1UCLA

Mutants of rnase sa
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
96
structure length
96
Chain Sequence
DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTTITPGARTRGTRRIITGEATQEDYYTGDHYATFSLIDQTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The contribution of polar group burial to protein stability is strongly context-dependent
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase
molecule keywords Guanyl-specific ribonuclease Sa
total genus 24
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2003-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1uclA00
1RGCA 1GMQA 1BIRA 2HOHA 4GSPA 1BRKA 3D5IA 1T2HA 1G02A 3WR2A 1FW7A 3DH2A 1YGWA 1PYLA 4GHOA 1HYFA 1X1WA 1BNJA 1GMRA 1TRPA 1AY7A 1JBTA 1FYSA 4BIRA 7GSPA 1JBRA 1BSCA 3GSPA 1RGEA 1LNIA 1LRAA 2KF3A 1T2IA 1B2ZA 1RN1A 5BU4A 1I2FA 4BU4A 2AAEA 1I2EA 2BU4A 7RNTA 3BU4A 6GSPA 1I8VA 2KF5A 5RNTA 1X1YA 1YVSA 5BIRA 1PY3A 1TTOA 4J5GA 1FUSA 1RNBA 1TRQA 1BUJA 1FZUA 1BRJA 1BNRA 1C54A 1BVIA 1I70A 5GSPA 1RHLA 1BU4A 3AGNA 1B2XA 1BRIA 3Q3FA 1B2MA 1BNFA 1RNTA 1LOWA 9RNTA 2C4BA 1RGKA 1R4YA 1AQZA 1A2PA 3AHWA 1BSDA 1JBSA 1RN4A 1GOVA 1BRNL 5HOHA 1B2SA 1I3FA 1RGFA 1RMSA 1BNEA 1FUTA 1ZGXA 4J5KA 8RNTA 1BOXA 1DETA 1BSBA 1MGWA 1I0VA 1RDSA 1UCLA 1RGAA 1BRSA 1RTUA 1RGHA 1LOVA 2KAAA 3RNTA 3URPA 2RBIA 2F4YA 1IYYA 1BNSA 1GOUA 3WHOA 1Q9EA 3D5GA 4HAAA 2GSPA 1GMPA 1MGRA 1GOYA 1B20A 1BNGA 2KF4A 1YNVX 2AADA 1RGLA 1B2UA 1I3IA 2F56A 1GSPA 1B27A 1UCJA 2F5MA 1BSAA 1BAOA 1BRHA 1HZ1A 1UCKA 3AHSA 2SARA 2BIRA 1BANA 3KCHA 3BIRA 1CH0A 3D4AA 3SYUA 1RLSA 1RSNA 1BSEA 2KF6A 1X1XA 1BGSA 1BNIA 1I2GA 1RGGA 1X1UA 1BRGA 2RNTA 3A5EA 6RNTA 4HOHA 2F5WA 3AGOA 3DGYA 1DE3A 1RCKA 1UCIA 3HOHA 1SARA 1LOYA 2ZA4A 4RNTA 1B21A 1RCLA 1B3SA 1I0XA
chains in the Genus database with same CATH superfamily
1OH0A 1RJOA 5FW5A 3BNBA 3RDEA 1BRKA 5D81A 1VQO3 3NQZA 3K63A 3S27A 1MWTA 4ILFA 1J2BA 3Q90A 3LYGA 4HBRA 3NXJA 1PYLA 5TGNA 4R9LA 2MC8A 1X1WA 1BNJA 2XFSA 2QIYA 1W4NA 1JN5B 1G96A 3FKAA 3IPTA 7GSPA 3GSPA 2CK3H 3CCU3 3CD63 3CU3A 4KFEA 3G713 2W56B 1Q42A 5BU4A 1IV9A 2P0XA 4BU4A 3G6E3 4NREA 3F8HA 1I2EA 5AEWB 4CCVA 1VQ63 1ASKA 4BL3A 2UX0A 3BU4A 1I8VA 2B24B 1OCVA 2BMRB 1X1YA 3CXC2 1VQN3 4FR9A 1FZUA 4K1VA 2W04A 5AIIA 5BVBA 1WMOA 8CHOA 1I70A 1K734 5STDA 3DGLA 1YJ93 1BNRA 2CC3A 1MWRA 1RHLA 3DXOA 1VQ73 1T3BA 3Q3FA 2Z77A 4HM0B 1RNTA 4K90B 3Q2PA 1LOWA 9RNTA 1EUIC 4WYKA 3V98A 3SVAA 2JQ5A 1W5ZA 1PFPA 1BSDA 4H61A 1RN4A 1WTHA 1N9EA 2BHMA 3FSDA 1CYUA 1GOVA 2V1LA 3NBJA 3PGBA 3U97A 2YX9A 3CPOA 1O7HB 3B8LA 2XFTA 4X2OA 1FGRA 2QEX3 1US1A 3Q1CA 4WYKB 1UI8A 4XBTA 2W2CA 4FCJA 3UNLA 2L1SA 2FGTA 1IVVA 1JRQA 2HMOB 1MGWA 1UCLA 2H0HA 1RGAA 3LZAA 3ECFA 1AVKA 3FH1A 4HM3B 4IT7A 3LTCA 1EA2A 2KAAA 3MYTA 4AKYA 3CMA3 1ZO2A 1OHOA 3RNTA 3URPA 3FG3A 2RBIA 3EJVA 3CPW2 1RRLA 4KFDA 1GOUA 2WOFA 4OK0A 3LMLA 3O8YA 1V58A 4LSOA 3F40A 5CK6A 3AMOB 1EG9B 2GSPA 2WO0A 1GOYA 1B20A 4O2HA 4GL6A 1UI7A 4EYCA 3NX0A 4L8OA 2KRTA 1FUWA 2CKFB 5CLKA 1WMNA 3LTDA 1B2UA 1NDOB 2LYXA 3V99A 1SPUA 1BSAA 3JUQA 4DKIA 1BRHA 1JN5A 2WGQA 4MMZB 1YGEA 3WOEB 4WHAA 2P09A 3HIIA 5IG5A 1RSNA 3VGNA 3B4OA 4XDVA 4AEQA 4N6LA 1QAFA 3ER7A 1I2GA 2WGOA 3PXMA 1IVWA 3PYJA 1G0TA 1IQ8A 4MMXB 1VQ43 3UL5A 1D6UA 3KSPA 2XH9A 4I4KA 5DRVA 2OOVA 3AGOA 6RNTA 3DUKA 1RCKA 1JV2B 1A67A 2GEYA 3MSOA 1LQMB 1N5HA 1VQQA 3EF8A 1M904 5DREA 1OUNA 3K5TA 5IG4A 1NJI4 1RN1A 2HMNB 2HMMB 1FGMA 3KE7A 5M1AA 1W6CA 1IQYA 1RGCA 1GMQA 1BIRA 2CIUA 3KZTA 3NV0B 3U1WA 2KCDA 1CYVA 1STDA 1U8CB 2XR8B 1GY7A 3DGNA 4PEJA 3MPHA 5AIFA 3CCM3 3CC43 3SXXA 1FW7A 4FMAA 1JB2A 2A15A 3DMCA 1KC84 1HU9A 2HMLB 3PS8A 3F7SA 1A90A 4K61A 1WNHA 4OUQA 3JUMA 3MG3A 4HM8B 4BIRA 3EHCA 1JBRA 3S29A 1AVLA 1DYUA 3ALAA 3BNEA 2PZVA 2IUKA 2P05A 4TX4A 5ELUA 2BU4A 2CG1A 3KKGA 1TU5A 3K9MC 4I5QA 3CNXA 5RNTA 1NB3I 1YVSA 1FUSA 1W6YA 1ZS7A 2CX1A 2I9WA 3DM8A 3GRDA 1N8QA 1BUJA 1IQXA 2BO9B 3RGRA 5JPUA 4L8PA 4QWTA 5AI1A 3G4S3 1QVG2 1N8R4 3TDGA 3MG1A 1OACA 2IMJA 4IPBA 5ELJA 1BU4A 3AGNA 1UGIA 5D82A 3WDGB 4EW5A 3WA2X 3OW22 2XGNA 2CWUA 3D3LA 1RGKA 1VZZA 1QALA 1IK3A 1FGQA 4GB5A 1JBSA 1TFOA 3PCRA 3WODG 1DVDA 1BRNL 2XSOB 1C7HA 2IYJA 3H3HA 5HOHA 3MWZA 2E2UA 4IIAA 3I563 4JRFA 4N6OB 1I3FA 3FZWA 1SQWA 2K54A 4JF8A 1STFI 1N9JA 1RMSA 3D9RA 3I0YA 3WA3A 2MF7A 1ISKA 1JNQA 1MWSA 1DETA 2OQEC 3CCR3 1Y4KA 5G1KA 1GD4A 1I0VA 3CC73 2XGLA 1JKGA 3QRDA 3EC9A 1DMNA 4WWUC 1VQP3 2HMJB 3K0ZA 2W6JH 2GXFA 2Y74A 2IA7A 3KFQC 2CFKA 1W01A 3BNDA 3FLJA 4N6NB 2F99A 1IT7A 4HAAA 3KN4A 1MGRA 1VQ53 1FGTA 1RGLA 3F8XA 5A0OB 2F56A 2W9PA 2RFRA 1UUVB 3AHSA 3V92A 2BMOB 1GD3A 1JJ22 4MMYB 1BANA 3STDA 3BIRA 5FGOA 3D4AA 4N6V0 1OHPA 3SYUA 1RLSA 4RBNA 2R4IA 1EEJA 4HVNA 4RNYA 3CCS3 1X1XA 3B4PA 4N3VA 5IF6A 2ML5A 3ROBA 3EB8A 3L0RA 1NU3A 1CQSA 2FXTA 1W6GA 1Q824 1M1K4 2CH9A 4KT3B 2STDA 1ROAA 2W56A 2P0MA 4HM1B 3WMDA 1W2B2 3HOHA 2UUGC 2CX0A 1DVCA 2D42A 1LOYA 1ULIB 2Z6BA 4RNTA 2Q07A 2OCTA 3DY5A 2HOHA 4GSPA 3OWYA 4X2HA 4EV2A 3NV0A 1ULJB 1W02A 1UUGB 1NB5I 1DMQA 3D5IA 4O02B 1T2HA 1G02A 4NPBA 3DH2A 3SOYA 3VSYA 1IVXA 1IDPA 2RCDA 1W2ZA 1RRHA 1HYFA 2Z76A 1FGOA 1GMRA 1TRPA 3OWSA 5AIGA 2IUJA 2QGUA 1JBTA 2GEXA 1VQL3 5M19A 5EQLA 1JZOA 1BSCA 3FGYA 1VQK3 4KZ1A 1NO3A 2O9UX 2B1XB 4XDWA 2GU3A 3S5CA 4LMIA 5CXOA 3LXUX 1E3RA 1I2FA 1KQS2 3DZLA 2CFDA 5AYSC 2ZDJA 5CF1A 3T0UA 2R41A 2KF5A 2HMKB 1YJN3 4HYZA 1PU4A 4BTYA 3GWRA 4CJNA 2YFIB 2Y73A 3JUNA 1C54A 3N54B 3KSED 4KFFA 1GY6A 5GSPA 1Q7HA 2XSHB 1EQKA 1BRIA 1B2MA 2M7OA 1YI23 4BTXA 1WMPA 1O7GB 5CF2A 4J8TA 1CEWI 2INXA 2C4BA 1KSIA 1SIHA 2CG0A 1Z1SA 3EBTA 1AQZA 1A2PA 4HM6B 2QA43 1K9M4 1V57A 3AMOA 4MJDA 2CWVA 4LEHA 3OV4A 1GS3A 2H0IA 1RKYA 1E97A 1IU7A 3F7XA 4FCZA 1GYBA 1BUQA 1RGFA 1JB5A 4J9AA 2CFWA 1O7NB 3HI7A 4WFOA 2XEPA 3ZG5A 1QVF2 3DGMA 3CCV3 4FMBA 4N6MA 1ZGXA 4J5KA 8RNTA 3I553 1R4CA 1UGHI 5IEOA 1KWIA 1O7WB 4CPKA 4U13A 4RZMA 2E2VA 1BSBA 3LT9A 3H51A 3CC23 3N9HA 4O8SA 1RTUA 1UUWB 1UW1A 1DMMA 2CFLA 5BXQA 3HK4A 3GZYB 3X3ZA 1TP6A 5LC6A 2OOVC 1IYYA 1BNSA 1LQGC 3BNCA 1FA3A 3EX9A 2C11A 4STDA 3D5GA 4XBYA 1GMPA 1TIJA 4LZIA 3T8NA 2W0QA 3EN1B 3FG1A 1Q814 2F98A 3GZXB 1I3IA 1MNLA 1UCJA 1B27A 2F5MA 2BNGA 1YJW3 3OX9A 4OVMA 2SARA 3G0KA 4N6UA 1S5AA 3KCHA 2IY2A 3LH4A 1CH0A 4HM2B 4HZBB 1QAKA 3NBRA 1IVUA 3CME3 5AIHA 1IV7A 3F14A 1O7PB 5KP1A 2RNTA 1X1UA 1BRGA 5G2GA 5IG3A 1Q864 2F5WA 3DGYA 3WOFB 4KVHA 3CCL3 1UCIA 1OF5A 1SARA 2P38A 3X40A 1W00A 3FG4A 5IENA 1L5GB 2JDIH 3NUVA 5IERA 1K28A 1RCLA 2KXGA 1B3SA 1V74A 1I0XA 3NQYA 4ORLA 3CCQ3 1YIT3 3K7CA 5JBSA 3G8ZA 3HIGA 3EQQB 2ML6A 4XB5A 4HM4B 2GBWB 4EBGA 4MEIA 3WR2A 3SOAA 1OPYA 1Q40A 1YGWA 5LC7A 1LXEA 4GHOA 3NM7A 4G1MB 4NHFA 3D79A 2YFLB 1AY7A 3M8CA 1FYSA 3N8BA 1N5PA 1GY5A 1WQLB 4EV5A 3QK9A 1OHSA 1RGEA 3BB9A 1LNIA 1LRAA 3JVCA 5I97A 2KF3A 2UGIA 1T2IA 1B2ZA 1TJDA 5EEOA 3UL6A 4BL2A 3G16A 2J8XB 4HKVB 1VQM3 1MWUA 1M9GA 2AAEA 5HGRA 7RNTA 1ZX2A 6GSPA 2K0MA 2BMQB 1HKXA 1AR0A 3ZFZA 2OQEA 2W03A 1OGZA 1LOXA 3X3XA 5BIRA 1PY3A 1TTOA 4J5GA 1RNBA 1TRQA 3T8UA 3ZG0A 1TFKA 1KD14 1BRJA 1D6ZA 1JZDA 2RSXA 3EBYA 1BVIA 4R1KA 3JUOA 2L4VA 1NNVA 4FMCA 5AYRB 4LGQA 2CWTA 3MHEA 1Q40B 1B2XA 3A76A 2XRXB 4FMDA 1BNFA 2XF3A 3UB1A 2OTL3 2BT3A 2OTJ3 1R4YA 3MKIA 4L7KA 1Q7Y4 3AHWA 1F8NA 4BTWA 1W7CA 4LYLB 5G1LA 1A2KA 1SJWA 2Z7AA 5KP3A 3SLUA 6STDA 1VQ93 2C10A 3FCSB 4EXRA 3LTAA 3MG2A 4R80A 1UDII 3DGOA 1B2SA 1D6YA 3X3YA 1YHQ3 1AV4A 4HZ9B 3SX1A 5AEUB 1LVNA 2YFJB 1BNEA 1FUTA 3GAXA 1OGXA 3PCSA 4WP5A 4RNZA 1O7MB 1BOXA 3CCE3 2LQVA 3NHXA 3OXAA 1ROVA 4N6TA 4HM5B 1RDSA 1BRSA 5IG0A 3UJMA 1RGHA 1LOVA 2WOHA 5M18A 2ZHXB 1K41A 1JB4A 4ZM8A 4EC6A 3LOYA 1SIIA 2F4YA 3EE1A 5JPPA 4AKZA 1QMAA 2H0GA 3WHOA 3F9SA 3VF1A 1EKMA 1Q9EA 2CHCA 3B7CA 1MOLA 2SBLA 3KIIA 2PNCA 1T5YA 2CW9A 3X41A 5D83A 3X42A 3E99A 1BNGA 2GU1A 4R9KA 2O3OA 1YIJ3 2KF4A 1YNVX 2AADA 1S723 4O3VA 3SEDA 3OWUA 1GSPA 3CNMA 1IT8A 3BLZA 3LTBA 1RN7A 1BAOA 1TUHA 1HZ1A 1E3VA 1UCKA 2F86B 3HZPA 2RGQA 3NM2A 2GBXB 1A2VA 7STDA 1K8A4 2BIRA 4CDLA 2D1WA 2E2TA 2CFGA 1JKGB 4H3UA 3FF0A 3S67A 1YVBI 3IJEB 1BSEA 2KF6A 3NBBA 1LNHA 1QJGA 2ZL8A 1BGSA 1NWWA 2FNQA 2K3DA 4R4KA 3GZBA 4XBXA 3RGAA 1BNIA 1RGGA 3HX8A 3S28A 3PZWA 1VQ83 3A5EA 1U5OA 1OF5B 4HOHA 3IMAB 4FCMA 5KP4A 2OWPA 4XM4A 1DE3A 4HJLB 5IEPA 3GZRA 5EVHA 3FF2A 3JUPA 3J7Yd 4Q53A 2W9QA 3CCJ3 3EN8A 5IW9A 1M1XB 2ZA4A 1B21A 4HM7B 3LT8A 4K1UA
chains in the Genus database with same CATH topology
1RGCA 1GMQA 1BIRA 2HOHA 4GSPA 1BRKA 3D5IA 1T2HA 1G02A 3WR2A 1FW7A 3DH2A 1YGWA 1PYLA 4GHOA 1HYFA 1X1WA 1BNJA 1GMRA 1TRPA 1AY7A 1JBTA 1FYSA 4BIRA 7GSPA 1JBRA 1BSCA 3GSPA 1RGEA 1LNIA 1LRAA 2KF3A 1T2IA 1B2ZA 1RN1A 5BU4A 1I2FA 4BU4A 2AAEA 1I2EA 2BU4A 7RNTA 3BU4A 6GSPA 1I8VA 2KF5A 5RNTA 1X1YA 1YVSA 5BIRA 1PY3A 1TTOA 4J5GA 1FUSA 1RNBA 1TRQA 1BUJA 1FZUA 1BRJA 1BNRA 1C54A 1BVIA 1I70A 5GSPA 1RHLA 1BU4A 3AGNA 1B2XA 1BRIA 3Q3FA 1B2MA 1BNFA 1RNTA 1LOWA 9RNTA 2C4BA 1RGKA 1R4YA 1AQZA 1A2PA 3AHWA 1BSDA 1JBSA 1RN4A 1GOVA 1BRNL 5HOHA 1B2SA 1I3FA 1RGFA 1RMSA 1BNEA 1FUTA 1ZGXA 4J5KA 8RNTA 1BOXA 1DETA 1BSBA 1MGWA 1I0VA 1RDSA 1UCLA 1RGAA 1BRSA 1RTUA 1RGHA 1LOVA 2KAAA 3RNTA 3URPA 2RBIA 2F4YA 1IYYA 1BNSA 1GOUA 3WHOA 1Q9EA 3D5GA 4HAAA 2GSPA 1GMPA 1MGRA 1GOYA 1B20A 1BNGA 2KF4A 1YNVX 2AADA 1RGLA 1B2UA 1I3IA 2F56A 1GSPA 1B27A 1UCJA 2F5MA 1BSAA 1BAOA 1BRHA 1HZ1A 1UCKA 3AHSA 2SARA 2BIRA 1BANA 3KCHA 3BIRA 1CH0A 3D4AA 3SYUA 1RLSA 1RSNA 1BSEA 2KF6A 1X1XA 1BGSA 1BNIA 1I2GA 1RGGA 1X1UA 1BRGA 2RNTA 3A5EA 6RNTA 4HOHA 2F5WA 3AGOA 3DGYA 1DE3A 1RCKA 1UCIA 3HOHA 1SARA 1LOYA 2ZA4A 4RNTA 1B21A 1RCLA 1B3SA 1I0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RGC A;  1GMQ A;  1BIR A;  2HOH A;  4GSP A;  1BRK A;  3D5I A;  1T2H A;  1G02 A;  3WR2 A;  1FW7 A;  3DH2 A;  1YGW A;  1PYL A;  4GHO A;  1HYF A;  1X1W A;  1BNJ A;  1GMR A;  1TRP A;  1AY7 A;  1JBT A;  1FYS A;  4BIR A;  7GSP A;  1JBR A;  1BSC A;  3GSP A;  1RGE A;  1LNI A;  1LRA A;  2KF3 A;  1T2I A;  1B2Z A;  1RN1 A;  5BU4 A;  1I2F A;  4BU4 A;  2AAE A;  1I2E A;  2BU4 A;  7RNT A;  3BU4 A;  6GSP A;  1I8V A;  2KF5 A;  5RNT A;  1X1Y A;  1YVS A;  5BIR A;  1PY3 A;  1TTO A;  4J5G A;  1FUS A;  1RNB A;  1TRQ A;  1BUJ A;  1FZU A;  1BRJ A;  1BNR A;  1C54 A;  1BVI A;  1I70 A;  5GSP A;  1RHL A;  1BU4 A;  3AGN A;  1B2X A;  1BRI A;  3Q3F A;  1B2M A;  1BNF A;  1RNT A;  1LOW A;  9RNT A;  2C4B A;  1RGK A;  1R4Y A;  1AQZ A;  1A2P A;  3AHW A;  1BSD A;  1JBS A;  1RN4 A;  1GOV A;  1BRN L;  5HOH A;  1B2S A;  1I3F A;  1RGF A;  1RMS A;  1BNE A;  1FUT A;  1ZGX A;  4J5K A;  8RNT A;  1BOX A;  1DET A;  1BSB A;  1MGW A;  1I0V A;  1RDS A;  1UCL A;  1RGA A;  1BRS A;  1RTU A;  1RGH A;  1LOV A;  2KAA A;  3RNT A;  3URP A;  2RBI A;  2F4Y A;  1IYY A;  1BNS A;  1GOU A;  3WHO A;  1Q9E A;  3D5G A;  4HAA A;  2GSP A;  1GMP A;  1MGR A;  1GOY A;  1B20 A;  1BNG A;  2KF4 A;  1YNV X;  2AAD A;  1RGL A;  1B2U A;  1I3I A;  2F56 A;  1GSP A;  1B27 A;  1UCJ A;  2F5M A;  1BSA A;  1BAO A;  1BRH A;  1HZ1 A;  1UCK A;  3AHS A;  2SAR A;  2BIR A;  1BAN A;  3KCH A;  3BIR A;  1CH0 A;  3D4A A;  3SYU A;  1RLS A;  1RSN A;  1BSE A;  2KF6 A;  1X1X A;  1BGS A;  1BNI A;  1I2G A;  1RGG A;  1X1U A;  1BRG A;  2RNT A;  3A5E A;  6RNT A;  4HOH A;  2F5W A;  3AGO A;  3DGY A;  1DE3 A;  1RCK A;  1UCI A;  3HOH A;  1SAR A;  1LOY A;  2ZA4 A;  4RNT A;  1B21 A;  1RCL A;  1B3S A;  1I0X A; 
#chains in the Genus database with same CATH topology
 1OH0 A;  1RJO A;  5FW5 A;  3BNB A;  3RDE A;  1BRK A;  5D81 A;  1VQO 3;  3NQZ A;  3K63 A;  3S27 A;  1MWT A;  4ILF A;  1J2B A;  3Q90 A;  3LYG A;  4HBR A;  3NXJ A;  1PYL A;  5TGN A;  4R9L A;  2MC8 A;  1X1W A;  1BNJ A;  2XFS A;  2QIY A;  1W4N A;  1JN5 B;  1G96 A;  3FKA A;  3IPT A;  7GSP A;  3GSP A;  2CK3 H;  3CCU 3;  3CD6 3;  3CU3 A;  4KFE A;  3G71 3;  2W56 B;  1Q42 A;  5BU4 A;  1IV9 A;  2P0X A;  4BU4 A;  3G6E 3;  4NRE A;  3F8H A;  1I2E A;  5AEW B;  4CCV A;  1VQ6 3;  1ASK A;  4BL3 A;  2UX0 A;  3BU4 A;  1I8V A;  2B24 B;  1OCV A;  2BMR B;  1X1Y A;  3CXC 2;  1VQN 3;  4FR9 A;  1FZU A;  4K1V A;  2W04 A;  5AII A;  5BVB A;  1WMO A;  8CHO A;  1I70 A;  1K73 4;  5STD A;  3DGL A;  1YJ9 3;  1BNR A;  2CC3 A;  1MWR A;  1RHL A;  3DXO A;  1VQ7 3;  1T3B A;  3Q3F A;  2Z77 A;  4HM0 B;  1RNT A;  4K90 B;  3Q2P A;  1LOW A;  9RNT A;  1EUI C;  4WYK A;  3V98 A;  3SVA A;  2JQ5 A;  1W5Z A;  1PFP A;  1BSD A;  4H61 A;  1RN4 A;  1WTH A;  1N9E A;  2BHM A;  3FSD A;  1CYU A;  1GOV A;  2V1L A;  3NBJ A;  3PGB A;  3U97 A;  2YX9 A;  3CPO A;  1O7H B;  3B8L A;  2XFT A;  4X2O A;  1FGR A;  2QEX 3;  1US1 A;  3Q1C A;  4WYK B;  1UI8 A;  4XBT A;  2W2C A;  4FCJ A;  3UNL A;  2L1S A;  2FGT A;  1IVV A;  1JRQ A;  2HMO B;  1MGW A;  1UCL A;  2H0H A;  1RGA A;  3LZA A;  3ECF A;  1AVK A;  3FH1 A;  4HM3 B;  4IT7 A;  3LTC A;  1EA2 A;  2KAA A;  3MYT A;  4AKY A;  3CMA 3;  1ZO2 A;  1OHO A;  3RNT A;  3URP A;  3FG3 A;  2RBI A;  3EJV A;  3CPW 2;  1RRL A;  4KFD A;  1GOU A;  2WOF A;  4OK0 A;  3LML A;  3O8Y A;  1V58 A;  4LSO A;  3F40 A;  5CK6 A;  3AMO B;  1EG9 B;  2GSP A;  2WO0 A;  1GOY A;  1B20 A;  4O2H A;  4GL6 A;  1UI7 A;  4EYC A;  3NX0 A;  4L8O A;  2KRT A;  1FUW A;  2CKF B;  5CLK A;  1WMN A;  3LTD A;  1B2U A;  1NDO B;  2LYX A;  3V99 A;  1SPU A;  1BSA A;  3JUQ A;  4DKI A;  1BRH A;  1JN5 A;  2WGQ A;  4MMZ B;  1YGE A;  3WOE B;  4WHA A;  2P09 A;  3HII A;  5IG5 A;  1RSN A;  3VGN A;  3B4O A;  4XDV A;  4AEQ A;  4N6L A;  1QAF A;  3ER7 A;  1I2G A;  2WGO A;  3PXM A;  1IVW A;  3PYJ A;  1G0T A;  1IQ8 A;  4MMX B;  1VQ4 3;  3UL5 A;  1D6U A;  3KSP A;  2XH9 A;  4I4K A;  5DRV A;  2OOV A;  3AGO A;  6RNT A;  3DUK A;  1RCK A;  1JV2 B;  1A67 A;  2GEY A;  3MSO A;  1LQM B;  1N5H A;  1VQQ A;  3EF8 A;  1M90 4;  5DRE A;  1OUN A;  3K5T A;  5IG4 A;  1NJI 4;  1RN1 A;  2HMN B;  2HMM B;  1FGM A;  3KE7 A;  5M1A A;  1W6C A;  1IQY A;  1RGC A;  1GMQ A;  1BIR A;  2CIU A;  3KZT A;  3NV0 B;  3U1W A;  2KCD A;  1CYV A;  1STD A;  1U8C B;  2XR8 B;  1GY7 A;  3DGN A;  4PEJ A;  3MPH A;  5AIF A;  3CCM 3;  3CC4 3;  3SXX A;  1FW7 A;  4FMA A;  1JB2 A;  2A15 A;  3DMC A;  1KC8 4;  1HU9 A;  2HML B;  3PS8 A;  3F7S A;  1A90 A;  4K61 A;  1WNH A;  4OUQ A;  3JUM A;  3MG3 A;  4HM8 B;  4BIR A;  3EHC A;  1JBR A;  3S29 A;  1AVL A;  1DYU A;  3ALA A;  3BNE A;  2PZV A;  2IUK A;  2P05 A;  4TX4 A;  5ELU A;  2BU4 A;  2CG1 A;  3KKG A;  1TU5 A;  3K9M C;  4I5Q A;  3CNX A;  5RNT A;  1NB3 I;  1YVS A;  1FUS A;  1W6Y A;  1ZS7 A;  2CX1 A;  2I9W A;  3DM8 A;  3GRD A;  1N8Q A;  1BUJ A;  1IQX A;  2BO9 B;  3RGR A;  5JPU A;  4L8P A;  4QWT A;  5AI1 A;  3G4S 3;  1QVG 2;  1N8R 4;  3TDG A;  3MG1 A;  1OAC A;  2IMJ A;  4IPB A;  5ELJ A;  1BU4 A;  3AGN A;  1UGI A;  5D82 A;  3WDG B;  4EW5 A;  3WA2 X;  3OW2 2;  2XGN A;  2CWU A;  3D3L A;  1RGK A;  1VZZ A;  1QAL A;  1IK3 A;  1FGQ A;  4GB5 A;  1JBS A;  1TFO A;  3PCR A;  3WOD G;  1DVD A;  1BRN L;  2XSO B;  1C7H A;  2IYJ A;  3H3H A;  5HOH A;  3MWZ A;  2E2U A;  4IIA A;  3I56 3;  4JRF A;  4N6O B;  1I3F A;  3FZW A;  1SQW A;  2K54 A;  4JF8 A;  1STF I;  1N9J A;  1RMS A;  3D9R A;  3I0Y A;  3WA3 A;  2MF7 A;  1ISK A;  1JNQ A;  1MWS A;  1DET A;  2OQE C;  3CCR 3;  1Y4K A;  5G1K A;  1GD4 A;  1I0V A;  3CC7 3;  2XGL A;  1JKG A;  3QRD A;  3EC9 A;  1DMN A;  4WWU C;  1VQP 3;  2HMJ B;  3K0Z A;  2W6J H;  2GXF A;  2Y74 A;  2IA7 A;  3KFQ C;  2CFK A;  1W01 A;  3BND A;  3FLJ A;  4N6N B;  2F99 A;  1IT7 A;  4HAA A;  3KN4 A;  1MGR A;  1VQ5 3;  1FGT A;  1RGL A;  3F8X A;  5A0O B;  2F56 A;  2W9P A;  2RFR A;  1UUV B;  3AHS A;  3V92 A;  2BMO B;  1GD3 A;  1JJ2 2;  4MMY B;  1BAN A;  3STD A;  3BIR A;  5FGO A;  3D4A A;  4N6V 0;  1OHP A;  3SYU A;  1RLS A;  4RBN A;  2R4I A;  1EEJ A;  4HVN A;  4RNY A;  3CCS 3;  1X1X A;  3B4P A;  4N3V A;  5IF6 A;  2ML5 A;  3ROB A;  3EB8 A;  3L0R A;  1NU3 A;  1CQS A;  2FXT A;  1W6G A;  1Q82 4;  1M1K 4;  2CH9 A;  4KT3 B;  2STD A;  1ROA A;  2W56 A;  2P0M A;  4HM1 B;  3WMD A;  1W2B 2;  3HOH A;  2UUG C;  2CX0 A;  1DVC A;  2D42 A;  1LOY A;  1ULI B;  2Z6B A;  4RNT A;  2Q07 A;  2OCT A;  3DY5 A;  2HOH A;  4GSP A;  3OWY A;  4X2H A;  4EV2 A;  3NV0 A;  1ULJ B;  1W02 A;  1UUG B;  1NB5 I;  1DMQ A;  3D5I A;  4O02 B;  1T2H A;  1G02 A;  4NPB A;  3DH2 A;  3SOY A;  3VSY A;  1IVX A;  1IDP A;  2RCD A;  1W2Z A;  1RRH A;  1HYF A;  2Z76 A;  1FGO A;  1GMR A;  1TRP A;  3OWS A;  5AIG A;  2IUJ A;  2QGU A;  1JBT A;  2GEX A;  1VQL 3;  5M19 A;  5EQL A;  1JZO A;  1BSC A;  3FGY A;  1VQK 3;  4KZ1 A;  1NO3 A;  2O9U X;  2B1X B;  4XDW A;  2GU3 A;  3S5C A;  4LMI A;  5CXO A;  3LXU X;  1E3R A;  1I2F A;  1KQS 2;  3DZL A;  2CFD A;  5AYS C;  2ZDJ A;  5CF1 A;  3T0U A;  2R41 A;  2KF5 A;  2HMK B;  1YJN 3;  4HYZ A;  1PU4 A;  4BTY A;  3GWR A;  4CJN A;  2YFI B;  2Y73 A;  3JUN A;  1C54 A;  3N54 B;  3KSE D;  4KFF A;  1GY6 A;  5GSP A;  1Q7H A;  2XSH B;  1EQK A;  1BRI A;  1B2M A;  2M7O A;  1YI2 3;  4BTX A;  1WMP A;  1O7G B;  5CF2 A;  4J8T A;  1CEW I;  2INX A;  2C4B A;  1KSI A;  1SIH A;  2CG0 A;  1Z1S A;  3EBT A;  1AQZ A;  1A2P A;  4HM6 B;  2QA4 3;  1K9M 4;  1V57 A;  3AMO A;  4MJD A;  2CWV A;  4LEH A;  3OV4 A;  1GS3 A;  2H0I A;  1RKY A;  1E97 A;  1IU7 A;  3F7X A;  4FCZ A;  1GYB A;  1BUQ A;  1RGF A;  1JB5 A;  4J9A A;  2CFW A;  1O7N B;  3HI7 A;  4WFO A;  2XEP A;  3ZG5 A;  1QVF 2;  3DGM A;  3CCV 3;  4FMB A;  4N6M A;  1ZGX A;  4J5K A;  8RNT A;  3I55 3;  1R4C A;  1UGH I;  5IEO A;  1KWI A;  1O7W B;  4CPK A;  4U13 A;  4RZM A;  2E2V A;  1BSB A;  3LT9 A;  3H51 A;  3CC2 3;  3N9H A;  4O8S A;  1RTU A;  1UUW B;  1UW1 A;  1DMM A;  2CFL A;  5BXQ A;  3HK4 A;  3GZY B;  3X3Z A;  1TP6 A;  5LC6 A;  2OOV C;  1IYY A;  1BNS A;  1LQG C;  3BNC A;  1FA3 A;  3EX9 A;  2C11 A;  4STD A;  3D5G A;  4XBY A;  1GMP A;  1TIJ A;  4LZI A;  3T8N A;  2W0Q A;  3EN1 B;  3FG1 A;  1Q81 4;  2F98 A;  3GZX B;  1I3I A;  1MNL A;  1UCJ A;  1B27 A;  2F5M A;  2BNG A;  1YJW 3;  3OX9 A;  4OVM A;  2SAR A;  3G0K A;  4N6U A;  1S5A A;  3KCH A;  2IY2 A;  3LH4 A;  1CH0 A;  4HM2 B;  4HZB B;  1QAK A;  3NBR A;  1IVU A;  3CME 3;  5AIH A;  1IV7 A;  3F14 A;  1O7P B;  5KP1 A;  2RNT A;  1X1U A;  1BRG A;  5G2G A;  5IG3 A;  1Q86 4;  2F5W A;  3DGY A;  3WOF B;  4KVH A;  3CCL 3;  1UCI A;  1OF5 A;  1SAR A;  2P38 A;  3X40 A;  1W00 A;  3FG4 A;  5IEN A;  1L5G B;  2JDI H;  3NUV A;  5IER A;  1K28 A;  1RCL A;  2KXG A;  1B3S A;  1V74 A;  1I0X A;  3NQY A;  4ORL A;  3CCQ 3;  1YIT 3;  3K7C A;  5JBS A;  3G8Z A;  3HIG A;  3EQQ B;  2ML6 A;  4XB5 A;  4HM4 B;  2GBW B;  4EBG A;  4MEI A;  3WR2 A;  3SOA A;  1OPY A;  1Q40 A;  1YGW A;  5LC7 A;  1LXE A;  4GHO A;  3NM7 A;  4G1M B;  4NHF A;  3D79 A;  2YFL B;  1AY7 A;  3M8C A;  1FYS A;  3N8B A;  1N5P A;  1GY5 A;  1WQL B;  4EV5 A;  3QK9 A;  1OHS A;  1RGE A;  3BB9 A;  1LNI A;  1LRA A;  3JVC A;  5I97 A;  2KF3 A;  2UGI A;  1T2I A;  1B2Z A;  1TJD A;  5EEO A;  3UL6 A;  4BL2 A;  3G16 A;  2J8X B;  4HKV B;  1VQM 3;  1MWU A;  1M9G A;  2AAE A;  5HGR A;  7RNT A;  1ZX2 A;  6GSP A;  2K0M A;  2BMQ B;  1HKX A;  1AR0 A;  3ZFZ A;  2OQE A;  2W03 A;  1OGZ A;  1LOX A;  3X3X A;  5BIR A;  1PY3 A;  1TTO A;  4J5G A;  1RNB A;  1TRQ A;  3T8U A;  3ZG0 A;  1TFK A;  1KD1 4;  1BRJ A;  1D6Z A;  1JZD A;  2RSX A;  3EBY A;  1BVI A;  4R1K A;  3JUO A;  2L4V A;  1NNV A;  4FMC A;  5AYR B;  4LGQ A;  2CWT A;  3MHE A;  1Q40 B;  1B2X A;  3A76 A;  2XRX B;  4FMD A;  1BNF A;  2XF3 A;  3UB1 A;  2OTL 3;  2BT3 A;  2OTJ 3;  1R4Y A;  3MKI A;  4L7K A;  1Q7Y 4;  3AHW A;  1F8N A;  4BTW A;  1W7C A;  4LYL B;  5G1L A;  1A2K A;  1SJW A;  2Z7A A;  5KP3 A;  3SLU A;  6STD A;  1VQ9 3;  2C10 A;  3FCS B;  4EXR A;  3LTA A;  3MG2 A;  4R80 A;  1UDI I;  3DGO A;  1B2S A;  1D6Y A;  3X3Y A;  1YHQ 3;  1AV4 A;  4HZ9 B;  3SX1 A;  5AEU B;  1LVN A;  2YFJ B;  1BNE A;  1FUT A;  3GAX A;  1OGX A;  3PCS A;  4WP5 A;  4RNZ A;  1O7M B;  1BOX A;  3CCE 3;  2LQV A;  3NHX A;  3OXA A;  1ROV A;  4N6T A;  4HM5 B;  1RDS A;  1BRS A;  5IG0 A;  3UJM A;  1RGH A;  1LOV A;  2WOH A;  5M18 A;  2ZHX B;  1K41 A;  1JB4 A;  4ZM8 A;  4EC6 A;  3LOY A;  1SII A;  2F4Y A;  3EE1 A;  5JPP A;  4AKZ A;  1QMA A;  2H0G A;  3WHO A;  3F9S A;  3VF1 A;  1EKM A;  1Q9E A;  2CHC A;  3B7C A;  1MOL A;  2SBL A;  3KII A;  2PNC A;  1T5Y A;  2CW9 A;  3X41 A;  5D83 A;  3X42 A;  3E99 A;  1BNG A;  2GU1 A;  4R9K A;  2O3O A;  1YIJ 3;  2KF4 A;  1YNV X;  2AAD A;  1S72 3;  4O3V A;  3SED A;  3OWU A;  1GSP A;  3CNM A;  1IT8 A;  3BLZ A;  3LTB A;  1RN7 A;  1BAO A;  1TUH A;  1HZ1 A;  1E3V A;  1UCK A;  2F86 B;  3HZP A;  2RGQ A;  3NM2 A;  2GBX B;  1A2V A;  7STD A;  1K8A 4;  2BIR A;  4CDL A;  2D1W A;  2E2T A;  2CFG A;  1JKG B;  4H3U A;  3FF0 A;  3S67 A;  1YVB I;  3IJE B;  1BSE A;  2KF6 A;  3NBB A;  1LNH A;  1QJG A;  2ZL8 A;  1BGS A;  1NWW A;  2FNQ A;  2K3D A;  4R4K A;  3GZB A;  4XBX A;  3RGA A;  1BNI A;  1RGG A;  3HX8 A;  3S28 A;  3PZW A;  1VQ8 3;  3A5E A;  1U5O A;  1OF5 B;  4HOH A;  3IMA B;  4FCM A;  5KP4 A;  2OWP A;  4XM4 A;  1DE3 A;  4HJL B;  5IEP A;  3GZR A;  5EVH A;  3FF2 A;  3JUP A;  3J7Y d;  4Q53 A;  2W9Q A;  3CCJ 3;  3EN8 A;  5IW9 A;  1M1X B;  2ZA4 A;  1B21 A;  4HM7 B;  3LT8 A;  4K1U A; 
#chains in the Genus database with same CATH homology
 1RGC A;  1GMQ A;  1BIR A;  2HOH A;  4GSP A;  1BRK A;  3D5I A;  1T2H A;  1G02 A;  3WR2 A;  1FW7 A;  3DH2 A;  1YGW A;  1PYL A;  4GHO A;  1HYF A;  1X1W A;  1BNJ A;  1GMR A;  1TRP A;  1AY7 A;  1JBT A;  1FYS A;  4BIR A;  7GSP A;  1JBR A;  1BSC A;  3GSP A;  1RGE A;  1LNI A;  1LRA A;  2KF3 A;  1T2I A;  1B2Z A;  1RN1 A;  5BU4 A;  1I2F A;  4BU4 A;  2AAE A;  1I2E A;  2BU4 A;  7RNT A;  3BU4 A;  6GSP A;  1I8V A;  2KF5 A;  5RNT A;  1X1Y A;  1YVS A;  5BIR A;  1PY3 A;  1TTO A;  4J5G A;  1FUS A;  1RNB A;  1TRQ A;  1BUJ A;  1FZU A;  1BRJ A;  1BNR A;  1C54 A;  1BVI A;  1I70 A;  5GSP A;  1RHL A;  1BU4 A;  3AGN A;  1B2X A;  1BRI A;  3Q3F A;  1B2M A;  1BNF A;  1RNT A;  1LOW A;  9RNT A;  2C4B A;  1RGK A;  1R4Y A;  1AQZ A;  1A2P A;  3AHW A;  1BSD A;  1JBS A;  1RN4 A;  1GOV A;  1BRN L;  5HOH A;  1B2S A;  1I3F A;  1RGF A;  1RMS A;  1BNE A;  1FUT A;  1ZGX A;  4J5K A;  8RNT A;  1BOX A;  1DET A;  1BSB A;  1MGW A;  1I0V A;  1RDS A;  1UCL A;  1RGA A;  1BRS A;  1RTU A;  1RGH A;  1LOV A;  2KAA A;  3RNT A;  3URP A;  2RBI A;  2F4Y A;  1IYY A;  1BNS A;  1GOU A;  3WHO A;  1Q9E A;  3D5G A;  4HAA A;  2GSP A;  1GMP A;  1MGR A;  1GOY A;  1B20 A;  1BNG A;  2KF4 A;  1YNV X;  2AAD A;  1RGL A;  1B2U A;  1I3I A;  2F56 A;  1GSP A;  1B27 A;  1UCJ A;  2F5M A;  1BSA A;  1BAO A;  1BRH A;  1HZ1 A;  1UCK A;  3AHS A;  2SAR A;  2BIR A;  1BAN A;  3KCH A;  3BIR A;  1CH0 A;  3D4A A;  3SYU A;  1RLS A;  1RSN A;  1BSE A;  2KF6 A;  1X1X A;  1BGS A;  1BNI A;  1I2G A;  1RGG A;  1X1U A;  1BRG A;  2RNT A;  3A5E A;  6RNT A;  4HOH A;  2F5W A;  3AGO A;  3DGY A;  1DE3 A;  1RCK A;  1UCI A;  3HOH A;  1SAR A;  1LOY A;  2ZA4 A;  4RNT A;  1B21 A;  1RCL A;  1B3S A;  1I0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...