  1CEW I;  1GMR A;  5AYR B;  2BO9 B;  2OQE C;  1NJI 4;  4HM8 B;  1EKM A;  2W9P A;  1QAF A;  3ER7 A;  1RMS A;  1EG9 B;  2CH9 A;  2RNT A;  3K9M C;  5CF1 A;  1T2H A;  3GZR A;  1VQ8 3;  3PCS A;  1BSC A;  1IT8 A;  1JZD A;  2WGQ A;  2XF3 A;  3DXO A;  5A0O B;  1IK3 A;  4GL6 A;  1LOV A;  4I5Q A;  1JBS A;  3EN8 A;  3QK9 A;  4G1M B;  3N54 B;  1EEJ A;  1U8C B;  4XDV A;  3B4P A;  3JUM A;  2D42 A;  3CCV 3;  3HOH A;  2CIU A;  1GSP A;  3BB9 A;  1D6Y A;  1IVU A;  2OWP A;  1BUJ A;  2KAA A;  5RNT A;  1PY3 A;  1BVI A;  7RNT A;  1LQM B;  2P09 A;  2CG1 A;  2UGI A;  2F98 A;  2E2U A;  3QRD A;  5CK6 A;  4EV2 A;  1K9M 4;  3S5C A;  1GD4 A;  1UCL A;  4X2H A;  3DMC A;  3U97 A;  3KCH A;  3DGN A;  3OWU A;  1GMQ A;  5M18 A;  2XFT A;  1LQG C;  3PZW A;  1OH0 A;  4H3U A;  3GZY B;  3EE1 A;  1I0X A;  2RGQ A;  5LC6 A;  4KT3 B;  3D9R A;  1STF I;  4K1U A;  2XR8 B;  3MSO A;  1VQ9 3;  2K0M A;  1BSD A;  1M9G A;  2P38 A;  4NRE A;  1Q7Y 4;  4MMX B;  1WQL B;  1VQ5 3;  1TFK A;  3PS8 A;  2GBX B;  4XDW A;  5I97 A;  1RDS A;  2GEY A;  1UGH I;  2F4Y A;  4R9L A;  5IG5 A;  4L7K A;  2KF3 A;  3FG3 A;  3FG4 A;  2F56 A;  1RJO A;  1HYF A;  2KF6 A;  3G0K A;  2CW9 A;  4KFD A;  3OWY A;  3S29 A;  1I2E A;  4BTY A;  1GY7 A;  2HMN B;  1W5Z A;  1HKX A;  1WTH A;  1TIJ A;  3CNM A;  1RN1 A;  2W6J H;  2E2T A;  1T2I A;  3L0R A;  2M7O A;  1UUW B;  2CWV A;  3SX1 A;  1B27 A;  1JN5 B;  2D1W A;  2W56 A;  4O8S A;  3WOF B;  9RNT A;  1FUT A;  4HAA A;  5BXQ A;  8CHO A;  1BRN L;  1AR0 A;  5STD A;  3CC4 3;  1ISK A;  2XRX B;  5JPP A;  3V98 A;  3ZFZ A;  2ML6 A;  2W9Q A;  1OF5 B;  2BU4 A;  3DGM A;  3F8H A;  5CXO A;  3VSY A;  4WP5 A;  4BTW A;  2HML B;  4KVH A;  3LXU X;  4CDL A;  1AQZ A;  2E2V A;  4WWU C;  4WFO A;  2F86 B;  2W03 A;  3MHE A;  1RGL A;  3STD A;  3BNB A;  2P0M A;  3O8Y A;  3D79 A;  1E3R A;  3SLU A;  1JRQ A;  3FG1 A;  1R4C A;  5EQL A;  1R4Y A;  1GOV A;  3J7Y d;  4O2H A;  1N8R 4;  3GRD A;  1US1 A;  1TJD A;  1OHS A;  3VF1 A;  1ASK A;  1B2Z A;  1MWT A;  2PNC A;  1FGQ A;  3KSE D;  3LZA A;  2CX1 A;  4GHO A;  4FR9 A;  4N3V A;  1ZGX A;  1QJG A;  2CFD A;  1Y4K A;  3KKG A;  4MMY B;  1DMN A;  2GU1 A;  1ULI B;  1JB2 A;  1WMO A;  2ZDJ A;  3NBJ A;  2IUK A;  2QA4 3;  1BAO A;  3HI7 A;  1EQK A;  1V58 A;  3TDG A;  4HZ9 B;  3FKA A;  3UB1 A;  6RNT A;  2UX0 A;  5AIG A;  5AIF A;  1JNQ A;  1U5O A;  3RDE A;  3VGN A;  4AEQ A;  3OV4 A;  3EQQ B;  1RKY A;  2AAD A;  4HKV B;  1O7G B;  3CCR 3;  3LOY A;  3CCE 3;  1IVV A;  1JN5 A;  1JZO A;  1QMA A;  4HZB B;  1BUQ A;  1FGR A;  1IV7 A;  2HMJ B;  2HMM B;  4LYL B;  5G2G A;  3T0U A;  1HU9 A;  1UCI A;  2CFL A;  2H0G A;  3G8Z A;  3WOE B;  1DMQ A;  5IG0 A;  3I56 3;  1OF5 A;  6GSP A;  5BU4 A;  3B7C A;  3CME 3;  3UL6 A;  1F8N A;  2CWU A;  4R1K A;  5AIH A;  1TP6 A;  3EHC A;  3CCJ 3;  1W2B 2;  2XEP A;  3SVA A;  1FW7 A;  1O7N B;  3GAX A;  1W4N A;  5AEU B;  1KD1 4;  3D5I A;  2C11 A;  4FMD A;  1FZU A;  1TFO A;  3EB8 A;  3D5G A;  4BTX A;  2WO0 A;  4CPK A;  3DGO A;  3OW2 2;  1FUW A;  1CQS A; 
#chains in the Genus database with same CATH homology
 2L1S A;  4EW5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...