1YIJ3

Crystal structure of telithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
total genus 16
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2005-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1yij300
3CMA3 1VQ53 3CC43 1VQL3 1YJ93 3CCJ3 1K9M4 1VQ93 1VQM3 1Q864 1VQ43 1S723 1N8R4 2OTJ3 3G713 1YJN3 3CCM3 3I553 3CCR3 1Q814 1QVG2 1VQO3 1K734 1KQS2 3CME3 3I563 2QA43 1JJ22 3G6E3 1YIT3 1M904 1K8A4 2OTL3 1VQP3 1NJI4 3CCQ3 1Q7Y4 3CD63 1VQN3 3CCU3 3CCV3 3CXC2 1M1K4 1VQ73 1YJW3 3CCE3 1VQK3 3CCS3 3OW22 1YI23 1W2B2 1YHQ3 3G4S3 1KC84 1QVF2 1VQ63 1VQ83 3CCL3 1Q824 3CC73 1KD14 3CC23 3CPW2 2QEX3 1YIJ3
chains in the Genus database with same CATH superfamily
1I0VA 1BU4A 2KF5A 5RNTA 1W6YA 1IQ8A 1UW1A 1I0XA 1A2VA 1DVDA 1Q814 1JKGB 2RNTA 2RSXA 1HYFA 2HMMB 4IIAA 1GY6A 4OVMA 4R9KA 2K54A 2QA43 2YX9A 3NBRA 1W7CA 2OOVA 2E2TA 3EBYA 3AHSA 3K5TA 4HM1B 4HZ9B 1RRLA 1WMOA 1WTHA 1GY5A 1QALA 3FF0A 4FCJA 5CF2A 4EC6A 3CCQ3 1WNHA 1FGQA 4RBNA 1BSCA 1T3BA 2RCDA 2XFTA 3D9RA 2CG0A 1ROAA 2WO0A 3NUVA 3CC23 2XSHB 5AYSC 4EV5A 1ZO2A 1EUIC 1OACA 1YIT3 3RGRA 4KVHA 3FCSB 3EQQB 2XGNA 2WOHA 3IMAB 2JDIH 1TFKA 3SYUA 1B2UA 3UL5A 4FR9A 1EG9B 1VQQA 2F99A 1K734 3GZRA 3I563 3LXUX 4WFOA 5AEWB 4N6LA 5KP4A 1B2ZA 2I9WA 4HM7B 3NXJA 1W00A 4L8PA 4MJDA 4EV2A 1HKXA 1R4CA 1SIIA 1UUWB 3NV0B 1UI8A 4R9LA 1M9GA 4IT7A 1SQWA 1V57A 4BTWA 1X1WA 3EX9A 3CCE3 2P09A 1JV2B 1GSPA 4XDVA 1VQ63 2W56B 1WMNA 1TRPA 4X2OA 2MC8A 2OTL3 4XM4A 2OQEC 1T2HA 3RNTA 3LOYA 1Q40A 1BRSA 5STDA 1JZOA 5KP3A 2XH9A 3AHWA 2F56A 4O2HA 1RDSA 2SARA 4J8TA 4HM5B 2CFWA 1B20A 2Y74A 1KSIA 4FMDA 1FUTA 2Z7AA 3G8ZA 3T8NA 1B3SA 1N5HA 1N5PA 1RGGA 2HMJB 2INXA 1CEWI 1RNTA 2AAEA 4MMZB 4Q53A 3BNBA 3SX1A 5FW5A 2IMJA 2IA7A 1J2BA 1ZX2A 4H61A 4BIRA 3KSPA 1N9JA 1DYUA 1RTUA 3FSDA 4O8SA 1YVBI 3G16A 1VQK3 1U8CB 1RGCA 2JQ5A 3PYJA 3L0RA 1PFPA 1BRIA 2HMOB 2D1WA 2K3DA 3H3HA 4BL2A 3FG3A 1YHQ3 3URPA 4AKZA 4XBXA 5AIFA 5FGOA 3VGNA 4WYKA 3OX9A 1NB3I 1OGXA 5BVBA 1ASKA 3GZXB 3FGYA 7RNTA 1UDII 3MPHA 1IU7A 3CC43 1BUQA 3EJVA 5BU4A 1UCJA 4FMCA 3G6E3 3ZG5A 1BRKA 5IF6A 1I2EA 4NPBA 2KF4A 3LH4A 3VSYA 1GOYA 5LC7A 4O02B 4HBRA 4BL3A 2OWPA 8CHOA 1AV4A 4I5QA 6STDA 3CD63 1Q42A 3B4PA 4WYKB 4EYCA 3CCU3 3NM2A 3TDGA 5EVHA 1CH0A 4QWTA 1BNSA 4HAAA 4J5KA 4J9AA 1PY3A 1VQ53 2OCTA 1GMPA 1A67A 4WP5A 1RN4A 4I4KA 3SEDA 1QAKA 4N6OB 2E2VA 2CW9A 5AYRB 3G0KA 3WHOA 1QMAA 4BU4A 8RNTA 1I3IA 3T0UA 2LYXA 5D81A 3V98A 2D42A 1Q9EA 2V1LA 1K8A4 3BB9A 4LEHA 1FW7A 1D6YA 1I3FA 3DGYA 1BNGA 2C11A 3BNDA 3STDA 1NDOB 2CHCA 1C54A 1LOVA 1OGZA 2OQEA 3HX8A 4KFFA 5A0OB 1I70A 1BRJA 1IQYA 1RLSA 3FLJA 3Q2PA 2Z77A 1BNFA 3DH2A 3F9SA 1LXEA 1B2SA 3Q90A 2RGQA 1EA2A 1BNIA 1AQZA 2QEX3 1SPUA 1FA3A 1W02A 3U97A 4HM2B 3SLUA 1W4NA 3CCJ3 2ZDJA 1VQ43 1DMMA 2RFRA 1IDPA 1S723 1BIRA 2O3OA 2IUKA 2ML5A 4HZBB 2OTJ3 1BNEA 1MNLA 1RGKA 2B1XB 3GRDA 5IG3A 3CCM3 1BUJA 4FMBA 3SOYA 3H51A 2BT3A 4LYLB 3NQYA 2IYJA 1OCVA 3UB1A 1RJOA 4X2HA 5AIHA 1M904 4AKYA 4KFDA 1MWUA 2W6JH 4RNTA 3KIIA 3PCSA 1JZDA 2CK3H 3MSOA 5JPUA 1WQLB 5DREA 4EXRA 3ZFZA 2F98A 1TU5A 1M1K4 3MG3A 4EW5A 3CCS3 1O7NB 5EEOA 2WGQA 3LYGA 5IENA 1W2B2 1PYLA 3S29A 1Q7HA 1CQSA 1STDA 1U5OA 2BMOB 3CCL3 1QAFA 2XSOB 3F40A 3LTAA 3X40A 4CPKA 3I553 3KCHA 1OF5B 3D5IA 3Q1CA 4HM6B 4HM4B 4N6MA 3DY5A 2BU4A 5ELJA 3NV0A 4GB5A 4N6V0 5IG4A 3X3ZA 5IW9A 1HU9A 1TP6A 2WOFA 5M19A 1O7HB 1RCKA 2XEPA 1EKMA 2CFKA 2ML6A 1NU3A 2BIRA 1YGEA 1UCIA 1KWIA 3MWZA 2W56A 3HOHA 3I0YA 5IEPA 5CXOA 2XFSA 3PCRA 3FG1A 4L8OA 3BIRA 2WGOA 3JUOA 3EN1B 2YFJB 3D3LA 2UUGC 1STFI 4WHAA 3ZG0A 1VQN3 4R1KA 1CYUA 1BGSA 1BSDA 3OWSA 2STDA 1VQ73 4TX4A 1LOXA 2P0MA 3BNEA 3DM8A 3Q3FA 4L7KA 1RHLA 4R80A 1RGLA 2A15A 1OH0A 1JB2A 1O7MB 4ORLA 4ZM8A 2GBWB 1RGAA 6RNTA 2XR8B 1FUSA 1PU4A 1ULJB 3X3XA 3GZBA 2C4BA 1RGEA 4CDLA 1BNJA 1TUHA 4K1UA 2CKFB 4R4KA 1OHPA 1HZ1A 1BVIA 1LOWA 2HMLB 2CX0A 3X3YA 1GS3A 3NBJA 1JJ22 2AADA 3MG1A 1BRNL 1DE3A 2W04A 1SIHA 1TRQA 3SXXA 4GL6A 3SOAA 4N3VA 1RGFA 1RCLA 2CWVA 5JPPA 4K1VA 3CCV3 3WR2A 5IG5A 4MMXB 2BNGA 4XBTA 2KRTA 2Y73A 9RNTA 3OWYA 3JUPA 3X42A 1RSNA 2KF3A 1A2PA 1SJWA 4HOHA 4KFEA 1TIJA 2W9PA 3B8LA 1JNQA 5M1AA 1T5YA 3AGNA 3ECFA 1RN1A 3KZTA 3MG2A 5TGNA 4N6UA 1I2FA 1SARA 1UCLA 2MF7A 1VQ93 3DGMA 4HJLB 4LMIA 3V99A 1VQM3 4RNZA 4JRFA 3OV4A 2LQVA 4GHOA 3F8XA 1LNHA 2KAAA 3BU4A 1IK3A 1YJN3 1QVG2 1YGWA 3S5CA 1WMPA 1DMNA 2KF6A 5AIIA 1UUGB 1FGMA 2QGUA 3WA3A 1OHSA 3EN8A 1NJI4 5IG0A 1GMRA 3JUMA 2HMNB 2KCDA 4BTXA 5IERA 2CC3A 1BAOA 3SVAA 4J5GA 1QVF2 3J7Yd 3GSPA 1KD14 3HK4A 1UUVB 4H3UA 5ELUA 4CCVA 1IV7A 2F4YA 2FGTA 3LTCA 3QRDA 3T8UA 2BO9B 2HMKB 1BSBA 5AEUB 4MEIA 2E2UA 3KKGA 1EQKA 1I8VA 2YFLB 3ROBA 3IPTA 5M18A 1UI7A 3NM7A 2BMQB 2O9UX 3NBBA 1VQP3 1IYYA 2L1SA 2CFLA 1ISKA 1IQXA 1FGOA 1FZUA 3LZAA 3F7XA 1MWTA 1JRQA 3ALAA 3LTBA 2GU1A 4XDWA 3DGOA 3PXMA 4RNYA 1A90A 1BSEA 2ZA4A 3JUQA 3LMLA 1AVLA 2GU3A 1FGRA 3EC9A 4PEJA 3G4S3 4FCZA 3E99A 1T2IA 2GEXA 3S28A 1E3RA 2GBXB 1OUNA 3F14A 3CMA3 2QIYA 3MHEA 4HM0B 1RMSA 3GWRA 1K9M4 3KE7A 3EE1A 3JUNA 1ROVA 3K63A 3DUKA 1JB5A 3KFQC 5LC6A 2M7OA 2F5WA 5G1LA 3S27A 4O3VA 3S67A 1E97A 1TTOA 3DMCA 1VQO3 1L5GB 4OK0A 1IVVA 2J8XB 1VZZA 2UGIA 1B27A 1OF5A 3GAXA 2XRXB 2CIUA 4LZIA 1JBRA 2B24B 2CX1A 1I2GA 2H0IA 1X1XA 5BIRA 3LTDA 1B2MA 3FZWA 4OUQA 1RKYA 3OW22 2F86B 2FNQA 3DXOA 2ZHXB 3JVCA 1D6ZA 1AR0A 3HZPA 3CC73 3OWUA 3FKAA 3CU3A 1X1UA 3WMDA 1US1A 1QJGA 3QK9A 1RGHA 5D83A 3A5EA 1M1XB 2CFGA 1RNBA 1OHOA 3BNCA 2R41A 1UCKA 1IT8A 1KQS2 3D79A 1IV9A 1TFOA 1NNVA 3AMOA 2P05A 3DZLA 3LT8A 1LVNA 3CPW2 4FCMA 2CWTA 2GSPA 2IY2A 1CYVA 1ZGXA 4FMAA 3IJEB 3RDEA 2KXGA 4JF8A 5DRVA 1TJDA 2CH9A 1GOVA 3MKIA 4N6TA 1OPYA 2K0MA 3CNMA 2GEYA 4XB5A 1N8QA 3M8CA 1VQ83 1BOXA 1G0TA 1UGHI 2CFDA 1B2XA 1GD3A 3N54B 3B4OA 3AMOB 1R4YA 1IT7A 1W2ZA 1N8R4 1AVKA 3EF8A 1B21A 1MGRA 4RZMA 4XBYA 3G713 3KSED 1YNVX 2F5MA 3RGAA 3CME3 4WWUC 3K0ZA 2CWUA 7GSPA 1Y4KA 3U1WA 2BHMA 3X41A 1LQGC 2R4IA 3CNXA 2W0QA 2L4VA 1G96A 1GY7A 1W6GA 2HOHA 5D82A 2W03A 5BXQA 2Z6BA 4HKVB 1MOLA 3BLZA 3WA2X 4STDA 3CXC2 4NREA 2ZL8A 3FH1A 3K9MC 1JBSA 3DGNA 4DKIA 3CPOA 4KZ1A 2C10A 5KP1A 1AY7A 4BTYA 1Q824 1DMQA 6GSPA 3LT9A 3FG4A 1BANA 1K28A 1UGIA 1IVUA 1LQMB 1O7PB 3UNLA 3B7CA 1VQL3 2H0HA 2P38A 1RN7A 1FUWA 5HOHA 2RBIA 2SBLA 3NHXA 3EB8A 1F8NA 4IPBA 5CF1A 1W5ZA 1C7HA 1ZS7A 2W9QA 3OXAA 2Z76A 3AGOA 4HM8B 4CJNA 3WOEB 3PGBA 1IVXA 1GMQA 4NHFA 2W2CA 4LSOA 5AI1A 3WODG 4GSPA 2XF3A 1Q40B 4K61A 5G1KA 3N9HA 2OOVC 1YI23 3F7SA 1BSAA 3GZYB 1RRHA 1BRGA 4KT3B 3ER7A 1Q7Y4 1JN5A 5G2GA 2CG1A 1JB4A 3A76A 3UL6A 1NB5I 1YIJ3 3EBTA 3F8HA 3HIIA 3UJMA 4HYZA 1BNRA 2P0XA 1MWSA 3O8YA 1MGWA 1LOYA 3D4AA 2PNCA 1V74A 3DGLA 1JBTA 1W6CA 1ULIB 5HGRA 1O7GB 1V58A 2YFIB 5GSPA 3EHCA 2FXTA 1NWWA 2BMRB 1JN5B 4HM3B 4HVNA 1X1YA 1DVCA 1W01A 4AEQA 1EEJA 1Z1SA 1D6UA 3HI7A 3VF1A 1YJW3 4EBGA 2PZVA 4ILFA 5CK6A 1K41A 1FGTA 5JBSA 3HIGA 3WDGB 4G1MB 2Q07A 3V92A 1BRHA 1A2KA 3KN4A 3NQZA 4MMYB 4U13A 1YJ93 3WOFB 1Q864 1N9EA 1IVWA 1GYBA 3NX0A 1O7WB 2H0GA 1YVSA 5I97A 2UX0A 3PS8A 3PZWA 1FYSA 3CCR3 3FF2A 5CLKA 1LRAA 1GOUA 4N6NB 1DETA 3K7CA 3N8BA 1GD4A 1JKGA 5IEOA 2GXFA 1E3VA 1G02A 1S5AA 1MWRA 3MYTA 4K90B 4LGQA 1LNIA 5AIGA 1KC84 2XGLA 1NO3A 2IUJA 3D5GA 5EQLA 7STDA
chains in the Genus database with same CATH topology
1W6YA 1IQ8A 1UW1A 1A2VA 1DVDA 1Q814 1JKGB 4IIAA 2RSXA 3CCR3 2HMMB 4OVMA 1GY6A 4R9KA 2QA43 2K54A 2YX9A 3NBRA 1W7CA 2OOVA 2E2TA 3EBYA 3K5TA 4HZ9B 4HM1B 1RRLA 1WMOA 1WTHA 1GY5A 1QALA 3FF0A 4FCJA 5CF2A 4EC6A 3CCQ3 1WNHA 1FGQA 4RBNA 2RCDA 2XFTA 3D9RA 2CG0A 1ROAA 2WO0A 3NUVA 3CC23 2XSHB 5AYSC 4EV5A 1ZO2A 1OACA 1YIT3 3RGRA 4KVHA 3FCSB 3EQQB 2XGNA 2WOHA 3IMAB 2JDIH 1TFKA 3UL5A 4FR9A 1EG9B 2F99A 1K734 3GZRA 3I563 3LXUX 4WFOA 5AEWB 4N6LA 5KP4A 2I9WA 4HM7B 3NXJA 1W00A 4L8PA 4MJDA 4EV2A 1HKXA 1R4CA 1SIIA 1UUWB 3NV0B 1UI8A 4R9LA 1M9GA 4IT7A 1SQWA 4BTWA 3CCE3 3EX9A 2P09A 1JV2B 4XDVA 1VQ63 2W56B 1WMNA 4X2OA 2MC8A 2OTL3 4XM4A 2OQEC 3LOYA 1Q40A 5STDA 5KP3A 2XH9A 4O2HA 4J8TA 4HM5B 2CFWA 2Y74A 1KSIA 4FMDA 2Z7AA 3G8ZA 3T8NA 1N5HA 1N5PA 2HMJB 2INXA 1CEWI 4Q53A 4MMZB 3BNBA 3SX1A 5FW5A 2IMJA 2IA7A 1J2BA 1ZX2A 4H61A 3KSPA 1N9JA 1DYUA 3FSDA 4O8SA 1VQK3 1YVBI 3G16A 1U8CB 3PYJA 2JQ5A 3L0RA 1PFPA 3H3HA 2HMOB 2D1WA 1YHQ3 3FG3A 4AKZA 4XBXA 5AIFA 5FGOA 3VGNA 4WYKA 3OX9A 1NB3I 1OGXA 5BVBA 1ASKA 3GZXB 3FGYA 3MPHA 1IU7A 3CC43 1BUQA 3EJVA 4FMCA 3G6E3 5IF6A 3LH4A 3VSYA 5LC7A 4O02B 4HBRA 2OWPA 8CHOA 1AV4A 6STDA 3CD63 1Q42A 3B4PA 4WYKB 4EYCA 3CCU3 3NM2A 3TDGA 5EVHA 4QWTA 4J9AA 1VQ53 2OCTA 1A67A 4WP5A 4I4KA 3SEDA 1QAKA 4N6OB 2E2VA 2CW9A 5AYRB 3G0KA 1QMAA 3T0UA 2LYXA 5D81A 3V98A 2D42A 1K8A4 2V1LA 3BB9A 4LEHA 1D6YA 3STDA 2C11A 3BNDA 1NDOB 2CHCA 1OGZA 2OQEA 3HX8A 4KFFA 5A0OB 1IQYA 3FLJA 3Q2PA 2Z77A 3F9SA 1LXEA 3Q90A 2RGQA 1EA2A 2QEX3 1SPUA 1FA3A 1W02A 3U97A 4HM2B 3SLUA 1W4NA 3CCJ3 2ZDJA 1VQ43 1DMMA 2RFRA 1IDPA 1S723 2O3OA 4HZBB 2IUKA 2ML5A 2OTJ3 3GRDA 1MNLA 2B1XB 5IG3A 3CCM3 4FMBA 3SOYA 3H51A 2BT3A 3NQYA 1OCVA 3UB1A 1RJOA 4X2HA 5AIHA 1M904 4AKYA 4KFDA 2W6JH 3KIIA 3PCSA 2CK3H 3MSOA 5JPUA 1WQLB 5DREA 4EXRA 1TU5A 2F98A 1M1K4 3MG3A 3CCS3 1O7NB 5EEOA 2WGQA 3LYGA 5IENA 1W2B2 3S29A 1CQSA 1STDA 1U5OA 2BMOB 3CCL3 1QAFA 2XSOB 3F40A 3LTAA 3X40A 3I553 3CPW2 3Q1CA 1OF5B 4HM6B 4N6MA 4HM4B 3DY5A 5ELJA 5IG4A 3NV0A 4GB5A 4N6V0 5IW9A 3X3ZA 1HU9A 1TP6A 2WOFA 1O7HB 2XEPA 1EKMA 2CFKA 2ML6A 1NU3A 1YGEA 1KWIA 3MWZA 2W56A 5IEPA 3I0YA 5CXOA 2XFSA 3PCRA 3FG1A 4L8OA 3JUOA 2WGOA 3EN1B 2YFJB 3D3LA 1STFI 4WHAA 1VQN3 4R1KA 1CYUA 3OWSA 2STDA 1VQ73 4TX4A 1LOXA 2P0MA 3BNEA 3DM8A 4L7KA 4R80A 2A15A 1OH0A 1JB2A 1O7MB 4ORLA 4ZM8A 2GBWB 2XR8B 1PU4A 1ULJB 3X3XA 3GZBA 4CDLA 1TUHA 4K1UA 2CKFB 4R4KA 1OHPA 2HMLB 3X3YA 1GS3A 3NBJA 1JJ22 3MG1A 2W04A 1SIHA 3SXXA 4GL6A 3SOAA 4N3VA 2CWVA 5JPPA 4K1VA 3CCV3 5IG5A 4MMXB 2BNGA 4XBTA 2KRTA 2Y73A 3OWYA 3JUPA 3X42A 4KFEA 1SJWA 1TIJA 2W9PA 3B8LA 1JNQA 1T5YA 3ECFA 3KZTA 3MG2A 5TGNA 4N6UA 2MF7A 1VQ93 3DGMA 4HJLB 4LMIA 3V99A 1VQM3 4RNZA 4JRFA 3OV4A 2LQVA 3F8XA 1LNHA 1IK3A 1YJN3 1QVG2 3S5CA 1WMPA 1DMNA 5AIIA 1FGMA 2QGUA 3WA3A 1OHSA 3EN8A 1NJI4 5IG0A 3JUMA 2HMNB 2KCDA 4BTXA 5IERA 2CC3A 3SVAA 1QVF2 3J7Yd 1KD14 3HK4A 1UUVB 4H3UA 5ELUA 4CCVA 1IV7A 2FGTA 3LTCA 3QRDA 3T8UA 2BO9B 2HMKB 5AEUB 4MEIA 2E2UA 3KKGA 1EQKA 2YFLB 3ROBA 3IPTA 1UI7A 3NM7A 2BMQB 2O9UX 3NBBA 1VQP3 2CFLA 1ISKA 1IQXA 1FGOA 3LZAA 3F7XA 1JRQA 3ALAA 3LTBA 2GU1A 4XDWA 3DGOA 3PXMA 4RNYA 1A90A 3JUQA 3LMLA 1AVLA 2GU3A 1FGRA 3EC9A 4PEJA 3G4S3 4FCZA 3E99A 2GEXA 3S28A 1E3RA 2GBXB 1OUNA 3F14A 3CMA3 2QIYA 3MHEA 4HM0B 3GWRA 1K9M4 3KE7A 3EE1A 3JUNA 1ROVA 3K63A 3DUKA 1JB5A 3KFQC 5LC6A 2M7OA 3S27A 4O3VA 3S67A 1E97A 3DMCA 1VQO3 1L5GB 4OK0A 1IVVA 1VZZA 1OF5A 3GAXA 2XRXB 2CIUA 4LZIA 2B24B 3LTDA 3FZWA 4OUQA 1RKYA 3OW22 2F86B 2FNQA 3DXOA 3JVCA 1D6ZA 1AR0A 3HZPA 3CC73 3OWUA 3FKAA 3CU3A 3WMDA 1US1A 1QJGA 3QK9A 5D83A 1M1XB 2CFGA 1OHOA 3BNCA 1IT8A 1KQS2 1IV9A 1TFOA 3DZLA 3AMOA 2P05A 3LT8A 1LVNA 4FCMA 2CWTA 1CYVA 3RDEA 4FMAA 3IJEB 2KXGA 4JF8A 5DRVA 2CH9A 3MKIA 4N6TA 1OPYA 2K0MA 3CNMA 2GEYA 4XB5A 1N8QA 3M8CA 1VQ83 2CFDA 1GD3A 3N54B 3B4OA 3AMOB 1IT7A 1W2ZA 1N8R4 1AVKA 3EF8A 4XBYA 3G713 4RZMA 3KSED 3CME3 3RGAA 4WWUC 3K0ZA 2CWUA 1Y4KA 3U1WA 2BHMA 3X41A 2R4IA 3CNXA 2W0QA 2L4VA 1G96A 1GY7A 1W6GA 5D82A 2W03A 5BXQA 2Z6BA 4HKVB 1MOLA 3BLZA 3WA2X 4STDA 3CXC2 4NREA 2ZL8A 3FH1A 3K9MC 3DGNA 3CPOA 4KZ1A 2C10A 5KP1A 4BTYA 1Q824 1DMQA 3LT9A 3FG4A 1K28A 1VQL3 1IVUA 1FUWA 1O7PB 3UNLA 3B7CA 2P38A 1RN7A 2SBLA 3NHXA 3EB8A 1F8NA 4IPBA 5CF1A 1W5ZA 1C7HA 2W9QA 3OXAA 2Z76A 4HM8B 3WOEB 3PGBA 1IVXA 4NHFA 5AI1A 2W2CA 4LSOA 3WODG 2XF3A 1Q40B 4K61A 3N9HA 2OOVC 1YI23 3F7SA 3GZYB 1RRHA 1NB5I 3ER7A 1Q7Y4 1JN5A 5G2GA 2CG1A 1JB4A 3A76A 3UL6A 1YIJ3 3EBTA 3F8HA 3HIIA 3UJMA 4HYZA 2P0XA 3O8YA 2PNCA 1V74A 3DGLA 1W6CA 1ULIB 5HGRA 1O7GB 2YFIB 3EHCA 2FXTA 1NWWA 2BMRB 1JN5B 4HM3B 4HVNA 1DVCA 1W01A 4AEQA 1Z1SA 1D6UA 3HI7A 3VF1A 1YJW3 4EBGA 2PZVA 5CK6A 1K41A 1FGTA 5JBSA 3HIGA 3WDGB 4G1MB 2Q07A 3V92A 1A2KA 3KN4A 3NQZA 4MMYB 4U13A 1YJ93 3WOFB 1Q864 1N9EA 1IVWA 1GYBA 3NX0A 1O7WB 5I97A 2UX0A 3PS8A 3PZWA 3FF2A 5CLKA 4N6NB 3K7CA 3N8BA 1GD4A 1JKGA 5IEOA 2GXFA 1E3VA 1S5AA 3MYTA 4K90B 4LGQA 5AIGA 1KC84 2XGLA 1NO3A 2IUJA 5EQLA 7STDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CMA 3;  1VQ5 3;  3CC4 3;  1VQL 3;  1YJ9 3;  3CCJ 3;  1K9M 4;  1VQ9 3;  1VQM 3;  1Q86 4;  1VQ4 3;  1S72 3;  1N8R 4;  2OTJ 3;  3G71 3;  1YJN 3;  3CCM 3;  3I55 3;  3CCR 3;  1Q81 4;  1QVG 2;  1VQO 3;  1K73 4;  1KQS 2;  3CME 3;  3I56 3;  2QA4 3;  1JJ2 2;  3G6E 3;  1YIT 3;  1M90 4;  1K8A 4;  2OTL 3;  1VQP 3;  1NJI 4;  3CCQ 3;  1Q7Y 4;  3CD6 3;  1VQN 3;  3CCU 3;  3CCV 3;  3CXC 2;  1M1K 4;  1VQ7 3;  1YJW 3;  3CCE 3;  1VQK 3;  3CCS 3;  3OW2 2;  1YI2 3;  1W2B 2;  1YHQ 3;  3G4S 3;  1KC8 4;  1QVF 2;  1VQ6 3;  1VQ8 3;  3CCL 3;  1Q82 4;  3CC7 3;  1KD1 4;  3CC2 3;  3CPW 2;  2QEX 3;  1YIJ 3; 
#chains in the Genus database with same CATH topology
 1I0V A;  1BU4 A;  2KF5 A;  5RNT A;  1W6Y A;  1IQ8 A;  1UW1 A;  1I0X A;  1A2V A;  1DVD A;  1Q81 4;  1JKG B;  2RNT A;  2RSX A;  1HYF A;  2HMM B;  4IIA A;  1GY6 A;  4OVM A;  4R9K A;  2K54 A;  2QA4 3;  2YX9 A;  3NBR A;  1W7C A;  2OOV A;  2E2T A;  3EBY A;  3AHS A;  3K5T A;  4HM1 B;  4HZ9 B;  1RRL A;  1WMO A;  1WTH A;  1GY5 A;  1QAL A;  3FF0 A;  4FCJ A;  5CF2 A;  4EC6 A;  3CCQ 3;  1WNH A;  1FGQ A;  4RBN A;  1BSC A;  1T3B A;  2RCD A;  2XFT A;  3D9R A;  2CG0 A;  1ROA A;  2WO0 A;  3NUV A;  3CC2 3;  2XSH B;  5AYS C;  4EV5 A;  1ZO2 A;  1EUI C;  1OAC A;  1YIT 3;  3RGR A;  4KVH A;  3FCS B;  3EQQ B;  2XGN A;  2WOH A;  3IMA B;  2JDI H;  1TFK A;  3SYU A;  1B2U A;  3UL5 A;  4FR9 A;  1EG9 B;  1VQQ A;  2F99 A;  1K73 4;  3GZR A;  3I56 3;  3LXU X;  4WFO A;  5AEW B;  4N6L A;  5KP4 A;  1B2Z A;  2I9W A;  4HM7 B;  3NXJ A;  1W00 A;  4L8P A;  4MJD A;  4EV2 A;  1HKX A;  1R4C A;  1SII A;  1UUW B;  3NV0 B;  1UI8 A;  4R9L A;  1M9G A;  4IT7 A;  1SQW A;  1V57 A;  4BTW A;  1X1W A;  3EX9 A;  3CCE 3;  2P09 A;  1JV2 B;  1GSP A;  4XDV A;  1VQ6 3;  2W56 B;  1WMN A;  1TRP A;  4X2O A;  2MC8 A;  2OTL 3;  4XM4 A;  2OQE C;  1T2H A;  3RNT A;  3LOY A;  1Q40 A;  1BRS A;  5STD A;  1JZO A;  5KP3 A;  2XH9 A;  3AHW A;  2F56 A;  4O2H A;  1RDS A;  2SAR A;  4J8T A;  4HM5 B;  2CFW A;  1B20 A;  2Y74 A;  1KSI A;  4FMD A;  1FUT A;  2Z7A A;  3G8Z A;  3T8N A;  1B3S A;  1N5H A;  1N5P A;  1RGG A;  2HMJ B;  2INX A;  1CEW I;  1RNT A;  2AAE A;  4MMZ B;  4Q53 A;  3BNB A;  3SX1 A;  5FW5 A;  2IMJ A;  2IA7 A;  1J2B A;  1ZX2 A;  4H61 A;  4BIR A;  3KSP A;  1N9J A;  1DYU A;  1RTU A;  3FSD A;  4O8S A;  1YVB I;  3G16 A;  1VQK 3;  1U8C B;  1RGC A;  2JQ5 A;  3PYJ A;  3L0R A;  1PFP A;  1BRI A;  2HMO B;  2D1W A;  2K3D A;  3H3H A;  4BL2 A;  3FG3 A;  1YHQ 3;  3URP A;  4AKZ A;  4XBX A;  5AIF A;  5FGO A;  3VGN A;  4WYK A;  3OX9 A;  1NB3 I;  1OGX A;  5BVB A;  1ASK A;  3GZX B;  3FGY A;  7RNT A;  1UDI I;  3MPH A;  1IU7 A;  3CC4 3;  1BUQ A;  3EJV A;  5BU4 A;  1UCJ A;  4FMC A;  3G6E 3;  3ZG5 A;  1BRK A;  5IF6 A;  1I2E A;  4NPB A;  2KF4 A;  3LH4 A;  3VSY A;  1GOY A;  5LC7 A;  4O02 B;  4HBR A;  4BL3 A;  2OWP A;  8CHO A;  1AV4 A;  4I5Q A;  6STD A;  3CD6 3;  1Q42 A;  3B4P A;  4WYK B;  4EYC A;  3CCU 3;  3NM2 A;  3TDG A;  5EVH A;  1CH0 A;  4QWT A;  1BNS A;  4HAA A;  4J5K A;  4J9A A;  1PY3 A;  1VQ5 3;  2OCT A;  1GMP A;  1A67 A;  4WP5 A;  1RN4 A;  4I4K A;  3SED A;  1QAK A;  4N6O B;  2E2V A;  2CW9 A;  5AYR B;  3G0K A;  3WHO A;  1QMA A;  4BU4 A;  8RNT A;  1I3I A;  3T0U A;  2LYX A;  5D81 A;  3V98 A;  2D42 A;  1Q9E A;  2V1L A;  1K8A 4;  3BB9 A;  4LEH A;  1FW7 A;  1D6Y A;  1I3F A;  3DGY A;  1BNG A;  2C11 A;  3BND A;  3STD A;  1NDO B;  2CHC A;  1C54 A;  1LOV A;  1OGZ A;  2OQE A;  3HX8 A;  4KFF A;  5A0O B;  1I70 A;  1BRJ A;  1IQY A;  1RLS A;  3FLJ A;  3Q2P A;  2Z77 A;  1BNF A;  3DH2 A;  3F9S A;  1LXE A;  1B2S A;  3Q90 A;  2RGQ A;  1EA2 A;  1BNI A;  1AQZ A;  2QEX 3;  1SPU A;  1FA3 A;  1W02 A;  3U97 A;  4HM2 B;  3SLU A;  1W4N A;  3CCJ 3;  2ZDJ A;  1VQ4 3;  1DMM A;  2RFR A;  1IDP A;  1S72 3;  1BIR A;  2O3O A;  2IUK A;  2ML5 A;  4HZB B;  2OTJ 3;  1BNE A;  1MNL A;  1RGK A;  2B1X B;  3GRD A;  5IG3 A;  3CCM 3;  1BUJ A;  4FMB A;  3SOY A;  3H51 A;  2BT3 A;  4LYL B;  3NQY A;  2IYJ A;  1OCV A;  3UB1 A;  1RJO A;  4X2H A;  5AIH A;  1M90 4;  4AKY A;  4KFD A;  1MWU A;  2W6J H;  4RNT A;  3KII A;  3PCS A;  1JZD A;  2CK3 H;  3MSO A;  5JPU A;  1WQL B;  5DRE A;  4EXR A;  3ZFZ A;  2F98 A;  1TU5 A;  1M1K 4;  3MG3 A;  4EW5 A;  3CCS 3;  1O7N B;  5EEO A;  2WGQ A;  3LYG A;  5IEN A;  1W2B 2;  1PYL A;  3S29 A;  1Q7H A;  1CQS A;  1STD A;  1U5O A;  2BMO B;  3CCL 3;  1QAF A;  2XSO B;  3F40 A;  3LTA A;  3X40 A;  4CPK A;  3I55 3;  3KCH A;  1OF5 B;  3D5I A;  3Q1C A;  4HM6 B;  4HM4 B;  4N6M A;  3DY5 A;  2BU4 A;  5ELJ A;  3NV0 A;  4GB5 A;  4N6V 0;  5IG4 A;  3X3Z A;  5IW9 A;  1HU9 A;  1TP6 A;  2WOF A;  5M19 A;  1O7H B;  1RCK A;  2XEP A;  1EKM A;  2CFK A;  2ML6 A;  1NU3 A;  2BIR A;  1YGE A;  1UCI A;  1KWI A;  3MWZ A;  2W56 A;  3HOH A;  3I0Y A;  5IEP A;  5CXO A;  2XFS A;  3PCR A;  3FG1 A;  4L8O A;  3BIR A;  2WGO A;  3JUO A;  3EN1 B;  2YFJ B;  3D3L A;  2UUG C;  1STF I;  4WHA A;  3ZG0 A;  1VQN 3;  4R1K A;  1CYU A;  1BGS A;  1BSD A;  3OWS A;  2STD A;  1VQ7 3;  4TX4 A;  1LOX A;  2P0M A;  3BNE A;  3DM8 A;  3Q3F A;  4L7K A;  1RHL A;  4R80 A;  1RGL A;  2A15 A;  1OH0 A;  1JB2 A;  1O7M B;  4ORL A;  4ZM8 A;  2GBW B;  1RGA A;  6RNT A;  2XR8 B;  1FUS A;  1PU4 A;  1ULJ B;  3X3X A;  3GZB A;  2C4B A;  1RGE A;  4CDL A;  1BNJ A;  1TUH A;  4K1U A;  2CKF B;  4R4K A;  1OHP A;  1HZ1 A;  1BVI A;  1LOW A;  2HML B;  2CX0 A;  3X3Y A;  1GS3 A;  3NBJ A;  1JJ2 2;  2AAD A;  3MG1 A;  1BRN L;  1DE3 A;  2W04 A;  1SIH A;  1TRQ A;  3SXX A;  4GL6 A;  3SOA A;  4N3V A;  1RGF A;  1RCL A;  2CWV A;  5JPP A;  4K1V A;  3CCV 3;  3WR2 A;  5IG5 A;  4MMX B;  2BNG A;  4XBT A;  2KRT A;  2Y73 A;  9RNT A;  3OWY A;  3JUP A;  3X42 A;  1RSN A;  2KF3 A;  1A2P A;  1SJW A;  4HOH A;  4KFE A;  1TIJ A;  2W9P A;  3B8L A;  1JNQ A;  5M1A A;  1T5Y A;  3AGN A;  3ECF A;  1RN1 A;  3KZT A;  3MG2 A;  5TGN A;  4N6U A;  1I2F A;  1SAR A;  1UCL A;  2MF7 A;  1VQ9 3;  3DGM A;  4HJL B;  4LMI A;  3V99 A;  1VQM 3;  4RNZ A;  4JRF A;  3OV4 A;  2LQV A;  4GHO A;  3F8X A;  1LNH A;  2KAA A;  3BU4 A;  1IK3 A;  1YJN 3;  1QVG 2;  1YGW A;  3S5C A;  1WMP A;  1DMN A;  2KF6 A;  5AII A;  1UUG B;  1FGM A;  2QGU A;  3WA3 A;  1OHS A;  3EN8 A;  1NJI 4;  5IG0 A;  1GMR A;  3JUM A;  2HMN B;  2KCD A;  4BTX A;  5IER A;  2CC3 A;  1BAO A;  3SVA A;  4J5G A;  1QVF 2;  3J7Y d;  3GSP A;  1KD1 4;  3HK4 A;  1UUV B;  4H3U A;  5ELU A;  4CCV A;  1IV7 A;  2F4Y A;  2FGT A;  3LTC A;  3QRD A;  3T8U A;  2BO9 B;  2HMK B;  1BSB A;  5AEU B;  4MEI A;  2E2U A;  3KKG A;  1EQK A;  1I8V A;  2YFL B;  3ROB A;  3IPT A;  5M18 A;  1UI7 A;  3NM7 A;  2BMQ B;  2O9U X;  3NBB A;  1VQP 3;  1IYY A;  2L1S A;  2CFL A;  1ISK A;  1IQX A;  1FGO A;  1FZU A;  3LZA A;  3F7X A;  1MWT A;  1JRQ A;  3ALA A;  3LTB A;  2GU1 A;  4XDW A;  3DGO A;  3PXM A;  4RNY A;  1A90 A;  1BSE A;  2ZA4 A;  3JUQ A;  3LML A;  1AVL A;  2GU3 A;  1FGR A;  3EC9 A;  4PEJ A;  3G4S 3;  4FCZ A;  3E99 A;  1T2I A;  2GEX A;  3S28 A;  1E3R A;  2GBX B;  1OUN A;  3F14 A;  3CMA 3;  2QIY A;  3MHE A;  4HM0 B;  1RMS A;  3GWR A;  1K9M 4;  3KE7 A;  3EE1 A;  3JUN A;  1ROV A;  3K63 A;  3DUK A;  1JB5 A;  3KFQ C;  5LC6 A;  2M7O A;  2F5W A;  5G1L A;  3S27 A;  4O3V A;  3S67 A;  1E97 A;  1TTO A;  3DMC A;  1VQO 3;  1L5G B;  4OK0 A;  1IVV A;  2J8X B;  1VZZ A;  2UGI A;  1B27 A;  1OF5 A;  3GAX A;  2XRX B;  2CIU A;  4LZI A;  1JBR A;  2B24 B;  2CX1 A;  1I2G A;  2H0I A;  1X1X A;  5BIR A;  3LTD A;  1B2M A;  3FZW A;  4OUQ A;  1RKY A;  3OW2 2;  2F86 B;  2FNQ A;  3DXO A;  2ZHX B;  3JVC A;  1D6Z A;  1AR0 A;  3HZP A;  3CC7 3;  3OWU A;  3FKA A;  3CU3 A;  1X1U A;  3WMD A;  1US1 A;  1QJG A;  3QK9 A;  1RGH A;  5D83 A;  3A5E A;  1M1X B;  2CFG A;  1RNB A;  1OHO A;  3BNC A;  2R41 A;  1UCK A;  1IT8 A;  1KQS 2;  3D79 A;  1IV9 A;  1TFO A;  1NNV A;  3AMO A;  2P05 A;  3DZL A;  3LT8 A;  1LVN A;  3CPW 2;  4FCM A;  2CWT A;  2GSP A;  2IY2 A;  1CYV A;  1ZGX A;  4FMA A;  3IJE B;  3RDE A;  2KXG A;  4JF8 A;  5DRV A;  1TJD A;  2CH9 A;  1GOV A;  3MKI A;  4N6T A;  1OPY A;  2K0M A;  3CNM A;  2GEY A;  4XB5 A;  1N8Q A;  3M8C A;  1VQ8 3;  1BOX A;  1G0T A;  1UGH I;  2CFD A;  1B2X A;  1GD3 A;  3N54 B;  3B4O A;  3AMO B;  1R4Y A;  1IT7 A;  1W2Z A;  1N8R 4;  1AVK A;  3EF8 A;  1B21 A;  1MGR A;  4RZM A;  4XBY A;  3G71 3;  3KSE D;  1YNV X;  2F5M A;  3RGA A;  3CME 3;  4WWU C;  3K0Z A;  2CWU A;  7GSP A;  1Y4K A;  3U1W A;  2BHM A;  3X41 A;  1LQG C;  2R4I A;  3CNX A;  2W0Q A;  2L4V A;  1G96 A;  1GY7 A;  1W6G A;  2HOH A;  5D82 A;  2W03 A;  5BXQ A;  2Z6B A;  4HKV B;  1MOL A;  3BLZ A;  3WA2 X;  4STD A;  3CXC 2;  4NRE A;  2ZL8 A;  3FH1 A;  3K9M C;  1JBS A;  3DGN A;  4DKI A;  3CPO A;  4KZ1 A;  2C10 A;  5KP1 A;  1AY7 A;  4BTY A;  1Q82 4;  1DMQ A;  6GSP A;  3LT9 A;  3FG4 A;  1BAN A;  1K28 A;  1UGI A;  1IVU A;  1LQM B;  1O7P B;  3UNL A;  3B7C A;  1VQL 3;  2H0H A;  2P38 A;  1RN7 A;  1FUW A;  5HOH A;  2RBI A;  2SBL A;  3NHX A;  3EB8 A;  1F8N A;  4IPB A;  5CF1 A;  1W5Z A;  1C7H A;  1ZS7 A;  2W9Q A;  3OXA A;  2Z76 A;  3AGO A;  4HM8 B;  4CJN A;  3WOE B;  3PGB A;  1IVX A;  1GMQ A;  4NHF A;  2W2C A;  4LSO A;  5AI1 A;  3WOD G;  4GSP A;  2XF3 A;  1Q40 B;  4K61 A;  5G1K A;  3N9H A;  2OOV C;  1YI2 3;  3F7S A;  1BSA A;  3GZY B;  1RRH A;  1BRG A;  4KT3 B;  3ER7 A;  1Q7Y 4;  1JN5 A;  5G2G A;  2CG1 A;  1JB4 A;  3A76 A;  3UL6 A;  1NB5 I;  1YIJ 3;  3EBT A;  3F8H A;  3HII A;  3UJM A;  4HYZ A;  1BNR A;  2P0X A;  1MWS A;  3O8Y A;  1MGW A;  1LOY A;  3D4A A;  2PNC A;  1V74 A;  3DGL A;  1JBT A;  1W6C A;  1ULI B;  5HGR A;  1O7G B;  1V58 A;  2YFI B;  5GSP A;  3EHC A;  2FXT A;  1NWW A;  2BMR B;  1JN5 B;  4HM3 B;  4HVN A;  1X1Y A;  1DVC A;  1W01 A;  4AEQ A;  1EEJ A;  1Z1S A;  1D6U A;  3HI7 A;  3VF1 A;  1YJW 3;  4EBG A;  2PZV A;  4ILF A;  5CK6 A;  1K41 A;  1FGT A;  5JBS A;  3HIG A;  3WDG B;  4G1M B;  2Q07 A;  3V92 A;  1BRH A;  1A2K A;  3KN4 A;  3NQZ A;  4MMY B;  4U13 A;  1YJ9 3;  3WOF B;  1Q86 4;  1N9E A;  1IVW A;  1GYB A;  3NX0 A;  1O7W B;  2H0G A;  1YVS A;  5I97 A;  2UX0 A;  3PS8 A;  3PZW A;  1FYS A;  3CCR 3;  3FF2 A;  5CLK A;  1LRA A;  1GOU A;  4N6N B;  1DET A;  3K7C A;  3N8B A;  1GD4 A;  1JKG A;  5IEO A;  2GXF A;  1E3V A;  1G02 A;  1S5A A;  1MWR A;  3MYT A;  4K90 B;  4LGQ A;  1LNI A;  5AIG A;  1KC8 4;  2XGL A;  1NO3 A;  2IUJ A;  3D5G A;  5EQL A;  7STD A; 
#chains in the Genus database with same CATH homology
 1W6Y A;  1IQ8 A;  1UW1 A;  1A2V A;  1DVD A;  1Q81 4;  1JKG B;  4IIA A;  2RSX A;  3CCR 3;  2HMM B;  4OVM A;  1GY6 A;  4R9K A;  2QA4 3;  2K54 A;  2YX9 A;  3NBR A;  1W7C A;  2OOV A;  2E2T A;  3EBY A;  3K5T A;  4HZ9 B;  4HM1 B;  1RRL A;  1WMO A;  1WTH A;  1GY5 A;  1QAL A;  3FF0 A;  4FCJ A;  5CF2 A;  4EC6 A;  3CCQ 3;  1WNH A;  1FGQ A;  4RBN A;  2RCD A;  2XFT A;  3D9R A;  2CG0 A;  1ROA A;  2WO0 A;  3NUV A;  3CC2 3;  2XSH B;  5AYS C;  4EV5 A;  1ZO2 A;  1OAC A;  1YIT 3;  3RGR A;  4KVH A;  3FCS B;  3EQQ B;  2XGN A;  2WOH A;  3IMA B;  2JDI H;  1TFK A;  3UL5 A;  4FR9 A;  1EG9 B;  2F99 A;  1K73 4;  3GZR A;  3I56 3;  3LXU X;  4WFO A;  5AEW B;  4N6L A;  5KP4 A;  2I9W A;  4HM7 B;  3NXJ A;  1W00 A;  4L8P A;  4MJD A;  4EV2 A;  1HKX A;  1R4C A;  1SII A;  1UUW B;  3NV0 B;  1UI8 A;  4R9L A;  1M9G A;  4IT7 A;  1SQW A;  4BTW A;  3CCE 3;  3EX9 A;  2P09 A;  1JV2 B;  4XDV A;  1VQ6 3;  2W56 B;  1WMN A;  4X2O A;  2MC8 A;  2OTL 3;  4XM4 A;  2OQE C;  3LOY A;  1Q40 A;  5STD A;  5KP3 A;  2XH9 A;  4O2H A;  4J8T A;  4HM5 B;  2CFW A;  2Y74 A;  1KSI A;  4FMD A;  2Z7A A;  3G8Z A;  3T8N A;  1N5H A;  1N5P A;  2HMJ B;  2INX A;  1CEW I;  4Q53 A;  4MMZ B;  3BNB A;  3SX1 A;  5FW5 A;  2IMJ A;  2IA7 A;  1J2B A;  1ZX2 A;  4H61 A;  3KSP A;  1N9J A;  1DYU A;  3FSD A;  4O8S A;  1VQK 3;  1YVB I;  3G16 A;  1U8C B;  3PYJ A;  2JQ5 A;  3L0R A;  1PFP A;  3H3H A;  2HMO B;  2D1W A;  1YHQ 3;  3FG3 A;  4AKZ A;  4XBX A;  5AIF A;  5FGO A;  3VGN A;  4WYK A;  3OX9 A;  1NB3 I;  1OGX A;  5BVB A;  1ASK A;  3GZX B;  3FGY A;  3MPH A;  1IU7 A;  3CC4 3;  1BUQ A;  3EJV A;  4FMC A;  3G6E 3;  5IF6 A;  3LH4 A;  3VSY A;  5LC7 A;  4O02 B;  4HBR A;  2OWP A;  8CHO A;  1AV4 A;  6STD A;  3CD6 3;  1Q42 A;  3B4P A;  4WYK B;  4EYC A;  3CCU 3;  3NM2 A;  3TDG A;  5EVH A;  4QWT A;  4J9A A;  1VQ5 3;  2OCT A;  1A67 A;  4WP5 A;  4I4K A;  3SED A;  1QAK A;  4N6O B;  2E2V A;  2CW9 A;  5AYR B;  3G0K A;  1QMA A;  3T0U A;  2LYX A;  5D81 A;  3V98 A;  2D42 A;  1K8A 4;  2V1L A;  3BB9 A;  4LEH A;  1D6Y A;  3STD A;  2C11 A;  3BND A;  1NDO B;  2CHC A;  1OGZ A;  2OQE A;  3HX8 A;  4KFF A;  5A0O B;  1IQY A;  3FLJ A;  3Q2P A;  2Z77 A;  3F9S A;  1LXE A;  3Q90 A;  2RGQ A;  1EA2 A;  2QEX 3;  1SPU A;  1FA3 A;  1W02 A;  3U97 A;  4HM2 B;  3SLU A;  1W4N A;  3CCJ 3;  2ZDJ A;  1VQ4 3;  1DMM A;  2RFR A;  1IDP A;  1S72 3;  2O3O A;  4HZB B;  2IUK A;  2ML5 A;  2OTJ 3;  3GRD A;  1MNL A;  2B1X B;  5IG3 A;  3CCM 3;  4FMB A;  3SOY A;  3H51 A;  2BT3 A;  3NQY A;  1OCV A;  3UB1 A;  1RJO A;  4X2H A;  5AIH A;  1M90 4;  4AKY A;  4KFD A;  2W6J H;  3KII A;  3PCS A;  2CK3 H;  3MSO A;  5JPU A;  1WQL B;  5DRE A;  4EXR A;  1TU5 A;  2F98 A;  1M1K 4;  3MG3 A;  3CCS 3;  1O7N B;  5EEO A;  2WGQ A;  3LYG A;  5IEN A;  1W2B 2;  3S29 A;  1CQS A;  1STD A;  1U5O A;  2BMO B;  3CCL 3;  1QAF A;  2XSO B;  3F40 A;  3LTA A;  3X40 A;  3I55 3;  3CPW 2;  3Q1C A;  1OF5 B;  4HM6 B;  4N6M A;  4HM4 B;  3DY5 A;  5ELJ A;  5IG4 A;  3NV0 A;  4GB5 A;  4N6V 0;  5IW9 A;  3X3Z A;  1HU9 A;  1TP6 A;  2WOF A;  1O7H B;  2XEP A;  1EKM A;  2CFK A;  2ML6 A;  1NU3 A;  1YGE A;  1KWI A;  3MWZ A;  2W56 A;  5IEP A;  3I0Y A;  5CXO A;  2XFS A;  3PCR A;  3FG1 A;  4L8O A;  3JUO A;  2WGO A;  3EN1 B;  2YFJ B;  3D3L A;  1STF I;  4WHA A;  1VQN 3;  4R1K A;  1CYU A;  3OWS A;  2STD A;  1VQ7 3;  4TX4 A;  1LOX A;  2P0M A;  3BNE A;  3DM8 A;  4L7K A;  4R80 A;  2A15 A;  1OH0 A;  1JB2 A;  1O7M B;  4ORL A;  4ZM8 A;  2GBW B;  2XR8 B;  1PU4 A;  1ULJ B;  3X3X A;  3GZB A;  4CDL A;  1TUH A;  4K1U A;  2CKF B;  4R4K A;  1OHP A;  2HML B;  3X3Y A;  1GS3 A;  3NBJ A;  1JJ2 2;  3MG1 A;  2W04 A;  1SIH A;  3SXX A;  4GL6 A;  3SOA A;  4N3V A;  2CWV A;  5JPP A;  4K1V A;  3CCV 3;  5IG5 A;  4MMX B;  2BNG A;  4XBT A;  2KRT A;  2Y73 A;  3OWY A;  3JUP A;  3X42 A;  4KFE A;  1SJW A;  1TIJ A;  2W9P A;  3B8L A;  1JNQ A;  1T5Y A;  3ECF A;  3KZT A;  3MG2 A;  5TGN A;  4N6U A;  2MF7 A;  1VQ9 3;  3DGM A;  4HJL B;  4LMI A;  3V99 A;  1VQM 3;  4RNZ A;  4JRF A;  3OV4 A;  2LQV A;  3F8X A;  1LNH A;  1IK3 A;  1YJN 3;  1QVG 2;  3S5C A;  1WMP A;  1DMN A;  5AII A;  1FGM A;  2QGU A;  3WA3 A;  1OHS A;  3EN8 A;  1NJI 4;  5IG0 A;  3JUM A;  2HMN B;  2KCD A;  4BTX A;  5IER A;  2CC3 A;  3SVA A;  1QVF 2;  3J7Y d;  1KD1 4;  3HK4 A;  1UUV B;  4H3U A;  5ELU A;  4CCV A;  1IV7 A;  2FGT A;  3LTC A;  3QRD A;  3T8U A;  2BO9 B;  2HMK B;  5AEU B;  4MEI A;  2E2U A;  3KKG A;  1EQK A;  2YFL B;  3ROB A;  3IPT A;  1UI7 A;  3NM7 A;  2BMQ B;  2O9U X;  3NBB A;  1VQP 3;  2CFL A;  1ISK A;  1IQX A;  1FGO A;  3LZA A;  3F7X A;  1JRQ A;  3ALA A;  3LTB A;  2GU1 A;  4XDW A;  3DGO A;  3PXM A;  4RNY A;  1A90 A;  3JUQ A;  3LML A;  1AVL A;  2GU3 A;  1FGR A;  3EC9 A;  4PEJ A;  3G4S 3;  4FCZ A;  3E99 A;  2GEX A;  3S28 A;  1E3R A;  2GBX B;  1OUN A;  3F14 A;  3CMA 3;  2QIY A;  3MHE A;  4HM0 B;  3GWR A;  1K9M 4;  3KE7 A;  3EE1 A;  3JUN A;  1ROV A;  3K63 A;  3DUK A;  1JB5 A;  3KFQ C;  5LC6 A;  2M7O A;  3S27 A;  4O3V A;  3S67 A;  1E97 A;  3DMC A;  1VQO 3;  1L5G B;  4OK0 A;  1IVV A;  1VZZ A;  1OF5 A;  3GAX A;  2XRX B;  2CIU A;  4LZI A;  2B24 B;  3LTD A;  3FZW A;  4OUQ A;  1RKY A;  3OW2 2;  2F86 B;  2FNQ A;  3DXO A;  3JVC A;  1D6Z A;  1AR0 A;  3HZP A;  3CC7 3;  3OWU A;  3FKA A;  3CU3 A;  3WMD A;  1US1 A;  1QJG A;  3QK9 A;  5D83 A;  1M1X B;  2CFG A;  1OHO A;  3BNC A;  1IT8 A;  1KQS 2;  1IV9 A;  1TFO A;  3DZL A;  3AMO A;  2P05 A;  3LT8 A;  1LVN A;  4FCM A;  2CWT A;  1CYV A;  3RDE A;  4FMA A;  3IJE B;  2KXG A;  4JF8 A;  5DRV A;  2CH9 A;  3MKI A;  4N6T A;  1OPY A;  2K0M A;  3CNM A;  2GEY A;  4XB5 A;  1N8Q A;  3M8C A;  1VQ8 3;  2CFD A;  1GD3 A;  3N54 B;  3B4O A;  3AMO B;  1IT7 A;  1W2Z A;  1N8R 4;  1AVK A;  3EF8 A;  4XBY A;  3G71 3;  4RZM A;  3KSE D;  3CME 3;  3RGA A;  4WWU C;  3K0Z A;  2CWU A;  1Y4K A;  3U1W A;  2BHM A;  3X41 A;  2R4I A;  3CNX A;  2W0Q A;  2L4V A;  1G96 A;  1GY7 A;  1W6G A;  5D82 A;  2W03 A;  5BXQ A;  2Z6B A;  4HKV B;  1MOL A;  3BLZ A;  3WA2 X;  4STD A;  3CXC 2;  4NRE A;  2ZL8 A;  3FH1 A;  3K9M C;  3DGN A;  3CPO A;  4KZ1 A;  2C10 A;  5KP1 A;  4BTY A;  1Q82 4;  1DMQ A;  3LT9 A;  3FG4 A;  1K28 A;  1VQL 3;  1IVU A;  1FUW A;  1O7P B;  3UNL A;  3B7C A;  2P38 A;  1RN7 A;  2SBL A;  3NHX A;  3EB8 A;  1F8N A;  4IPB A;  5CF1 A;  1W5Z A;  1C7H A;  2W9Q A;  3OXA A;  2Z76 A;  4HM8 B;  3WOE B;  3PGB A;  1IVX A;  4NHF A;  5AI1 A;  2W2C A;  4LSO A;  3WOD G;  2XF3 A;  1Q40 B;  4K61 A;  3N9H A;  2OOV C;  1YI2 3;  3F7S A;  3GZY B;  1RRH A;  1NB5 I;  3ER7 A;  1Q7Y 4;  1JN5 A;  5G2G A;  2CG1 A;  1JB4 A;  3A76 A;  3UL6 A;  1YIJ 3;  3EBT A;  3F8H A;  3HII A;  3UJM A;  4HYZ A;  2P0X A;  3O8Y A;  2PNC A;  1V74 A;  3DGL A;  1W6C A;  1ULI B;  5HGR A;  1O7G B;  2YFI B;  3EHC A;  2FXT A;  1NWW A;  2BMR B;  1JN5 B;  4HM3 B;  4HVN A;  1DVC A;  1W01 A;  4AEQ A;  1Z1S A;  1D6U A;  3HI7 A;  3VF1 A;  1YJW 3;  4EBG A;  2PZV A;  5CK6 A;  1K41 A;  1FGT A;  5JBS A;  3HIG A;  3WDG B;  4G1M B;  2Q07 A;  3V92 A;  1A2K A;  3KN4 A;  3NQZ A;  4MMY B;  4U13 A;  1YJ9 3;  3WOF B;  1Q86 4;  1N9E A;  1IVW A;  1GYB A;  3NX0 A;  1O7W B;  5I97 A;  2UX0 A;  3PS8 A;  3PZW A;  3FF2 A;  5CLK A;  4N6N B;  3K7C A;  3N8B A;  1GD4 A;  1JKG A;  5IEO A;  2GXF A;  1E3V A;  1S5A A;  3MYT A;  4K90 B;  4LGQ A;  5AIG A;  1KC8 4;  2XGL A;  1NO3 A;  2IUJ A;  5EQL A;  7STD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...