1N5PA

Solution structure of the cathelin-like domain of protegrins (all amide bonds involving proline residues are in trans conformation)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
105
structure length
105
Chain Sequence
GSHMQALSYREAVLRAVDRLNEQSSEANLYRLLELDQPPKADEDPGTPKPVSFTVKETVCPRPTRQPPELCDFKENGRVKQCVGTVTLDQIKDPLDITCNEVQGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protegrins
publication title NMR Structure of the Cathelin-like domain of the protegrin-3 Precursor
pubmed doi rcsb
source organism Sus scrofa
molecule tags Antibiotic
total genus 18
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2002-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00666 Cathelicidins Cathelicidin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1n5pA00
3PS8A 1IV7A 1ROAA 4IT7A 2KXGA 4TX4A 1CEWI 1DVCA 4N6MA 1MOLA 3PYJA 3UL6A 1N5PA 4N6TA 3S67A 1MNLA 1FA3A 3QRDA 3UL5A 1NB3I 4EYCA 4LZIA 5LC7A 5LC6A 1N9JA 1FUWA 4N6LA 4N6V0 1A90A 5A0OB 2W9PA 1WNHA 5ELUA 3SVAA 1CYUA 3KSED 5ELJA 1GD3A 3LH4A 4N6UA 3GAXA 3IMAB 1PFPA 1M9GA 1RN7A 1A67A 1CYVA 2W9QA 4ZM8A 1STFI 1N5HA 3MWZA 1YVBI 1DVDA 1IV9A 2BO9B 4N6OB 3KFQC 1KWIA 3K9MC 1GD4A 2OCTA 1EQKA 2CH9A 3PXMA 4N6NB 5EQLA 3L0RA 1TIJA 4CCVA 1G96A 1R4CA 3Q2PA 3NX0A 1NB5I 2O9UX 1LXEA
chains in the Genus database with same CATH superfamily
1JN5B 3PS8A 2GBWB 2UX0A 4NPBA 1O7MB 5I97A 2CFKA 2CWVA 3CU3A 1Q42A 4GB5A 1V74A 3DMCA 1JKGA 4U13A 3ECFA 1GY6A 1CEWI 1Q9EA 5D81A 1W00A 2E2UA 3K0ZA 3B4OA 1DVCA 1DMNA 2F86B 2KF4A 4N6MA 1RRHA 3ROBA 5HGRA 2ML5A 3DGNA 1O7PB 5IEPA 2QA43 4WP5A 3KN4A 3K5TA 3NV0B 4CDLA 2YX9A 1CQSA 4LMIA 4FMCA 2L4VA 1W2B2 1ZGXA 1RJOA 2OWPA 3LMLA 1TRQA 2RFRA 4ILFA 2OTL3 5GSPA 3G8ZA 2IY2A 4BU4A 1SPUA 5IF6A 1M1K4 4GSPA 2CWUA 4N6TA 1EEJA 4R9KA 3I563 2KCDA 2HMMB 1UUWB 1BRIA 3T8UA 1ULJB 1MNLA 5KP4A 3LZAA 4MMZB 4XBYA 3QRDA 1TP6A 3N54B 3VF1A 1QJGA 4WYKB 1Q824 1X1UA 1EA2A 1AVLA 1RMSA 2HMJB 4LZIA 1VQK3 5LC7A 4HM6B 1RHLA 1IVVA 2Z7AA 4HM3B 2XSHB 4O02B 3U1WA 2KF5A 1R4YA 5LC6A 1GMQA 3EX9A 2QIYA 1K28A 3DGOA 1VQ63 4N6LA 1X1YA 3NHXA 3CD63 5G2GA 4HJLB 5IEOA 3DH2A 1RGKA 3WMDA 3NM2A 3MG3A 2OOVC 1U5OA 2W9PA 3LOYA 1UGIA 4NREA 2XGLA 3B7CA 3RGRA 2C10A 5AEUB 5FGOA 1X1WA 1IVXA 1I3IA 5CLKA 3F14A 3F40A 4FMBA 5ELJA 3CPOA 1JKGB 4RNZA 2UGIA 2CFWA 1LOVA 1WMOA 3IMAB 2RNTA 3UJMA 1N9EA 1RGEA 1L5GB 1MWTA 1OUNA 2W56A 4HM0B 4J8TA 1CYVA 1HYFA 2FXTA 4ZM8A 1WTHA 3F9SA 1STFI 3PCRA 4STDA 3CME3 1IV9A 1IU7A 4XM4A 2BO9B 2XRXB 2H0HA 3EHCA 5CF2A 2HMKB 5AIIA 3I0YA 1Z1SA 2KF6A 3KFQC 2QGUA 1K41A 1EQKA 1YGEA 3JVCA 1BRHA 1QMAA 1I3FA 2WO0A 3OWSA 1GOUA 2CH9A 3AGOA 1LOYA 3GSPA 4GHOA 1RN1A 3S28A 3FG1A 1Y4KA 1PU4A 2IYJA 3L0RA 3D9RA 2JQ5A 3LXUX 3BIRA 3ALAA 1OGZA 3K7CA 1RGLA 2K0MA 3KE7A 1JJ22 2W2CA 4FCMA 3CCL3 4H61A 1JB2A 3G0KA 3GZYB 2ZDJA 4PEJA 1HKXA 3JUPA 3LYGA 4L8OA 2AAEA 1JB4A 1NB5I 2LQVA 3HIGA 5RNTA 1S5AA 1SIHA 1YIT3 5M19A 1LXEA 1NDOB 2WGQA 2OQEA 4RBNA 4BTYA 4OUQA 4FCZA 3DGLA 4FMAA 1SJWA 2F99A 4IPBA 4EBGA 3KZTA 1W6YA 3FGYA 1YJ93 1YHQ3 2IMJA 2YFIB 1ROAA 4TX4A 2C4BA 4BL3A 3LTCA 1N8R4 2D1WA 3URPA 2XFSA 3RNTA 2BIRA 1BRJA 1F8NA 2D42A 1BUQA 2R41A 2BU4A 3HOHA 4MMXB 5STDA 1GMPA 8RNTA 2W56B 3EQQB 3SOAA 9RNTA 1GYBA 3Q90A 3SYUA 1ZS7A 5BIRA 1Q40A 1DE3A 1UCIA 2CG1A 1LOXA 4JF8A 2ZHXB 2OTJ3 1GMRA 3WOEB 1FZUA 1AVKA 1C7HA 1VQQA 1N5PA 4JRFA 1KQS2 5IG4A 4K1UA 1G0TA 5AEWB 4BL2A 2WOHA 1MWUA 2Y74A 3VSYA 1DETA 3BNBA 4HM5B 1OACA 3SEDA 3UL5A 5IG3A 1D6YA 1KSIA 4EYCA 1JZDA 4R9LA 1UCKA 3A76A 2MF7A 2E2TA 2XR8B 1EKMA 5JPPA 1B3SA 1BNJA 3MPHA 3G4S3 3B8LA 1RGCA 1A90A 1JBRA 3WDGB 5D83A 1RSNA 1YIJ3 1WMPA 3GZRA 3DGYA 4X2HA 1E3VA 2GSPA 1KD14 1VQ93 5FW5A 4RNYA 1WNHA 3D5GA 2XEPA 3IJEB 3NQYA 2H0IA 2CFGA 1K9M4 1VQO3 2K3DA 3WOFB 1BNRA 2KRTA 1A2PA 3X40A 3T0UA 3JUNA 1CH0A 5IENA 1BNIA 2Z77A 3NBBA 2BMQB 3BNCA 6GSPA 2UUGC 2FNQA 1FGMA 3M8CA 3HK4A 4HYZA 2YFJB 3WA2X 3CCV3 1JBTA 1ASKA 1RN7A 1UDII 2SBLA 3CNMA 4LYLB 5G1LA 1RKYA 1NJI4 1OHSA 4BIRA 5BU4A 5AIHA 3HX8A 1BRSA 2CG0A 1Q40B 4HVNA 1N5HA 1BSAA 3BB9A 1FUSA 1BRNL 1DVDA 3CCQ3 2BNGA 3EN8A 2GBXB 4R80A 2GEXA 4XDVA 2STDA 1LQGC 1BSCA 1GY5A 3AMOA 1IVWA 3FSDA 1I2EA 2OCTA 3WHOA 1RTUA 4OVMA 7GSPA 4MMYB 1BAOA 1VQ83 4N6NB 5EQLA 2HMOB 5G1KA 1FGTA 5CXOA 2H0GA 4MEIA 2M7OA 1I0VA 3EN1B 3DUKA 1MWRA 3PZWA 1OCVA 3D3LA 1LQMB 1IVUA 1AV4A 1JBSA 5DREA 5AIFA 1W02A 1HU9A 1VQ73 4EW5A 3F8HA 1Q7Y4 3V98A 1IYYA 4J9AA 1GOYA 1DMMA 4XB5A 4LEHA 2OQEC 4XDWA 2FGTA 1J2BA 2HMLB 4HBRA 5KP3A 3ZFZA 1KC84 3NBJA 1I2FA 1LVNA 2F56A 4WFOA 2MC8A 3DGMA 1ZX2A 2W03A 2P38A 2BHMA 1K734 3J7Yd 1YVSA 2XF3A 2Y73A 4IIAA 3KCHA 3Q3FA 4HKVB 1O7WB 1VQP3 1IV7A 1OPYA 1ZO2A 3OW22 1AY7A 2P05A 4IT7A 3HZPA 4HM7B 1RN4A 1O7NB 1TFOA 1VQ43 1O7HB 3EB8A 1MOLA 1M904 2CX0A 3PYJA 3UB1A 4R4KA 2IUJA 1RGGA 2Q07A 3CMA3 3NM7A 1FGQA 1JRQA 4WHAA 2W6JH 3A5EA 2P0MA 3GRDA 1NNVA 1NU3A 3E99A 3QK9A 5JBSA 3AMOB 4J5KA 1JB5A 1YI23 1Q7HA 2CK3H 3G16A 1RCLA 3OWUA 1AR0A 1BGSA 1JN5A 1FYSA 3BU4A 3PGBA 3S67A 2RBIA 2F4YA 1I8VA 1FA3A 2XFTA 1SQWA 2F5WA 1NB3I 1RNBA 1TRPA 1BIRA 2W0QA 1DMQA 3X42A 1ULIB 1MWSA 4FMDA 2CWTA 5IERA 2B1XB 1TFKA 1QALA 2Z6BA 4K1VA 1YJW3 2C11A 1BSEA 1N9JA 2A15A 4XBTA 3OWYA 3GWRA 3I553 4N6V0 2WOFA 4FCJA 2K54A 5M18A 1IQYA 5A0OB 1B21A 1NO3A 1BRKA 1E3RA 1UCLA 2O3OA 1YNVX 1B2ZA 3BNEA 3FG4A 3AGNA 3RDEA 3SLUA 4CPKA 4HAAA 3JUQA 5KP1A 4K90B 5AYRB 3SVAA 1QVG2 4KFDA 1EUIC 2Z76A 3HI7A 1W7CA 1WMNA 4L7KA 4CJNA 1PY3A 1W5ZA 1U8CB 1I2GA 1UCJA 3LH4A 2I9WA 1HZ1A 3IPTA 2F5MA 2XSOB 2P0XA 4N6UA 1TJDA 1US1A 1N8QA 1PFPA 1S723 2CC3A 3F8XA 1TU5A 1RNTA 1VQ53 1M1XB 2XH9A 1I70A 2W9QA 4WWUC 3MHEA 1YJN3 2B24B 3MWZA 1GOVA 3ZG5A 1UUGB 3G713 3D4AA 5M1AA 2E2VA 4H3UA 1QAKA 2SARA 3Q1CA 1QAFA 3EBTA 3EJVA 3MKIA 4O8SA 2CHCA 1KWIA 1OH0A 1VZZA 3K9MC 4KVHA 1GD4A 2RCDA 7STDA 3WA3A 1JZOA 2CFDA 3GZXB 2JDIH 2J8XB 3JUMA 3AHWA 3PXMA 4LSOA 2R4IA 2RGQA 3FF2A 1QVF2 4AKYA 1TIJA 3NBRA 4NHFA 1RDSA 1T3BA 4QWTA 5IG0A 3FF0A 3OXAA 1G02A 2GEYA 1DYUA 1LOWA 1T5YA 3LTDA 3H3HA 3DY5A 1G96A 1RCKA 3BNDA 3Q2PA 4HM8B 3V99A 1RLSA 3DM8A 6RNTA 3FLJA 5CF1A 4FR9A 3PCSA 3KIIA 3D5IA 2KF3A 1FGOA 2CKFB 1OHPA 3ZG0A 3FZWA 3OX9A 5TGNA 2PNCA 1B2UA 1TTOA 1RGFA 3NQZA 1W6GA 1W2ZA 3CCR3 1BVIA 1OHOA 3SOYA 1X1XA 1BU4A 1A2KA 4I4KA 2BT3A 4BTXA 1GS3A 1B2XA 1LNHA 1UW1A 5DRVA 4HM2B 1VQL3 1VQM3 2IA7A 3G6E3 1UUVB 4HM1B 1BNEA 1T2IA 2AADA 2KXGA 3K63A 1D6UA 4L8PA 3FCSB 3UNLA 1Q864 1IK3A 3F7XA 3TDGA 1B2SA 1BNFA 3X3ZA 3EE1A 3KKGA 4Q53A 1LNIA 2BMOB 3EF8A 3FG3A 1MGRA 1A2VA 2V1LA 2ZA4A 5EVHA 3X3XA 2ZL8A 4ORLA 3ER7A 3CC43 3CCS3 3DXOA 1IT7A 1ROVA 4HZ9B 3UL6A 1BNGA 2ML6A 3EC9A 3OV4A 1JNQA 1JV2B 1BANA 2RSXA 3WR2A 4K61A 4GL6A 5BXQA 3LTBA 3F7SA 3MSOA 4O3VA 3VGNA 1RRLA 4J5GA 1PYLA 2BMRB 2CFLA 1I0XA 4LGQA 1B2MA 1C54A 3CCU3 3KSPA 3O8YA 3RGAA 3T8NA 4EXRA 2HOHA 3LT8A 1OF5A 1FGRA 3DZLA 5AYSC 4RNTA 3CCM3 1BUJA 2GU1A 3JUOA 2IUKA 3X41A 3NUVA 1Q814 1FUWA 5IW9A 1ISKA 3GZBA 7RNTA 1IQXA 3LTAA 1BNSA 4AKZA 3SXXA 1UI8A 1IT8A 1GSPA 2OOVA 3S29A 1V58A 1D6ZA 5ELUA 1CYUA 1W01A 3KSED 4G1MB 3FKAA 4KFFA 2GXFA 3FH1A 1K8A4 1BSDA 4HM4B 1GD3A 2P09A 1BOXA 3N8BA 3N9HA 3NXJA 3HIIA 3AHSA 3GAXA 1STDA 1E97A 1AQZA 2L1SA 2LYXA 2W04A 4DKIA 4EV2A 1FW7A 3MYTA 1M9GA 6STDA 3S27A 3CCJ3 1A67A 1IDPA 2KAAA 3NV0A 3WODG 1EG9B 5CK6A 2WGOA 1FUTA 1OGXA 1WQLB 1YVBI 4N3VA 3X3YA 4EC6A 1B20A 1BSBA 3S5CA 3B4PA 4AEQA 4HOHA 5HOHA 5EEOA 2QEX3 1UI7A 4N6OB 4R1KA 8CHOA 1V57A 1RGAA 3CC73 5BVBA 5D82A 4KT3B 1W4NA 5AI1A 3CPW2 5IG5A 3LT9A 1NWWA 2XGNA 3CXC2 1SIIA 1B27A 4RZMA 4WYKA 4KZ1A 5JPUA 3SX1A 2INXA 4XBXA 1SARA 4CCVA 3V92A 4OK0A 1OF5B 5AIGA 4O2HA 1IQ8A 1YGWA 1R4CA 2HMNB 4HZBB 3BLZA 3H51A 1RGHA 2CIUA 2CX1A 2GU3A 3U97A 1MGWA 1W6CA 4MJDA 1GY7A 3NX0A 3MG1A 4I5QA 2F98A 2PZVA 4BTWA 1O7GB 2O9UX 3D79A 3EBYA 2YFLB 3CNXA 4X2OA 1BRGA 3CCE3 4KFEA 1VQN3 1UGHI 1T2HA 3MG2A 1TUHA 3STDA 2CW9A 3CC23 4EV5A 1LRAA
chains in the Genus database with same CATH topology
1JN5B 3PS8A 2GBWB 2UX0A 5I97A 1O7MB 2CFKA 2CWVA 3CU3A 1Q42A 4GB5A 1V74A 3DMCA 1JKGA 4U13A 3ECFA 1GY6A 1CEWI 5D81A 1W00A 2E2UA 3K0ZA 3B4OA 1DVCA 1DMNA 2F86B 4N6MA 1RRHA 3ROBA 5HGRA 2ML5A 3DGNA 1O7PB 5IEPA 2QA43 4WP5A 3KN4A 3K5TA 3NV0B 4CDLA 2YX9A 1CQSA 4LMIA 4FMCA 2L4VA 1W2B2 3LMLA 1RJOA 2OWPA 2RFRA 2OTL3 3G8ZA 1SPUA 5IF6A 1M1K4 2CWUA 4N6TA 4R9KA 3I563 2KCDA 2HMMB 1UUWB 3T8UA 1ULJB 1MNLA 5KP4A 3LZAA 4MMZB 4XBYA 3QRDA 1TP6A 3N54B 3VF1A 1QJGA 4WYKB 1Q824 1EA2A 1AVLA 2HMJB 4LZIA 1VQK3 5LC7A 4HM6B 2Z7AA 1IVVA 4HM3B 3U1WA 2XSHB 4O02B 5LC6A 3EX9A 2QIYA 1K28A 3DGOA 1VQ63 4N6LA 3CD63 3NHXA 5G2GA 4HJLB 5IEOA 3WMDA 3NM2A 3MG3A 2OOVC 1U5OA 2W9PA 3LOYA 4NREA 2XGLA 3B7CA 3RGRA 2C10A 5AEUB 5FGOA 1IVXA 5CLKA 3F14A 3F40A 4FMBA 5ELJA 3CPOA 1JKGB 4RNZA 2CFWA 3IMAB 1WMOA 3UJMA 1N9EA 1L5GB 1OUNA 2W56A 4HM0B 4J8TA 1CYVA 2FXTA 4ZM8A 1WTHA 3F9SA 1STFI 3PCRA 4STDA 3CME3 1IV9A 1IU7A 4XM4A 2BO9B 2XRXB 3EHCA 5CF2A 2HMKB 5AIIA 3I0YA 1Z1SA 3KFQC 2QGUA 1K41A 1EQKA 1YGEA 3JVCA 1QMAA 3OWSA 2WO0A 2CH9A 3S28A 1PU4A 3FG1A 1Y4KA 3L0RA 3D9RA 2JQ5A 3LXUX 3ALAA 1OGZA 3K7CA 2K0MA 3KE7A 1JJ22 2W2CA 4FCMA 3CCL3 4H61A 1JB2A 3G0KA 3GZYB 2ZDJA 4PEJA 1HKXA 3JUPA 3LYGA 4L8OA 1JB4A 1NB5I 2LQVA 3HIGA 1YIT3 1S5AA 1SIHA 1LXEA 1NDOB 2WGQA 2OQEA 4RBNA 4BTYA 4OUQA 4FCZA 3DGLA 4FMAA 1SJWA 2F99A 4IPBA 4EBGA 3KZTA 1W6YA 3FGYA 1YJ93 1YHQ3 2IMJA 2YFIB 1ROAA 4TX4A 1N8R4 3LTCA 2D1WA 2XFSA 1F8NA 2D42A 1BUQA 5STDA 4MMXB 2W56B 3EQQB 3SOAA 1GYBA 3Q90A 1Q40A 2CG1A 1LOXA 4JF8A 2OTJ3 3WOEB 1AVKA 1C7HA 1N5PA 4JRFA 1KQS2 5IG4A 4K1UA 5AEWB 2WOHA 3VSYA 2Y74A 4HM5B 3BNBA 3UL5A 1OACA 3SEDA 5IG3A 1D6YA 1KSIA 4EYCA 4R9LA 3A76A 2MF7A 2E2TA 2XR8B 1EKMA 5JPPA 3MPHA 3G4S3 3B8LA 1A90A 3WDGB 5D83A 1YIJ3 1WMPA 3GZRA 4X2HA 1E3VA 1KD14 1VQ93 5FW5A 4RNYA 1WNHA 3NQYA 2XEPA 3IJEB 2CFGA 1K9M4 1VQO3 2KRTA 3X40A 3T0UA 3JUNA 5IENA 3NBBA 2Z77A 2BMQB 3BNCA 2FNQA 1FGMA 3M8CA 3HK4A 4HYZA 2YFJB 3WA2X 3CCV3 1ASKA 1RN7A 2SBLA 3CNMA 1NJI4 1RKYA 1OHSA 5AIHA 3HX8A 2CG0A 4HVNA 1Q40B 1N5HA 3BB9A 1DVDA 3CCQ3 2BNGA 3EN8A 2GBXB 4R80A 2GEXA 4XDVA 2STDA 1GY5A 3AMOA 1IVWA 3FSDA 2OCTA 4OVMA 4MMYB 1VQ83 4N6NB 5EQLA 2HMOB 1FGTA 5CXOA 4MEIA 2M7OA 3EN1B 3DUKA 3PZWA 1OCVA 3D3LA 1IVUA 1AV4A 5DREA 5AIFA 1W02A 1HU9A 1VQ73 3F8HA 1Q7Y4 3V98A 4J9AA 1DMMA 4XB5A 4LEHA 2OQEC 4XDWA 2FGTA 1J2BA 2HMLB 4HBRA 5KP3A 1KC84 3NBJA 1LVNA 4WFOA 2MC8A 3DGMA 1ZX2A 2W03A 2P38A 2BHMA 1K734 3J7Yd 2XF3A 2Y73A 4IIAA 4HKVB 1O7WB 1VQP3 1IV7A 1OPYA 1ZO2A 3OW22 2P05A 4IT7A 3HZPA 4HM7B 1O7NB 1TFOA 1VQ43 1O7HB 3EB8A 1MOLA 1M904 3PYJA 3UB1A 4R4KA 2IUJA 2Q07A 3CMA3 3NM7A 1FGQA 1JRQA 4WHAA 2W6JH 2P0MA 3GRDA 1NU3A 3E99A 3QK9A 5JBSA 3AMOB 1YI23 1JB5A 3G16A 2CK3H 3OWUA 1AR0A 1JN5A 3PGBA 3S67A 1FA3A 2XFTA 1SQWA 1NB3I 2W0QA 1DMQA 3X42A 1ULIB 4FMDA 2CWTA 5IERA 2B1XB 1TFKA 1QALA 2Z6BA 4K1VA 1YJW3 2C11A 1N9JA 2A15A 4XBTA 3OWYA 3GWRA 3I553 4N6V0 2WOFA 4FCJA 2K54A 1IQYA 5A0OB 1NO3A 1E3RA 2O3OA 3RDEA 3BNEA 3FG4A 3SLUA 3JUQA 5KP1A 4K90B 5AYRB 3SVAA 1QVG2 4KFDA 4L7KA 2Z76A 3HI7A 1W7CA 1WMNA 1W5ZA 1U8CB 3LH4A 2I9WA 3IPTA 2XSOB 2P0XA 4N6UA 1US1A 1N8QA 1PFPA 1S723 2CC3A 3F8XA 1TU5A 1VQ53 1M1XB 2XH9A 2W9QA 4WWUC 3MHEA 1YJN3 2B24B 3MWZA 3G713 2E2VA 4H3UA 1QAKA 3Q1CA 1QAFA 3EBTA 3EJVA 3MKIA 4O8SA 2CHCA 1KWIA 1OH0A 1VZZA 3K9MC 4KVHA 1GD4A 2RCDA 7STDA 3WA3A 2CFDA 3GZXB 2JDIH 3JUMA 3PXMA 4LSOA 2R4IA 2RGQA 3FF2A 1QVF2 4AKYA 1TIJA 3NBRA 4NHFA 3WOFB 4QWTA 5IG0A 3FF0A 3OXAA 2GEYA 1DYUA 1T5YA 3LTDA 3H3HA 3DY5A 1G96A 3BNDA 3Q2PA 4HM8B 3V99A 3DM8A 3FLJA 5CF1A 4FR9A 3PCSA 3KIIA 1FGOA 2CKFB 1OHPA 3FZWA 3OX9A 5TGNA 2PNCA 3NQZA 1W6GA 1W2ZA 3CCR3 1OHOA 3SOYA 1A2KA 4I4KA 2BT3A 4BTXA 1GS3A 1LNHA 1UW1A 5DRVA 4HM2B 1VQL3 1VQM3 2IA7A 3G6E3 1UUVB 4HM1B 2KXGA 3K63A 1D6UA 4L8PA 3FCSB 3UNLA 1Q864 1IK3A 3F7XA 3TDGA 3X3ZA 3EE1A 3KKGA 4Q53A 2BMOB 3EF8A 3FG3A 2V1LA 1A2VA 5EVHA 3X3XA 2ZL8A 4ORLA 3ER7A 3CC43 3CCS3 3DXOA 1IT7A 1ROVA 4HZ9B 3UL6A 2ML6A 3EC9A 3OV4A 1JNQA 1JV2B 2RSXA 4K61A 4GL6A 5BXQA 3LTBA 3F7SA 3MSOA 4O3VA 3VGNA 1RRLA 2BMRB 2CFLA 4LGQA 3CCU3 3KSPA 3O8YA 3RGAA 3T8NA 4EXRA 3CCM3 3LT8A 1OF5A 1FGRA 3DZLA 5AYSC 2GU1A 3JUOA 2IUKA 3X41A 3NUVA 1Q814 1FUWA 5IW9A 1ISKA 3GZBA 1IQXA 3LTAA 4AKZA 3SXXA 1UI8A 1IT8A 2OOVA 3S29A 1D6ZA 5ELUA 1CYUA 1W01A 3KSED 4G1MB 3FKAA 4KFFA 2GXFA 3FH1A 1K8A4 4HM4B 1GD3A 2P09A 3N8BA 3N9HA 3NXJA 3HIIA 3GAXA 1STDA 1E97A 2LYXA 4EV2A 2W04A 3MYTA 1M9GA 6STDA 3S27A 3CCJ3 1A67A 1IDPA 3NV0A 3WODG 1EG9B 5CK6A 2WGOA 1OGXA 1WQLB 1YVBI 4N3VA 3X3YA 4EC6A 3S5CA 3B4PA 4AEQA 5EEOA 2QEX3 1UI7A 4N6OB 4R1KA 8CHOA 3CC73 5BVBA 5D82A 1W4NA 5AI1A 3CPW2 5IG5A 3LT9A 1NWWA 2XGNA 3CXC2 1SIIA 4RZMA 4WYKA 4KZ1A 5JPUA 3SX1A 2INXA 4XBXA 4CCVA 3V92A 4OK0A 1OF5B 5AIGA 4O2HA 1IQ8A 2HMNB 1R4CA 4HZBB 3BLZA 3H51A 2CIUA 2GU3A 3U97A 1W6CA 4MJDA 1GY7A 3NX0A 3MG1A 4BTWA 2F98A 2PZVA 1O7GB 2O9UX 3EBYA 2YFLB 3CNXA 4X2OA 3CCE3 4KFEA 1VQN3 3MG2A 1TUHA 3STDA 2CW9A 3CC23 4EV5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PS8 A;  1IV7 A;  1ROA A;  4IT7 A;  2KXG A;  4TX4 A;  1CEW I;  1DVC A;  4N6M A;  1MOL A;  3PYJ A;  3UL6 A;  1N5P A;  4N6T A;  3S67 A;  1MNL A;  1FA3 A;  3QRD A;  3UL5 A;  1NB3 I;  4EYC A;  4LZI A;  5LC7 A;  5LC6 A;  1N9J A;  1FUW A;  4N6L A;  4N6V 0;  1A90 A;  5A0O B;  2W9P A;  1WNH A;  5ELU A;  3SVA A;  1CYU A;  3KSE D;  5ELJ A;  1GD3 A;  3LH4 A;  4N6U A;  3GAX A;  3IMA B;  1PFP A;  1M9G A;  1RN7 A;  1A67 A;  1CYV A;  2W9Q A;  4ZM8 A;  1STF I;  1N5H A;  3MWZ A;  1YVB I;  1DVD A;  1IV9 A;  2BO9 B;  4N6O B;  3KFQ C;  1KWI A;  3K9M C;  1GD4 A;  2OCT A;  1EQK A;  2CH9 A;  3PXM A;  4N6N B;  5EQL A;  3L0R A;  1TIJ A;  4CCV A;  1G96 A;  1R4C A;  3Q2P A;  3NX0 A;  1NB5 I;  2O9U X;  1LXE A; 
#chains in the Genus database with same CATH topology
 1JN5 B;  3PS8 A;  2GBW B;  2UX0 A;  4NPB A;  1O7M B;  5I97 A;  2CFK A;  2CWV A;  3CU3 A;  1Q42 A;  4GB5 A;  1V74 A;  3DMC A;  1JKG A;  4U13 A;  3ECF A;  1GY6 A;  1CEW I;  1Q9E A;  5D81 A;  1W00 A;  2E2U A;  3K0Z A;  3B4O A;  1DVC A;  1DMN A;  2F86 B;  2KF4 A;  4N6M A;  1RRH A;  3ROB A;  5HGR A;  2ML5 A;  3DGN A;  1O7P B;  5IEP A;  2QA4 3;  4WP5 A;  3KN4 A;  3K5T A;  3NV0 B;  4CDL A;  2YX9 A;  1CQS A;  4LMI A;  4FMC A;  2L4V A;  1W2B 2;  1ZGX A;  1RJO A;  2OWP A;  3LML A;  1TRQ A;  2RFR A;  4ILF A;  2OTL 3;  5GSP A;  3G8Z A;  2IY2 A;  4BU4 A;  1SPU A;  5IF6 A;  1M1K 4;  4GSP A;  2CWU A;  4N6T A;  1EEJ A;  4R9K A;  3I56 3;  2KCD A;  2HMM B;  1UUW B;  1BRI A;  3T8U A;  1ULJ B;  1MNL A;  5KP4 A;  3LZA A;  4MMZ B;  4XBY A;  3QRD A;  1TP6 A;  3N54 B;  3VF1 A;  1QJG A;  4WYK B;  1Q82 4;  1X1U A;  1EA2 A;  1AVL A;  1RMS A;  2HMJ B;  4LZI A;  1VQK 3;  5LC7 A;  4HM6 B;  1RHL A;  1IVV A;  2Z7A A;  4HM3 B;  2XSH B;  4O02 B;  3U1W A;  2KF5 A;  1R4Y A;  5LC6 A;  1GMQ A;  3EX9 A;  2QIY A;  1K28 A;  3DGO A;  1VQ6 3;  4N6L A;  1X1Y A;  3NHX A;  3CD6 3;  5G2G A;  4HJL B;  5IEO A;  3DH2 A;  1RGK A;  3WMD A;  3NM2 A;  3MG3 A;  2OOV C;  1U5O A;  2W9P A;  3LOY A;  1UGI A;  4NRE A;  2XGL A;  3B7C A;  3RGR A;  2C10 A;  5AEU B;  5FGO A;  1X1W A;  1IVX A;  1I3I A;  5CLK A;  3F14 A;  3F40 A;  4FMB A;  5ELJ A;  3CPO A;  1JKG B;  4RNZ A;  2UGI A;  2CFW A;  1LOV A;  1WMO A;  3IMA B;  2RNT A;  3UJM A;  1N9E A;  1RGE A;  1L5G B;  1MWT A;  1OUN A;  2W56 A;  4HM0 B;  4J8T A;  1CYV A;  1HYF A;  2FXT A;  4ZM8 A;  1WTH A;  3F9S A;  1STF I;  3PCR A;  4STD A;  3CME 3;  1IV9 A;  1IU7 A;  4XM4 A;  2BO9 B;  2XRX B;  2H0H A;  3EHC A;  5CF2 A;  2HMK B;  5AII A;  3I0Y A;  1Z1S A;  2KF6 A;  3KFQ C;  2QGU A;  1K41 A;  1EQK A;  1YGE A;  3JVC A;  1BRH A;  1QMA A;  1I3F A;  2WO0 A;  3OWS A;  1GOU A;  2CH9 A;  3AGO A;  1LOY A;  3GSP A;  4GHO A;  1RN1 A;  3S28 A;  3FG1 A;  1Y4K A;  1PU4 A;  2IYJ A;  3L0R A;  3D9R A;  2JQ5 A;  3LXU X;  3BIR A;  3ALA A;  1OGZ A;  3K7C A;  1RGL A;  2K0M A;  3KE7 A;  1JJ2 2;  2W2C A;  4FCM A;  3CCL 3;  4H61 A;  1JB2 A;  3G0K A;  3GZY B;  2ZDJ A;  4PEJ A;  1HKX A;  3JUP A;  3LYG A;  4L8O A;  2AAE A;  1JB4 A;  1NB5 I;  2LQV A;  3HIG A;  5RNT A;  1S5A A;  1SIH A;  1YIT 3;  5M19 A;  1LXE A;  1NDO B;  2WGQ A;  2OQE A;  4RBN A;  4BTY A;  4OUQ A;  4FCZ A;  3DGL A;  4FMA A;  1SJW A;  2F99 A;  4IPB A;  4EBG A;  3KZT A;  1W6Y A;  3FGY A;  1YJ9 3;  1YHQ 3;  2IMJ A;  2YFI B;  1ROA A;  4TX4 A;  2C4B A;  4BL3 A;  3LTC A;  1N8R 4;  2D1W A;  3URP A;  2XFS A;  3RNT A;  2BIR A;  1BRJ A;  1F8N A;  2D42 A;  1BUQ A;  2R41 A;  2BU4 A;  3HOH A;  4MMX B;  5STD A;  1GMP A;  8RNT A;  2W56 B;  3EQQ B;  3SOA A;  9RNT A;  1GYB A;  3Q90 A;  3SYU A;  1ZS7 A;  5BIR A;  1Q40 A;  1DE3 A;  1UCI A;  2CG1 A;  1LOX A;  4JF8 A;  2ZHX B;  2OTJ 3;  1GMR A;  3WOE B;  1FZU A;  1AVK A;  1C7H A;  1VQQ A;  1N5P A;  4JRF A;  1KQS 2;  5IG4 A;  4K1U A;  1G0T A;  5AEW B;  4BL2 A;  2WOH A;  1MWU A;  2Y74 A;  3VSY A;  1DET A;  3BNB A;  4HM5 B;  1OAC A;  3SED A;  3UL5 A;  5IG3 A;  1D6Y A;  1KSI A;  4EYC A;  1JZD A;  4R9L A;  1UCK A;  3A76 A;  2MF7 A;  2E2T A;  2XR8 B;  1EKM A;  5JPP A;  1B3S A;  1BNJ A;  3MPH A;  3G4S 3;  3B8L A;  1RGC A;  1A90 A;  1JBR A;  3WDG B;  5D83 A;  1RSN A;  1YIJ 3;  1WMP A;  3GZR A;  3DGY A;  4X2H A;  1E3V A;  2GSP A;  1KD1 4;  1VQ9 3;  5FW5 A;  4RNY A;  1WNH A;  3D5G A;  2XEP A;  3IJE B;  3NQY A;  2H0I A;  2CFG A;  1K9M 4;  1VQO 3;  2K3D A;  3WOF B;  1BNR A;  2KRT A;  1A2P A;  3X40 A;  3T0U A;  3JUN A;  1CH0 A;  5IEN A;  1BNI A;  2Z77 A;  3NBB A;  2BMQ B;  3BNC A;  6GSP A;  2UUG C;  2FNQ A;  1FGM A;  3M8C A;  3HK4 A;  4HYZ A;  2YFJ B;  3WA2 X;  3CCV 3;  1JBT A;  1ASK A;  1RN7 A;  1UDI I;  2SBL A;  3CNM A;  4LYL B;  5G1L A;  1RKY A;  1NJI 4;  1OHS A;  4BIR A;  5BU4 A;  5AIH A;  3HX8 A;  1BRS A;  2CG0 A;  1Q40 B;  4HVN A;  1N5H A;  1BSA A;  3BB9 A;  1FUS A;  1BRN L;  1DVD A;  3CCQ 3;  2BNG A;  3EN8 A;  2GBX B;  4R80 A;  2GEX A;  4XDV A;  2STD A;  1LQG C;  1BSC A;  1GY5 A;  3AMO A;  1IVW A;  3FSD A;  1I2E A;  2OCT A;  3WHO A;  1RTU A;  4OVM A;  7GSP A;  4MMY B;  1BAO A;  1VQ8 3;  4N6N B;  5EQL A;  2HMO B;  5G1K A;  1FGT A;  5CXO A;  2H0G A;  4MEI A;  2M7O A;  1I0V A;  3EN1 B;  3DUK A;  1MWR A;  3PZW A;  1OCV A;  3D3L A;  1LQM B;  1IVU A;  1AV4 A;  1JBS A;  5DRE A;  5AIF A;  1W02 A;  1HU9 A;  1VQ7 3;  4EW5 A;  3F8H A;  1Q7Y 4;  3V98 A;  1IYY A;  4J9A A;  1GOY A;  1DMM A;  4XB5 A;  4LEH A;  2OQE C;  4XDW A;  2FGT A;  1J2B A;  2HML B;  4HBR A;  5KP3 A;  3ZFZ A;  1KC8 4;  3NBJ A;  1I2F A;  1LVN A;  2F56 A;  4WFO A;  2MC8 A;  3DGM A;  1ZX2 A;  2W03 A;  2P38 A;  2BHM A;  1K73 4;  3J7Y d;  1YVS A;  2XF3 A;  2Y73 A;  4IIA A;  3KCH A;  3Q3F A;  4HKV B;  1O7W B;  1VQP 3;  1IV7 A;  1OPY A;  1ZO2 A;  3OW2 2;  1AY7 A;  2P05 A;  4IT7 A;  3HZP A;  4HM7 B;  1RN4 A;  1O7N B;  1TFO A;  1VQ4 3;  1O7H B;  3EB8 A;  1MOL A;  1M90 4;  2CX0 A;  3PYJ A;  3UB1 A;  4R4K A;  2IUJ A;  1RGG A;  2Q07 A;  3CMA 3;  3NM7 A;  1FGQ A;  1JRQ A;  4WHA A;  2W6J H;  3A5E A;  2P0M A;  3GRD A;  1NNV A;  1NU3 A;  3E99 A;  3QK9 A;  5JBS A;  3AMO B;  4J5K A;  1JB5 A;  1YI2 3;  1Q7H A;  2CK3 H;  3G16 A;  1RCL A;  3OWU A;  1AR0 A;  1BGS A;  1JN5 A;  1FYS A;  3BU4 A;  3PGB A;  3S67 A;  2RBI A;  2F4Y A;  1I8V A;  1FA3 A;  2XFT A;  1SQW A;  2F5W A;  1NB3 I;  1RNB A;  1TRP A;  1BIR A;  2W0Q A;  1DMQ A;  3X42 A;  1ULI B;  1MWS A;  4FMD A;  2CWT A;  5IER A;  2B1X B;  1TFK A;  1QAL A;  2Z6B A;  4K1V A;  1YJW 3;  2C11 A;  1BSE A;  1N9J A;  2A15 A;  4XBT A;  3OWY A;  3GWR A;  3I55 3;  4N6V 0;  2WOF A;  4FCJ A;  2K54 A;  5M18 A;  1IQY A;  5A0O B;  1B21 A;  1NO3 A;  1BRK A;  1E3R A;  1UCL A;  2O3O A;  1YNV X;  1B2Z A;  3BNE A;  3FG4 A;  3AGN A;  3RDE A;  3SLU A;  4CPK A;  4HAA A;  3JUQ A;  5KP1 A;  4K90 B;  5AYR B;  3SVA A;  1QVG 2;  4KFD A;  1EUI C;  2Z76 A;  3HI7 A;  1W7C A;  1WMN A;  4L7K A;  4CJN A;  1PY3 A;  1W5Z A;  1U8C B;  1I2G A;  1UCJ A;  3LH4 A;  2I9W A;  1HZ1 A;  3IPT A;  2F5M A;  2XSO B;  2P0X A;  4N6U A;  1TJD A;  1US1 A;  1N8Q A;  1PFP A;  1S72 3;  2CC3 A;  3F8X A;  1TU5 A;  1RNT A;  1VQ5 3;  1M1X B;  2XH9 A;  1I70 A;  2W9Q A;  4WWU C;  3MHE A;  1YJN 3;  2B24 B;  3MWZ A;  1GOV A;  3ZG5 A;  1UUG B;  3G71 3;  3D4A A;  5M1A A;  2E2V A;  4H3U A;  1QAK A;  2SAR A;  3Q1C A;  1QAF A;  3EBT A;  3EJV A;  3MKI A;  4O8S A;  2CHC A;  1KWI A;  1OH0 A;  1VZZ A;  3K9M C;  4KVH A;  1GD4 A;  2RCD A;  7STD A;  3WA3 A;  1JZO A;  2CFD A;  3GZX B;  2JDI H;  2J8X B;  3JUM A;  3AHW A;  3PXM A;  4LSO A;  2R4I A;  2RGQ A;  3FF2 A;  1QVF 2;  4AKY A;  1TIJ A;  3NBR A;  4NHF A;  1RDS A;  1T3B A;  4QWT A;  5IG0 A;  3FF0 A;  3OXA A;  1G02 A;  2GEY A;  1DYU A;  1LOW A;  1T5Y A;  3LTD A;  3H3H A;  3DY5 A;  1G96 A;  1RCK A;  3BND A;  3Q2P A;  4HM8 B;  3V99 A;  1RLS A;  3DM8 A;  6RNT A;  3FLJ A;  5CF1 A;  4FR9 A;  3PCS A;  3KII A;  3D5I A;  2KF3 A;  1FGO A;  2CKF B;  1OHP A;  3ZG0 A;  3FZW A;  3OX9 A;  5TGN A;  2PNC A;  1B2U A;  1TTO A;  1RGF A;  3NQZ A;  1W6G A;  1W2Z A;  3CCR 3;  1BVI A;  1OHO A;  3SOY A;  1X1X A;  1BU4 A;  1A2K A;  4I4K A;  2BT3 A;  4BTX A;  1GS3 A;  1B2X A;  1LNH A;  1UW1 A;  5DRV A;  4HM2 B;  1VQL 3;  1VQM 3;  2IA7 A;  3G6E 3;  1UUV B;  4HM1 B;  1BNE A;  1T2I A;  2AAD A;  2KXG A;  3K63 A;  1D6U A;  4L8P A;  3FCS B;  3UNL A;  1Q86 4;  1IK3 A;  3F7X A;  3TDG A;  1B2S A;  1BNF A;  3X3Z A;  3EE1 A;  3KKG A;  4Q53 A;  1LNI A;  2BMO B;  3EF8 A;  3FG3 A;  1MGR A;  1A2V A;  2V1L A;  2ZA4 A;  5EVH A;  3X3X A;  2ZL8 A;  4ORL A;  3ER7 A;  3CC4 3;  3CCS 3;  3DXO A;  1IT7 A;  1ROV A;  4HZ9 B;  3UL6 A;  1BNG A;  2ML6 A;  3EC9 A;  3OV4 A;  1JNQ A;  1JV2 B;  1BAN A;  2RSX A;  3WR2 A;  4K61 A;  4GL6 A;  5BXQ A;  3LTB A;  3F7S A;  3MSO A;  4O3V A;  3VGN A;  1RRL A;  4J5G A;  1PYL A;  2BMR B;  2CFL A;  1I0X A;  4LGQ A;  1B2M A;  1C54 A;  3CCU 3;  3KSP A;  3O8Y A;  3RGA A;  3T8N A;  4EXR A;  2HOH A;  3LT8 A;  1OF5 A;  1FGR A;  3DZL A;  5AYS C;  4RNT A;  3CCM 3;  1BUJ A;  2GU1 A;  3JUO A;  2IUK A;  3X41 A;  3NUV A;  1Q81 4;  1FUW A;  5IW9 A;  1ISK A;  3GZB A;  7RNT A;  1IQX A;  3LTA A;  1BNS A;  4AKZ A;  3SXX A;  1UI8 A;  1IT8 A;  1GSP A;  2OOV A;  3S29 A;  1V58 A;  1D6Z A;  5ELU A;  1CYU A;  1W01 A;  3KSE D;  4G1M B;  3FKA A;  4KFF A;  2GXF A;  3FH1 A;  1K8A 4;  1BSD A;  4HM4 B;  1GD3 A;  2P09 A;  1BOX A;  3N8B A;  3N9H A;  3NXJ A;  3HII A;  3AHS A;  3GAX A;  1STD A;  1E97 A;  1AQZ A;  2L1S A;  2LYX A;  2W04 A;  4DKI A;  4EV2 A;  1FW7 A;  3MYT A;  1M9G A;  6STD A;  3S27 A;  3CCJ 3;  1A67 A;  1IDP A;  2KAA A;  3NV0 A;  3WOD G;  1EG9 B;  5CK6 A;  2WGO A;  1FUT A;  1OGX A;  1WQL B;  1YVB I;  4N3V A;  3X3Y A;  4EC6 A;  1B20 A;  1BSB A;  3S5C A;  3B4P A;  4AEQ A;  4HOH A;  5HOH A;  5EEO A;  2QEX 3;  1UI7 A;  4N6O B;  4R1K A;  8CHO A;  1V57 A;  1RGA A;  3CC7 3;  5BVB A;  5D82 A;  4KT3 B;  1W4N A;  5AI1 A;  3CPW 2;  5IG5 A;  3LT9 A;  1NWW A;  2XGN A;  3CXC 2;  1SII A;  1B27 A;  4RZM A;  4WYK A;  4KZ1 A;  5JPU A;  3SX1 A;  2INX A;  4XBX A;  1SAR A;  4CCV A;  3V92 A;  4OK0 A;  1OF5 B;  5AIG A;  4O2H A;  1IQ8 A;  1YGW A;  1R4C A;  2HMN B;  4HZB B;  3BLZ A;  3H51 A;  1RGH A;  2CIU A;  2CX1 A;  2GU3 A;  3U97 A;  1MGW A;  1W6C A;  4MJD A;  1GY7 A;  3NX0 A;  3MG1 A;  4I5Q A;  2F98 A;  2PZV A;  4BTW A;  1O7G B;  2O9U X;  3D79 A;  3EBY A;  2YFL B;  3CNX A;  4X2O A;  1BRG A;  3CCE 3;  4KFE A;  1VQN 3;  1UGH I;  1T2H A;  3MG2 A;  1TUH A;  3STD A;  2CW9 A;  3CC2 3;  4EV5 A;  1LRA A; 
#chains in the Genus database with same CATH homology
 1JN5 B;  3PS8 A;  2GBW B;  2UX0 A;  5I97 A;  1O7M B;  2CFK A;  2CWV A;  3CU3 A;  1Q42 A;  4GB5 A;  1V74 A;  3DMC A;  1JKG A;  4U13 A;  3ECF A;  1GY6 A;  1CEW I;  5D81 A;  1W00 A;  2E2U A;  3K0Z A;  3B4O A;  1DVC A;  1DMN A;  2F86 B;  4N6M A;  1RRH A;  3ROB A;  5HGR A;  2ML5 A;  3DGN A;  1O7P B;  5IEP A;  2QA4 3;  4WP5 A;  3KN4 A;  3K5T A;  3NV0 B;  4CDL A;  2YX9 A;  1CQS A;  4LMI A;  4FMC A;  2L4V A;  1W2B 2;  3LML A;  1RJO A;  2OWP A;  2RFR A;  2OTL 3;  3G8Z A;  1SPU A;  5IF6 A;  1M1K 4;  2CWU A;  4N6T A;  4R9K A;  3I56 3;  2KCD A;  2HMM B;  1UUW B;  3T8U A;  1ULJ B;  1MNL A;  5KP4 A;  3LZA A;  4MMZ B;  4XBY A;  3QRD A;  1TP6 A;  3N54 B;  3VF1 A;  1QJG A;  4WYK B;  1Q82 4;  1EA2 A;  1AVL A;  2HMJ B;  4LZI A;  1VQK 3;  5LC7 A;  4HM6 B;  2Z7A A;  1IVV A;  4HM3 B;  3U1W A;  2XSH B;  4O02 B;  5LC6 A;  3EX9 A;  2QIY A;  1K28 A;  3DGO A;  1VQ6 3;  4N6L A;  3CD6 3;  3NHX A;  5G2G A;  4HJL B;  5IEO A;  3WMD A;  3NM2 A;  3MG3 A;  2OOV C;  1U5O A;  2W9P A;  3LOY A;  4NRE A;  2XGL A;  3B7C A;  3RGR A;  2C10 A;  5AEU B;  5FGO A;  1IVX A;  5CLK A;  3F14 A;  3F40 A;  4FMB A;  5ELJ A;  3CPO A;  1JKG B;  4RNZ A;  2CFW A;  3IMA B;  1WMO A;  3UJM A;  1N9E A;  1L5G B;  1OUN A;  2W56 A;  4HM0 B;  4J8T A;  1CYV A;  2FXT A;  4ZM8 A;  1WTH A;  3F9S A;  1STF I;  3PCR A;  4STD A;  3CME 3;  1IV9 A;  1IU7 A;  4XM4 A;  2BO9 B;  2XRX B;  3EHC A;  5CF2 A;  2HMK B;  5AII A;  3I0Y A;  1Z1S A;  3KFQ C;  2QGU A;  1K41 A;  1EQK A;  1YGE A;  3JVC A;  1QMA A;  3OWS A;  2WO0 A;  2CH9 A;  3S28 A;  1PU4 A;  3FG1 A;  1Y4K A;  3L0R A;  3D9R A;  2JQ5 A;  3LXU X;  3ALA A;  1OGZ A;  3K7C A;  2K0M A;  3KE7 A;  1JJ2 2;  2W2C A;  4FCM A;  3CCL 3;  4H61 A;  1JB2 A;  3G0K A;  3GZY B;  2ZDJ A;  4PEJ A;  1HKX A;  3JUP A;  3LYG A;  4L8O A;  1JB4 A;  1NB5 I;  2LQV A;  3HIG A;  1YIT 3;  1S5A A;  1SIH A;  1LXE A;  1NDO B;  2WGQ A;  2OQE A;  4RBN A;  4BTY A;  4OUQ A;  4FCZ A;  3DGL A;  4FMA A;  1SJW A;  2F99 A;  4IPB A;  4EBG A;  3KZT A;  1W6Y A;  3FGY A;  1YJ9 3;  1YHQ 3;  2IMJ A;  2YFI B;  1ROA A;  4TX4 A;  1N8R 4;  3LTC A;  2D1W A;  2XFS A;  1F8N A;  2D42 A;  1BUQ A;  5STD A;  4MMX B;  2W56 B;  3EQQ B;  3SOA A;  1GYB A;  3Q90 A;  1Q40 A;  2CG1 A;  1LOX A;  4JF8 A;  2OTJ 3;  3WOE B;  1AVK A;  1C7H A;  1N5P A;  4JRF A;  1KQS 2;  5IG4 A;  4K1U A;  5AEW B;  2WOH A;  3VSY A;  2Y74 A;  4HM5 B;  3BNB A;  3UL5 A;  1OAC A;  3SED A;  5IG3 A;  1D6Y A;  1KSI A;  4EYC A;  4R9L A;  3A76 A;  2MF7 A;  2E2T A;  2XR8 B;  1EKM A;  5JPP A;  3MPH A;  3G4S 3;  3B8L A;  1A90 A;  3WDG B;  5D83 A;  1YIJ 3;  1WMP A;  3GZR A;  4X2H A;  1E3V A;  1KD1 4;  1VQ9 3;  5FW5 A;  4RNY A;  1WNH A;  3NQY A;  2XEP A;  3IJE B;  2CFG A;  1K9M 4;  1VQO 3;  2KRT A;  3X40 A;  3T0U A;  3JUN A;  5IEN A;  3NBB A;  2Z77 A;  2BMQ B;  3BNC A;  2FNQ A;  1FGM A;  3M8C A;  3HK4 A;  4HYZ A;  2YFJ B;  3WA2 X;  3CCV 3;  1ASK A;  1RN7 A;  2SBL A;  3CNM A;  1NJI 4;  1RKY A;  1OHS A;  5AIH A;  3HX8 A;  2CG0 A;  4HVN A;  1Q40 B;  1N5H A;  3BB9 A;  1DVD A;  3CCQ 3;  2BNG A;  3EN8 A;  2GBX B;  4R80 A;  2GEX A;  4XDV A;  2STD A;  1GY5 A;  3AMO A;  1IVW A;  3FSD A;  2OCT A;  4OVM A;  4MMY B;  1VQ8 3;  4N6N B;  5EQL A;  2HMO B;  1FGT A;  5CXO A;  4MEI A;  2M7O A;  3EN1 B;  3DUK A;  3PZW A;  1OCV A;  3D3L A;  1IVU A;  1AV4 A;  5DRE A;  5AIF A;  1W02 A;  1HU9 A;  1VQ7 3;  3F8H A;  1Q7Y 4;  3V98 A;  4J9A A;  1DMM A;  4XB5 A;  4LEH A;  2OQE C;  4XDW A;  2FGT A;  1J2B A;  2HML B;  4HBR A;  5KP3 A;  1KC8 4;  3NBJ A;  1LVN A;  4WFO A;  2MC8 A;  3DGM A;  1ZX2 A;  2W03 A;  2P38 A;  2BHM A;  1K73 4;  3J7Y d;  2XF3 A;  2Y73 A;  4IIA A;  4HKV B;  1O7W B;  1VQP 3;  1IV7 A;  1OPY A;  1ZO2 A;  3OW2 2;  2P05 A;  4IT7 A;  3HZP A;  4HM7 B;  1O7N B;  1TFO A;  1VQ4 3;  1O7H B;  3EB8 A;  1MOL A;  1M90 4;  3PYJ A;  3UB1 A;  4R4K A;  2IUJ A;  2Q07 A;  3CMA 3;  3NM7 A;  1FGQ A;  1JRQ A;  4WHA A;  2W6J H;  2P0M A;  3GRD A;  1NU3 A;  3E99 A;  3QK9 A;  5JBS A;  3AMO B;  1YI2 3;  1JB5 A;  3G16 A;  2CK3 H;  3OWU A;  1AR0 A;  1JN5 A;  3PGB A;  3S67 A;  1FA3 A;  2XFT A;  1SQW A;  1NB3 I;  2W0Q A;  1DMQ A;  3X42 A;  1ULI B;  4FMD A;  2CWT A;  5IER A;  2B1X B;  1TFK A;  1QAL A;  2Z6B A;  4K1V A;  1YJW 3;  2C11 A;  1N9J A;  2A15 A;  4XBT A;  3OWY A;  3GWR A;  3I55 3;  4N6V 0;  2WOF A;  4FCJ A;  2K54 A;  1IQY A;  5A0O B;  1NO3 A;  1E3R A;  2O3O A;  3RDE A;  3BNE A;  3FG4 A;  3SLU A;  3JUQ A;  5KP1 A;  4K90 B;  5AYR B;  3SVA A;  1QVG 2;  4KFD A;  4L7K A;  2Z76 A;  3HI7 A;  1W7C A;  1WMN A;  1W5Z A;  1U8C B;  3LH4 A;  2I9W A;  3IPT A;  2XSO B;  2P0X A;  4N6U A;  1US1 A;  1N8Q A;  1PFP A;  1S72 3;  2CC3 A;  3F8X A;  1TU5 A;  1VQ5 3;  1M1X B;  2XH9 A;  2W9Q A;  4WWU C;  3MHE A;  1YJN 3;  2B24 B;  3MWZ A;  3G71 3;  2E2V A;  4H3U A;  1QAK A;  3Q1C A;  1QAF A;  3EBT A;  3EJV A;  3MKI A;  4O8S A;  2CHC A;  1KWI A;  1OH0 A;  1VZZ A;  3K9M C;  4KVH A;  1GD4 A;  2RCD A;  7STD A;  3WA3 A;  2CFD A;  3GZX B;  2JDI H;  3JUM A;  3PXM A;  4LSO A;  2R4I A;  2RGQ A;  3FF2 A;  1QVF 2;  4AKY A;  1TIJ A;  3NBR A;  4NHF A;  3WOF B;  4QWT A;  5IG0 A;  3FF0 A;  3OXA A;  2GEY A;  1DYU A;  1T5Y A;  3LTD A;  3H3H A;  3DY5 A;  1G96 A;  3BND A;  3Q2P A;  4HM8 B;  3V99 A;  3DM8 A;  3FLJ A;  5CF1 A;  4FR9 A;  3PCS A;  3KII A;  1FGO A;  2CKF B;  1OHP A;  3FZW A;  3OX9 A;  5TGN A;  2PNC A;  3NQZ A;  1W6G A;  1W2Z A;  3CCR 3;  1OHO A;  3SOY A;  1A2K A;  4I4K A;  2BT3 A;  4BTX A;  1GS3 A;  1LNH A;  1UW1 A;  5DRV A;  4HM2 B;  1VQL 3;  1VQM 3;  2IA7 A;  3G6E 3;  1UUV B;  4HM1 B;  2KXG A;  3K63 A;  1D6U A;  4L8P A;  3FCS B;  3UNL A;  1Q86 4;  1IK3 A;  3F7X A;  3TDG A;  3X3Z A;  3EE1 A;  3KKG A;  4Q53 A;  2BMO B;  3EF8 A;  3FG3 A;  2V1L A;  1A2V A;  5EVH A;  3X3X A;  2ZL8 A;  4ORL A;  3ER7 A;  3CC4 3;  3CCS 3;  3DXO A;  1IT7 A;  1ROV A;  4HZ9 B;  3UL6 A;  2ML6 A;  3EC9 A;  3OV4 A;  1JNQ A;  1JV2 B;  2RSX A;  4K61 A;  4GL6 A;  5BXQ A;  3LTB A;  3F7S A;  3MSO A;  4O3V A;  3VGN A;  1RRL A;  2BMR B;  2CFL A;  4LGQ A;  3CCU 3;  3KSP A;  3O8Y A;  3RGA A;  3T8N A;  4EXR A;  3CCM 3;  3LT8 A;  1OF5 A;  1FGR A;  3DZL A;  5AYS C;  2GU1 A;  3JUO A;  2IUK A;  3X41 A;  3NUV A;  1Q81 4;  1FUW A;  5IW9 A;  1ISK A;  3GZB A;  1IQX A;  3LTA A;  4AKZ A;  3SXX A;  1UI8 A;  1IT8 A;  2OOV A;  3S29 A;  1D6Z A;  5ELU A;  1CYU A;  1W01 A;  3KSE D;  4G1M B;  3FKA A;  4KFF A;  2GXF A;  3FH1 A;  1K8A 4;  4HM4 B;  1GD3 A;  2P09 A;  3N8B A;  3N9H A;  3NXJ A;  3HII A;  3GAX A;  1STD A;  1E97 A;  2LYX A;  4EV2 A;  2W04 A;  3MYT A;  1M9G A;  6STD A;  3S27 A;  3CCJ 3;  1A67 A;  1IDP A;  3NV0 A;  3WOD G;  1EG9 B;  5CK6 A;  2WGO A;  1OGX A;  1WQL B;  1YVB I;  4N3V A;  3X3Y A;  4EC6 A;  3S5C A;  3B4P A;  4AEQ A;  5EEO A;  2QEX 3;  1UI7 A;  4N6O B;  4R1K A;  8CHO A;  3CC7 3;  5BVB A;  5D82 A;  1W4N A;  5AI1 A;  3CPW 2;  5IG5 A;  3LT9 A;  1NWW A;  2XGN A;  3CXC 2;  1SII A;  4RZM A;  4WYK A;  4KZ1 A;  5JPU A;  3SX1 A;  2INX A;  4XBX A;  4CCV A;  3V92 A;  4OK0 A;  1OF5 B;  5AIG A;  4O2H A;  1IQ8 A;  2HMN B;  1R4C A;  4HZB B;  3BLZ A;  3H51 A;  2CIU A;  2GU3 A;  3U97 A;  1W6C A;  4MJD A;  1GY7 A;  3NX0 A;  3MG1 A;  4BTW A;  2F98 A;  2PZV A;  1O7G B;  2O9U X;  3EBY A;  2YFL B;  3CNX A;  4X2O A;  3CCE 3;  4KFE A;  1VQN 3;  3MG2 A;  1TUH A;  3STD A;  2CW9 A;  3CC2 3;  4EV5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...