1N5PA

Solution structure of the cathelin-like domain of protegrins (all amide bonds involving proline residues are in trans conformation)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
105
structure length
105
Chain Sequence
GSHMQALSYREAVLRAVDRLNEQSSEANLYRLLELDQPPKADEDPGTPKPVSFTVKETVCPRPTRQPPELCDFKENGRVKQCVGTVTLDQIKDPLDITCNEVQGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protegrins
publication title NMR Structure of the Cathelin-like domain of the protegrin-3 Precursor
pubmed doi rcsb
source organism Sus scrofa
molecule tags Antibiotic
total genus 18
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2002-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00666 Cathelicidins Cathelicidin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1n5pA00
1IV7A 4N6NB 1N9JA 3NX0A 2OCTA 4N6TA 2W9PA 3K9MC 1GD4A 4ZM8A 3Q2PA 3QRDA 4N6V0 1IV9A 5EQLA 1TIJA 3MWZA 3PS8A 1FA3A 3UL5A 4EYCA 3IMAB 1MNLA 3S67A 1DVCA 4CCVA 1M9GA 1CEWI 3UL6A 3PXMA 4N6OB 5ELJA 3PYJA 3KSED 5LC6A 1GD3A 1FUWA 1DVDA 1RN7A 1NB3I 2O9UX 1CYUA 1EQKA 5LC7A 5A0OB 2CH9A 1WNHA 1N5PA 3SVAA 1YVBI 2KXGA 1PFPA 3GAXA 1R4CA 4N6LA 1MOLA 1N5HA 1KWIA 1CYVA 1A90A 3LH4A 1NB5I 4IT7A 1STFI 4TX4A 3KFQC 4N6UA 1A67A 1G96A 1LXEA 4N6MA 4LZIA 1ROAA 2BO9B 5ELUA 2W9QA 3L0RA
chains in the Genus database with same CATH superfamily
2YX9A 1IV7A 3BNEA 1TRPA 3RDEA 2H0HA 1UUVB 3U97A 4KFEA 2R4IA 3DMCA 3DM8A 2E2UA 3G16A 1I70A 4WYKA 1RRLA 1FGQA 4QWTA 3KZTA 1JZDA 1KSIA 3S27A 3VGNA 1NO3A 3X41A 3OW22 3AMOB 6GSPA 3B4OA 3BNBA 3CPOA 2W9PA 3ECFA 3S29A 4EBGA 2RFRA 3K9MC 1GD4A 4HM1B 1I8VA 3Q2PA 5IG5A 3OXAA 1KD14 1MWTA 3DH2A 1IDPA 3CME3 2K3DA 5EQLA 1TRQA 4H61A 2IA7A 1BNGA 3NV0A 4H3UA 3TDGA 2A15A 1AV4A 3WOFB 2XRXB 1K9M4 1DMNA 4XM4A 2XR8B 4HM6B 4LMIA 2RGQA 2Z76A 1BOXA 2O3OA 1I2FA 5G1LA 5BIRA 1DYUA 3EJVA 1CEWI 4I4KA 3NBRA 1QJGA 3PXMA 4N6OB 4PEJA 3J7Yd 3CCQ3 2P05A 1RLSA 5G1KA 4JRFA 3DGLA 1RGHA 3NQYA 4BIRA 4LGQA 2AADA 4XDWA 1W01A 2JDIH 2KAAA 5LC6A 3RGAA 1LNHA 1AQZA 3CC73 1MWUA 3D5GA 1RKYA 3CC23 1EEJA 4HM5B 2E2TA 2CWUA 2P09A 4R80A 3U1WA 3CXC2 3NXJA 1DVDA 1UI7A 3T0UA 4EC6A 1RN7A 2B1XB 2O9UX 3FG1A 1EQKA 2ZDJA 3X3XA 2BMRB 2F86B 3S5CA 1GSPA 2YFLB 4CJNA 1C54A 1X1YA 1O7PB 4HM7B 1GOYA 1JN5B 1YVBI 3LZAA 3Q1CA 3NM2A 1V57A 1PU4A 2ML5A 2XF3A 1DE3A 1B2UA 4J5KA 3MG3A 1AR0A 3PCSA 3GZXB 1B2ZA 3LT8A 3CCR3 3FSDA 1PFPA 1MGWA 1LOWA 3K0ZA 2BHMA 2HMKB 4L8OA 4EV2A 1N8R4 1BRGA 1MOLA 3GZYB 1J2BA 1I3FA 2Z77A 3CNMA 3F7XA 1TTOA 4GSPA 3JUPA 5KP4A 2XGLA 4U13A 1BNIA 2GBWB 3AHWA 1MWRA 3H3HA 1O7NB 3HK4A 2PZVA 3AGNA 3D5IA 1ROVA 3K63A 1E97A 1BSDA 3D79A 1LNIA 5FW5A 1A2KA 3T8NA 2P0XA 4N6MA 1IVWA 3GWRA 1YIJ3 2HMMB 3EB8A 3AMOA 2OWPA 4BL3A 1FW7A 1VQ83 2E2VA 1TUHA 1NNVA 2XFTA 2CKFB 2GEYA 2CX1A 3D9RA 4HJLB 2W04A 4BTWA 4N6NB 3G6E3 3IJEB 1BSEA 1RGGA 5JPUA 1YHQ3 3FH1A 3A76A 2L4VA 4MMYB 1LRAA 1BRIA 1RGLA 2BMQB 1YNVX 4FCMA 3FF0A 3FZWA 1TFKA 1RGCA 2J8XB 1Q824 1BRKA 4ILFA 5HGRA 2CW9A 1L5GB 4RNYA 3OWYA 1OGXA 1BSCA 2XSHB 1PYLA 3QRDA 3BLZA 3WA2X 4R9LA 5KP1A 1BNSA 5AYRB 1VQ73 1JRQA 2CFDA 3OWSA 1RTUA 1OHOA 3K5TA 2CFGA 4HKVB 4AKZA 1WMOA 1X1WA 4HM2B 2BIRA 1JNQA 2CK3H 2GXFA 4HM4B 4HZ9B 3IMAB 4O2HA 4R9KA 5EEOA 4OVMA 3FG4A 4O8SA 1ZO2A 1BNJA 3LTCA 1FUTA 3UNLA 2B24B 3D3LA 3WDGB 1VQP3 4Q53A 1YGWA 1RGKA 2GU1A 4HZBB 2YFJB 1VQL3 1IT8A 2KF4A 5EVHA 1HZ1A 2H0GA 1BUJA 4HAAA 2OTJ3 4HM3B 5IG3A 4OK0A 3EE1A 1EA2A 2CFKA 3BU4A 3KSED 2MF7A 3PCRA 1YGEA 2CIUA 4I5QA 4FR9A 1FUWA 1JN5A 1DETA 1UUGB 2W0QA 3DGYA 2H0IA 4BL2A 1UCJA 3BIRA 1ZGXA 3DZLA 2Z7AA 3N54B 3WOEB 3F9SA 3NBJA 1IVXA 3F8XA 3I563 1U5OA 3CCJ3 1YJW3 1GS3A 4G1MB 1CYUA 1KC84 2IYJA 1QALA 3EBYA 3DY5A 4J8TA 1RGFA 1UW1A 5LC7A 4DKIA 1VQ63 2D42A 1Q42A 4KFDA 1UCLA 2K0MA 1WTHA 4HYZA 3LT9A 4RZMA 3ZG5A 4HBRA 5BU4A 1VQ93 4X2OA 1OH0A 2W2CA 3MG1A 3T8UA 2SBLA 3JUQA 5AIHA 3I553 5CF1A 3PGBA 3HZPA 1YIT3 1QAKA 3EF8A 2AAEA 1IVUA 1US1A 1I0XA 1GOVA 1GY5A 2P38A 3B7CA 5DREA 3ZG0A 4RNTA 3DXOA 2W6JH 3GSPA 1VQ43 1I2GA 1R4CA 1FGOA 2CG0A 2F99A 5IG0A 4MJDA 1K41A 1ULJB 3GRDA 3SXXA 2IY2A 2CX0A 1HYFA 4IPBA 5AIGA 2RSXA 1AVLA 2KF5A 4HOHA 2IUKA 1RN4A 3G0KA 4WP5A 4RBNA 4WWUC 1BAOA 1O7HB 3NQZA 1BRHA 1I2EA 2FNQA 2C11A 3LH4A 4XBXA 3Q3FA 1STDA 5IERA 1W2ZA 1B21A 1U8CB 1BVIA 3KIIA 2F5MA 4K61A 1RNBA 1GMRA 4TX4A 3KFQC 1B2MA 1VQM3 3EQQB 4N6UA 1A67A 1UI8A 3CNXA 1G96A 1LQMB 2XFSA 2XH9A 3G713 3RNTA 3X3YA 3X3ZA 1TJDA 4K1VA 1OF5B 3K7CA 3UJMA 4AKYA 3V99A 4FMAA 4KZ1A 1VQN3 2W9QA 1RDSA 3JUOA 3KN4A 1VZZA 1K8A4 3F8HA 1M904 5I97A 2OOVC 4ORLA 1LVNA 2L1SA 1RGAA 3FKAA 1D6ZA 1TU5A 3NX0A 1KQS2 6STDA 1T3BA 3N8BA 2XEPA 3MSOA 1Q814 3H51A 3SEDA 1D6UA 1UDII 7RNTA 1UCIA 2GBXB 1VQO3 3SOAA 2F98A 3LYGA 1I3IA 5IG4A 3FLJA 4RNZA 1W02A 3DGNA 4CPKA 4ZM8A 2Z6BA 4FMBA 2UGIA 1S723 1K734 3LTAA 3ER7A 3F7SA 1MWSA 1CQSA 3G8ZA 3MG2A 1OGZA 4GB5A 1MGRA 1FGTA 1YVSA 5AI1A 1JBRA 5G2GA 2HMJB 1IVVA 1TIJA 1X1UA 3DUKA 1FA3A 2CFWA 3PZWA 3I0YA 1O7MB 3MPHA 1A2PA 3E99A 3UL5A 4EYCA 1W00A 2C4BA 2HMOB 1EG9B 1BSBA 1MNLA 3WA3A 1EKMA 3DGOA 3GZRA 4FCJA 3OX9A 3F14A 3S67A 5IEPA 1RN1A 2Y73A 4CCVA 1UGHI 2KRTA 3JVCA 1M9GA 1A2VA 3V98A 3UL6A 2WO0A 5AEUB 1HKXA 1NWWA 3BNCA 4XBYA 3WR2A 2CHCA 3NM7A 3ROBA 1B20A 3JUNA 7GSPA 2QA43 2I9WA 3PYJA 7STDA 2HOHA 3IPTA 4R1KA 4J5GA 3HIGA 1RCLA 2V1LA 1AVKA 3DGMA 1WQLB 4KFFA 1IT7A 1G02A 3UB1A 3KE7A 9RNTA 4LYLB 1SARA 3CC43 1T5YA 1TFOA 3FCSB 1OUNA 1W4NA 1FUSA 1V74A 1NB3I 4IIAA 4NREA 2C10A 4N3VA 3Q90A 4K90B 4XBTA 1IK3A 1ZS7A 1BANA 3EBTA 1Q9EA 1IQYA 1B27A 3FF2A 1JB4A 1JKGB 1SJWA 2CH9A 2GEXA 3A5EA 2YFIB 5IF6A 1WNHA 2QEX3 1OCVA 2GU3A 1E3VA 8RNTA 4BTYA 1LOYA 3HIIA 1GOUA 3MHEA 3WODG 2P0MA 2KXGA 1IU7A 1R4YA 3F40A 2JQ5A 1YI23 1AY7A 4XDVA 2M7OA 3MYTA 3HX8A 5AIFA 3CCM3 3M8CA 1B2XA 1QAFA 1NJI4 3STDA 5CK6A 4N6LA 4FCZA 5IW9A 1CH0A 1N5HA 3V92A 1KWIA 1GMQA 3AGOA 5D81A 2HMNB 1W5ZA 4WHAA 1OF5A 1CYVA 1LQGC 3B4PA 4LSOA 5IENA 1Z1SA 3AHSA 1JBTA 4OUQA 2R41A 2XSOB 2GSPA 2W03A 3JUMA 5STDA 1NB5I 2ZL8A 1EUIC 5HOHA 1BSAA 1ASKA 4HM8B 5KP3A 5CF2A 2WOHA 4EW5A 1JBSA 3EN8A 1G0TA 3BB9A 1Q40B 4AEQA 1BGSA 3SX1A 1HU9A 1UCKA 2F4YA 1M1XB 1I0VA 1ROAA 3WMDA 4KT3B 1SIIA 4R4KA 4WFOA 3CCL3 2BO9B 5BVBA 1W6YA 2UUGC 1RRHA 2BT3A 2CWVA 4HVNA 4STDA 1S5AA 2BU4A 2INXA 2W56B 4L8PA 4EXRA 2ML6A 1N8QA 4BU4A 2RBIA 1W7CA 3CCS3 4GL6A 3NBBA 4CDLA 5JPPA 1BUQA 3X42A 3CCV3 2KF3A 1VQQA 3SOYA 1N9JA 1RGEA 4HM0B 1JZOA 1UGIA 2OCTA 4FMCA 1IQXA 3CMA3 2RNTA 3KCHA 4N6TA 2QGUA 2F56A 1VQK3 1JV2B 2OOVA 2OTL3 3ZFZA 5AYSC 3LXUX 4N6V0 4NPBA 1VQ53 2BMOB 5DRVA 1IQ8A 1LOXA 1WMNA 1IV9A 4WYKB 3MWZA 1SIHA 2Q07A 3OWUA 1DMMA 3PS8A 3S28A 1RNTA 3VF1A 1FYSA 5BXQA 1JB5A 1RCKA 1GMPA 1NU3A 2KF6A 1TP6A 1BRJA 2STDA 1BRNL 4KVHA 4MEIA 3N9HA 4J9AA 1K28A 2IUJA 1DVCA 1GY7A 4FMDA 3GZBA 1O7WB 1V58A 3HI7A 1BNEA 1D6YA 3CCU3 2CWTA 1QMAA 4X2HA 2WGOA 1JJ22 1NDOB 1LOVA 1UUWB 3QK9A 4XB5A 5IEOA 1OACA 3NV0B 3URPA 5M18A 2ZA4A 1BIRA 1JKGA 5ELJA 3LTDA 1Q864 2WGQA 3EHCA 1T2HA 3BNDA 1FGMA 1W2B2 1A90A 2UX0A 3FGYA 5JBSA 1BU4A 1GD3A 2QIYA 5M19A 4GHOA 3B8LA 1ULIB 1YJN3 5D82A 3WHOA 1YJ93 3OV4A 4JF8A 3LMLA 1RJOA 5AEWB 2D1WA 3LTBA 4K1UA 5GSPA 1Q7HA 3D4AA 2SARA 1QVF2 1RHLA 2RCDA 1W6GA 5A0OB 1SPUA 5AIIA 1B3SA 4O02B 2CFLA 1JB2A 5RNTA 1N5PA 3CCE3 4EV5A 1RSNA 2FXTA 2PNCA 4L7KA 4MMZB 5CLKA 2CG1A 1O7GB 3SVAA 1BNRA 4LEHA 3CPW2 1B2SA 1GYBA 1T2IA 2F5WA 2Y74A 2BNGA 2MC8A 1WMPA 3O8YA 2OQEA 6RNTA 3EN1B 1SQWA 2K54A 1DMQA 2IMJA 3EC9A 5D83A 3GAXA 2CC3A 2LQVA 3KSPA 3NUVA 4MMXB 1Q40A 4BTXA 1FZUA 1ZX2A 1W6CA 3CD63 1BRSA 1X1XA 1IYYA 3MKIA 1E3RA 8CHOA 1N9EA 1PY3A 2OQEC 4IT7A 1M1K4 2W56A 1ISKA 2HMLB 2ZHXB 1FGRA 1OPYA 3FG3A 1STFI 5M1AA 1BNFA 3SYUA 3HOHA 3NHXA 3RGRA 3SLUA 1QVG2 4NHFA 1OHPA 1RMSA 1LXEA 1Q7Y4 1Y4KA 4LZIA 1C7HA 3CU3A 3KKGA 3ALAA 5TGNA 5FGOA 3X40A 5ELUA 3VSYA 1F8NA 2LYXA 2XGNA 2FGTA 1GY6A 2KCDA 5CXOA 3EX9A 3LOYA 1OHSA 4O3VA 3G4S3 2WOFA 3L0RA
chains in the Genus database with same CATH topology
2YX9A 1IV7A 3BNEA 3RDEA 1UUVB 3U97A 4KFEA 2R4IA 3DMCA 3DM8A 2E2UA 3G16A 4WYKA 1RRLA 1FGQA 4QWTA 3KZTA 1KSIA 3S27A 3VGNA 1NO3A 3X41A 3OW22 3AMOB 3B4OA 3BNBA 3CPOA 2W9PA 3ECFA 3S29A 4EBGA 2RFRA 3K9MC 1GD4A 4HM1B 3Q2PA 5IG5A 3OXAA 1KD14 1IDPA 3CME3 5EQLA 4H61A 2IA7A 3NV0A 4H3UA 3TDGA 2A15A 1AV4A 3WOFB 2XRXB 1K9M4 1DMNA 4XM4A 2XR8B 4HM6B 4LMIA 2RGQA 2Z76A 2O3OA 1DYUA 3EJVA 1CEWI 4I4KA 3NBRA 1QJGA 3PXMA 4N6OB 4PEJA 3J7Yd 3CCQ3 2P05A 4JRFA 3DGLA 3NQYA 4LGQA 4XDWA 1W01A 2JDIH 5LC6A 3RGAA 1LNHA 3CC73 1RKYA 3CC23 4HM5B 2E2TA 2CWUA 2P09A 4R80A 3U1WA 3CXC2 3NXJA 1DVDA 1UI7A 3T0UA 4EC6A 1RN7A 2B1XB 2O9UX 3FG1A 1EQKA 2ZDJA 3X3XA 2BMRB 2F86B 3S5CA 2YFLB 1O7PB 4HM7B 1YVBI 1JN5B 3LZAA 3Q1CA 3NM2A 1PU4A 2ML5A 2XF3A 3MG3A 1AR0A 3PCSA 3GZXB 3LT8A 3CCR3 3FSDA 1PFPA 3K0ZA 2BHMA 2HMKB 4L8OA 4EV2A 1N8R4 1MOLA 3GZYB 1J2BA 2Z77A 3CNMA 3F7XA 3JUPA 5KP4A 2XGLA 4U13A 2GBWB 3H3HA 1O7NB 3HK4A 2PZVA 1ROVA 3K63A 1E97A 1A2KA 3T8NA 2P0XA 4N6MA 1IVWA 3GWRA 1YIJ3 2HMMB 3EB8A 3AMOA 2OWPA 1VQ83 2E2VA 1TUHA 2XFTA 2CKFB 2GEYA 3D9RA 4HJLB 2W04A 4BTWA 4N6NB 3G6E3 3IJEB 5JPUA 1YHQ3 3FH1A 3A76A 2L4VA 4MMYB 2BMQB 4FCMA 3FF0A 3FZWA 1TFKA 1Q824 5HGRA 2CW9A 1L5GB 4RNYA 3OWYA 1OGXA 2XSHB 3QRDA 3WA2X 3BLZA 5KP1A 4R9LA 5AYRB 1VQ73 1JRQA 2CFDA 3OWSA 1OHOA 3K5TA 2CFGA 4HKVB 4AKZA 1WMOA 4HM2B 1JNQA 2CK3H 2GXFA 4HM4B 4HZ9B 3IMAB 4O2HA 4R9KA 5EEOA 4OVMA 3FG4A 4O8SA 1ZO2A 3LTCA 3UNLA 2B24B 3D3LA 3WDGB 1VQP3 4Q53A 2GU1A 4HZBB 2YFJB 1VQL3 1IT8A 5EVHA 2OTJ3 4HM3B 5IG3A 4OK0A 3EE1A 1EA2A 2CFKA 3KSED 2MF7A 3PCRA 1YGEA 2CIUA 4FR9A 1FUWA 1JN5A 2W0QA 3DZLA 2Z7AA 3N54B 3WOEB 3F9SA 3NBJA 1IVXA 3F8XA 3I563 1U5OA 3CCJ3 1YJW3 1GS3A 4G1MB 1CYUA 1KC84 3EBYA 1QALA 5LC7A 3DY5A 4J8TA 1UW1A 1VQ63 2D42A 1Q42A 4KFDA 2K0MA 1WTHA 4HYZA 3LT9A 4RZMA 4HBRA 1VQ93 4X2OA 1OH0A 2W2CA 3MG1A 3T8UA 2SBLA 3JUQA 5AIHA 3I553 5CF1A 3PGBA 3HZPA 1YIT3 1QAKA 3EF8A 1IVUA 1US1A 2P38A 1GY5A 5DREA 3B7CA 3DXOA 2W6JH 1VQ43 1R4CA 1FGOA 2CG0A 2F99A 5IG0A 4MJDA 1K41A 1ULJB 3GRDA 3SXXA 4IPBA 5AIGA 2RSXA 1AVLA 4WP5A 4WWUC 2IUKA 3G0KA 5FW5A 1A90A 4RBNA 3NQZA 1O7HB 4XB5A 2FNQA 3LH4A 2C11A 5IERA 4XBXA 1STDA 1W2ZA 1U8CB 3KIIA 4K61A 4TX4A 3KFQC 1VQM3 3EQQB 4N6UA 1A67A 1UI8A 3CNXA 1G96A 2XFSA 2XH9A 3G713 3X3YA 3X3ZA 4K1VA 1OF5B 3K7CA 3UJMA 4AKYA 3V99A 4FMAA 4KZ1A 1VQN3 2W9QA 3JUOA 3KN4A 1VZZA 1K8A4 3F8HA 1M904 5I97A 2OOVC 4ORLA 1LVNA 3FKAA 1D6ZA 1TU5A 3NX0A 1KQS2 6STDA 3N8BA 2XEPA 3MSOA 1Q814 3H51A 3SEDA 1D6UA 2GBXB 1VQO3 3SOAA 2F98A 3LYGA 5IG4A 3FLJA 4RNZA 1W02A 3DGNA 4ZM8A 2Z6BA 4FMBA 1S723 1K734 3LTAA 3ER7A 3F7SA 1CQSA 3G8ZA 3MG2A 1OGZA 4GB5A 1FGTA 5AI1A 5G2GA 2HMJB 1IVVA 1TIJA 3DUKA 1FA3A 2CFWA 3PZWA 3I0YA 1O7MB 3MPHA 3UL5A 3E99A 4EYCA 1W00A 2HMOB 1EG9B 1MNLA 3WA3A 1EKMA 3DGOA 3GZRA 4FCJA 3OX9A 3F14A 3S67A 5IEPA 4CCVA 2Y73A 2KRTA 3JVCA 1M9GA 1A2VA 3V98A 3UL6A 2WO0A 5AEUB 1HKXA 1NWWA 3BNCA 4XBYA 2CHCA 3NM7A 3ROBA 3JUNA 2QA43 2I9WA 3PYJA 7STDA 3IPTA 4R1KA 3HIGA 2V1LA 1AVKA 3DGMA 1WQLB 4KFFA 1IT7A 3UB1A 3KE7A 3CC43 1T5YA 1TFOA 3FCSB 1OUNA 1W4NA 1V74A 1NB3I 4IIAA 4NREA 2C10A 4N3VA 3Q90A 4K90B 4XBTA 1IK3A 3EBTA 1IQYA 3FF2A 1JB4A 1JKGB 1SJWA 2CH9A 2GEXA 2YFIB 5IF6A 1WNHA 2QEX3 1OCVA 2GU3A 1E3VA 4BTYA 3HIIA 3MHEA 3WODG 2P0MA 2KXGA 1IU7A 3F40A 2JQ5A 1YI23 4XDVA 2M7OA 3MYTA 3HX8A 5AIFA 3CCM3 3M8CA 1QAFA 1NJI4 3STDA 5CK6A 4N6LA 4FCZA 5IW9A 1N5HA 3V92A 1KWIA 5D81A 2HMNB 1W5ZA 4WHAA 1OF5A 1CYVA 3B4PA 4LSOA 5IENA 1Z1SA 4OUQA 2XSOB 1NB5I 3JUMA 2W03A 5STDA 2ZL8A 1ASKA 4HM8B 5KP3A 5CF2A 2WOHA 3EN8A 4AEQA 3BB9A 1Q40B 3SX1A 1HU9A 1M1XB 1ROAA 3WMDA 1SIIA 4R4KA 4WFOA 3CCL3 2BO9B 5BVBA 1W6YA 1RRHA 2BT3A 2CWVA 4HVNA 4STDA 1S5AA 2INXA 2W56B 4EXRA 4L8PA 2ML6A 1N8QA 3CCS3 1W7CA 4GL6A 3NBBA 4CDLA 5JPPA 1BUQA 3X42A 3CCV3 3SOYA 1N9JA 4HM0B 2OCTA 4FMCA 1IQXA 3CMA3 4N6TA 2QGUA 1VQK3 1JV2B 2OOVA 2OTL3 5AYSC 3LXUX 4N6V0 1VQ53 2BMOB 5DRVA 1IQ8A 1LOXA 1WMNA 1IV9A 4WYKB 3MWZA 1SIHA 2Q07A 3OWUA 1DMMA 3PS8A 3S28A 3VF1A 5BXQA 1JB5A 1NU3A 2STDA 1TP6A 4KVHA 4MEIA 3N9HA 4J9AA 1K28A 2IUJA 1DVCA 1GY7A 4FMDA 3GZBA 1O7WB 3HI7A 1D6YA 3CCU3 2CWTA 1QMAA 4X2HA 2WGOA 1JJ22 1NDOB 1UUWB 3QK9A 5IEOA 1OACA 3NV0B 1JKGA 5ELJA 3LTDA 1Q864 2WGQA 3EHCA 3BNDA 1FGMA 1W2B2 2UX0A 3FGYA 5JBSA 1GD3A 2QIYA 3B8LA 1ULIB 1YJN3 5D82A 1YJ93 3OV4A 4JF8A 3LMLA 1RJOA 5AEWB 2D1WA 3LTBA 4K1UA 1QVF2 2RCDA 1W6GA 5A0OB 1SPUA 5AIIA 4O02B 2CFLA 1JB2A 1N5PA 3CCE3 4EV5A 2FXTA 4L7KA 2PNCA 4MMZB 5CLKA 3SVAA 2CG1A 1O7GB 4LEHA 3CPW2 1GYBA 2Y74A 2BNGA 2MC8A 1WMPA 3O8YA 2OQEA 3EN1B 1SQWA 2K54A 1DMQA 2IMJA 3EC9A 5D83A 3GAXA 2CC3A 2LQVA 3KSPA 3NUVA 4MMXB 1Q40A 4BTXA 1ZX2A 1W6CA 3CD63 3MKIA 1E3RA 8CHOA 1N9EA 2OQEC 4IT7A 1M1K4 2W56A 1ISKA 2HMLB 1FGRA 1OPYA 3FG3A 1STFI 3SLUA 3NHXA 3RGRA 1QVG2 4NHFA 1OHPA 1LXEA 1Q7Y4 1Y4KA 4LZIA 1C7HA 3CU3A 3KKGA 3ALAA 5TGNA 5FGOA 3X40A 5ELUA 3VSYA 1F8NA 2LYXA 2XGNA 2FGTA 1GY6A 2KCDA 5CXOA 3EX9A 3LOYA 1OHSA 4O3VA 3G4S3 2WOFA 3L0RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IV7 A;  4N6N B;  1N9J A;  3NX0 A;  2OCT A;  4N6T A;  2W9P A;  3K9M C;  1GD4 A;  4ZM8 A;  3Q2P A;  3QRD A;  4N6V 0;  1IV9 A;  5EQL A;  1TIJ A;  3MWZ A;  3PS8 A;  1FA3 A;  3UL5 A;  4EYC A;  3IMA B;  1MNL A;  3S67 A;  1DVC A;  4CCV A;  1M9G A;  1CEW I;  3UL6 A;  3PXM A;  4N6O B;  5ELJ A;  3PYJ A;  3KSE D;  5LC6 A;  1GD3 A;  1FUW A;  1DVD A;  1RN7 A;  1NB3 I;  2O9U X;  1CYU A;  1EQK A;  5LC7 A;  5A0O B;  2CH9 A;  1WNH A;  1N5P A;  3SVA A;  1YVB I;  2KXG A;  1PFP A;  3GAX A;  1R4C A;  4N6L A;  1MOL A;  1N5H A;  1KWI A;  1CYV A;  1A90 A;  3LH4 A;  1NB5 I;  4IT7 A;  1STF I;  4TX4 A;  3KFQ C;  4N6U A;  1A67 A;  1G96 A;  1LXE A;  4N6M A;  4LZI A;  1ROA A;  2BO9 B;  5ELU A;  2W9Q A;  3L0R A; 
#chains in the Genus database with same CATH topology
 2YX9 A;  1IV7 A;  3BNE A;  1TRP A;  3RDE A;  2H0H A;  1UUV B;  3U97 A;  4KFE A;  2R4I A;  3DMC A;  3DM8 A;  2E2U A;  3G16 A;  1I70 A;  4WYK A;  1RRL A;  1FGQ A;  4QWT A;  3KZT A;  1JZD A;  1KSI A;  3S27 A;  3VGN A;  1NO3 A;  3X41 A;  3OW2 2;  3AMO B;  6GSP A;  3B4O A;  3BNB A;  3CPO A;  2W9P A;  3ECF A;  3S29 A;  4EBG A;  2RFR A;  3K9M C;  1GD4 A;  4HM1 B;  1I8V A;  3Q2P A;  5IG5 A;  3OXA A;  1KD1 4;  1MWT A;  3DH2 A;  1IDP A;  3CME 3;  2K3D A;  5EQL A;  1TRQ A;  4H61 A;  2IA7 A;  1BNG A;  3NV0 A;  4H3U A;  3TDG A;  2A15 A;  1AV4 A;  3WOF B;  2XRX B;  1K9M 4;  1DMN A;  4XM4 A;  2XR8 B;  4HM6 B;  4LMI A;  2RGQ A;  2Z76 A;  1BOX A;  2O3O A;  1I2F A;  5G1L A;  5BIR A;  1DYU A;  3EJV A;  1CEW I;  4I4K A;  3NBR A;  1QJG A;  3PXM A;  4N6O B;  4PEJ A;  3J7Y d;  3CCQ 3;  2P05 A;  1RLS A;  5G1K A;  4JRF A;  3DGL A;  1RGH A;  3NQY A;  4BIR A;  4LGQ A;  2AAD A;  4XDW A;  1W01 A;  2JDI H;  2KAA A;  5LC6 A;  3RGA A;  1LNH A;  1AQZ A;  3CC7 3;  1MWU A;  3D5G A;  1RKY A;  3CC2 3;  1EEJ A;  4HM5 B;  2E2T A;  2CWU A;  2P09 A;  4R80 A;  3U1W A;  3CXC 2;  3NXJ A;  1DVD A;  1UI7 A;  3T0U A;  4EC6 A;  1RN7 A;  2B1X B;  2O9U X;  3FG1 A;  1EQK A;  2ZDJ A;  3X3X A;  2BMR B;  2F86 B;  3S5C A;  1GSP A;  2YFL B;  4CJN A;  1C54 A;  1X1Y A;  1O7P B;  4HM7 B;  1GOY A;  1JN5 B;  1YVB I;  3LZA A;  3Q1C A;  3NM2 A;  1V57 A;  1PU4 A;  2ML5 A;  2XF3 A;  1DE3 A;  1B2U A;  4J5K A;  3MG3 A;  1AR0 A;  3PCS A;  3GZX B;  1B2Z A;  3LT8 A;  3CCR 3;  3FSD A;  1PFP A;  1MGW A;  1LOW A;  3K0Z A;  2BHM A;  2HMK B;  4L8O A;  4EV2 A;  1N8R 4;  1BRG A;  1MOL A;  3GZY B;  1J2B A;  1I3F A;  2Z77 A;  3CNM A;  3F7X A;  1TTO A;  4GSP A;  3JUP A;  5KP4 A;  2XGL A;  4U13 A;  1BNI A;  2GBW B;  3AHW A;  1MWR A;  3H3H A;  1O7N B;  3HK4 A;  2PZV A;  3AGN A;  3D5I A;  1ROV A;  3K63 A;  1E97 A;  1BSD A;  3D79 A;  1LNI A;  5FW5 A;  1A2K A;  3T8N A;  2P0X A;  4N6M A;  1IVW A;  3GWR A;  1YIJ 3;  2HMM B;  3EB8 A;  3AMO A;  2OWP A;  4BL3 A;  1FW7 A;  1VQ8 3;  2E2V A;  1TUH A;  1NNV A;  2XFT A;  2CKF B;  2GEY A;  2CX1 A;  3D9R A;  4HJL B;  2W04 A;  4BTW A;  4N6N B;  3G6E 3;  3IJE B;  1BSE A;  1RGG A;  5JPU A;  1YHQ 3;  3FH1 A;  3A76 A;  2L4V A;  4MMY B;  1LRA A;  1BRI A;  1RGL A;  2BMQ B;  1YNV X;  4FCM A;  3FF0 A;  3FZW A;  1TFK A;  1RGC A;  2J8X B;  1Q82 4;  1BRK A;  4ILF A;  5HGR A;  2CW9 A;  1L5G B;  4RNY A;  3OWY A;  1OGX A;  1BSC A;  2XSH B;  1PYL A;  3QRD A;  3BLZ A;  3WA2 X;  4R9L A;  5KP1 A;  1BNS A;  5AYR B;  1VQ7 3;  1JRQ A;  2CFD A;  3OWS A;  1RTU A;  1OHO A;  3K5T A;  2CFG A;  4HKV B;  4AKZ A;  1WMO A;  1X1W A;  4HM2 B;  2BIR A;  1JNQ A;  2CK3 H;  2GXF A;  4HM4 B;  4HZ9 B;  3IMA B;  4O2H A;  4R9K A;  5EEO A;  4OVM A;  3FG4 A;  4O8S A;  1ZO2 A;  1BNJ A;  3LTC A;  1FUT A;  3UNL A;  2B24 B;  3D3L A;  3WDG B;  1VQP 3;  4Q53 A;  1YGW A;  1RGK A;  2GU1 A;  4HZB B;  2YFJ B;  1VQL 3;  1IT8 A;  2KF4 A;  5EVH A;  1HZ1 A;  2H0G A;  1BUJ A;  4HAA A;  2OTJ 3;  4HM3 B;  5IG3 A;  4OK0 A;  3EE1 A;  1EA2 A;  2CFK A;  3BU4 A;  3KSE D;  2MF7 A;  3PCR A;  1YGE A;  2CIU A;  4I5Q A;  4FR9 A;  1FUW A;  1JN5 A;  1DET A;  1UUG B;  2W0Q A;  3DGY A;  2H0I A;  4BL2 A;  1UCJ A;  3BIR A;  1ZGX A;  3DZL A;  2Z7A A;  3N54 B;  3WOE B;  3F9S A;  3NBJ A;  1IVX A;  3F8X A;  3I56 3;  1U5O A;  3CCJ 3;  1YJW 3;  1GS3 A;  4G1M B;  1CYU A;  1KC8 4;  2IYJ A;  1QAL A;  3EBY A;  3DY5 A;  4J8T A;  1RGF A;  1UW1 A;  5LC7 A;  4DKI A;  1VQ6 3;  2D42 A;  1Q42 A;  4KFD A;  1UCL A;  2K0M A;  1WTH A;  4HYZ A;  3LT9 A;  4RZM A;  3ZG5 A;  4HBR A;  5BU4 A;  1VQ9 3;  4X2O A;  1OH0 A;  2W2C A;  3MG1 A;  3T8U A;  2SBL A;  3JUQ A;  5AIH A;  3I55 3;  5CF1 A;  3PGB A;  3HZP A;  1YIT 3;  1QAK A;  3EF8 A;  2AAE A;  1IVU A;  1US1 A;  1I0X A;  1GOV A;  1GY5 A;  2P38 A;  3B7C A;  5DRE A;  3ZG0 A;  4RNT A;  3DXO A;  2W6J H;  3GSP A;  1VQ4 3;  1I2G A;  1R4C A;  1FGO A;  2CG0 A;  2F99 A;  5IG0 A;  4MJD A;  1K41 A;  1ULJ B;  3GRD A;  3SXX A;  2IY2 A;  2CX0 A;  1HYF A;  4IPB A;  5AIG A;  2RSX A;  1AVL A;  2KF5 A;  4HOH A;  2IUK A;  1RN4 A;  3G0K A;  4WP5 A;  4RBN A;  4WWU C;  1BAO A;  1O7H B;  3NQZ A;  1BRH A;  1I2E A;  2FNQ A;  2C11 A;  3LH4 A;  4XBX A;  3Q3F A;  1STD A;  5IER A;  1W2Z A;  1B21 A;  1U8C B;  1BVI A;  3KII A;  2F5M A;  4K61 A;  1RNB A;  1GMR A;  4TX4 A;  3KFQ C;  1B2M A;  1VQM 3;  3EQQ B;  4N6U A;  1A67 A;  1UI8 A;  3CNX A;  1G96 A;  1LQM B;  2XFS A;  2XH9 A;  3G71 3;  3RNT A;  3X3Y A;  3X3Z A;  1TJD A;  4K1V A;  1OF5 B;  3K7C A;  3UJM A;  4AKY A;  3V99 A;  4FMA A;  4KZ1 A;  1VQN 3;  2W9Q A;  1RDS A;  3JUO A;  3KN4 A;  1VZZ A;  1K8A 4;  3F8H A;  1M90 4;  5I97 A;  2OOV C;  4ORL A;  1LVN A;  2L1S A;  1RGA A;  3FKA A;  1D6Z A;  1TU5 A;  3NX0 A;  1KQS 2;  6STD A;  1T3B A;  3N8B A;  2XEP A;  3MSO A;  1Q81 4;  3H51 A;  3SED A;  1D6U A;  1UDI I;  7RNT A;  1UCI A;  2GBX B;  1VQO 3;  3SOA A;  2F98 A;  3LYG A;  1I3I A;  5IG4 A;  3FLJ A;  4RNZ A;  1W02 A;  3DGN A;  4CPK A;  4ZM8 A;  2Z6B A;  4FMB A;  2UGI A;  1S72 3;  1K73 4;  3LTA A;  3ER7 A;  3F7S A;  1MWS A;  1CQS A;  3G8Z A;  3MG2 A;  1OGZ A;  4GB5 A;  1MGR A;  1FGT A;  1YVS A;  5AI1 A;  1JBR A;  5G2G A;  2HMJ B;  1IVV A;  1TIJ A;  1X1U A;  3DUK A;  1FA3 A;  2CFW A;  3PZW A;  3I0Y A;  1O7M B;  3MPH A;  1A2P A;  3E99 A;  3UL5 A;  4EYC A;  1W00 A;  2C4B A;  2HMO B;  1EG9 B;  1BSB A;  1MNL A;  3WA3 A;  1EKM A;  3DGO A;  3GZR A;  4FCJ A;  3OX9 A;  3F14 A;  3S67 A;  5IEP A;  1RN1 A;  2Y73 A;  4CCV A;  1UGH I;  2KRT A;  3JVC A;  1M9G A;  1A2V A;  3V98 A;  3UL6 A;  2WO0 A;  5AEU B;  1HKX A;  1NWW A;  3BNC A;  4XBY A;  3WR2 A;  2CHC A;  3NM7 A;  3ROB A;  1B20 A;  3JUN A;  7GSP A;  2QA4 3;  2I9W A;  3PYJ A;  7STD A;  2HOH A;  3IPT A;  4R1K A;  4J5G A;  3HIG A;  1RCL A;  2V1L A;  1AVK A;  3DGM A;  1WQL B;  4KFF A;  1IT7 A;  1G02 A;  3UB1 A;  3KE7 A;  9RNT A;  4LYL B;  1SAR A;  3CC4 3;  1T5Y A;  1TFO A;  3FCS B;  1OUN A;  1W4N A;  1FUS A;  1V74 A;  1NB3 I;  4IIA A;  4NRE A;  2C10 A;  4N3V A;  3Q90 A;  4K90 B;  4XBT A;  1IK3 A;  1ZS7 A;  1BAN A;  3EBT A;  1Q9E A;  1IQY A;  1B27 A;  3FF2 A;  1JB4 A;  1JKG B;  1SJW A;  2CH9 A;  2GEX A;  3A5E A;  2YFI B;  5IF6 A;  1WNH A;  2QEX 3;  1OCV A;  2GU3 A;  1E3V A;  8RNT A;  4BTY A;  1LOY A;  3HII A;  1GOU A;  3MHE A;  3WOD G;  2P0M A;  2KXG A;  1IU7 A;  1R4Y A;  3F40 A;  2JQ5 A;  1YI2 3;  1AY7 A;  4XDV A;  2M7O A;  3MYT A;  3HX8 A;  5AIF A;  3CCM 3;  3M8C A;  1B2X A;  1QAF A;  1NJI 4;  3STD A;  5CK6 A;  4N6L A;  4FCZ A;  5IW9 A;  1CH0 A;  1N5H A;  3V92 A;  1KWI A;  1GMQ A;  3AGO A;  5D81 A;  2HMN B;  1W5Z A;  4WHA A;  1OF5 A;  1CYV A;  1LQG C;  3B4P A;  4LSO A;  5IEN A;  1Z1S A;  3AHS A;  1JBT A;  4OUQ A;  2R41 A;  2XSO B;  2GSP A;  2W03 A;  3JUM A;  5STD A;  1NB5 I;  2ZL8 A;  1EUI C;  5HOH A;  1BSA A;  1ASK A;  4HM8 B;  5KP3 A;  5CF2 A;  2WOH A;  4EW5 A;  1JBS A;  3EN8 A;  1G0T A;  3BB9 A;  1Q40 B;  4AEQ A;  1BGS A;  3SX1 A;  1HU9 A;  1UCK A;  2F4Y A;  1M1X B;  1I0V A;  1ROA A;  3WMD A;  4KT3 B;  1SII A;  4R4K A;  4WFO A;  3CCL 3;  2BO9 B;  5BVB A;  1W6Y A;  2UUG C;  1RRH A;  2BT3 A;  2CWV A;  4HVN A;  4STD A;  1S5A A;  2BU4 A;  2INX A;  2W56 B;  4L8P A;  4EXR A;  2ML6 A;  1N8Q A;  4BU4 A;  2RBI A;  1W7C A;  3CCS 3;  4GL6 A;  3NBB A;  4CDL A;  5JPP A;  1BUQ A;  3X42 A;  3CCV 3;  2KF3 A;  1VQQ A;  3SOY A;  1N9J A;  1RGE A;  4HM0 B;  1JZO A;  1UGI A;  2OCT A;  4FMC A;  1IQX A;  3CMA 3;  2RNT A;  3KCH A;  4N6T A;  2QGU A;  2F56 A;  1VQK 3;  1JV2 B;  2OOV A;  2OTL 3;  3ZFZ A;  5AYS C;  3LXU X;  4N6V 0;  4NPB A;  1VQ5 3;  2BMO B;  5DRV A;  1IQ8 A;  1LOX A;  1WMN A;  1IV9 A;  4WYK B;  3MWZ A;  1SIH A;  2Q07 A;  3OWU A;  1DMM A;  3PS8 A;  3S28 A;  1RNT A;  3VF1 A;  1FYS A;  5BXQ A;  1JB5 A;  1RCK A;  1GMP A;  1NU3 A;  2KF6 A;  1TP6 A;  1BRJ A;  2STD A;  1BRN L;  4KVH A;  4MEI A;  3N9H A;  4J9A A;  1K28 A;  2IUJ A;  1DVC A;  1GY7 A;  4FMD A;  3GZB A;  1O7W B;  1V58 A;  3HI7 A;  1BNE A;  1D6Y A;  3CCU 3;  2CWT A;  1QMA A;  4X2H A;  2WGO A;  1JJ2 2;  1NDO B;  1LOV A;  1UUW B;  3QK9 A;  4XB5 A;  5IEO A;  1OAC A;  3NV0 B;  3URP A;  5M18 A;  2ZA4 A;  1BIR A;  1JKG A;  5ELJ A;  3LTD A;  1Q86 4;  2WGQ A;  3EHC A;  1T2H A;  3BND A;  1FGM A;  1W2B 2;  1A90 A;  2UX0 A;  3FGY A;  5JBS A;  1BU4 A;  1GD3 A;  2QIY A;  5M19 A;  4GHO A;  3B8L A;  1ULI B;  1YJN 3;  5D82 A;  3WHO A;  1YJ9 3;  3OV4 A;  4JF8 A;  3LML A;  1RJO A;  5AEW B;  2D1W A;  3LTB A;  4K1U A;  5GSP A;  1Q7H A;  3D4A A;  2SAR A;  1QVF 2;  1RHL A;  2RCD A;  1W6G A;  5A0O B;  1SPU A;  5AII A;  1B3S A;  4O02 B;  2CFL A;  1JB2 A;  5RNT A;  1N5P A;  3CCE 3;  4EV5 A;  1RSN A;  2FXT A;  2PNC A;  4L7K A;  4MMZ B;  5CLK A;  2CG1 A;  1O7G B;  3SVA A;  1BNR A;  4LEH A;  3CPW 2;  1B2S A;  1GYB A;  1T2I A;  2F5W A;  2Y74 A;  2BNG A;  2MC8 A;  1WMP A;  3O8Y A;  2OQE A;  6RNT A;  3EN1 B;  1SQW A;  2K54 A;  1DMQ A;  2IMJ A;  3EC9 A;  5D83 A;  3GAX A;  2CC3 A;  2LQV A;  3KSP A;  3NUV A;  4MMX B;  1Q40 A;  4BTX A;  1FZU A;  1ZX2 A;  1W6C A;  3CD6 3;  1BRS A;  1X1X A;  1IYY A;  3MKI A;  1E3R A;  8CHO A;  1N9E A;  1PY3 A;  2OQE C;  4IT7 A;  1M1K 4;  2W56 A;  1ISK A;  2HML B;  2ZHX B;  1FGR A;  1OPY A;  3FG3 A;  1STF I;  5M1A A;  1BNF A;  3SYU A;  3HOH A;  3NHX A;  3RGR A;  3SLU A;  1QVG 2;  4NHF A;  1OHP A;  1RMS A;  1LXE A;  1Q7Y 4;  1Y4K A;  4LZI A;  1C7H A;  3CU3 A;  3KKG A;  3ALA A;  5TGN A;  5FGO A;  3X40 A;  5ELU A;  3VSY A;  1F8N A;  2LYX A;  2XGN A;  2FGT A;  1GY6 A;  2KCD A;  5CXO A;  3EX9 A;  3LOY A;  1OHS A;  4O3V A;  3G4S 3;  2WOF A;  3L0R A; 
#chains in the Genus database with same CATH homology
 2YX9 A;  1IV7 A;  3BNE A;  3RDE A;  1UUV B;  3U97 A;  4KFE A;  2R4I A;  3DMC A;  3DM8 A;  2E2U A;  3G16 A;  4WYK A;  1RRL A;  1FGQ A;  4QWT A;  3KZT A;  1KSI A;  3S27 A;  3VGN A;  1NO3 A;  3X41 A;  3OW2 2;  3AMO B;  3B4O A;  3BNB A;  3CPO A;  2W9P A;  3ECF A;  3S29 A;  4EBG A;  2RFR A;  3K9M C;  1GD4 A;  4HM1 B;  3Q2P A;  5IG5 A;  3OXA A;  1KD1 4;  1IDP A;  3CME 3;  5EQL A;  4H61 A;  2IA7 A;  3NV0 A;  4H3U A;  3TDG A;  2A15 A;  1AV4 A;  3WOF B;  2XRX B;  1K9M 4;  1DMN A;  4XM4 A;  2XR8 B;  4HM6 B;  4LMI A;  2RGQ A;  2Z76 A;  2O3O A;  1DYU A;  3EJV A;  1CEW I;  4I4K A;  3NBR A;  1QJG A;  3PXM A;  4N6O B;  4PEJ A;  3J7Y d;  3CCQ 3;  2P05 A;  4JRF A;  3DGL A;  3NQY A;  4LGQ A;  4XDW A;  1W01 A;  2JDI H;  5LC6 A;  3RGA A;  1LNH A;  3CC7 3;  1RKY A;  3CC2 3;  4HM5 B;  2E2T A;  2CWU A;  2P09 A;  4R80 A;  3U1W A;  3CXC 2;  3NXJ A;  1DVD A;  1UI7 A;  3T0U A;  4EC6 A;  1RN7 A;  2B1X B;  2O9U X;  3FG1 A;  1EQK A;  2ZDJ A;  3X3X A;  2BMR B;  2F86 B;  3S5C A;  2YFL B;  1O7P B;  4HM7 B;  1YVB I;  1JN5 B;  3LZA A;  3Q1C A;  3NM2 A;  1PU4 A;  2ML5 A;  2XF3 A;  3MG3 A;  1AR0 A;  3PCS A;  3GZX B;  3LT8 A;  3CCR 3;  3FSD A;  1PFP A;  3K0Z A;  2BHM A;  2HMK B;  4L8O A;  4EV2 A;  1N8R 4;  1MOL A;  3GZY B;  1J2B A;  2Z77 A;  3CNM A;  3F7X A;  3JUP A;  5KP4 A;  2XGL A;  4U13 A;  2GBW B;  3H3H A;  1O7N B;  3HK4 A;  2PZV A;  1ROV A;  3K63 A;  1E97 A;  1A2K A;  3T8N A;  2P0X A;  4N6M A;  1IVW A;  3GWR A;  1YIJ 3;  2HMM B;  3EB8 A;  3AMO A;  2OWP A;  1VQ8 3;  2E2V A;  1TUH A;  2XFT A;  2CKF B;  2GEY A;  3D9R A;  4HJL B;  2W04 A;  4BTW A;  4N6N B;  3G6E 3;  3IJE B;  5JPU A;  1YHQ 3;  3FH1 A;  3A76 A;  2L4V A;  4MMY B;  2BMQ B;  4FCM A;  3FF0 A;  3FZW A;  1TFK A;  1Q82 4;  5HGR A;  2CW9 A;  1L5G B;  4RNY A;  3OWY A;  1OGX A;  2XSH B;  3QRD A;  3WA2 X;  3BLZ A;  5KP1 A;  4R9L A;  5AYR B;  1VQ7 3;  1JRQ A;  2CFD A;  3OWS A;  1OHO A;  3K5T A;  2CFG A;  4HKV B;  4AKZ A;  1WMO A;  4HM2 B;  1JNQ A;  2CK3 H;  2GXF A;  4HM4 B;  4HZ9 B;  3IMA B;  4O2H A;  4R9K A;  5EEO A;  4OVM A;  3FG4 A;  4O8S A;  1ZO2 A;  3LTC A;  3UNL A;  2B24 B;  3D3L A;  3WDG B;  1VQP 3;  4Q53 A;  2GU1 A;  4HZB B;  2YFJ B;  1VQL 3;  1IT8 A;  5EVH A;  2OTJ 3;  4HM3 B;  5IG3 A;  4OK0 A;  3EE1 A;  1EA2 A;  2CFK A;  3KSE D;  2MF7 A;  3PCR A;  1YGE A;  2CIU A;  4FR9 A;  1FUW A;  1JN5 A;  2W0Q A;  3DZL A;  2Z7A A;  3N54 B;  3WOE B;  3F9S A;  3NBJ A;  1IVX A;  3F8X A;  3I56 3;  1U5O A;  3CCJ 3;  1YJW 3;  1GS3 A;  4G1M B;  1CYU A;  1KC8 4;  3EBY A;  1QAL A;  5LC7 A;  3DY5 A;  4J8T A;  1UW1 A;  1VQ6 3;  2D42 A;  1Q42 A;  4KFD A;  2K0M A;  1WTH A;  4HYZ A;  3LT9 A;  4RZM A;  4HBR A;  1VQ9 3;  4X2O A;  1OH0 A;  2W2C A;  3MG1 A;  3T8U A;  2SBL A;  3JUQ A;  5AIH A;  3I55 3;  5CF1 A;  3PGB A;  3HZP A;  1YIT 3;  1QAK A;  3EF8 A;  1IVU A;  1US1 A;  2P38 A;  1GY5 A;  5DRE A;  3B7C A;  3DXO A;  2W6J H;  1VQ4 3;  1R4C A;  1FGO A;  2CG0 A;  2F99 A;  5IG0 A;  4MJD A;  1K41 A;  1ULJ B;  3GRD A;  3SXX A;  4IPB A;  5AIG A;  2RSX A;  1AVL A;  4WP5 A;  4WWU C;  2IUK A;  3G0K A;  5FW5 A;  1A90 A;  4RBN A;  3NQZ A;  1O7H B;  4XB5 A;  2FNQ A;  3LH4 A;  2C11 A;  5IER A;  4XBX A;  1STD A;  1W2Z A;  1U8C B;  3KII A;  4K61 A;  4TX4 A;  3KFQ C;  1VQM 3;  3EQQ B;  4N6U A;  1A67 A;  1UI8 A;  3CNX A;  1G96 A;  2XFS A;  2XH9 A;  3G71 3;  3X3Y A;  3X3Z A;  4K1V A;  1OF5 B;  3K7C A;  3UJM A;  4AKY A;  3V99 A;  4FMA A;  4KZ1 A;  1VQN 3;  2W9Q A;  3JUO A;  3KN4 A;  1VZZ A;  1K8A 4;  3F8H A;  1M90 4;  5I97 A;  2OOV C;  4ORL A;  1LVN A;  3FKA A;  1D6Z A;  1TU5 A;  3NX0 A;  1KQS 2;  6STD A;  3N8B A;  2XEP A;  3MSO A;  1Q81 4;  3H51 A;  3SED A;  1D6U A;  2GBX B;  1VQO 3;  3SOA A;  2F98 A;  3LYG A;  5IG4 A;  3FLJ A;  4RNZ A;  1W02 A;  3DGN A;  4ZM8 A;  2Z6B A;  4FMB A;  1S72 3;  1K73 4;  3LTA A;  3ER7 A;  3F7S A;  1CQS A;  3G8Z A;  3MG2 A;  1OGZ A;  4GB5 A;  1FGT A;  5AI1 A;  5G2G A;  2HMJ B;  1IVV A;  1TIJ A;  3DUK A;  1FA3 A;  2CFW A;  3PZW A;  3I0Y A;  1O7M B;  3MPH A;  3UL5 A;  3E99 A;  4EYC A;  1W00 A;  2HMO B;  1EG9 B;  1MNL A;  3WA3 A;  1EKM A;  3DGO A;  3GZR A;  4FCJ A;  3OX9 A;  3F14 A;  3S67 A;  5IEP A;  4CCV A;  2Y73 A;  2KRT A;  3JVC A;  1M9G A;  1A2V A;  3V98 A;  3UL6 A;  2WO0 A;  5AEU B;  1HKX A;  1NWW A;  3BNC A;  4XBY A;  2CHC A;  3NM7 A;  3ROB A;  3JUN A;  2QA4 3;  2I9W A;  3PYJ A;  7STD A;  3IPT A;  4R1K A;  3HIG A;  2V1L A;  1AVK A;  3DGM A;  1WQL B;  4KFF A;  1IT7 A;  3UB1 A;  3KE7 A;  3CC4 3;  1T5Y A;  1TFO A;  3FCS B;  1OUN A;  1W4N A;  1V74 A;  1NB3 I;  4IIA A;  4NRE A;  2C10 A;  4N3V A;  3Q90 A;  4K90 B;  4XBT A;  1IK3 A;  3EBT A;  1IQY A;  3FF2 A;  1JB4 A;  1JKG B;  1SJW A;  2CH9 A;  2GEX A;  2YFI B;  5IF6 A;  1WNH A;  2QEX 3;  1OCV A;  2GU3 A;  1E3V A;  4BTY A;  3HII A;  3MHE A;  3WOD G;  2P0M A;  2KXG A;  1IU7 A;  3F40 A;  2JQ5 A;  1YI2 3;  4XDV A;  2M7O A;  3MYT A;  3HX8 A;  5AIF A;  3CCM 3;  3M8C A;  1QAF A;  1NJI 4;  3STD A;  5CK6 A;  4N6L A;  4FCZ A;  5IW9 A;  1N5H A;  3V92 A;  1KWI A;  5D81 A;  2HMN B;  1W5Z A;  4WHA A;  1OF5 A;  1CYV A;  3B4P A;  4LSO A;  5IEN A;  1Z1S A;  4OUQ A;  2XSO B;  1NB5 I;  3JUM A;  2W03 A;  5STD A;  2ZL8 A;  1ASK A;  4HM8 B;  5KP3 A;  5CF2 A;  2WOH A;  3EN8 A;  4AEQ A;  3BB9 A;  1Q40 B;  3SX1 A;  1HU9 A;  1M1X B;  1ROA A;  3WMD A;  1SII A;  4R4K A;  4WFO A;  3CCL 3;  2BO9 B;  5BVB A;  1W6Y A;  1RRH A;  2BT3 A;  2CWV A;  4HVN A;  4STD A;  1S5A A;  2INX A;  2W56 B;  4EXR A;  4L8P A;  2ML6 A;  1N8Q A;  3CCS 3;  1W7C A;  4GL6 A;  3NBB A;  4CDL A;  5JPP A;  1BUQ A;  3X42 A;  3CCV 3;  3SOY A;  1N9J A;  4HM0 B;  2OCT A;  4FMC A;  1IQX A;  3CMA 3;  4N6T A;  2QGU A;  1VQK 3;  1JV2 B;  2OOV A;  2OTL 3;  5AYS C;  3LXU X;  4N6V 0;  1VQ5 3;  2BMO B;  5DRV A;  1IQ8 A;  1LOX A;  1WMN A;  1IV9 A;  4WYK B;  3MWZ A;  1SIH A;  2Q07 A;  3OWU A;  1DMM A;  3PS8 A;  3S28 A;  3VF1 A;  5BXQ A;  1JB5 A;  1NU3 A;  2STD A;  1TP6 A;  4KVH A;  4MEI A;  3N9H A;  4J9A A;  1K28 A;  2IUJ A;  1DVC A;  1GY7 A;  4FMD A;  3GZB A;  1O7W B;  3HI7 A;  1D6Y A;  3CCU 3;  2CWT A;  1QMA A;  4X2H A;  2WGO A;  1JJ2 2;  1NDO B;  1UUW B;  3QK9 A;  5IEO A;  1OAC A;  3NV0 B;  1JKG A;  5ELJ A;  3LTD A;  1Q86 4;  2WGQ A;  3EHC A;  3BND A;  1FGM A;  1W2B 2;  2UX0 A;  3FGY A;  5JBS A;  1GD3 A;  2QIY A;  3B8L A;  1ULI B;  1YJN 3;  5D82 A;  1YJ9 3;  3OV4 A;  4JF8 A;  3LML A;  1RJO A;  5AEW B;  2D1W A;  3LTB A;  4K1U A;  1QVF 2;  2RCD A;  1W6G A;  5A0O B;  1SPU A;  5AII A;  4O02 B;  2CFL A;  1JB2 A;  1N5P A;  3CCE 3;  4EV5 A;  2FXT A;  4L7K A;  2PNC A;  4MMZ B;  5CLK A;  3SVA A;  2CG1 A;  1O7G B;  4LEH A;  3CPW 2;  1GYB A;  2Y74 A;  2BNG A;  2MC8 A;  1WMP A;  3O8Y A;  2OQE A;  3EN1 B;  1SQW A;  2K54 A;  1DMQ A;  2IMJ A;  3EC9 A;  5D83 A;  3GAX A;  2CC3 A;  2LQV A;  3KSP A;  3NUV A;  4MMX B;  1Q40 A;  4BTX A;  1ZX2 A;  1W6C A;  3CD6 3;  3MKI A;  1E3R A;  8CHO A;  1N9E A;  2OQE C;  4IT7 A;  1M1K 4;  2W56 A;  1ISK A;  2HML B;  1FGR A;  1OPY A;  3FG3 A;  1STF I;  3SLU A;  3NHX A;  3RGR A;  1QVG 2;  4NHF A;  1OHP A;  1LXE A;  1Q7Y 4;  1Y4K A;  4LZI A;  1C7H A;  3CU3 A;  3KKG A;  3ALA A;  5TGN A;  5FGO A;  3X40 A;  5ELU A;  3VSY A;  1F8N A;  2LYX A;  2XGN A;  2FGT A;  1GY6 A;  2KCD A;  5CXO A;  3EX9 A;  3LOY A;  1OHS A;  4O3V A;  3G4S 3;  2WOF A;  3L0R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...