1N5PA

Solution structure of the cathelin-like domain of protegrins (all amide bonds involving proline residues are in trans conformation)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
105
structure length
105
Chain Sequence
GSHMQALSYREAVLRAVDRLNEQSSEANLYRLLELDQPPKADEDPGTPKPVSFTVKETVCPRPTRQPPELCDFKENGRVKQCVGTVTLDQIKDPLDITCNEVQGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antibiotic
molecule keywords protegrins
publication title NMR Structure of the Cathelin-like domain of the protegrin-3 Precursor
pubmed doi rcsb
source organism Sus scrofa
total genus 18
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2002-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00666 Cathelicidins Cathelicidin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1n5pA00
3S67A 1TIJA 4LZIA 1M9GA 5LC7A 3QRDA 1CYVA 1N9JA 1NB5I 2W9PA 1NB3I 3UL5A 3SVAA 1IV7A 3K9MC 3PXMA 4TX4A 1CYUA 3L0RA 2CH9A 1PFPA 1WNHA 1GD4A 3UL6A 1IV9A 4ZM8A 1STFI 4CCVA 5A0OB 1CEWI 4N6TA 4N6UA 1EQKA 1YVBI 3LH4A 1GD3A 3PS8A 1MNLA 4N6NB 1DVDA 4N6LA 3GAXA 1ROAA 5ELJA 1N5HA 1R4CA 2W9QA 2OCTA 4N6OB 3IMAB 1LXEA 1N5PA 3KSED 3MWZA 4EYCA 5ELUA 1MOLA 4N6MA 1KWIA 4N6V0 1A90A 4IT7A 2BO9B 1A67A 1G96A 1FA3A 1FUWA 5EQLA 2KXGA 3Q2PA 1RN7A 5LC6A 3PYJA 3KFQC 1DVCA 3NX0A 2O9UX
chains in the Genus database with same CATH superfamily
1NJI4 3JVCA 2I9WA 2ML6A 2YFIB 4LZIA 1Q864 1EEJA 1UI7A 1GY7A 3M8CA 1DMMA 5TGNA 3T0UA 1UCKA 3EF8A 1PYLA 3K7CA 1FGQA 3SOAA 6STDA 2HMKB 2KCDA 4LEHA 4L8PA 1TRQA 1EG9B 1RLSA 1RCLA 5BXQA 4OVMA 1IV7A 5BIRA 4R9KA 3K0ZA 1SPUA 1IVWA 1B2ZA 1AVKA 2ZDJA 3K9MC 3CC43 3PCSA 1YIJ3 1ZO2A 1N8R4 4MJDA 2C10A 3RGRA 1BANA 1JZOA 5AYSC 1IDPA 1RN4A 1BRHA 2KF6A 3QK9A 2E2TA 3EBYA 3DXOA 4HM5B 1BSDA 2BMRB 3BB9A 1GMRA 5AIHA 4K1UA 1JBRA 1Q40A 1GD4A 1NO3A 2SBLA 1TP6A 2INXA 1BNGA 4ZM8A 5BU4A 4OK0A 3F9SA 2CHCA 3WODG 1X1XA 1UGIA 2P0MA 1BSCA 3GZBA 1IT7A 1FUSA 1OHOA 2CFLA 1Q42A 2CFKA 3Q90A 4N6UA 3WR2A 2CWTA 2FNQA 2XGNA 4WHAA 3RNTA 3X3ZA 2ZL8A 1GD3A 1OGZA 2GBWB 1BNIA 2PZVA 2P05A 3KSPA 5IG5A 2F5MA 4DKIA 2QA43 2QGUA 1MNLA 1B20A 3HX8A 2OOVC 4N6NB 2F4YA 3DGNA 1I2FA 1HU9A 3FZWA 1AV4A 1GY6A 1NDOB 3F40A 1O7WB 1TRPA 1B3SA 3CMA3 3D4AA 3X40A 3CCM3 1GMQA 5AYRB 1T5YA 2H0HA 2XGLA 1QVF2 1B21A 4GL6A 1YIT3 3CME3 1OGXA 4FR9A 3EN1B 4BTWA 4HM2B 2K3DA 1LNIA 1N8QA 1Q7Y4 5KP4A 4X2OA 1OUNA 1L5GB 3OWSA 1ROVA 5DRVA 3NXJA 4EXRA 4MMYB 1NU3A 2L4VA 4AKYA 4CJNA 3FH1A 1MGWA 3FF2A 1BOXA 1JB4A 2C11A 1BSBA 5ELUA 2WGQA 1YGEA 4HYZA 4MMXB 1FZUA 1T3BA 4HM8B 4RNYA 3GRDA 2XFTA 1RN1A 2FXTA 2RCDA 1JNQA 2CFDA 4J9AA 1WMOA 3AGOA 4JRFA 1TFOA 4WYKB 1UUVB 2PNCA 2ZA4A 2L1SA 1BSAA 4HM6B 3WMDA 4MEIA 1ULIB 3MG1A 1YHQ3 1I8VA 2BO9B 1OHPA 1A67A 1MWRA 4WYKA 1JBTA 1LOXA 3LMLA 2BIRA 4R1KA 5RNTA 2OTL3 5AIIA 1SARA 4XBYA 5M1AA 5IENA 1ZGXA 3UJMA 4FCMA 3CCS3 1ZX2A 2P38A 1RGEA 1IQ8A 2GEXA 5IG0A 3FGYA 3WDGB 1RGGA 3TDGA 1SIIA 3B7CA 1VQO3 3VSYA 3CCR3 4BTYA 3PZWA 4OUQA 4NREA 1DVCA 3CCQ3 3OW22 3CC73 3H3HA 1AR0A 2UUGC 3MPHA 2BMOB 2W56B 2XFSA 3CCV3 2V1LA 3PCRA 1RCKA 4HKVB 4XDVA 1TIJA 3DUKA 1W2ZA 4HM4B 4XM4A 1DMQA 5I97A 3CCJ3 1RNBA 4ILFA 3T8NA 5LC7A 1N9EA 1TUHA 1FGOA 1B2MA 1JRQA 1CYVA 1N9JA 3S29A 4CPKA 1NB3I 3DGMA 3LXUX 1NB5I 1A2VA 3X42A 1GSPA 3DGLA 2CG1A 3SVAA 1ZS7A 2WOHA 5EEOA 1TFKA 1VZZA 3HIIA 3AGNA 3MSOA 4L8OA 3ZFZA 3NHXA 2K0MA 3BNEA 1V74A 4I4KA 3MKIA 1I70A 1LQGC 4FMBA 3BU4A 4TX4A 1Y4KA 2XH9A 5DREA 3HOHA 1ISKA 2AAEA 2F86B 3D9RA 1US1A 3L0RA 5FW5A 2IY2A 1LRAA 2CWUA 4BL2A 1E3VA 2CK3H 2CH9A 2K54A 6RNTA 5M19A 1PFPA 1WNHA 2BMQB 5GSPA 1OACA 2OQEC 3EB8A 3GSPA 1WTHA 2HMJB 1VQ43 3OWYA 3JUMA 5IW9A 2F56A 1STFI 1UI8A 1I3FA 4CCVA 4EC6A 4L7KA 5A0OB 5FGOA 5CXOA 1K8A4 4N6TA 4FCZA 3JUPA 1E97A 2A15A 5G2GA 3NBRA 1W6YA 1B2SA 3FSDA 2W0QA 5IEOA 3LH4A 3U97A 3KKGA 2HOHA 2E2VA 2GU1A 1FYSA 4PEJA 3B4OA 4GB5A 3AHWA 4K61A 3H51A 2D1WA 4O3VA 3NQZA 2D42A 3G4S3 1I2EA 1AVLA 4HM0B 2LQVA 2OCTA 3V98A 2F98A 4KFFA 1PY3A 1GMPA 3JUQA 1C54A 3GWRA 3K5TA 3N54B 1D6ZA 1K28A 1OHSA 4U13A 3IMAB 4QWTA 1CQSA 2XEPA 5CF2A 1VQ83 1Q814 4G1MB 1LXEA 3KSED 1LOYA 1UCIA 1UUWB 4EYCA 1RRLA 1BNEA 7GSPA 3ZG0A 3LTAA 1T2IA 3I563 3G8ZA 3EQQB 2SARA 1W2B2 1QAKA 4HBRA 4IPBA 2CG0A 1DETA 1I0XA 3BNBA 3K63A 1RNTA 1UCJA 3A5EA 2CFWA 3EJVA 2CIUA 1VQ53 5D82A 4WP5A 1FUTA 1SIHA 2IYJA 4O02B 3CPOA 1KC84 5D83A 3DGOA 5EQLA 3BLZA 3EBTA 2KF3A 1GS3A 1A2PA 3LYGA 3Q2PA 5STDA 1FGMA 1V57A 4XDWA 1BNRA 1GY5A 3PYJA 3BIRA 2KF5A 4LGQA 2JQ5A 3CPW2 1K41A 1Z1SA 1O7GB 2GXFA 2ML5A 2P0XA 3CCE3 1FW7A 4EV2A 3KE7A 5JPUA 3VF1A 3D5GA 1B2XA 2RNTA 5AIGA 2O9UX 3UNLA 2UGIA 3WHOA 1D6YA 3V99A 1SJWA 3OV4A 4HM3B 4GHOA 1RHLA 2BT3A 1M9GA 2OWPA 1QAFA 3HK4A 1KD14 5EVHA 1EA2A 1JKGB 2HMMB 2E2UA 2WO0A 1AQZA 1IK3A 1W5ZA 3BNDA 3KCHA 1Q824 3NV0B 1RSNA 8RNTA 1BVIA 3UL5A 1VQK3 1BSEA 1ULJB 1JKGA 2W04A 3SXXA 3F7XA 3I553 4MMZB 1QVG2 1A2KA 1O7NB 2Z7AA 3SEDA 3OX9A 1RGHA 1S5AA 1VQ63 1B2UA 3RDEA 4HM1B 4J5GA 3X41A 2CW9A 3ALAA 3CCL3 3GZYB 5JPPA 1CYUA 1RGCA 4BL3A 3N9HA 3GZRA 3CNXA 4EW5A 2F99A 3NM7A 3WA2X 1OF5B 4HM7B 2IUJA 1J2BA 1OCVA 1YJN3 1HYFA 1QMAA 3ZG5A 3DM8A 3WOFB 3FF0A 1IV9A 2W56A 3Q3FA 2MC8A 1O7MB 2STDA 2QEX3 4R80A 2CC3A 2OQEA 4H61A 2GU3A 1DE3A 1CEWI 1TTOA 3I0YA 2BNGA 2BHMA 1YVBI 1I2GA 2W6JH 2HMLB 1W6GA 3B4PA 5AEWB 2CWVA 2C4BA 1GOUA 2Z6BA 4J5KA 1KSIA 3DH2A 5CF1A 3AMOB 7RNTA 2IUKA 1VQN3 5AIFA 2HMOB 1LOWA 3PS8A 2XR8B 1Q9EA 4X2HA 3S28A 5AI1A 4LSOA 4O8SA 3GAXA 3G713 1BGSA 1RGAA 5ELJA 2KRTA 1ASKA 2XRXB 1BUJA 1I3IA 3JUOA 1BRNL 1R4CA 2FGTA 1SQWA 1NWWA 1RRHA 2MF7A 3ECFA 1WMNA 1DYUA 2HMNB 4KZ1A 1YJ93 1VQ73 2RFRA 3D5IA 1M1K4 4R4KA 1U8CB 1K9M4 3MG3A 2B24B 1BNFA 1LOVA 1VQM3 3HZPA 2Z77A 1S723 1N5PA 1RGFA 7STDA 4NPBA 1JN5B 5HGRA 3D79A 1RGLA 4FMCA 1JB2A 1MOLA 1FGRA 2GEYA 5CLKA 1JN5A 1HKXA 4N6MA 4KT3B 2CFGA 4N6V0 2M7OA 1BRIA 3LTCA 2OOVA 2RSXA 4RZMA 3F8XA 1EUIC 3MHEA 2WGOA 5KP1A 3ROBA 4FMDA 3SOYA 3DZLA 3S5CA 4RNTA 1WQLB 1KQS2 4J8TA 3VGNA 1C7HA 3SLUA 1G96A 2O3OA 1LNHA 4EBGA 8CHOA 1FUWA 4I5QA 2J8XB 1IQYA 1GYBA 2KXGA 3E99A 1BNSA 3G6E3 4H3UA 3G0KA 5LC6A 2AADA 2H0GA 1BRSA 2CX0A 2GBXB 3EE1A 3HIGA 5IEPA 1Q40B 2W03A 3F8HA 1LVNA 4EV5A 1IYYA 1GOYA 1RJOA 2R4IA 3EX9A 4IIAA 1X1YA 4O2HA 1BU4A 1UDII 2GSPA 2JDIH 2Z76A 3HI7A 3S67A 1BAOA 3X3XA 4WFOA 5CK6A 3NUVA 4K1VA 1EKMA 4XBXA 2Y74A 3NM2A 4K90B 3QRDA 3FCSB 4NHFA 4KFDA 2W9PA 1MWTA 1BNJA 1TJDA 3AHSA 3J7Yd 2LYXA 4AKZA 3GZXB 4JF8A 1JB5A 2QIYA 3CCU3 4BTXA 3LZAA 1BRJA 1UUGB 3PXMA 3U1WA 3STDA 4CDLA 1PU4A 3FLJA 1O7PB 2IMJA 1IVUA 3CNMA 3LTBA 1GOVA 4KFEA 1YGWA 5HOHA 1V58A 4XB5A 1FGTA 4WWUC 1CH0A 1RKYA 1O7HB 1G0TA 1Q7HA 3S27A 5IERA 2RGQA 3UL6A 5JBSA 1DMNA 2BU4A 3SYUA 1BUQA 1VQP3 1VQL3 2RBIA 1W4NA 1W7CA 4ORLA 4FCJA 3WOEB 4BU4A 1X1WA 1QJGA 3DY5A 3OXAA 1W01A 1UW1A 2KF4A 5IG3A 3KZTA 3CC23 1UGHI 3V92A 4N3VA 1EQKA 1BIRA 2WOFA 3NV0A 1F8NA 2R41A 5KP3A 5M18A 3OWUA 3DMCA 3O8YA 2ZHXB 3EN8A 3EHCA 4BIRA 1R4YA 9RNTA 4FMAA 1DVDA 3JUNA 4LMIA 4N6LA 3A76A 4XBTA 5BVBA 1YI23 3BNCA 3F14A 4HOHA 1ROAA 1D6UA 2YFLB 3DGYA 3T8UA 4GSPA 4RNZA 3F7SA 3WA3A 2XSOB 1N5HA 1RDSA 3NQYA 1TU5A 3CXC2 1MGRA 1RGKA 1RTUA 3FKAA 1OF5A 2W9QA 1JJ22 1AY7A 3URPA 4STDA 3KIIA 1IT8A 2P09A 2XF3A 3FG3A 2Q07A 4HVNA 1JBSA 1LQMB 1IQXA 1MWSA 4HZ9B 4N6OB 3EC9A 4KVHA 2OTJ3 3RGAA 1MWUA 2YX9A 3IPTA 1U5OA 5G1KA 4AEQA 5D81A 3B8LA 3ER7A 6GSPA 1G02A 1YNVX 3MWZA 1T2HA 3MG2A 3FG1A 2W2CA 1BRGA 1X1UA 1WMPA 2KAAA 1E3RA 3NBBA 4RBNA 3KN4A 1KWIA 2CX1A 4HAAA 3IJEB 1YVSA 3AMOA 3Q1CA 2UX0A 1IVVA 1BRKA 4LYLB 1VQ93 1A90A 5G1LA 3MYTA 1B27A 5AEUB 1VQQA 1W6CA 2XSHB 2IA7A 3LT9A 4IT7A 1JV2B 1M904 1IVXA 3NBJA 1RMSA 4Q53A 2H0IA 3LOYA 2Y73A 1FA3A 1M1XB 1K734 1YJW3 2CKFB 1W02A 1NNVA 3PGBA 3CD63 3LT8A 3X3YA 1QALA 1HZ1A 1UCLA 4HZBB 5IG4A 3FG4A 3N8BA 1IU7A 3G16A 3D3LA 1W00A 2B1XB 1RN7A 2F5WA 5IF6A 2YFJB 1STDA 1OPYA 3UB1A 4R9LA 1I0VA 3SX1A 1OH0A 3KFQC 4HJLB 3NX0A 3LTDA 3CU3A 1JZDA
chains in the Genus database with same CATH topology
1NJI4 3JVCA 2I9WA 2ML6A 2YFIB 4LZIA 1Q864 5TGNA 1UI7A 1GY7A 3M8CA 1DMMA 3T0UA 3EF8A 3K7CA 3SOAA 1FGQA 6STDA 2HMKB 2KCDA 4LEHA 4L8PA 1EG9B 5BXQA 4OVMA 1IV7A 4R9KA 3K0ZA 1SPUA 1IVWA 2ZDJA 1AVKA 3K9MC 3CC43 3PCSA 1YIJ3 1ZO2A 1N8R4 4MJDA 2C10A 3RGRA 5AYSC 1IDPA 3QK9A 4HM5B 2E2TA 3EBYA 3DXOA 2BMRB 3BB9A 5AIHA 4K1UA 1Q40A 2SBLA 1GD4A 1NO3A 1TP6A 2INXA 4ZM8A 4OK0A 3F9SA 2CHCA 3WODG 2P0MA 3GZBA 1IT7A 1OHOA 2CFLA 2CFKA 1Q42A 3Q90A 4N6UA 2CWTA 2FNQA 2XGNA 4WHAA 3X3ZA 2ZL8A 1GD3A 1OGZA 2GBWB 3KSPA 2PZVA 2P05A 5IG5A 2QGUA 1MNLA 4N6NB 3HX8A 2OOVC 3DGNA 3FZWA 1HU9A 1AV4A 1GY6A 1NDOB 3F40A 1O7WB 3CMA3 3X40A 3CCM3 5AYRB 1T5YA 1QVF2 2XGLA 4GL6A 1YIT3 3CME3 1OGXA 4FR9A 3EN1B 4BTWA 4HM2B 1Q7Y4 1N8QA 5KP4A 4X2OA 1OUNA 1L5GB 3OWSA 1ROVA 5DRVA 3NXJA 4EXRA 4MMYB 1NU3A 2L4VA 4AKYA 3FH1A 3FF2A 2C11A 1JB4A 5ELUA 2WGQA 1YGEA 4HYZA 4MMXB 4HM8B 4RNYA 3GRDA 2XFTA 2FXTA 2RCDA 1JNQA 2CFDA 4J9AA 1WMOA 4JRFA 1TFOA 4WYKB 1UUVB 2PNCA 4HM6B 3WMDA 4MEIA 1ULIB 3MG1A 1YHQ3 2BO9B 1OHPA 1A67A 4WYKA 1LOXA 3LMLA 4R1KA 2OTL3 5AIIA 4XBYA 5IENA 3UJMA 4FCMA 3CCS3 1ZX2A 2P38A 1IQ8A 2GEXA 5IG0A 3FGYA 3WDGB 3TDGA 1SIIA 3B7CA 1VQO3 3VSYA 3CCR3 4BTYA 3PZWA 4OUQA 4NREA 1DVCA 3CCQ3 3OW22 3CC73 3H3HA 1AR0A 3MPHA 2BMOB 2W56B 2XFSA 3CCV3 2V1LA 3PCRA 4HKVB 4XDVA 5I97A 1TIJA 3DUKA 1W2ZA 4HM4B 4XM4A 1DMQA 3CCJ3 3T8NA 5LC7A 1N9EA 1TUHA 1FGOA 1JRQA 1CYVA 1N9JA 3S29A 1NB5I 1NB3I 3DGMA 3LXUX 1A2VA 3X42A 3DGLA 2CG1A 3SVAA 2WOHA 5EEOA 1TFKA 1VZZA 3HIIA 3MSOA 4L8OA 3NHXA 2K0MA 3BNEA 1V74A 4I4KA 3MKIA 4FMBA 4TX4A 1Y4KA 2XH9A 5DREA 1ISKA 2F86B 3D9RA 1US1A 3L0RA 5FW5A 2CWUA 1E3VA 2CK3H 2CH9A 2K54A 1PFPA 1WNHA 2BMQB 1OACA 2OQEC 3EB8A 1VQ43 1WTHA 2HMJB 3OWYA 3JUMA 5IW9A 1STFI 1UI8A 4CCVA 4EC6A 5A0OB 4L7KA 1K8A4 5FGOA 5CXOA 4N6TA 4FCZA 3JUPA 1E97A 2A15A 5G2GA 3NBRA 1W6YA 5IEOA 3FSDA 2W0QA 3LH4A 3U97A 3KKGA 2E2VA 2GU1A 4PEJA 3B4OA 4GB5A 4K61A 3H51A 2D1WA 4O3VA 3NQZA 2D42A 3G4S3 1AVLA 4HM0B 2LQVA 2OCTA 3V98A 2F98A 4KFFA 3JUQA 3GWRA 3K5TA 3N54B 1D6ZA 1K28A 1OHSA 4U13A 3IMAB 4QWTA 1CQSA 2XEPA 5CF2A 1VQ83 1Q814 4G1MB 1LXEA 3KSED 1UUWB 4EYCA 1RRLA 3LTAA 3I563 3G8ZA 3EQQB 1W2B2 1QAKA 4HBRA 4IPBA 2CG0A 3BNBA 3K63A 2CFWA 3EJVA 2CIUA 1VQ53 5D82A 4WP5A 4O02B 1SIHA 3CPOA 1KC84 5D83A 3DGOA 5EQLA 3BLZA 3EBTA 1GS3A 3LYGA 3Q2PA 5STDA 1FGMA 4XDWA 1GY5A 3PYJA 4LGQA 2JQ5A 3CPW2 1K41A 1Z1SA 1O7GB 2GXFA 2ML5A 2P0XA 3CCE3 4EV2A 3KE7A 5JPUA 3VF1A 5AIGA 3UNLA 2O9UX 1D6YA 3V99A 1SJWA 3OV4A 4HM3B 2BT3A 1M9GA 2OWPA 1QAFA 3HK4A 1KD14 5EVHA 1EA2A 1JKGB 2HMMB 2E2UA 2WO0A 1IK3A 1W5ZA 3BNDA 1Q824 3NV0B 1VQK3 3UL5A 1ULJB 1JKGA 2W04A 3SXXA 3F7XA 3I553 4MMZB 1QVG2 1A2KA 1O7NB 2Z7AA 3SEDA 3OX9A 1S5AA 1VQ63 3RDEA 4HM1B 3X41A 2CW9A 3ALAA 3CCL3 3GZYB 5JPPA 1CYUA 3N9HA 3GZRA 3CNXA 2F99A 3NM7A 3WA2X 1OF5B 4HM7B 2IUJA 1J2BA 1OCVA 1YJN3 1QMAA 3DM8A 3WOFB 3FF0A 1IV9A 2W56A 2MC8A 1O7MB 2STDA 2QEX3 4R80A 2CC3A 2OQEA 4H61A 2GU3A 1CEWI 3I0YA 2BNGA 2BHMA 1YVBI 2W6JH 3B4PA 2HMLB 1W6GA 5AEWB 2CWVA 2Z6BA 1KSIA 5CF1A 3AMOB 2IUKA 1VQN3 5AIFA 2HMOB 3PS8A 2XR8B 4X2HA 3S28A 5AI1A 4LSOA 4O8SA 3GAXA 3G713 5ELJA 2KRTA 1ASKA 2XRXB 3JUOA 1R4CA 2FGTA 1SQWA 1NWWA 1RRHA 2MF7A 3ECFA 1WMNA 1DYUA 2HMNB 4KZ1A 1YJ93 1VQ73 2RFRA 1M1K4 4R4KA 1U8CB 1K9M4 3MG3A 2B24B 1VQM3 3HZPA 2Z77A 1S723 1N5PA 7STDA 1JN5B 5HGRA 4FMCA 1JB2A 1MOLA 1FGRA 2GEYA 5CLKA 1JN5A 1HKXA 4N6MA 2CFGA 4N6V0 2M7OA 3LTCA 2OOVA 2RSXA 4RZMA 3F8XA 3MHEA 2WGOA 5KP1A 3ROBA 4FMDA 3SOYA 3DZLA 3S5CA 1WQLB 1KQS2 4J8TA 3VGNA 1C7HA 3SLUA 1G96A 2O3OA 1LNHA 4EBGA 8CHOA 1FUWA 1IQYA 1GYBA 2KXGA 3E99A 3G6E3 4H3UA 3G0KA 5LC6A 2GBXB 3EE1A 3HIGA 5IEPA 1Q40B 2W03A 3F8HA 1LVNA 4EV5A 3SX1A 1RJOA 2R4IA 3EX9A 4IIAA 4O2HA 2QA43 2JDIH 3S67A 2Z76A 3HI7A 3X3XA 4WFOA 5CK6A 3NUVA 4K1VA 1EKMA 4XBXA 2Y74A 3NM2A 4K90B 3QRDA 3FCSB 4NHFA 4KFDA 2W9PA 3J7Yd 2LYXA 4AKZA 3GZXB 4JF8A 1JB5A 2QIYA 3CCU3 4BTXA 3LZAA 3PXMA 3U1WA 3STDA 4CDLA 1PU4A 3FLJA 1O7PB 2IMJA 1IVUA 3CNMA 3LTBA 4KFEA 4XB5A 1FGTA 4WWUC 1RKYA 1O7HB 3S27A 5IERA 2RGQA 3UL6A 5JBSA 1DMNA 1BUQA 1VQP3 1VQL3 1W4NA 1W7CA 4ORLA 4FCJA 3WOEB 1QJGA 3DY5A 3OXAA 1W01A 1UW1A 5IG3A 3KZTA 3CC23 3V92A 4N3VA 1EQKA 2WOFA 3NV0A 1F8NA 5KP3A 3OWUA 3DMCA 3O8YA 3EN8A 3EHCA 4FMAA 1DVDA 3JUNA 4LMIA 4N6LA 3A76A 4XBTA 5BVBA 1YI23 3BNCA 3F14A 1ROAA 1D6UA 2YFLB 3T8UA 4RNZA 3F7SA 3WA3A 2XSOB 1N5HA 3NQYA 1TU5A 3CXC2 3FKAA 1OF5A 2W9QA 1JJ22 4STDA 3KIIA 1IT8A 2P09A 2XF3A 3FG3A 2Q07A 4HVNA 4HZ9B 1IQXA 4N6OB 3EC9A 4KVHA 2OTJ3 3RGAA 2YX9A 3IPTA 4AEQA 1U5OA 5D81A 3B8LA 3ER7A 3MWZA 3MG2A 3FG1A 2W2CA 1WMPA 1E3RA 3NBBA 4RBNA 3KN4A 1KWIA 3IJEB 3AMOA 3Q1CA 2UX0A 1IVVA 1VQ93 1A90A 3MYTA 5AEUB 1W6CA 2XSHB 2IA7A 3LT9A 4IT7A 1JV2B 1M904 1IVXA 3NBJA 4Q53A 3LOYA 2Y73A 1FA3A 1M1XB 1K734 1YJW3 2CKFB 1W02A 3PGBA 3CD63 3LT8A 3X3YA 1QALA 4HZBB 5IG4A 3FG4A 3N8BA 1IU7A 3G16A 3D3LA 1W00A 2B1XB 1RN7A 5IF6A 2YFJB 1STDA 1OPYA 3UB1A 4R9LA 1OH0A 3KFQC 4HJLB 3NX0A 3LTDA 3CU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S67 A;  1TIJ A;  4LZI A;  1M9G A;  5LC7 A;  3QRD A;  1CYV A;  1N9J A;  1NB5 I;  2W9P A;  1NB3 I;  3UL5 A;  3SVA A;  1IV7 A;  3K9M C;  3PXM A;  4TX4 A;  1CYU A;  3L0R A;  2CH9 A;  1PFP A;  1WNH A;  1GD4 A;  3UL6 A;  1IV9 A;  4ZM8 A;  1STF I;  4CCV A;  5A0O B;  1CEW I;  4N6T A;  4N6U A;  1EQK A;  1YVB I;  3LH4 A;  1GD3 A;  3PS8 A;  1MNL A;  4N6N B;  1DVD A;  4N6L A;  3GAX A;  1ROA A;  5ELJ A;  1N5H A;  1R4C A;  2W9Q A;  2OCT A;  4N6O B;  3IMA B;  1LXE A;  1N5P A;  3KSE D;  3MWZ A;  4EYC A;  5ELU A;  1MOL A;  4N6M A;  1KWI A;  4N6V 0;  1A90 A;  4IT7 A;  2BO9 B;  1A67 A;  1G96 A;  1FA3 A;  1FUW A;  5EQL A;  2KXG A;  3Q2P A;  1RN7 A;  5LC6 A;  3PYJ A;  3KFQ C;  1DVC A;  3NX0 A;  2O9U X; 
#chains in the Genus database with same CATH topology
 1NJI 4;  3JVC A;  2I9W A;  2ML6 A;  2YFI B;  4LZI A;  1Q86 4;  1EEJ A;  1UI7 A;  1GY7 A;  3M8C A;  1DMM A;  5TGN A;  3T0U A;  1UCK A;  3EF8 A;  1PYL A;  3K7C A;  1FGQ A;  3SOA A;  6STD A;  2HMK B;  2KCD A;  4LEH A;  4L8P A;  1TRQ A;  1EG9 B;  1RLS A;  1RCL A;  5BXQ A;  4OVM A;  1IV7 A;  5BIR A;  4R9K A;  3K0Z A;  1SPU A;  1IVW A;  1B2Z A;  1AVK A;  2ZDJ A;  3K9M C;  3CC4 3;  3PCS A;  1YIJ 3;  1ZO2 A;  1N8R 4;  4MJD A;  2C10 A;  3RGR A;  1BAN A;  1JZO A;  5AYS C;  1IDP A;  1RN4 A;  1BRH A;  2KF6 A;  3QK9 A;  2E2T A;  3EBY A;  3DXO A;  4HM5 B;  1BSD A;  2BMR B;  3BB9 A;  1GMR A;  5AIH A;  4K1U A;  1JBR A;  1Q40 A;  1GD4 A;  1NO3 A;  2SBL A;  1TP6 A;  2INX A;  1BNG A;  4ZM8 A;  5BU4 A;  4OK0 A;  3F9S A;  2CHC A;  3WOD G;  1X1X A;  1UGI A;  2P0M A;  1BSC A;  3GZB A;  1IT7 A;  1FUS A;  1OHO A;  2CFL A;  1Q42 A;  2CFK A;  3Q90 A;  4N6U A;  3WR2 A;  2CWT A;  2FNQ A;  2XGN A;  4WHA A;  3RNT A;  3X3Z A;  2ZL8 A;  1GD3 A;  1OGZ A;  2GBW B;  1BNI A;  2PZV A;  2P05 A;  3KSP A;  5IG5 A;  2F5M A;  4DKI A;  2QA4 3;  2QGU A;  1MNL A;  1B20 A;  3HX8 A;  2OOV C;  4N6N B;  2F4Y A;  3DGN A;  1I2F A;  1HU9 A;  3FZW A;  1AV4 A;  1GY6 A;  1NDO B;  3F40 A;  1O7W B;  1TRP A;  1B3S A;  3CMA 3;  3D4A A;  3X40 A;  3CCM 3;  1GMQ A;  5AYR B;  1T5Y A;  2H0H A;  2XGL A;  1QVF 2;  1B21 A;  4GL6 A;  1YIT 3;  3CME 3;  1OGX A;  4FR9 A;  3EN1 B;  4BTW A;  4HM2 B;  2K3D A;  1LNI A;  1N8Q A;  1Q7Y 4;  5KP4 A;  4X2O A;  1OUN A;  1L5G B;  3OWS A;  1ROV A;  5DRV A;  3NXJ A;  4EXR A;  4MMY B;  1NU3 A;  2L4V A;  4AKY A;  4CJN A;  3FH1 A;  1MGW A;  3FF2 A;  1BOX A;  1JB4 A;  2C11 A;  1BSB A;  5ELU A;  2WGQ A;  1YGE A;  4HYZ A;  4MMX B;  1FZU A;  1T3B A;  4HM8 B;  4RNY A;  3GRD A;  2XFT A;  1RN1 A;  2FXT A;  2RCD A;  1JNQ A;  2CFD A;  4J9A A;  1WMO A;  3AGO A;  4JRF A;  1TFO A;  4WYK B;  1UUV B;  2PNC A;  2ZA4 A;  2L1S A;  1BSA A;  4HM6 B;  3WMD A;  4MEI A;  1ULI B;  3MG1 A;  1YHQ 3;  1I8V A;  2BO9 B;  1OHP A;  1A67 A;  1MWR A;  4WYK A;  1JBT A;  1LOX A;  3LML A;  2BIR A;  4R1K A;  5RNT A;  2OTL 3;  5AII A;  1SAR A;  4XBY A;  5M1A A;  5IEN A;  1ZGX A;  3UJM A;  4FCM A;  3CCS 3;  1ZX2 A;  2P38 A;  1RGE A;  1IQ8 A;  2GEX A;  5IG0 A;  3FGY A;  3WDG B;  1RGG A;  3TDG A;  1SII A;  3B7C A;  1VQO 3;  3VSY A;  3CCR 3;  4BTY A;  3PZW A;  4OUQ A;  4NRE A;  1DVC A;  3CCQ 3;  3OW2 2;  3CC7 3;  3H3H A;  1AR0 A;  2UUG C;  3MPH A;  2BMO B;  2W56 B;  2XFS A;  3CCV 3;  2V1L A;  3PCR A;  1RCK A;  4HKV B;  4XDV A;  1TIJ A;  3DUK A;  1W2Z A;  4HM4 B;  4XM4 A;  1DMQ A;  5I97 A;  3CCJ 3;  1RNB A;  4ILF A;  3T8N A;  5LC7 A;  1N9E A;  1TUH A;  1FGO A;  1B2M A;  1JRQ A;  1CYV A;  1N9J A;  3S29 A;  4CPK A;  1NB3 I;  3DGM A;  3LXU X;  1NB5 I;  1A2V A;  3X42 A;  1GSP A;  3DGL A;  2CG1 A;  3SVA A;  1ZS7 A;  2WOH A;  5EEO A;  1TFK A;  1VZZ A;  3HII A;  3AGN A;  3MSO A;  4L8O A;  3ZFZ A;  3NHX A;  2K0M A;  3BNE A;  1V74 A;  4I4K A;  3MKI A;  1I70 A;  1LQG C;  4FMB A;  3BU4 A;  4TX4 A;  1Y4K A;  2XH9 A;  5DRE A;  3HOH A;  1ISK A;  2AAE A;  2F86 B;  3D9R A;  1US1 A;  3L0R A;  5FW5 A;  2IY2 A;  1LRA A;  2CWU A;  4BL2 A;  1E3V A;  2CK3 H;  2CH9 A;  2K54 A;  6RNT A;  5M19 A;  1PFP A;  1WNH A;  2BMQ B;  5GSP A;  1OAC A;  2OQE C;  3EB8 A;  3GSP A;  1WTH A;  2HMJ B;  1VQ4 3;  3OWY A;  3JUM A;  5IW9 A;  2F56 A;  1STF I;  1UI8 A;  1I3F A;  4CCV A;  4EC6 A;  4L7K A;  5A0O B;  5FGO A;  5CXO A;  1K8A 4;  4N6T A;  4FCZ A;  3JUP A;  1E97 A;  2A15 A;  5G2G A;  3NBR A;  1W6Y A;  1B2S A;  3FSD A;  2W0Q A;  5IEO A;  3LH4 A;  3U97 A;  3KKG A;  2HOH A;  2E2V A;  2GU1 A;  1FYS A;  4PEJ A;  3B4O A;  4GB5 A;  3AHW A;  4K61 A;  3H51 A;  2D1W A;  4O3V A;  3NQZ A;  2D42 A;  3G4S 3;  1I2E A;  1AVL A;  4HM0 B;  2LQV A;  2OCT A;  3V98 A;  2F98 A;  4KFF A;  1PY3 A;  1GMP A;  3JUQ A;  1C54 A;  3GWR A;  3K5T A;  3N54 B;  1D6Z A;  1K28 A;  1OHS A;  4U13 A;  3IMA B;  4QWT A;  1CQS A;  2XEP A;  5CF2 A;  1VQ8 3;  1Q81 4;  4G1M B;  1LXE A;  3KSE D;  1LOY A;  1UCI A;  1UUW B;  4EYC A;  1RRL A;  1BNE A;  7GSP A;  3ZG0 A;  3LTA A;  1T2I A;  3I56 3;  3G8Z A;  3EQQ B;  2SAR A;  1W2B 2;  1QAK A;  4HBR A;  4IPB A;  2CG0 A;  1DET A;  1I0X A;  3BNB A;  3K63 A;  1RNT A;  1UCJ A;  3A5E A;  2CFW A;  3EJV A;  2CIU A;  1VQ5 3;  5D82 A;  4WP5 A;  1FUT A;  1SIH A;  2IYJ A;  4O02 B;  3CPO A;  1KC8 4;  5D83 A;  3DGO A;  5EQL A;  3BLZ A;  3EBT A;  2KF3 A;  1GS3 A;  1A2P A;  3LYG A;  3Q2P A;  5STD A;  1FGM A;  1V57 A;  4XDW A;  1BNR A;  1GY5 A;  3PYJ A;  3BIR A;  2KF5 A;  4LGQ A;  2JQ5 A;  3CPW 2;  1K41 A;  1Z1S A;  1O7G B;  2GXF A;  2ML5 A;  2P0X A;  3CCE 3;  1FW7 A;  4EV2 A;  3KE7 A;  5JPU A;  3VF1 A;  3D5G A;  1B2X A;  2RNT A;  5AIG A;  2O9U X;  3UNL A;  2UGI A;  3WHO A;  1D6Y A;  3V99 A;  1SJW A;  3OV4 A;  4HM3 B;  4GHO A;  1RHL A;  2BT3 A;  1M9G A;  2OWP A;  1QAF A;  3HK4 A;  1KD1 4;  5EVH A;  1EA2 A;  1JKG B;  2HMM B;  2E2U A;  2WO0 A;  1AQZ A;  1IK3 A;  1W5Z A;  3BND A;  3KCH A;  1Q82 4;  3NV0 B;  1RSN A;  8RNT A;  1BVI A;  3UL5 A;  1VQK 3;  1BSE A;  1ULJ B;  1JKG A;  2W04 A;  3SXX A;  3F7X A;  3I55 3;  4MMZ B;  1QVG 2;  1A2K A;  1O7N B;  2Z7A A;  3SED A;  3OX9 A;  1RGH A;  1S5A A;  1VQ6 3;  1B2U A;  3RDE A;  4HM1 B;  4J5G A;  3X41 A;  2CW9 A;  3ALA A;  3CCL 3;  3GZY B;  5JPP A;  1CYU A;  1RGC A;  4BL3 A;  3N9H A;  3GZR A;  3CNX A;  4EW5 A;  2F99 A;  3NM7 A;  3WA2 X;  1OF5 B;  4HM7 B;  2IUJ A;  1J2B A;  1OCV A;  1YJN 3;  1HYF A;  1QMA A;  3ZG5 A;  3DM8 A;  3WOF B;  3FF0 A;  1IV9 A;  2W56 A;  3Q3F A;  2MC8 A;  1O7M B;  2STD A;  2QEX 3;  4R80 A;  2CC3 A;  2OQE A;  4H61 A;  2GU3 A;  1DE3 A;  1CEW I;  1TTO A;  3I0Y A;  2BNG A;  2BHM A;  1YVB I;  1I2G A;  2W6J H;  2HML B;  1W6G A;  3B4P A;  5AEW B;  2CWV A;  2C4B A;  1GOU A;  2Z6B A;  4J5K A;  1KSI A;  3DH2 A;  5CF1 A;  3AMO B;  7RNT A;  2IUK A;  1VQN 3;  5AIF A;  2HMO B;  1LOW A;  3PS8 A;  2XR8 B;  1Q9E A;  4X2H A;  3S28 A;  5AI1 A;  4LSO A;  4O8S A;  3GAX A;  3G71 3;  1BGS A;  1RGA A;  5ELJ A;  2KRT A;  1ASK A;  2XRX B;  1BUJ A;  1I3I A;  3JUO A;  1BRN L;  1R4C A;  2FGT A;  1SQW A;  1NWW A;  1RRH A;  2MF7 A;  3ECF A;  1WMN A;  1DYU A;  2HMN B;  4KZ1 A;  1YJ9 3;  1VQ7 3;  2RFR A;  3D5I A;  1M1K 4;  4R4K A;  1U8C B;  1K9M 4;  3MG3 A;  2B24 B;  1BNF A;  1LOV A;  1VQM 3;  3HZP A;  2Z77 A;  1S72 3;  1N5P A;  1RGF A;  7STD A;  4NPB A;  1JN5 B;  5HGR A;  3D79 A;  1RGL A;  4FMC A;  1JB2 A;  1MOL A;  1FGR A;  2GEY A;  5CLK A;  1JN5 A;  1HKX A;  4N6M A;  4KT3 B;  2CFG A;  4N6V 0;  2M7O A;  1BRI A;  3LTC A;  2OOV A;  2RSX A;  4RZM A;  3F8X A;  1EUI C;  3MHE A;  2WGO A;  5KP1 A;  3ROB A;  4FMD A;  3SOY A;  3DZL A;  3S5C A;  4RNT A;  1WQL B;  1KQS 2;  4J8T A;  3VGN A;  1C7H A;  3SLU A;  1G96 A;  2O3O A;  1LNH A;  4EBG A;  8CHO A;  1FUW A;  4I5Q A;  2J8X B;  1IQY A;  1GYB A;  2KXG A;  3E99 A;  1BNS A;  3G6E 3;  4H3U A;  3G0K A;  5LC6 A;  2AAD A;  2H0G A;  1BRS A;  2CX0 A;  2GBX B;  3EE1 A;  3HIG A;  5IEP A;  1Q40 B;  2W03 A;  3F8H A;  1LVN A;  4EV5 A;  1IYY A;  1GOY A;  1RJO A;  2R4I A;  3EX9 A;  4IIA A;  1X1Y A;  4O2H A;  1BU4 A;  1UDI I;  2GSP A;  2JDI H;  2Z76 A;  3HI7 A;  3S67 A;  1BAO A;  3X3X A;  4WFO A;  5CK6 A;  3NUV A;  4K1V A;  1EKM A;  4XBX A;  2Y74 A;  3NM2 A;  4K90 B;  3QRD A;  3FCS B;  4NHF A;  4KFD A;  2W9P A;  1MWT A;  1BNJ A;  1TJD A;  3AHS A;  3J7Y d;  2LYX A;  4AKZ A;  3GZX B;  4JF8 A;  1JB5 A;  2QIY A;  3CCU 3;  4BTX A;  3LZA A;  1BRJ A;  1UUG B;  3PXM A;  3U1W A;  3STD A;  4CDL A;  1PU4 A;  3FLJ A;  1O7P B;  2IMJ A;  1IVU A;  3CNM A;  3LTB A;  1GOV A;  4KFE A;  1YGW A;  5HOH A;  1V58 A;  4XB5 A;  1FGT A;  4WWU C;  1CH0 A;  1RKY A;  1O7H B;  1G0T A;  1Q7H A;  3S27 A;  5IER A;  2RGQ A;  3UL6 A;  5JBS A;  1DMN A;  2BU4 A;  3SYU A;  1BUQ A;  1VQP 3;  1VQL 3;  2RBI A;  1W4N A;  1W7C A;  4ORL A;  4FCJ A;  3WOE B;  4BU4 A;  1X1W A;  1QJG A;  3DY5 A;  3OXA A;  1W01 A;  1UW1 A;  2KF4 A;  5IG3 A;  3KZT A;  3CC2 3;  1UGH I;  3V92 A;  4N3V A;  1EQK A;  1BIR A;  2WOF A;  3NV0 A;  1F8N A;  2R41 A;  5KP3 A;  5M18 A;  3OWU A;  3DMC A;  3O8Y A;  2ZHX B;  3EN8 A;  3EHC A;  4BIR A;  1R4Y A;  9RNT A;  4FMA A;  1DVD A;  3JUN A;  4LMI A;  4N6L A;  3A76 A;  4XBT A;  5BVB A;  1YI2 3;  3BNC A;  3F14 A;  4HOH A;  1ROA A;  1D6U A;  2YFL B;  3DGY A;  3T8U A;  4GSP A;  4RNZ A;  3F7S A;  3WA3 A;  2XSO B;  1N5H A;  1RDS A;  3NQY A;  1TU5 A;  3CXC 2;  1MGR A;  1RGK A;  1RTU A;  3FKA A;  1OF5 A;  2W9Q A;  1JJ2 2;  1AY7 A;  3URP A;  4STD A;  3KII A;  1IT8 A;  2P09 A;  2XF3 A;  3FG3 A;  2Q07 A;  4HVN A;  1JBS A;  1LQM B;  1IQX A;  1MWS A;  4HZ9 B;  4N6O B;  3EC9 A;  4KVH A;  2OTJ 3;  3RGA A;  1MWU A;  2YX9 A;  3IPT A;  1U5O A;  5G1K A;  4AEQ A;  5D81 A;  3B8L A;  3ER7 A;  6GSP A;  1G02 A;  1YNV X;  3MWZ A;  1T2H A;  3MG2 A;  3FG1 A;  2W2C A;  1BRG A;  1X1U A;  1WMP A;  2KAA A;  1E3R A;  3NBB A;  4RBN A;  3KN4 A;  1KWI A;  2CX1 A;  4HAA A;  3IJE B;  1YVS A;  3AMO A;  3Q1C A;  2UX0 A;  1IVV A;  1BRK A;  4LYL B;  1VQ9 3;  1A90 A;  5G1L A;  3MYT A;  1B27 A;  5AEU B;  1VQQ A;  1W6C A;  2XSH B;  2IA7 A;  3LT9 A;  4IT7 A;  1JV2 B;  1M90 4;  1IVX A;  3NBJ A;  1RMS A;  4Q53 A;  2H0I A;  3LOY A;  2Y73 A;  1FA3 A;  1M1X B;  1K73 4;  1YJW 3;  2CKF B;  1W02 A;  1NNV A;  3PGB A;  3CD6 3;  3LT8 A;  3X3Y A;  1QAL A;  1HZ1 A;  1UCL A;  4HZB B;  5IG4 A;  3FG4 A;  3N8B A;  1IU7 A;  3G16 A;  3D3L A;  1W00 A;  2B1X B;  1RN7 A;  2F5W A;  5IF6 A;  2YFJ B;  1STD A;  1OPY A;  3UB1 A;  4R9L A;  1I0V A;  3SX1 A;  1OH0 A;  3KFQ C;  4HJL B;  3NX0 A;  3LTD A;  3CU3 A;  1JZD A; 
#chains in the Genus database with same CATH homology
 1NJI 4;  3JVC A;  2I9W A;  2ML6 A;  2YFI B;  4LZI A;  1Q86 4;  5TGN A;  1UI7 A;  1GY7 A;  3M8C A;  1DMM A;  3T0U A;  3EF8 A;  3K7C A;  3SOA A;  1FGQ A;  6STD A;  2HMK B;  2KCD A;  4LEH A;  4L8P A;  1EG9 B;  5BXQ A;  4OVM A;  1IV7 A;  4R9K A;  3K0Z A;  1SPU A;  1IVW A;  2ZDJ A;  1AVK A;  3K9M C;  3CC4 3;  3PCS A;  1YIJ 3;  1ZO2 A;  1N8R 4;  4MJD A;  2C10 A;  3RGR A;  5AYS C;  1IDP A;  3QK9 A;  4HM5 B;  2E2T A;  3EBY A;  3DXO A;  2BMR B;  3BB9 A;  5AIH A;  4K1U A;  1Q40 A;  2SBL A;  1GD4 A;  1NO3 A;  1TP6 A;  2INX A;  4ZM8 A;  4OK0 A;  3F9S A;  2CHC A;  3WOD G;  2P0M A;  3GZB A;  1IT7 A;  1OHO A;  2CFL A;  2CFK A;  1Q42 A;  3Q90 A;  4N6U A;  2CWT A;  2FNQ A;  2XGN A;  4WHA A;  3X3Z A;  2ZL8 A;  1GD3 A;  1OGZ A;  2GBW B;  3KSP A;  2PZV A;  2P05 A;  5IG5 A;  2QGU A;  1MNL A;  4N6N B;  3HX8 A;  2OOV C;  3DGN A;  3FZW A;  1HU9 A;  1AV4 A;  1GY6 A;  1NDO B;  3F40 A;  1O7W B;  3CMA 3;  3X40 A;  3CCM 3;  5AYR B;  1T5Y A;  1QVF 2;  2XGL A;  4GL6 A;  1YIT 3;  3CME 3;  1OGX A;  4FR9 A;  3EN1 B;  4BTW A;  4HM2 B;  1Q7Y 4;  1N8Q A;  5KP4 A;  4X2O A;  1OUN A;  1L5G B;  3OWS A;  1ROV A;  5DRV A;  3NXJ A;  4EXR A;  4MMY B;  1NU3 A;  2L4V A;  4AKY A;  3FH1 A;  3FF2 A;  2C11 A;  1JB4 A;  5ELU A;  2WGQ A;  1YGE A;  4HYZ A;  4MMX B;  4HM8 B;  4RNY A;  3GRD A;  2XFT A;  2FXT A;  2RCD A;  1JNQ A;  2CFD A;  4J9A A;  1WMO A;  4JRF A;  1TFO A;  4WYK B;  1UUV B;  2PNC A;  4HM6 B;  3WMD A;  4MEI A;  1ULI B;  3MG1 A;  1YHQ 3;  2BO9 B;  1OHP A;  1A67 A;  4WYK A;  1LOX A;  3LML A;  4R1K A;  2OTL 3;  5AII A;  4XBY A;  5IEN A;  3UJM A;  4FCM A;  3CCS 3;  1ZX2 A;  2P38 A;  1IQ8 A;  2GEX A;  5IG0 A;  3FGY A;  3WDG B;  3TDG A;  1SII A;  3B7C A;  1VQO 3;  3VSY A;  3CCR 3;  4BTY A;  3PZW A;  4OUQ A;  4NRE A;  1DVC A;  3CCQ 3;  3OW2 2;  3CC7 3;  3H3H A;  1AR0 A;  3MPH A;  2BMO B;  2W56 B;  2XFS A;  3CCV 3;  2V1L A;  3PCR A;  4HKV B;  4XDV A;  5I97 A;  1TIJ A;  3DUK A;  1W2Z A;  4HM4 B;  4XM4 A;  1DMQ A;  3CCJ 3;  3T8N A;  5LC7 A;  1N9E A;  1TUH A;  1FGO A;  1JRQ A;  1CYV A;  1N9J A;  3S29 A;  1NB5 I;  1NB3 I;  3DGM A;  3LXU X;  1A2V A;  3X42 A;  3DGL A;  2CG1 A;  3SVA A;  2WOH A;  5EEO A;  1TFK A;  1VZZ A;  3HII A;  3MSO A;  4L8O A;  3NHX A;  2K0M A;  3BNE A;  1V74 A;  4I4K A;  3MKI A;  4FMB A;  4TX4 A;  1Y4K A;  2XH9 A;  5DRE A;  1ISK A;  2F86 B;  3D9R A;  1US1 A;  3L0R A;  5FW5 A;  2CWU A;  1E3V A;  2CK3 H;  2CH9 A;  2K54 A;  1PFP A;  1WNH A;  2BMQ B;  1OAC A;  2OQE C;  3EB8 A;  1VQ4 3;  1WTH A;  2HMJ B;  3OWY A;  3JUM A;  5IW9 A;  1STF I;  1UI8 A;  4CCV A;  4EC6 A;  5A0O B;  4L7K A;  1K8A 4;  5FGO A;  5CXO A;  4N6T A;  4FCZ A;  3JUP A;  1E97 A;  2A15 A;  5G2G A;  3NBR A;  1W6Y A;  5IEO A;  3FSD A;  2W0Q A;  3LH4 A;  3U97 A;  3KKG A;  2E2V A;  2GU1 A;  4PEJ A;  3B4O A;  4GB5 A;  4K61 A;  3H51 A;  2D1W A;  4O3V A;  3NQZ A;  2D42 A;  3G4S 3;  1AVL A;  4HM0 B;  2LQV A;  2OCT A;  3V98 A;  2F98 A;  4KFF A;  3JUQ A;  3GWR A;  3K5T A;  3N54 B;  1D6Z A;  1K28 A;  1OHS A;  4U13 A;  3IMA B;  4QWT A;  1CQS A;  2XEP A;  5CF2 A;  1VQ8 3;  1Q81 4;  4G1M B;  1LXE A;  3KSE D;  1UUW B;  4EYC A;  1RRL A;  3LTA A;  3I56 3;  3G8Z A;  3EQQ B;  1W2B 2;  1QAK A;  4HBR A;  4IPB A;  2CG0 A;  3BNB A;  3K63 A;  2CFW A;  3EJV A;  2CIU A;  1VQ5 3;  5D82 A;  4WP5 A;  4O02 B;  1SIH A;  3CPO A;  1KC8 4;  5D83 A;  3DGO A;  5EQL A;  3BLZ A;  3EBT A;  1GS3 A;  3LYG A;  3Q2P A;  5STD A;  1FGM A;  4XDW A;  1GY5 A;  3PYJ A;  4LGQ A;  2JQ5 A;  3CPW 2;  1K41 A;  1Z1S A;  1O7G B;  2GXF A;  2ML5 A;  2P0X A;  3CCE 3;  4EV2 A;  3KE7 A;  5JPU A;  3VF1 A;  5AIG A;  3UNL A;  2O9U X;  1D6Y A;  3V99 A;  1SJW A;  3OV4 A;  4HM3 B;  2BT3 A;  1M9G A;  2OWP A;  1QAF A;  3HK4 A;  1KD1 4;  5EVH A;  1EA2 A;  1JKG B;  2HMM B;  2E2U A;  2WO0 A;  1IK3 A;  1W5Z A;  3BND A;  1Q82 4;  3NV0 B;  1VQK 3;  3UL5 A;  1ULJ B;  1JKG A;  2W04 A;  3SXX A;  3F7X A;  3I55 3;  4MMZ B;  1QVG 2;  1A2K A;  1O7N B;  2Z7A A;  3SED A;  3OX9 A;  1S5A A;  1VQ6 3;  3RDE A;  4HM1 B;  3X41 A;  2CW9 A;  3ALA A;  3CCL 3;  3GZY B;  5JPP A;  1CYU A;  3N9H A;  3GZR A;  3CNX A;  2F99 A;  3NM7 A;  3WA2 X;  1OF5 B;  4HM7 B;  2IUJ A;  1J2B A;  1OCV A;  1YJN 3;  1QMA A;  3DM8 A;  3WOF B;  3FF0 A;  1IV9 A;  2W56 A;  2MC8 A;  1O7M B;  2STD A;  2QEX 3;  4R80 A;  2CC3 A;  2OQE A;  4H61 A;  2GU3 A;  1CEW I;  3I0Y A;  2BNG A;  2BHM A;  1YVB I;  2W6J H;  3B4P A;  2HML B;  1W6G A;  5AEW B;  2CWV A;  2Z6B A;  1KSI A;  5CF1 A;  3AMO B;  2IUK A;  1VQN 3;  5AIF A;  2HMO B;  3PS8 A;  2XR8 B;  4X2H A;  3S28 A;  5AI1 A;  4LSO A;  4O8S A;  3GAX A;  3G71 3;  5ELJ A;  2KRT A;  1ASK A;  2XRX B;  3JUO A;  1R4C A;  2FGT A;  1SQW A;  1NWW A;  1RRH A;  2MF7 A;  3ECF A;  1WMN A;  1DYU A;  2HMN B;  4KZ1 A;  1YJ9 3;  1VQ7 3;  2RFR A;  1M1K 4;  4R4K A;  1U8C B;  1K9M 4;  3MG3 A;  2B24 B;  1VQM 3;  3HZP A;  2Z77 A;  1S72 3;  1N5P A;  7STD A;  1JN5 B;  5HGR A;  4FMC A;  1JB2 A;  1MOL A;  1FGR A;  2GEY A;  5CLK A;  1JN5 A;  1HKX A;  4N6M A;  2CFG A;  4N6V 0;  2M7O A;  3LTC A;  2OOV A;  2RSX A;  4RZM A;  3F8X A;  3MHE A;  2WGO A;  5KP1 A;  3ROB A;  4FMD A;  3SOY A;  3DZL A;  3S5C A;  1WQL B;  1KQS 2;  4J8T A;  3VGN A;  1C7H A;  3SLU A;  1G96 A;  2O3O A;  1LNH A;  4EBG A;  8CHO A;  1FUW A;  1IQY A;  1GYB A;  2KXG A;  3E99 A;  3G6E 3;  4H3U A;  3G0K A;  5LC6 A;  2GBX B;  3EE1 A;  3HIG A;  5IEP A;  1Q40 B;  2W03 A;  3F8H A;  1LVN A;  4EV5 A;  3SX1 A;  1RJO A;  2R4I A;  3EX9 A;  4IIA A;  4O2H A;  2QA4 3;  2JDI H;  3S67 A;  2Z76 A;  3HI7 A;  3X3X A;  4WFO A;  5CK6 A;  3NUV A;  4K1V A;  1EKM A;  4XBX A;  2Y74 A;  3NM2 A;  4K90 B;  3QRD A;  3FCS B;  4NHF A;  4KFD A;  2W9P A;  3J7Y d;  2LYX A;  4AKZ A;  3GZX B;  4JF8 A;  1JB5 A;  2QIY A;  3CCU 3;  4BTX A;  3LZA A;  3PXM A;  3U1W A;  3STD A;  4CDL A;  1PU4 A;  3FLJ A;  1O7P B;  2IMJ A;  1IVU A;  3CNM A;  3LTB A;  4KFE A;  4XB5 A;  1FGT A;  4WWU C;  1RKY A;  1O7H B;  3S27 A;  5IER A;  2RGQ A;  3UL6 A;  5JBS A;  1DMN A;  1BUQ A;  1VQP 3;  1VQL 3;  1W4N A;  1W7C A;  4ORL A;  4FCJ A;  3WOE B;  1QJG A;  3DY5 A;  3OXA A;  1W01 A;  1UW1 A;  5IG3 A;  3KZT A;  3CC2 3;  3V92 A;  4N3V A;  1EQK A;  2WOF A;  3NV0 A;  1F8N A;  5KP3 A;  3OWU A;  3DMC A;  3O8Y A;  3EN8 A;  3EHC A;  4FMA A;  1DVD A;  3JUN A;  4LMI A;  4N6L A;  3A76 A;  4XBT A;  5BVB A;  1YI2 3;  3BNC A;  3F14 A;  1ROA A;  1D6U A;  2YFL B;  3T8U A;  4RNZ A;  3F7S A;  3WA3 A;  2XSO B;  1N5H A;  3NQY A;  1TU5 A;  3CXC 2;  3FKA A;  1OF5 A;  2W9Q A;  1JJ2 2;  4STD A;  3KII A;  1IT8 A;  2P09 A;  2XF3 A;  3FG3 A;  2Q07 A;  4HVN A;  4HZ9 B;  1IQX A;  4N6O B;  3EC9 A;  4KVH A;  2OTJ 3;  3RGA A;  2YX9 A;  3IPT A;  4AEQ A;  1U5O A;  5D81 A;  3B8L A;  3ER7 A;  3MWZ A;  3MG2 A;  3FG1 A;  2W2C A;  1WMP A;  1E3R A;  3NBB A;  4RBN A;  3KN4 A;  1KWI A;  3IJE B;  3AMO A;  3Q1C A;  2UX0 A;  1IVV A;  1VQ9 3;  1A90 A;  3MYT A;  5AEU B;  1W6C A;  2XSH B;  2IA7 A;  3LT9 A;  4IT7 A;  1JV2 B;  1M90 4;  1IVX A;  3NBJ A;  4Q53 A;  3LOY A;  2Y73 A;  1FA3 A;  1M1X B;  1K73 4;  1YJW 3;  2CKF B;  1W02 A;  3PGB A;  3CD6 3;  3LT8 A;  3X3Y A;  1QAL A;  4HZB B;  5IG4 A;  3FG4 A;  3N8B A;  1IU7 A;  3G16 A;  3D3L A;  1W00 A;  2B1X B;  1RN7 A;  5IF6 A;  2YFJ B;  1STD A;  1OPY A;  3UB1 A;  4R9L A;  1OH0 A;  3KFQ C;  4HJL B;  3NX0 A;  3LTD A;  3CU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...