1N5PA

Solution structure of the cathelin-like domain of protegrins (all amide bonds involving proline residues are in trans conformation)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
105
structure length
105
Chain Sequence
b'GSHMQALSYREAVLRAVDRLNEQSSEANLYRLLELDQPPKADEDPGTPKPVSFTVKETVCPRPTRQPPELCDFKENGRVKQCVGTVTLDQIKDPLDITCNEVQGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protegrins
publication title NMR Structure of the Cathelin-like domain of the protegrin-3 Precursor
pubmed doi rcsb
source organism Sus scrofa
molecule tags Antibiotic
total genus 18
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2002-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00666 Cathelicidins Cathelicidin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1n5pA00
4EYCA 3GAXA 3PS8A 1N9JA 1ROAA 1EQKA 3S67A 1A67A 1DVCA 4N6MA 4N6V0 1DVDA 3MWZA 1IV9A 1PFPA 4N6NB 4N6TA 5EQLA 5LC7A 2BO9B 1GD3A 1G96A 1N5PA 1CYUA 1CYVA 1FA3A 3PYJA 1TIJA 3K9MC 2W9PA 4ZM8A 1FUWA 1NB5I 4N6OB 2CH9A 4N6UA 1STFI 5LC6A 1LXEA 1YVBI 3IMAB 1CEWI 4LZIA 1GD4A 3SVAA 2W9QA 1R4CA 3KSED 2OCTA 3LH4A 1M9GA 4TX4A 3PXMA 3QRDA 1A90A 1IV7A 3NX0A 4N6LA 3UL5A 3Q2PA 5A0OB 1MOLA 3L0RA 2KXGA 1KWIA 4CCVA 5ELJA 4IT7A 1MNLA 5ELUA 3UL6A 1N5HA 1WNHA 2O9UX 1NB3I 3KFQC 1RN7A
chains in the Genus database with same CATH superfamily
3N9HA 1LOWA 2O3OA 3RGRA 3NV0B 3JUOA 1OHOA 1JB4A 3SOAA 1LRAA 1PY3A 1FGQA 5IW9A 2FGTA 4J5GA 1DETA 1BSCA 5HOHA 2F86B 3BLZA 3SEDA 1A67A 3S27A 1LVNA 4FMCA 2KRTA 1JBTA 5IEPA 1RNBA 1RHLA 4HBRA 2L1SA 2STDA 3DH2A 1FGOA 1OGZA 1TRPA 3BNBA 3NV0A 3X41A 2CG0A 1YJN3 3BB9A 4R1KA 4Q53A 2BNGA 3SOYA 1JN5A 1IQYA 5IENA 4BU4A 3DM8A 4N6NB 5JPPA 3CNMA 1JB2A 1IVXA 4FMDA 2Z76A 1VQ53 5FGOA 3F7XA 2QIYA 4JF8A 2H0IA 2C10A 1U8CB 1VQ83 1SIHA 1AY7A 1YJ93 3Q1CA 2BO9B 3ZG0A 1MGWA 2XR8B 2IMJA 2UUGC 2W56A 4AEQA 1YIT3 3MG3A 2H0HA 1OF5B 2ML5A 3EQQB 1G96A 1N5PA 1OHSA 3NXJA 4KZ1A 1AQZA 4X2HA 5AEUB 1K734 4FCJA 1LQGC 3CC43 1FA3A 1VQO3 1DE3A 5AIIA 3GRDA 3OWYA 2SBLA 4OVMA 4RNTA 1ULJB 5DREA 4KFFA 2GBXB 2W9PA 4AKZA 2MC8A 3NQYA 1YNVX 3MYTA 1MWRA 1LNIA 1OF5A 1Q9EA 3LTAA 1TFKA 1JBSA 5CXOA 1AR0A 1K41A 5TGNA 5I97A 2XGNA 3CPOA 1N8R4 1BNGA 1RNTA 4BL2A 3T8NA 1RSNA 5IF6A 2WO0A 1BUJA 2QEX3 1FW7A 3I0YA 3B4OA 4BIRA 1CEWI 1S5AA 3BIRA 3EX9A 4KT3B 2HOHA 3LT9A 5BIRA 4EBGA 2KF4A 2XGLA 5AI1A 3N54B 1A2KA 7GSPA 1IVVA 1W7CA 1VQQA 3CCS3 3CU3A 4OUQA 2XFTA 2P0XA 2K3DA 4NREA 1RN4A 4K61A 1HKXA 3SVAA 1D6YA 2W9QA 2Z77A 3AHSA 4MMYB 3BU4A 2XF3A 1TU5A 1FGTA 1O7MB 5AIFA 1IQ8A 1W00A 2CW9A 4GB5A 1EA2A 5KP3A 3RDEA 3KCHA 1Y4KA 1LQMB 3UJMA 2W6JH 4LGQA 1I2EA 4XBYA 5G2GA 1IK3A 3KKGA 2A15A 2RSXA 3UL5A 6GSPA 4KFEA 3Q2PA 2INXA 2RGQA 1M1K4 2CFDA 1QVF2 1KWIA 1RMSA 1T3BA 4CCVA 3OV4A 4QWTA 1W4NA 5ELJA 1ZX2A 2D42A 1FUTA 4HM8B 2P38A 1BSBA 1I0VA 2RBIA 1BOXA 2Z7AA 3GZYB 3PGBA 2L4VA 1OH0A 3FG1A 1B2SA 3VSYA 3GZRA 5M18A 1N5HA 4RNZA 1VQ63 1JJ22 1GYBA 1YI23 1MWSA 3QK9A 1JV2B 3A5EA 4H3UA 1SARA 2OWPA 3UNLA 4NHFA 1KC84 3BNDA 4HOHA 1TTOA 3OWUA 3D79A 3KZTA 3UB1A 4EYCA 2GEYA 2CHCA 2ZHXB 4EC6A 1S723 1Q814 1Q40B 3GSPA 1ROAA 3HIGA 3KE7A 3V99A 1EQKA 3IPTA 3S67A 1TRQA 1LOVA 4O02B 5M19A 3G4S3 3PCSA 1GMPA 2Y73A 2IUJA 6STDA 1VQL3 2QA43 2RCDA 2YX9A 1GOUA 1O7PB 3AGNA 1LNHA 3F8XA 1VQ43 2RNTA 5HGRA 3EHCA 5D81A 1Q7Y4 1ROVA 1BSDA 4N6MA 1X1UA 3NBJA 4N6V0 1RGAA 3ER7A 3FH1A 1BVIA 4K90B 1DVDA 1IT7A 2D1WA 1PFPA 2F5MA 3WMDA 4O2HA 1ZGXA 3DXOA 2HMNB 3CCL3 3F9SA 1BGSA 5LC7A 3PCRA 1FGMA 5BU4A 1Q864 1AVLA 2BHMA 1A2VA 1K9M4 1BU4A 3LYGA 3CCR3 3TDGA 3O8YA 4BTWA 3B7CA 3JUPA 1V74A 4HKVB 4MJDA 3FG4A 1E3RA 1TJDA 2M7OA 3IJEB 1JKGB 3K5TA 5RNTA 1G0TA 2W03A 1JN5B 1B27A 2HMMB 2AADA 1UW1A 1BUQA 3GZXB 4LSOA 1K8A4 2LYXA 1JZOA 2R41A 1US1A 4XB5A 3CC23 1QALA 3S29A 3EB8A 1O7WB 2R4IA 1E97A 1GY6A 4RZMA 4PEJA 2SARA 3CCJ3 3F7SA 2J8XB 5CF2A 3OW22 1C54A 2F99A 2W56B 1BRJA 3JUNA 1JKGA 2GU3A 4EXRA 3AMOB 4DKIA 1RRLA 4G1MB 2KF6A 2BIRA 2CKFB 3CCQ3 1C7HA 3AHWA 1RRHA 4LMIA 3FG3A 4HVNA 2HMJB 5IEOA 2V1LA 1D6UA 1LXEA 1YVBI 4MEIA 1O7NB 3WA3A 5BXQA 2OTL3 1D6ZA 3GWRA 2ML6A 4HJLB 3SX1A 2W04A 1MGRA 1FUSA 4FMBA 1UGHI 2F56A 3AMOA 1OACA 9RNTA 1BNSA 3JUMA 1RGKA 4L7KA 3I553 2Y74A 3CD63 1RKYA 2FXTA 5STDA 3HZPA 1HZ1A 3FGYA 1IVWA 1QMAA 3LH4A 3PXMA 1IQXA 3URPA 3WA2X 3CCU3 3CMA3 1R4YA 5AIHA 1EG9B 1CQSA 4J8TA 1ASKA 1LOYA 1RTUA 1A90A 1GMQA 1GOVA 1E3VA 1K28A 4L8OA 3EE1A 4HM2B 5JPUA 3DY5A 1IU7A 1YIJ3 2C11A 4X2OA 1SIIA 3MG1A 3EF8A 4O8SA 4R4KA 1A2PA 2Q07A 4FMAA 1OPYA 3LTCA 5IG0A 3EBTA 1W6CA 1MWTA 5CK6A 2CX1A 5EVHA 3X3ZA 3G713 1IDPA 4IPBA 4RBNA 1WMNA 2CK3H 3VGNA 3S28A 1FZUA 3FF2A 1GY7A 2ZDJA 4HM5B 1FYSA 4EV2A 3D5IA 3ECFA 4WHAA 2KAAA 2W2CA 3CCV3 1B21A 2O9UX 3HK4A 3HOHA 5D82A 3KFQC 3CPW2 3DGMA 3MKIA 2B1XB 7STDA 1VQP3 4EW5A 3DGOA 2WGOA 4KFDA 2K0MA 3CNXA 1RJOA 1N9JA 1UCKA 1UDII 2BMOB 2E2UA 1M1XB 5IERA 3HI7A 1QVG2 3T8UA 2XFSA 2CC3A 4HAAA 3E99A 1OGXA 1W6GA 4KVHA 3J7Yd 2ZL8A 2CFKA 3D9RA 5CF1A 3MWZA 1NNVA 5KP4A 2QGUA 2H0GA 4N6TA 1DYUA 1I2FA 4GHOA 2CIUA 3NBRA 3KN4A 5EQLA 2PNCA 4WYKB 1WTHA 3U1WA 1BIRA 1VQ93 1V58A 3LT8A 4L8PA 4XM4A 3CCE3 2XH9A 1RDSA 2KF3A 3LOYA 1B2UA 1TFOA 4CPKA 1GD3A 3G6E3 3SXXA 1WMOA 1F8NA 3HIIA 1VQN3 2PZVA 1PU4A 2WOHA 3PYJA 1UCIA 4WYKA 1BRKA 3RGAA 3EN8A 3VF1A 4ORLA 2B24B 3K9MC 1EEJA 4ZM8A 1FUWA 2K54A 3NHXA 4HM0B 4H61A 4N6OB 1I3FA 2CH9A 3B4PA 4CDLA 3HX8A 7RNTA 4N6UA 1RGEA 1ZS7A 1IT8A 3MPHA 3ZG5A 5AIGA 1RCKA 1Q824 1DMMA 3H51A 1KD14 1LOXA 1O7HB 1T5YA 3DGLA 3LMLA 3K0ZA 1VQ73 1I2GA 2P0MA 2YFLB 1X1YA 1BNIA 3ROBA 2CG1A 2WGQA 3JVCA 4XDWA 3EJVA 3WODG 1FGRA 1GD4A 2GEXA 3EN1B 2CWTA 1NU3A 1ZO2A 2P09A 2GBWB 1V57A 1W01A 3X3XA 1Z1SA 2OCTA 4BTYA 5IG5A 4HM3B 1STDA 2MF7A 1UI8A 1KQS2 2Z6BA 4EV5A 3QRDA 3A76A 1DMNA 1TUHA 3DGNA 5AYRB 4I5QA 2I9WA 1BAOA 4N6LA 2JDIH 4WWUC 5KP1A 2FNQA 3D5GA 3G0KA 1I8VA 3KSPA 4WFOA 3SYUA 5A0OB 1TP6A 1MOLA 3NM2A 2CFLA 3G8ZA 4HZBB 3KIIA 2KXGA 1QJGA 3F40A 3FF0A 5M1AA 1NJI4 3X42A 4O3VA 2GU1A 4I4KA 1RGFA 2UX0A 1IVUA 4ILFA 1OHPA 1WQLB 1OUNA 1ISKA 1JRQA 2CX0A 3CC73 1B2XA 1YVSA 3D4AA 4BTXA 4STDA 1OCVA 2KF5A 1I0XA 1G02A 1MWUA 1N8QA 1RGLA 1WNHA 2CFGA 2P05A 5AYSC 4BL3A 3I563 1BRNL 1B2MA 1AVKA 1NB3I 1M904 4IIAA 3LTDA 4J9AA 3WDGB 1YGWA 1SJWA 2CFWA 1BNJA 2XSOB 3BNCA 2YFIB 3GAXA 4XBTA 3T0UA 3PS8A 1JNQA 1JB5A 3ZFZA 2E2VA 2IY2A 1W5ZA 2CWUA 1BRHA 1RLSA 1I70A 1GS3A 2AAEA 1UUWB 1NO3A 3NUVA 2RFRA 3BNEA 3G16A 3LZAA 1NDOB 4K1UA 4XDVA 2IUKA 3FSDA 1DVCA 3MHEA 1I3IA 1NWWA 1WMPA 3FKAA 1O7GB 5EEOA 3DMCA 4AKYA 1B3SA 3NQZA 1W02A 2BU4A 1UUGB 2GSPA 1AV4A 1GSPA 1UGIA 1W6YA 3MG2A 1IV9A 5GSPA 1SPUA 3OWSA 1UCLA 1UCJA 1BSEA 1BRGA 2OQEC 3FZWA 3PZWA 2F5WA 1PYLA 1T2IA 3LXUX 1YGEA 1HYFA 4GSPA 3GZBA 4N3VA 2JQ5A 3EC9A 2E2TA 5DRVA 1QAFA 4HYZA 1VQM3 4R80A 1UI7A 8CHOA 3ALAA 4HZ9B 1BNFA 1W2ZA 1CYUA 1CYVA 2CWVA 1GMRA 1TIJA 4FCZA 5G1LA 5IG4A 1RGGA 2C4BA 4GL6A 2HMLB 2OTJ3 1YHQ3 3AGOA 2HMKB 2OQEA 3N8BA 3DUKA 5JBSA 3K7CA 5BVBA 2F4YA 3SLUA 1NB5I 2WOFA 1JBRA 4MMZB 3WOEB 3OX9A 4FR9A 3WOFB 3U97A 1W2B2 2UGIA 1CH0A 1B20A 3FCSB 4LEHA 1STFI 1BRIA 2KCDA 4HM4B 5G1KA 5LC6A 2BMRB 2HMOB 4XBXA 1BRSA 2XRXB 3M8CA 4CJNA 1BANA 1ULIB 1J2BA 3IMAB 3X3YA 1DMQA 1U5OA 3F14A 2BT3A 2LQVA 3OXAA 1BNRA 3NM7A 3DZLA 4LZIA 3WR2A 3D3LA 1BSAA 2GXFA 4OK0A 3H3HA 2XSHB 2ZA4A 4MMXB 5CLKA 3CCM3 3V98A 1RGCA 3NBBA 4U13A 1SQWA 1Q7HA 1VZZA 1R4CA 1RGHA 3KSED 4R9KA 1L5GB 4R9LA 3V92A 1QAKA 4FCMA 4RNYA 3B8LA 3Q90A 1RCLA 2W0QA 1M9GA 4TX4A 3MSOA 1N9EA 1JZDA 3RNTA 3EBYA 6RNTA 3X40A 1T2HA 4WP5A 4LYLB 2XEPA 1GY5A 1UUVB 1X1WA 1X1XA 3JUQA 4NPBA 1IV7A 1GOYA 2OOVC 3NX0A 5D83A 8RNTA 1IYYA 4J5KA 2F98A 4HM7B 3K63A 3L0RA 4HM6B 1KSIA 4JRFA 1YJW3 3F8HA 3S5CA 3LTBA 2IYJA 1HU9A 1Q42A 5FW5A 1Q40A 2IA7A 4IT7A 1MNLA 2BMQB 5ELUA 3DGYA 3UL6A 3Q3FA 3FLJA 1RN1A 2OOVA 2YFJB 1EUIC 3STDA 3WHOA 3CXC2 3CME3 4K1VA 1VQK3 4HM1B 5AEWB 1EKMA 1B2ZA 5IG3A 1RN7A 1BNEA
chains in the Genus database with same CATH topology
3N9HA 2O3OA 3RGRA 3NV0B 3JUOA 1OHOA 1JB4A 3SOAA 1FGQA 5IW9A 2FGTA 2F86B 3BLZA 3SEDA 1A67A 3S27A 1LVNA 4FMCA 2KRTA 5IEPA 4HBRA 2STDA 1FGOA 1OGZA 3BNBA 3X41A 3NV0A 2CG0A 1YJN3 3BB9A 4R1KA 4Q53A 2BNGA 3SOYA 1JN5A 1IQYA 5IENA 5JPPA 3DM8A 4N6NB 3CNMA 1JB2A 1IVXA 4FMDA 2Z76A 1VQ53 5FGOA 3F7XA 2QIYA 4JF8A 2C10A 1U8CB 1VQ83 1SIHA 1YJ93 3Q1CA 2BO9B 2XR8B 2IMJA 2W56A 4AEQA 1YIT3 3MG3A 1OF5B 2ML5A 3EQQB 1G96A 1N5PA 1OHSA 3NXJA 4KZ1A 4X2HA 1K734 5AEUB 4FCJA 3CC43 1FA3A 1VQO3 5AIIA 3GRDA 3OWYA 2SBLA 4OVMA 1ULJB 5DREA 4KFFA 2GBXB 2W9PA 4AKZA 2MC8A 3NQYA 3MYTA 1OF5A 3LTAA 1TFKA 5CXOA 1AR0A 1K41A 5TGNA 5I97A 2XGNA 3CPOA 1N8R4 3T8NA 5IF6A 2WO0A 2QEX3 3I0YA 3B4OA 1CEWI 1S5AA 3EX9A 3LT9A 4EBGA 2XGLA 5AI1A 3N54B 1A2KA 1IVVA 1W7CA 3CCS3 3CU3A 4OUQA 2XFTA 2P0XA 4NREA 4K61A 1HKXA 3SVAA 1D6YA 2W9QA 2Z77A 4MMYB 2XF3A 1TU5A 1FGTA 1O7MB 5AIFA 1IQ8A 1W00A 2CW9A 4GB5A 1EA2A 5KP3A 3RDEA 1Y4KA 3UJMA 2W6JH 4LGQA 4XBYA 5G2GA 1IK3A 3KKGA 2A15A 2RSXA 3UL5A 4KFEA 3Q2PA 2INXA 2RGQA 1M1K4 2CFDA 1QVF2 1KWIA 4CCVA 3OV4A 4QWTA 1W4NA 5ELJA 1ZX2A 2D42A 4HM8B 2P38A 2Z7AA 3GZYB 3PGBA 2L4VA 1OH0A 3FG1A 3VSYA 3GZRA 1N5HA 4RNZA 1VQ63 1JJ22 1GYBA 1YI23 3QK9A 4H3UA 1JV2B 2OWPA 3UNLA 4NHFA 1KC84 3BNDA 3OWUA 3KZTA 3UB1A 4EYCA 2GEYA 2CHCA 4EC6A 1S723 1Q40B 1ROAA 3HIGA 3KE7A 3V99A 1EQKA 3IPTA 3S67A 4O02B 3G4S3 3PCSA 2Y73A 2IUJA 6STDA 1VQL3 2QA43 2RCDA 2YX9A 1O7PB 1LNHA 3F8XA 1VQ43 5HGRA 3EHCA 5D81A 1Q7Y4 1ROVA 4N6MA 3NBJA 4N6V0 3ER7A 3FH1A 4K90B 1DVDA 1IT7A 2D1WA 1PFPA 3WMDA 4O2HA 3DXOA 2HMNB 3CCL3 3F9SA 5LC7A 3PCRA 1FGMA 1Q864 1AVLA 2BHMA 1A2VA 1K9M4 3LYGA 3CCR3 3TDGA 3O8YA 4BTWA 3B7CA 3JUPA 1V74A 4HKVB 4MJDA 3FG4A 1E3RA 2M7OA 3IJEB 3K5TA 1JKGB 2W03A 1JN5B 2HMMB 1UW1A 3GZXB 4LSOA 1K8A4 2LYXA 1US1A 4XB5A 3CC23 1QALA 3S29A 3EB8A 1O7WB 2R4IA 1E97A 1GY6A 4RZMA 4PEJA 3CCJ3 3F7SA 5CF2A 3OW22 2F99A 2W56B 3JUNA 1JKGA 2GU3A 4EXRA 3AMOB 1RRLA 4G1MB 2CKFB 3CCQ3 1C7HA 1RRHA 4LMIA 3FG3A 4HVNA 2HMJB 5IEOA 2V1LA 1D6UA 1LXEA 1YVBI 4MEIA 1O7NB 3WA3A 5BXQA 2OTL3 1D6ZA 3GWRA 2ML6A 4HJLB 3SX1A 2W04A 4FMBA 3AMOA 1OACA 3JUMA 4L7KA 3I553 2Y74A 3CD63 1RKYA 2FXTA 5STDA 3HZPA 3FGYA 1IVWA 1QMAA 3LH4A 3PXMA 1IQXA 3WA2X 3CCU3 3CMA3 5AIHA 1EG9B 1CQSA 4J8TA 1ASKA 1A90A 1K28A 1E3VA 4L8OA 3EE1A 4HM2B 5JPUA 3DY5A 1IU7A 1YIJ3 2C11A 4X2OA 1SIIA 3MG1A 3EF8A 4O8SA 4R4KA 5IG0A 2Q07A 4FMAA 1OPYA 3LTCA 3EBTA 1W6CA 5CK6A 5EVHA 3X3ZA 3G713 1IDPA 4IPBA 4RBNA 1WMNA 2CK3H 3VGNA 3S28A 3FF2A 1GY7A 2ZDJA 4HM5B 4EV2A 3ECFA 4WHAA 2W2CA 3CCV3 2O9UX 3HK4A 5D82A 3CPW2 3KFQC 3DGMA 3MKIA 2B1XB 7STDA 1VQP3 3DGOA 2WGOA 4KFDA 2K0MA 3CNXA 1RJOA 1N9JA 2E2UA 2BMOB 1M1XB 5IERA 3HI7A 1QVG2 3T8UA 2XFSA 2CC3A 3E99A 1OGXA 1W6GA 4KVHA 3J7Yd 2ZL8A 2CFKA 3D9RA 5CF1A 3MWZA 5KP4A 2QGUA 4N6TA 1DYUA 5EQLA 2CIUA 3NBRA 3KN4A 2PNCA 4WYKB 1WTHA 3U1WA 1VQ93 3LT8A 4L8PA 4XM4A 3CCE3 2XH9A 3LOYA 1TFOA 1GD3A 3G6E3 3SXXA 1WMOA 1F8NA 3HIIA 1VQN3 2PZVA 1PU4A 2WOHA 3PYJA 4WYKA 3RGAA 3EN8A 3VF1A 4ORLA 2B24B 3K9MC 4ZM8A 1FUWA 2K54A 3NHXA 4HM0B 4H61A 4N6OB 2CH9A 3B4PA 4CDLA 3HX8A 4N6UA 3MPHA 1IT8A 5AIGA 1Q824 1DMMA 3H51A 1KD14 1LOXA 1O7HB 1T5YA 3DGLA 3LMLA 3K0ZA 1VQ73 2P0MA 2YFLB 3ROBA 2CG1A 2WGQA 3JVCA 4XDWA 3EJVA 3WODG 1FGRA 1GD4A 2GEXA 3EN1B 2CWTA 1NU3A 1ZO2A 2P09A 2GBWB 1W01A 3X3XA 1Z1SA 2OCTA 4BTYA 5IG5A 4HM3B 1STDA 2MF7A 1UI8A 1KQS2 2Z6BA 4EV5A 3QRDA 3A76A 1DMNA 1TUHA 3DGNA 5AYRB 2I9WA 4N6LA 2JDIH 4WWUC 5KP1A 2FNQA 4WFOA 3G0KA 3KSPA 5A0OB 1TP6A 1MOLA 3NM2A 2CFLA 3G8ZA 4HZBB 3KIIA 2KXGA 1QJGA 3F40A 3FF0A 1NJI4 3X42A 4O3VA 2GU1A 4I4KA 2UX0A 1IVUA 1OHPA 1WQLB 1OUNA 1ISKA 1JRQA 3CC73 4BTXA 4STDA 1OCVA 1N8QA 1Q814 2P05A 1WNHA 2CFGA 5AYSC 3I563 1AVKA 1NB3I 1M904 4IIAA 3LTDA 4J9AA 3WDGB 1SJWA 2CFWA 2XSOB 3BNCA 4XBTA 2YFIB 3GAXA 3T0UA 3PS8A 1JNQA 1JB5A 2E2VA 1W5ZA 2CWUA 3NUVA 1GS3A 1UUWB 1NO3A 2RFRA 3BNEA 3G16A 3LZAA 1NDOB 4K1UA 4XDVA 2IUKA 3FSDA 1DVCA 3MHEA 1NWWA 1WMPA 3FKAA 1O7GB 5EEOA 3DMCA 4AKYA 3NQZA 1W02A 1AV4A 1W6YA 3MG2A 1IV9A 1SPUA 3OWSA 3FZWA 2OQEC 3PZWA 3LXUX 1YGEA 4N3VA 3GZBA 2JQ5A 3EC9A 2E2TA 5DRVA 1QAFA 4HYZA 1VQM3 4R80A 1UI7A 8CHOA 3ALAA 4HZ9B 1W2ZA 1CYUA 1CYVA 2CWVA 1TIJA 4FCZA 5IG4A 4GL6A 2HMLB 2OTJ3 1YHQ3 2HMKB 2OQEA 3N8BA 3DUKA 5JBSA 3K7CA 5BVBA 1NB5I 3SLUA 2WOFA 4MMZB 3WOEB 3OX9A 4FR9A 3WOFB 3U97A 1W2B2 3FCSB 4LEHA 1STFI 2KCDA 4HM4B 5LC6A 2BMRB 2HMOB 4XBXA 2XRXB 3M8CA 1ULIB 1J2BA 3IMAB 3X3YA 1DMQA 1U5OA 3F14A 2BT3A 2LQVA 3OXAA 3NM7A 3DZLA 4LZIA 3D3LA 2GXFA 4OK0A 5CLKA 3H3HA 2XSHB 4MMXB 3CCM3 3V98A 3NBBA 4U13A 1SQWA 1VZZA 1R4CA 3KSED 4R9KA 1L5GB 4R9LA 3V92A 1QAKA 4FCMA 4RNYA 3B8LA 3Q90A 2W0QA 1M9GA 4TX4A 3MSOA 1N9EA 3EBYA 3X40A 4WP5A 2XEPA 1GY5A 1UUVB 5D83A 1BUQA 3JUQA 1IV7A 2OOVC 3NX0A 2F98A 4HM7B 3K63A 3L0RA 4HM6B 1KSIA 4JRFA 1YJW3 3F8HA 3S5CA 3LTBA 1HU9A 1Q42A 5FW5A 1Q40A 2IA7A 4IT7A 1MNLA 2BMQB 5ELUA 3UL6A 3FLJA 3STDA 2OOVA 2YFJB 3CXC2 3CME3 4K1VA 1VQK3 4HM1B 5AEWB 1EKMA 5IG3A 1RN7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EYC A;  3GAX A;  3PS8 A;  1N9J A;  1ROA A;  1EQK A;  3S67 A;  1A67 A;  1DVC A;  4N6M A;  4N6V 0;  1DVD A;  3MWZ A;  1IV9 A;  1PFP A;  4N6N B;  4N6T A;  5EQL A;  5LC7 A;  2BO9 B;  1GD3 A;  1G96 A;  1N5P A;  1CYU A;  1CYV A;  1FA3 A;  3PYJ A;  1TIJ A;  3K9M C;  2W9P A;  4ZM8 A;  1FUW A;  1NB5 I;  4N6O B;  2CH9 A;  4N6U A;  1STF I;  5LC6 A;  1LXE A;  1YVB I;  3IMA B;  1CEW I;  4LZI A;  1GD4 A;  3SVA A;  2W9Q A;  1R4C A;  3KSE D;  2OCT A;  3LH4 A;  1M9G A;  4TX4 A;  3PXM A;  3QRD A;  1A90 A;  1IV7 A;  3NX0 A;  4N6L A;  3UL5 A;  3Q2P A;  5A0O B;  1MOL A;  3L0R A;  2KXG A;  1KWI A;  4CCV A;  5ELJ A;  4IT7 A;  1MNL A;  5ELU A;  3UL6 A;  1N5H A;  1WNH A;  2O9U X;  1NB3 I;  3KFQ C;  1RN7 A; 
#chains in the Genus database with same CATH topology
 3N9H A;  1LOW A;  2O3O A;  3RGR A;  3NV0 B;  3JUO A;  1OHO A;  1JB4 A;  3SOA A;  1LRA A;  1PY3 A;  1FGQ A;  5IW9 A;  2FGT A;  4J5G A;  1DET A;  1BSC A;  5HOH A;  2F86 B;  3BLZ A;  3SED A;  1A67 A;  3S27 A;  1LVN A;  4FMC A;  2KRT A;  1JBT A;  5IEP A;  1RNB A;  1RHL A;  4HBR A;  2L1S A;  2STD A;  3DH2 A;  1FGO A;  1OGZ A;  1TRP A;  3BNB A;  3NV0 A;  3X41 A;  2CG0 A;  1YJN 3;  3BB9 A;  4R1K A;  4Q53 A;  2BNG A;  3SOY A;  1JN5 A;  1IQY A;  5IEN A;  4BU4 A;  3DM8 A;  4N6N B;  5JPP A;  3CNM A;  1JB2 A;  1IVX A;  4FMD A;  2Z76 A;  1VQ5 3;  5FGO A;  3F7X A;  2QIY A;  4JF8 A;  2H0I A;  2C10 A;  1U8C B;  1VQ8 3;  1SIH A;  1AY7 A;  1YJ9 3;  3Q1C A;  2BO9 B;  3ZG0 A;  1MGW A;  2XR8 B;  2IMJ A;  2UUG C;  2W56 A;  4AEQ A;  1YIT 3;  3MG3 A;  2H0H A;  1OF5 B;  2ML5 A;  3EQQ B;  1G96 A;  1N5P A;  1OHS A;  3NXJ A;  4KZ1 A;  1AQZ A;  4X2H A;  5AEU B;  1K73 4;  4FCJ A;  1LQG C;  3CC4 3;  1FA3 A;  1VQO 3;  1DE3 A;  5AII A;  3GRD A;  3OWY A;  2SBL A;  4OVM A;  4RNT A;  1ULJ B;  5DRE A;  4KFF A;  2GBX B;  2W9P A;  4AKZ A;  2MC8 A;  3NQY A;  1YNV X;  3MYT A;  1MWR A;  1LNI A;  1OF5 A;  1Q9E A;  3LTA A;  1TFK A;  1JBS A;  5CXO A;  1AR0 A;  1K41 A;  5TGN A;  5I97 A;  2XGN A;  3CPO A;  1N8R 4;  1BNG A;  1RNT A;  4BL2 A;  3T8N A;  1RSN A;  5IF6 A;  2WO0 A;  1BUJ A;  2QEX 3;  1FW7 A;  3I0Y A;  3B4O A;  4BIR A;  1CEW I;  1S5A A;  3BIR A;  3EX9 A;  4KT3 B;  2HOH A;  3LT9 A;  5BIR A;  4EBG A;  2KF4 A;  2XGL A;  5AI1 A;  3N54 B;  1A2K A;  7GSP A;  1IVV A;  1W7C A;  1VQQ A;  3CCS 3;  3CU3 A;  4OUQ A;  2XFT A;  2P0X A;  2K3D A;  4NRE A;  1RN4 A;  4K61 A;  1HKX A;  3SVA A;  1D6Y A;  2W9Q A;  2Z77 A;  3AHS A;  4MMY B;  3BU4 A;  2XF3 A;  1TU5 A;  1FGT A;  1O7M B;  5AIF A;  1IQ8 A;  1W00 A;  2CW9 A;  4GB5 A;  1EA2 A;  5KP3 A;  3RDE A;  3KCH A;  1Y4K A;  1LQM B;  3UJM A;  2W6J H;  4LGQ A;  1I2E A;  4XBY A;  5G2G A;  1IK3 A;  3KKG A;  2A15 A;  2RSX A;  3UL5 A;  6GSP A;  4KFE A;  3Q2P A;  2INX A;  2RGQ A;  1M1K 4;  2CFD A;  1QVF 2;  1KWI A;  1RMS A;  1T3B A;  4CCV A;  3OV4 A;  4QWT A;  1W4N A;  5ELJ A;  1ZX2 A;  2D42 A;  1FUT A;  4HM8 B;  2P38 A;  1BSB A;  1I0V A;  2RBI A;  1BOX A;  2Z7A A;  3GZY B;  3PGB A;  2L4V A;  1OH0 A;  3FG1 A;  1B2S A;  3VSY A;  3GZR A;  5M18 A;  1N5H A;  4RNZ A;  1VQ6 3;  1JJ2 2;  1GYB A;  1YI2 3;  1MWS A;  3QK9 A;  1JV2 B;  3A5E A;  4H3U A;  1SAR A;  2OWP A;  3UNL A;  4NHF A;  1KC8 4;  3BND A;  4HOH A;  1TTO A;  3OWU A;  3D79 A;  3KZT A;  3UB1 A;  4EYC A;  2GEY A;  2CHC A;  2ZHX B;  4EC6 A;  1S72 3;  1Q81 4;  1Q40 B;  3GSP A;  1ROA A;  3HIG A;  3KE7 A;  3V99 A;  1EQK A;  3IPT A;  3S67 A;  1TRQ A;  1LOV A;  4O02 B;  5M19 A;  3G4S 3;  3PCS A;  1GMP A;  2Y73 A;  2IUJ A;  6STD A;  1VQL 3;  2QA4 3;  2RCD A;  2YX9 A;  1GOU A;  1O7P B;  3AGN A;  1LNH A;  3F8X A;  1VQ4 3;  2RNT A;  5HGR A;  3EHC A;  5D81 A;  1Q7Y 4;  1ROV A;  1BSD A;  4N6M A;  1X1U A;  3NBJ A;  4N6V 0;  1RGA A;  3ER7 A;  3FH1 A;  1BVI A;  4K90 B;  1DVD A;  1IT7 A;  2D1W A;  1PFP A;  2F5M A;  3WMD A;  4O2H A;  1ZGX A;  3DXO A;  2HMN B;  3CCL 3;  3F9S A;  1BGS A;  5LC7 A;  3PCR A;  1FGM A;  5BU4 A;  1Q86 4;  1AVL A;  2BHM A;  1A2V A;  1K9M 4;  1BU4 A;  3LYG A;  3CCR 3;  3TDG A;  3O8Y A;  4BTW A;  3B7C A;  3JUP A;  1V74 A;  4HKV B;  4MJD A;  3FG4 A;  1E3R A;  1TJD A;  2M7O A;  3IJE B;  1JKG B;  3K5T A;  5RNT A;  1G0T A;  2W03 A;  1JN5 B;  1B27 A;  2HMM B;  2AAD A;  1UW1 A;  1BUQ A;  3GZX B;  4LSO A;  1K8A 4;  2LYX A;  1JZO A;  2R41 A;  1US1 A;  4XB5 A;  3CC2 3;  1QAL A;  3S29 A;  3EB8 A;  1O7W B;  2R4I A;  1E97 A;  1GY6 A;  4RZM A;  4PEJ A;  2SAR A;  3CCJ 3;  3F7S A;  2J8X B;  5CF2 A;  3OW2 2;  1C54 A;  2F99 A;  2W56 B;  1BRJ A;  3JUN A;  1JKG A;  2GU3 A;  4EXR A;  3AMO B;  4DKI A;  1RRL A;  4G1M B;  2KF6 A;  2BIR A;  2CKF B;  3CCQ 3;  1C7H A;  3AHW A;  1RRH A;  4LMI A;  3FG3 A;  4HVN A;  2HMJ B;  5IEO A;  2V1L A;  1D6U A;  1LXE A;  1YVB I;  4MEI A;  1O7N B;  3WA3 A;  5BXQ A;  2OTL 3;  1D6Z A;  3GWR A;  2ML6 A;  4HJL B;  3SX1 A;  2W04 A;  1MGR A;  1FUS A;  4FMB A;  1UGH I;  2F56 A;  3AMO A;  1OAC A;  9RNT A;  1BNS A;  3JUM A;  1RGK A;  4L7K A;  3I55 3;  2Y74 A;  3CD6 3;  1RKY A;  2FXT A;  5STD A;  3HZP A;  1HZ1 A;  3FGY A;  1IVW A;  1QMA A;  3LH4 A;  3PXM A;  1IQX A;  3URP A;  3WA2 X;  3CCU 3;  3CMA 3;  1R4Y A;  5AIH A;  1EG9 B;  1CQS A;  4J8T A;  1ASK A;  1LOY A;  1RTU A;  1A90 A;  1GMQ A;  1GOV A;  1E3V A;  1K28 A;  4L8O A;  3EE1 A;  4HM2 B;  5JPU A;  3DY5 A;  1IU7 A;  1YIJ 3;  2C11 A;  4X2O A;  1SII A;  3MG1 A;  3EF8 A;  4O8S A;  4R4K A;  1A2P A;  2Q07 A;  4FMA A;  1OPY A;  3LTC A;  5IG0 A;  3EBT A;  1W6C A;  1MWT A;  5CK6 A;  2CX1 A;  5EVH A;  3X3Z A;  3G71 3;  1IDP A;  4IPB A;  4RBN A;  1WMN A;  2CK3 H;  3VGN A;  3S28 A;  1FZU A;  3FF2 A;  1GY7 A;  2ZDJ A;  4HM5 B;  1FYS A;  4EV2 A;  3D5I A;  3ECF A;  4WHA A;  2KAA A;  2W2C A;  3CCV 3;  1B21 A;  2O9U X;  3HK4 A;  3HOH A;  5D82 A;  3KFQ C;  3CPW 2;  3DGM A;  3MKI A;  2B1X B;  7STD A;  1VQP 3;  4EW5 A;  3DGO A;  2WGO A;  4KFD A;  2K0M A;  3CNX A;  1RJO A;  1N9J A;  1UCK A;  1UDI I;  2BMO B;  2E2U A;  1M1X B;  5IER A;  3HI7 A;  1QVG 2;  3T8U A;  2XFS A;  2CC3 A;  4HAA A;  3E99 A;  1OGX A;  1W6G A;  4KVH A;  3J7Y d;  2ZL8 A;  2CFK A;  3D9R A;  5CF1 A;  3MWZ A;  1NNV A;  5KP4 A;  2QGU A;  2H0G A;  4N6T A;  1DYU A;  1I2F A;  4GHO A;  2CIU A;  3NBR A;  3KN4 A;  5EQL A;  2PNC A;  4WYK B;  1WTH A;  3U1W A;  1BIR A;  1VQ9 3;  1V58 A;  3LT8 A;  4L8P A;  4XM4 A;  3CCE 3;  2XH9 A;  1RDS A;  2KF3 A;  3LOY A;  1B2U A;  1TFO A;  4CPK A;  1GD3 A;  3G6E 3;  3SXX A;  1WMO A;  1F8N A;  3HII A;  1VQN 3;  2PZV A;  1PU4 A;  2WOH A;  3PYJ A;  1UCI A;  4WYK A;  1BRK A;  3RGA A;  3EN8 A;  3VF1 A;  4ORL A;  2B24 B;  3K9M C;  1EEJ A;  4ZM8 A;  1FUW A;  2K54 A;  3NHX A;  4HM0 B;  4H61 A;  4N6O B;  1I3F A;  2CH9 A;  3B4P A;  4CDL A;  3HX8 A;  7RNT A;  4N6U A;  1RGE A;  1ZS7 A;  1IT8 A;  3MPH A;  3ZG5 A;  5AIG A;  1RCK A;  1Q82 4;  1DMM A;  3H51 A;  1KD1 4;  1LOX A;  1O7H B;  1T5Y A;  3DGL A;  3LML A;  3K0Z A;  1VQ7 3;  1I2G A;  2P0M A;  2YFL B;  1X1Y A;  1BNI A;  3ROB A;  2CG1 A;  2WGQ A;  3JVC A;  4XDW A;  3EJV A;  3WOD G;  1FGR A;  1GD4 A;  2GEX A;  3EN1 B;  2CWT A;  1NU3 A;  1ZO2 A;  2P09 A;  2GBW B;  1V57 A;  1W01 A;  3X3X A;  1Z1S A;  2OCT A;  4BTY A;  5IG5 A;  4HM3 B;  1STD A;  2MF7 A;  1UI8 A;  1KQS 2;  2Z6B A;  4EV5 A;  3QRD A;  3A76 A;  1DMN A;  1TUH A;  3DGN A;  5AYR B;  4I5Q A;  2I9W A;  1BAO A;  4N6L A;  2JDI H;  4WWU C;  5KP1 A;  2FNQ A;  3D5G A;  3G0K A;  1I8V A;  3KSP A;  4WFO A;  3SYU A;  5A0O B;  1TP6 A;  1MOL A;  3NM2 A;  2CFL A;  3G8Z A;  4HZB B;  3KII A;  2KXG A;  1QJG A;  3F40 A;  3FF0 A;  5M1A A;  1NJI 4;  3X42 A;  4O3V A;  2GU1 A;  4I4K A;  1RGF A;  2UX0 A;  1IVU A;  4ILF A;  1OHP A;  1WQL B;  1OUN A;  1ISK A;  1JRQ A;  2CX0 A;  3CC7 3;  1B2X A;  1YVS A;  3D4A A;  4BTX A;  4STD A;  1OCV A;  2KF5 A;  1I0X A;  1G02 A;  1MWU A;  1N8Q A;  1RGL A;  1WNH A;  2CFG A;  2P05 A;  5AYS C;  4BL3 A;  3I56 3;  1BRN L;  1B2M A;  1AVK A;  1NB3 I;  1M90 4;  4IIA A;  3LTD A;  4J9A A;  3WDG B;  1YGW A;  1SJW A;  2CFW A;  1BNJ A;  2XSO B;  3BNC A;  2YFI B;  3GAX A;  4XBT A;  3T0U A;  3PS8 A;  1JNQ A;  1JB5 A;  3ZFZ A;  2E2V A;  2IY2 A;  1W5Z A;  2CWU A;  1BRH A;  1RLS A;  1I70 A;  1GS3 A;  2AAE A;  1UUW B;  1NO3 A;  3NUV A;  2RFR A;  3BNE A;  3G16 A;  3LZA A;  1NDO B;  4K1U A;  4XDV A;  2IUK A;  3FSD A;  1DVC A;  3MHE A;  1I3I A;  1NWW A;  1WMP A;  3FKA A;  1O7G B;  5EEO A;  3DMC A;  4AKY A;  1B3S A;  3NQZ A;  1W02 A;  2BU4 A;  1UUG B;  2GSP A;  1AV4 A;  1GSP A;  1UGI A;  1W6Y A;  3MG2 A;  1IV9 A;  5GSP A;  1SPU A;  3OWS A;  1UCL A;  1UCJ A;  1BSE A;  1BRG A;  2OQE C;  3FZW A;  3PZW A;  2F5W A;  1PYL A;  1T2I A;  3LXU X;  1YGE A;  1HYF A;  4GSP A;  3GZB A;  4N3V A;  2JQ5 A;  3EC9 A;  2E2T A;  5DRV A;  1QAF A;  4HYZ A;  1VQM 3;  4R80 A;  1UI7 A;  8CHO A;  3ALA A;  4HZ9 B;  1BNF A;  1W2Z A;  1CYU A;  1CYV A;  2CWV A;  1GMR A;  1TIJ A;  4FCZ A;  5G1L A;  5IG4 A;  1RGG A;  2C4B A;  4GL6 A;  2HML B;  2OTJ 3;  1YHQ 3;  3AGO A;  2HMK B;  2OQE A;  3N8B A;  3DUK A;  5JBS A;  3K7C A;  5BVB A;  2F4Y A;  3SLU A;  1NB5 I;  2WOF A;  1JBR A;  4MMZ B;  3WOE B;  3OX9 A;  4FR9 A;  3WOF B;  3U97 A;  1W2B 2;  2UGI A;  1CH0 A;  1B20 A;  3FCS B;  4LEH A;  1STF I;  1BRI A;  2KCD A;  4HM4 B;  5G1K A;  5LC6 A;  2BMR B;  2HMO B;  4XBX A;  1BRS A;  2XRX B;  3M8C A;  4CJN A;  1BAN A;  1ULI B;  1J2B A;  3IMA B;  3X3Y A;  1DMQ A;  1U5O A;  3F14 A;  2BT3 A;  2LQV A;  3OXA A;  1BNR A;  3NM7 A;  3DZL A;  4LZI A;  3WR2 A;  3D3L A;  1BSA A;  2GXF A;  4OK0 A;  3H3H A;  2XSH B;  2ZA4 A;  4MMX B;  5CLK A;  3CCM 3;  3V98 A;  1RGC A;  3NBB A;  4U13 A;  1SQW A;  1Q7H A;  1VZZ A;  1R4C A;  1RGH A;  3KSE D;  4R9K A;  1L5G B;  4R9L A;  3V92 A;  1QAK A;  4FCM A;  4RNY A;  3B8L A;  3Q90 A;  1RCL A;  2W0Q A;  1M9G A;  4TX4 A;  3MSO A;  1N9E A;  1JZD A;  3RNT A;  3EBY A;  6RNT A;  3X40 A;  1T2H A;  4WP5 A;  4LYL B;  2XEP A;  1GY5 A;  1UUV B;  1X1W A;  1X1X A;  3JUQ A;  4NPB A;  1IV7 A;  1GOY A;  2OOV C;  3NX0 A;  5D83 A;  8RNT A;  1IYY A;  4J5K A;  2F98 A;  4HM7 B;  3K63 A;  3L0R A;  4HM6 B;  1KSI A;  4JRF A;  1YJW 3;  3F8H A;  3S5C A;  3LTB A;  2IYJ A;  1HU9 A;  1Q42 A;  5FW5 A;  1Q40 A;  2IA7 A;  4IT7 A;  1MNL A;  2BMQ B;  5ELU A;  3DGY A;  3UL6 A;  3Q3F A;  3FLJ A;  1RN1 A;  2OOV A;  2YFJ B;  1EUI C;  3STD A;  3WHO A;  3CXC 2;  3CME 3;  4K1V A;  1VQK 3;  4HM1 B;  5AEW B;  1EKM A;  1B2Z A;  5IG3 A;  1RN7 A;  1BNE A; 
#chains in the Genus database with same CATH homology
 3N9H A;  2O3O A;  3RGR A;  3NV0 B;  3JUO A;  1OHO A;  1JB4 A;  3SOA A;  1FGQ A;  5IW9 A;  2FGT A;  2F86 B;  3BLZ A;  3SED A;  1A67 A;  3S27 A;  1LVN A;  4FMC A;  2KRT A;  5IEP A;  4HBR A;  2STD A;  1FGO A;  1OGZ A;  3BNB A;  3X41 A;  3NV0 A;  2CG0 A;  1YJN 3;  3BB9 A;  4R1K A;  4Q53 A;  2BNG A;  3SOY A;  1JN5 A;  1IQY A;  5IEN A;  5JPP A;  3DM8 A;  4N6N B;  3CNM A;  1JB2 A;  1IVX A;  4FMD A;  2Z76 A;  1VQ5 3;  5FGO A;  3F7X A;  2QIY A;  4JF8 A;  2C10 A;  1U8C B;  1VQ8 3;  1SIH A;  1YJ9 3;  3Q1C A;  2BO9 B;  2XR8 B;  2IMJ A;  2W56 A;  4AEQ A;  1YIT 3;  3MG3 A;  1OF5 B;  2ML5 A;  3EQQ B;  1G96 A;  1N5P A;  1OHS A;  3NXJ A;  4KZ1 A;  4X2H A;  1K73 4;  5AEU B;  4FCJ A;  3CC4 3;  1FA3 A;  1VQO 3;  5AII A;  3GRD A;  3OWY A;  2SBL A;  4OVM A;  1ULJ B;  5DRE A;  4KFF A;  2GBX B;  2W9P A;  4AKZ A;  2MC8 A;  3NQY A;  3MYT A;  1OF5 A;  3LTA A;  1TFK A;  5CXO A;  1AR0 A;  1K41 A;  5TGN A;  5I97 A;  2XGN A;  3CPO A;  1N8R 4;  3T8N A;  5IF6 A;  2WO0 A;  2QEX 3;  3I0Y A;  3B4O A;  1CEW I;  1S5A A;  3EX9 A;  3LT9 A;  4EBG A;  2XGL A;  5AI1 A;  3N54 B;  1A2K A;  1IVV A;  1W7C A;  3CCS 3;  3CU3 A;  4OUQ A;  2XFT A;  2P0X A;  4NRE A;  4K61 A;  1HKX A;  3SVA A;  1D6Y A;  2W9Q A;  2Z77 A;  4MMY B;  2XF3 A;  1TU5 A;  1FGT A;  1O7M B;  5AIF A;  1IQ8 A;  1W00 A;  2CW9 A;  4GB5 A;  1EA2 A;  5KP3 A;  3RDE A;  1Y4K A;  3UJM A;  2W6J H;  4LGQ A;  4XBY A;  5G2G A;  1IK3 A;  3KKG A;  2A15 A;  2RSX A;  3UL5 A;  4KFE A;  3Q2P A;  2INX A;  2RGQ A;  1M1K 4;  2CFD A;  1QVF 2;  1KWI A;  4CCV A;  3OV4 A;  4QWT A;  1W4N A;  5ELJ A;  1ZX2 A;  2D42 A;  4HM8 B;  2P38 A;  2Z7A A;  3GZY B;  3PGB A;  2L4V A;  1OH0 A;  3FG1 A;  3VSY A;  3GZR A;  1N5H A;  4RNZ A;  1VQ6 3;  1JJ2 2;  1GYB A;  1YI2 3;  3QK9 A;  4H3U A;  1JV2 B;  2OWP A;  3UNL A;  4NHF A;  1KC8 4;  3BND A;  3OWU A;  3KZT A;  3UB1 A;  4EYC A;  2GEY A;  2CHC A;  4EC6 A;  1S72 3;  1Q40 B;  1ROA A;  3HIG A;  3KE7 A;  3V99 A;  1EQK A;  3IPT A;  3S67 A;  4O02 B;  3G4S 3;  3PCS A;  2Y73 A;  2IUJ A;  6STD A;  1VQL 3;  2QA4 3;  2RCD A;  2YX9 A;  1O7P B;  1LNH A;  3F8X A;  1VQ4 3;  5HGR A;  3EHC A;  5D81 A;  1Q7Y 4;  1ROV A;  4N6M A;  3NBJ A;  4N6V 0;  3ER7 A;  3FH1 A;  4K90 B;  1DVD A;  1IT7 A;  2D1W A;  1PFP A;  3WMD A;  4O2H A;  3DXO A;  2HMN B;  3CCL 3;  3F9S A;  5LC7 A;  3PCR A;  1FGM A;  1Q86 4;  1AVL A;  2BHM A;  1A2V A;  1K9M 4;  3LYG A;  3CCR 3;  3TDG A;  3O8Y A;  4BTW A;  3B7C A;  3JUP A;  1V74 A;  4HKV B;  4MJD A;  3FG4 A;  1E3R A;  2M7O A;  3IJE B;  3K5T A;  1JKG B;  2W03 A;  1JN5 B;  2HMM B;  1UW1 A;  3GZX B;  4LSO A;  1K8A 4;  2LYX A;  1US1 A;  4XB5 A;  3CC2 3;  1QAL A;  3S29 A;  3EB8 A;  1O7W B;  2R4I A;  1E97 A;  1GY6 A;  4RZM A;  4PEJ A;  3CCJ 3;  3F7S A;  5CF2 A;  3OW2 2;  2F99 A;  2W56 B;  3JUN A;  1JKG A;  2GU3 A;  4EXR A;  3AMO B;  1RRL A;  4G1M B;  2CKF B;  3CCQ 3;  1C7H A;  1RRH A;  4LMI A;  3FG3 A;  4HVN A;  2HMJ B;  5IEO A;  2V1L A;  1D6U A;  1LXE A;  1YVB I;  4MEI A;  1O7N B;  3WA3 A;  5BXQ A;  2OTL 3;  1D6Z A;  3GWR A;  2ML6 A;  4HJL B;  3SX1 A;  2W04 A;  4FMB A;  3AMO A;  1OAC A;  3JUM A;  4L7K A;  3I55 3;  2Y74 A;  3CD6 3;  1RKY A;  2FXT A;  5STD A;  3HZP A;  3FGY A;  1IVW A;  1QMA A;  3LH4 A;  3PXM A;  1IQX A;  3WA2 X;  3CCU 3;  3CMA 3;  5AIH A;  1EG9 B;  1CQS A;  4J8T A;  1ASK A;  1A90 A;  1K28 A;  1E3V A;  4L8O A;  3EE1 A;  4HM2 B;  5JPU A;  3DY5 A;  1IU7 A;  1YIJ 3;  2C11 A;  4X2O A;  1SII A;  3MG1 A;  3EF8 A;  4O8S A;  4R4K A;  5IG0 A;  2Q07 A;  4FMA A;  1OPY A;  3LTC A;  3EBT A;  1W6C A;  5CK6 A;  5EVH A;  3X3Z A;  3G71 3;  1IDP A;  4IPB A;  4RBN A;  1WMN A;  2CK3 H;  3VGN A;  3S28 A;  3FF2 A;  1GY7 A;  2ZDJ A;  4HM5 B;  4EV2 A;  3ECF A;  4WHA A;  2W2C A;  3CCV 3;  2O9U X;  3HK4 A;  5D82 A;  3CPW 2;  3KFQ C;  3DGM A;  3MKI A;  2B1X B;  7STD A;  1VQP 3;  3DGO A;  2WGO A;  4KFD A;  2K0M A;  3CNX A;  1RJO A;  1N9J A;  2E2U A;  2BMO B;  1M1X B;  5IER A;  3HI7 A;  1QVG 2;  3T8U A;  2XFS A;  2CC3 A;  3E99 A;  1OGX A;  1W6G A;  4KVH A;  3J7Y d;  2ZL8 A;  2CFK A;  3D9R A;  5CF1 A;  3MWZ A;  5KP4 A;  2QGU A;  4N6T A;  1DYU A;  5EQL A;  2CIU A;  3NBR A;  3KN4 A;  2PNC A;  4WYK B;  1WTH A;  3U1W A;  1VQ9 3;  3LT8 A;  4L8P A;  4XM4 A;  3CCE 3;  2XH9 A;  3LOY A;  1TFO A;  1GD3 A;  3G6E 3;  3SXX A;  1WMO A;  1F8N A;  3HII A;  1VQN 3;  2PZV A;  1PU4 A;  2WOH A;  3PYJ A;  4WYK A;  3RGA A;  3EN8 A;  3VF1 A;  4ORL A;  2B24 B;  3K9M C;  4ZM8 A;  1FUW A;  2K54 A;  3NHX A;  4HM0 B;  4H61 A;  4N6O B;  2CH9 A;  3B4P A;  4CDL A;  3HX8 A;  4N6U A;  3MPH A;  1IT8 A;  5AIG A;  1Q82 4;  1DMM A;  3H51 A;  1KD1 4;  1LOX A;  1O7H B;  1T5Y A;  3DGL A;  3LML A;  3K0Z A;  1VQ7 3;  2P0M A;  2YFL B;  3ROB A;  2CG1 A;  2WGQ A;  3JVC A;  4XDW A;  3EJV A;  3WOD G;  1FGR A;  1GD4 A;  2GEX A;  3EN1 B;  2CWT A;  1NU3 A;  1ZO2 A;  2P09 A;  2GBW B;  1W01 A;  3X3X A;  1Z1S A;  2OCT A;  4BTY A;  5IG5 A;  4HM3 B;  1STD A;  2MF7 A;  1UI8 A;  1KQS 2;  2Z6B A;  4EV5 A;  3QRD A;  3A76 A;  1DMN A;  1TUH A;  3DGN A;  5AYR B;  2I9W A;  4N6L A;  2JDI H;  4WWU C;  5KP1 A;  2FNQ A;  4WFO A;  3G0K A;  3KSP A;  5A0O B;  1TP6 A;  1MOL A;  3NM2 A;  2CFL A;  3G8Z A;  4HZB B;  3KII A;  2KXG A;  1QJG A;  3F40 A;  3FF0 A;  1NJI 4;  3X42 A;  4O3V A;  2GU1 A;  4I4K A;  2UX0 A;  1IVU A;  1OHP A;  1WQL B;  1OUN A;  1ISK A;  1JRQ A;  3CC7 3;  4BTX A;  4STD A;  1OCV A;  1N8Q A;  1Q81 4;  2P05 A;  1WNH A;  2CFG A;  5AYS C;  3I56 3;  1AVK A;  1NB3 I;  1M90 4;  4IIA A;  3LTD A;  4J9A A;  3WDG B;  1SJW A;  2CFW A;  2XSO B;  3BNC A;  4XBT A;  2YFI B;  3GAX A;  3T0U A;  3PS8 A;  1JNQ A;  1JB5 A;  2E2V A;  1W5Z A;  2CWU A;  3NUV A;  1GS3 A;  1UUW B;  1NO3 A;  2RFR A;  3BNE A;  3G16 A;  3LZA A;  1NDO B;  4K1U A;  4XDV A;  2IUK A;  3FSD A;  1DVC A;  3MHE A;  1NWW A;  1WMP A;  3FKA A;  1O7G B;  5EEO A;  3DMC A;  4AKY A;  3NQZ A;  1W02 A;  1AV4 A;  1W6Y A;  3MG2 A;  1IV9 A;  1SPU A;  3OWS A;  3FZW A;  2OQE C;  3PZW A;  3LXU X;  1YGE A;  4N3V A;  3GZB A;  2JQ5 A;  3EC9 A;  2E2T A;  5DRV A;  1QAF A;  4HYZ A;  1VQM 3;  4R80 A;  1UI7 A;  8CHO A;  3ALA A;  4HZ9 B;  1W2Z A;  1CYU A;  1CYV A;  2CWV A;  1TIJ A;  4FCZ A;  5IG4 A;  4GL6 A;  2HML B;  2OTJ 3;  1YHQ 3;  2HMK B;  2OQE A;  3N8B A;  3DUK A;  5JBS A;  3K7C A;  5BVB A;  1NB5 I;  3SLU A;  2WOF A;  4MMZ B;  3WOE B;  3OX9 A;  4FR9 A;  3WOF B;  3U97 A;  1W2B 2;  3FCS B;  4LEH A;  1STF I;  2KCD A;  4HM4 B;  5LC6 A;  2BMR B;  2HMO B;  4XBX A;  2XRX B;  3M8C A;  1ULI B;  1J2B A;  3IMA B;  3X3Y A;  1DMQ A;  1U5O A;  3F14 A;  2BT3 A;  2LQV A;  3OXA A;  3NM7 A;  3DZL A;  4LZI A;  3D3L A;  2GXF A;  4OK0 A;  5CLK A;  3H3H A;  2XSH B;  4MMX B;  3CCM 3;  3V98 A;  3NBB A;  4U13 A;  1SQW A;  1VZZ A;  1R4C A;  3KSE D;  4R9K A;  1L5G B;  4R9L A;  3V92 A;  1QAK A;  4FCM A;  4RNY A;  3B8L A;  3Q90 A;  2W0Q A;  1M9G A;  4TX4 A;  3MSO A;  1N9E A;  3EBY A;  3X40 A;  4WP5 A;  2XEP A;  1GY5 A;  1UUV B;  5D83 A;  1BUQ A;  3JUQ A;  1IV7 A;  2OOV C;  3NX0 A;  2F98 A;  4HM7 B;  3K63 A;  3L0R A;  4HM6 B;  1KSI A;  4JRF A;  1YJW 3;  3F8H A;  3S5C A;  3LTB A;  1HU9 A;  1Q42 A;  5FW5 A;  1Q40 A;  2IA7 A;  4IT7 A;  1MNL A;  2BMQ B;  5ELU A;  3UL6 A;  3FLJ A;  3STD A;  2OOV A;  2YFJ B;  3CXC 2;  3CME 3;  4K1V A;  1VQK 3;  4HM1 B;  5AEW B;  1EKM A;  5IG3 A;  1RN7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...