1UCLA

Mutants of rnase sa
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
96
structure length
96
Chain Sequence
DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTTITPGARTRGTRRIITGEATQEDYYTGDHYATFSLIDQTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanyl-specific ribonuclease Sa
publication title The contribution of polar group burial to protein stability is strongly context-dependent
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase
total genus 24
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2003-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1uclA00
1BNSA 1RGAA 1BAOA 1UCIA 1T2IA 1GOYA 1I8VA 1PY3A 1RGHA 1BUJA 1JBRA 1B2SA 1BRSA 1RGLA 4HAAA 3WR2A 1BRJA 3AHWA 5BIRA 1I2EA 1RDSA 1BSEA 1MGRA 3GSPA 1BNRA 1AY7A 1RGGA 5GSPA 1RTUA 3HOHA 1I0XA 3D5IA 1UCJA 1BU4A 1RLSA 4GHOA 2C4BA 3DH2A 1X1XA 1SARA 1GMRA 3BU4A 3AGOA 7RNTA 1RCKA 1BNEA 1LRAA 1X1UA 3D4AA 1RHLA 2AADA 1B2ZA 1YNVX 1RMSA 1C54A 1R4YA 2F5WA 3WHOA 2F56A 1B21A 1RNTA 3A5EA 8RNTA 1RN4A 3URPA 2RNTA 4J5KA 1BANA 3RNTA 1UCLA 2KF4A 1A2PA 6RNTA 1BRNL 1MGWA 1JBSA 1BNGA 1BRGA 6GSPA 5RNTA 1I70A 4BIRA 2F4YA 1BSCA 1DE3A 1B2UA 1BSBA 1BNJA 1HZ1A 1BNIA 1BRIA 1IYYA 1B3SA 1T2HA 1TRPA 1ZGXA 1BRHA 2BU4A 1PYLA 4BU4A 2SARA 1B27A 1FUTA 1FUSA 2HOHA 1X1WA 1LOYA 4HOHA 4RNTA 1AQZA 1TTOA 2BIRA 1RN1A 4GSPA 1I2GA 1GOVA 1BNFA 1BSDA 1GSPA 2RBIA 1FZUA 1HYFA 2GSPA 1CH0A 1B2MA 5BU4A 1BRKA 3DGYA 1LOVA 2ZA4A 1FYSA 1I0VA 7GSPA 1RGCA 1RGEA 2KAAA 1YVSA 5HOHA 4J5GA 9RNTA 1YGWA 1RNBA 1RGFA 1LNIA 2KF6A 2KF3A 3Q3FA 2F5MA 1B2XA 1FW7A 1BGSA 1UCKA 1GOUA 1JBTA 3AHSA 1RSNA 1BIRA 2AAEA 1Q9EA 1I2FA 1G02A 1RGKA 1TRQA 1RCLA 1LOWA 3AGNA 3KCHA 2KF5A 3BIRA 1I3IA 1X1YA 1B20A 1BVIA 1GMQA 1GMPA 1I3FA 3SYUA 1BSAA 3D5GA 1DETA 1BOXA
chains in the Genus database with same CATH superfamily
4U13A 1BNSA 4L8OA 1O7GB 3UB1A 4BTYA 1Q814 3DXOA 1GOYA 2B24B 3D3LA 3OX9A 2H0HA 1I8VA 4BL2A 1BUJA 4KT3B 1JBRA 1B2SA 3FF0A 2OWPA 2E2TA 5EQLA 1NB3I 3H51A 1RDSA 2B1XB 1BSEA 2INXA 4ILFA 4KFEA 4R9LA 5DREA 1YJN3 1IVVA 1Q40B 1BNRA 2CHCA 1ZX2A 5GSPA 4O8SA 2XGNA 3K5TA 3X40A 1FGRA 1I0XA 1U5OA 1W6CA 1WMOA 2Z76A 2Z77A 3UJMA 2WOFA 5EEOA 4K1VA 1SARA 1JRQA 3BU4A 1YI23 3AGOA 3S67A 7RNTA 3DY5A 3CNXA 5G1LA 2XH9A 3CD63 1W6GA 2GXFA 3NBBA 3HZPA 2XR8B 2H0GA 1B2ZA 1ZO2A 1S5AA 2F5WA 1GD4A 3T0UA 3V98A 1W2ZA 3LOYA 1JB2A 1FGMA 1JN5B 1OHOA 1KQS2 3NV0A 1DVDA 1RN4A 3FZWA 4J5KA 1EKMA 1SQWA 4FCJA 1BANA 4N6TA 2XSOB 3RNTA 5JPPA 1JB5A 2P05A 4IPBA 1UCLA 5I97A 3FCSB 3NBRA 4G1MB 3LMLA 5TGNA 3X3YA 1BRNL 2CG0A 4FMDA 3EF8A 1ULJB 1KC84 6GSPA 3LTDA 5LC6A 4BIRA 1VQO3 1NDOB 3TDGA 3N54B 1BSCA 1UUGB 4QWTA 2W04A 1WMPA 4WFOA 1IQYA 1HZ1A 1HU9A 1TIJA 3CPOA 2KRTA 2Y74A 2C10A 1WTHA 1T2HA 4LGQA 2CIUA 3Q90A 1TRPA 1ZGXA 2BU4A 1PYLA 1EA2A 3HX8A 3B4PA 1GS3A 1M1XB 1OHPA 2HOHA 2D1WA 2KCDA 4FCMA 4HM7B 1E3RA 3X3ZA 4RNTA 1LXEA 2ZDJA 1SPUA 4OVMA 5IEOA 2BIRA 5IG3A 3F14A 5FGOA 2ML6A 4EV5A 1GOVA 3KZTA 3CC23 5STDA 1BSDA 1GSPA 4K61A 3SLUA 1CH0A 4K90B 3V92A 3ZG5A 1BRKA 2HMNB 1LOVA 1QVG2 1YIT3 1FYSA 7GSPA 3G4S3 1GD3A 1BUQA 5HOHA 4KVHA 1RNBA 1E97A 2HMOB 2BMRB 3ZG0A 2KF6A 4LMIA 2V1LA 4XM4A 4BL3A 5DRVA 3NHXA 1UUWB 2KXGA 4HZ9B 1V74A 1GOUA 2HMJB 3J7Yd 1ASKA 3WA3A 3WMDA 4OUQA 5IENA 3RDEA 1Z1SA 4EW5A 5IG0A 5IW9A 1TRQA 2GU3A 3KCHA 5D83A 2KF5A 1MWTA 4FMBA 4WHAA 5AIIA 4HBRA 3FG1A 3EX9A 1K28A 1M1K4 1GMPA 1O7NB 2CFDA 4N6UA 5JPUA 1BSAA 5IG4A 2XEPA 1LOXA 1BOXA 3D4AA 4L8PA 4O02B 3N8BA 3F8HA 1PFPA 1DVCA 4XB5A 2QGUA 4ORLA 3WDGB 2XFTA 2YFJB 3X42A 1S723 2K0MA 3KFQC 4HM8B 2F86B 3IPTA 1N8R4 3K7CA 3MG1A 3NXJA 4LZIA 4R80A 1EG9B 3MG3A 2R41A 3WODG 4R9KA 1MGRA 4KZ1A 1MNLA 2YFIB 1AY7A 3FSDA 2XF3A 3D79A 1MWUA 1IVXA 3HOHA 4R1KA 3AMOA 3X3XA 2UGIA 1QMAA 1YIJ3 4GHOA 4KFFA 2MC8A 4CDLA 1VZZA 1X1XA 2YFLB 3I563 2Y73A 1OCVA 3QRDA 3OWYA 3KSPA 1X1UA 2MF7A 2AADA 3KKGA 4XDVA 1KD14 3HIIA 1PU4A 2JDIH 3U97A 2IA7A 1ROVA 1TP6A 1C54A 1N9JA 1B21A 1LQGC 3KE7A 1N5HA 1WMNA 3PGBA 3URPA 1JB4A 3WOEB 4LYLB 1NJI4 1LVNA 3CCM3 4HM5B 1K41A 1NNVA 2L4VA 1G96A 2W2CA 1AR0A 1A2VA 3QK9A 3KN4A 3DGLA 5LC7A 1DMNA 2PZVA 3K9MC 5IG5A 1VQ73 1JBSA 1VQ43 1BNGA 2BMOB 1VQ63 4RZMA 1FGOA 1IDPA 4H3UA 1IV7A 1IQXA 2FGTA 3G0KA 4NPBA 1A67A 4R4KA 1M9GA 3OWUA 1Q7Y4 1BSBA 3PYJA 3Q2PA 3FG3A 1W4NA 2RSXA 2CH9A 2K3DA 3DUKA 1QAFA 4AKYA 5AEUB 3NM2A 1TU5A 1STFI 3DGNA 2BO9B 2SARA 2A15A 1B27A 1QALA 2W9PA 5M1AA 1Q40A 2Z7AA 3IJEB 3LTAA 1X1WA 1W7CA 3A76A 4MMXB 1A2KA 4RNYA 1Q864 5ELUA 3JUPA 2P38A 1FZUA 1CYVA 3FKAA 2GEYA 4CPKA 3DGYA 1OF5A 4K1UA 2O3OA 3BLZA 3LTCA 1RGEA 3CMA3 1YVSA 1YJW3 1ISKA 4J5GA 1O7MB 3K63A 4STDA 3DGOA 3GRDA 5CF2A 1RKYA 4FCZA 2KF3A 3BB9A 2F5MA 1B2XA 1JN5A 3UL5A 1FUWA 1FW7A 2E2VA 1UCKA 3B4OA 4ZM8A 1MWSA 1IT8A 4FR9A 3AHSA 3LXUX 4J8TA 2I9WA 3UNLA 1FGQA 3CNMA 1G02A 3PCSA 1TUHA 3ZFZA 1RCLA 2HMKB 1LOWA 4XBYA 1JKGA 1SIHA 3BIRA 5AYRB 1STDA 1VQL3 1I3IA 1X1YA 1B20A 4J9AA 3FH1A 3LH4A 3FG4A 3G8ZA 1MWRA 1DETA 3NQYA 3SOAA 4WWUC 3F7SA 1ULIB 5JBSA 4EC6A 2OOVC 2IYJA 3FGYA 1T2IA 2OQEC 5KP3A 1Y4KA 1VQK3 1AVLA 3MSOA 3OW22 3CU3A 5A0OB 1BRSA 1LQMB 4HM1B 4HAAA 4HZBB 1KSIA 3WR2A 1VQP3 1BRJA 3AHWA 1O7WB 2RCDA 3SEDA 3CCR3 3VSYA 2CC3A 2HMMB 2CWTA 4XBTA 1FA3A 3JUNA 1RTUA 2XGLA 3UL6A 4HM6B 3X41A 4LEHA 1JNQA 1RLSA 3ECFA 4N6NB 2SBLA 2XFSA 3EN1B 3I0YA 3H3HA 1D6UA 1GY7A 1GMRA 1VQN3 1BNEA 1QVF2 1LRAA 5G1KA 1OUNA 2BMQB 1ROAA 1SJWA 3EQQB 3U1WA 3E99A 1RHLA 4JRFA 1YHQ3 2FNQA 2WO0A 1IT7A 1RRLA 1YNVX 2CFGA 1RMSA 2Q07A 1K734 4L7KA 5AIGA 2QIYA 3WHOA 2OOVA 5CXOA 1JV2B 3WA2X 2OQEA 1IU7A 3A5EA 3F8XA 3F9SA 4MEIA 3DGMA 3SVAA 1F8NA 4WYKA 2W0QA 1D6ZA 3DMCA 3LTBA 2JQ5A 2F99A 3NX0A 3AMOB 4BTWA 3NQZA 3JUOA 3OWSA 1A90A 2Z6BA 1UGHI 3CXC2 1CQSA 1DYUA 1MGWA 1K9M4 2W56B 4EXRA 1NWWA 1BRGA 1LNHA 2O9UX 2P0XA 1IQ8A 4HM4B 5BXQA 1SIIA 5RNTA 6STDA 2CFLA 4BTXA 1DE3A 1CEWI 5CF1A 1RJOA 1YVBI 2P09A 2W9QA 1TFOA 3MHEA 4RNZA 1B2UA 1N8QA 5M18A 3CCJ3 3CCE3 3EHCA 1BNIA 2K54A 2WOHA 2QEX3 2D42A 3MPHA 2P0MA 3HI7A 7STDA 8CHOA 3VGNA 1BRHA 4BU4A 4DKIA 1JZOA 3ROBA 1UI8A 3HK4A 2GU1A 1OH0A 1EUIC 2R4IA 2RFRA 5AI1A 3T8UA 1FUSA 3CCU3 4CCVA 5IEPA 1LOYA 1UUVB 3BNBA 3BNEA 1OACA 2LYXA 2GEXA 1TTOA 1RN1A 4GSPA 1Q7HA 5M19A 3NBJA 1I2GA 1RRHA 4HM3B 1B2MA 1HYFA 2GSPA 2BNGA 2YX9A 4EV2A 4MMZB 5BU4A 1N9EA 3G16A 1NO3A 1GYBA 1WQLB 3GZYB 1I0VA 5D82A 1NB5I 3S29A 2BHMA 2KAAA 2CW9A 5EVHA 3RGAA 4O3VA 4MJDA 1YGWA 4HYZA 3NV0B 1LNIA 1EEJA 3FLJA 3GZXB 1OHSA 5BVBA 4X2HA 3Q3FA 1L5GB 5IERA 4Q53A 3EB8A 4LSOA 3CC73 1Q824 1MOLA 1GY5A 1RSNA 3B7CA 1BIRA 2QA43 2AAEA 1O7PB 2CKFB 1Q9EA 4N6LA 1OPYA 2IUJA 1VQM3 1VQ53 3BNCA 3CPW2 3AGNA 3LZAA 4HJLB 3G713 2IMJA 3N9HA 3PXMA 4WP5A 3M8CA 1BVIA 1OF5B 1GMQA 1QJGA 3EE1A 4IT7A 3SX1A 3I553 3DZLA 4KFDA 3D5GA 4N6MA 3S28A 2ZL8A 1TJDA 2F98A 2ZHXB 1RGAA 1BAOA 1UCIA 4GB5A 4OK0A 4XDWA 3D9RA 3KSED 3EBTA 1PY3A 4HKVB 1RGHA 4XBXA 1U8CB 1RGLA 1W6YA 5KP4A 1D6YA 3L0RA 5AIHA 5IF6A 2H0IA 5BIRA 1I2EA 4NREA 2CX1A 2WGQA 3GSPA 4I4KA 2LQVA 1RGGA 1T5YA 1T3BA 4TX4A 2ML5A 5ELJA 4AKZA 1JKGB 3OV4A 1DMMA 3EBYA 1US1A 2M7OA 3EJVA 3D5IA 1UCJA 3CCV3 1BU4A 3NM7A 1IK3A 2C4BA 2CFKA 1V58A 3DH2A 1TFKA 4FMCA 5FW5A 1ZS7A 1YGEA 3G6E3 1VQ93 2CG1A 3NUVA 4IIAA 1RCKA 1WNHA 2GBWB 1W01A 1OGZA 1UGIA 3DM8A 2OCTA 4O2HA 1VQQA 4JF8A 1YJ93 1G0TA 1R4YA 3MWZA 2F56A 3KIIA 4MMYB 3GZBA 3LYGA 2UX0A 1RNTA 2OTJ3 1OGXA 8RNTA 3CCL3 2RGQA 1CYUA 2HMLB 2CWUA 1EQKA 2IUKA 3LT9A 5CK6A 2RNTA 1O7HB 1GY6A 1W5ZA 3GAXA 3SOYA 4X2OA 3F7XA 2KF4A 4I5QA 1A2PA 1QAKA 1UW1A 2PNCA 2W03A 6RNTA 1UDII 4EBGA 3ALAA 3CCQ3 2FXTA 3STDA 5KP1A 4HM2B 1I70A 1NU3A 3RGRA 3F40A 4NHFA 2F4YA 2XSHB 5CLKA 3ER7A 3V99A 3HIGA 5AYSC 1BNJA 3B8LA 4N3VA 1BRIA 1C7HA 3BNDA 4WYKB 2OTL3 3PCRA 1B3SA 1AVKA 1IVWA 1IYYA 2XRXB 1IV9A 1V57A 4PEJA 2J8XB 3CCS3 3LT8A 1R4CA 2IY2A 1HKXA 3EN8A 1N5PA 1W00A 3PS8A 3PZWA 1M904 1FUTA 2C11A 2BT3A 1K8A4 3CC43 3EC9A 4HOHA 5G2GA 1AQZA 3S27A 1FGTA 4FMAA 5AEWB 1BNFA 2L1SA 2RBIA 4AEQA 1VQ83 4CJNA 3MYTA 2ZA4A 5HGRA 3WOFB 1RGCA 1JJ22 3FF2A 4N6OB 4EYCA 3JUMA 1JZDA 1W2B2 4H61A 9RNTA 1RN7A 3Q1CA 3CME3 1RGFA 3JUQA 3K0ZA 2CX0A 4GL6A 1UI7A 2CK3H 3OXAA 1DMQA 5AIFA 1Q42A 3GZRA 3MKIA 3JVCA 1BGSA 4HM0B 3SXXA 2WGOA 1E3VA 3O8YA 3T8NA 1JBTA 4RBNA 1KWIA 3VF1A 4HVNA 2STDA 3MG2A 2CWVA 1AV4A 2W6JH 1I2FA 1RGKA 2E2UA 2CFWA 4N6V0 1J2BA 3GWRA 5D81A 1W02A 1I3FA 2UUGC 2W56A 2GBXB 3SYUA 3S5CA 1IVUA 3IMAB
chains in the Genus database with same CATH topology
1BNSA 1RGAA 1BAOA 1UCIA 1T2IA 1GOYA 1I8VA 1PY3A 1RGHA 1BUJA 1JBRA 1B2SA 1BRSA 1RGLA 4HAAA 3WR2A 1BRJA 3AHWA 5BIRA 1I2EA 1RDSA 1BSEA 1MGRA 3GSPA 1BNRA 1AY7A 1RGGA 5GSPA 1RTUA 3HOHA 1I0XA 3D5IA 1UCJA 1BU4A 1RLSA 4GHOA 2C4BA 3DH2A 1X1XA 1SARA 1GMRA 3BU4A 3AGOA 7RNTA 1RCKA 1BNEA 1LRAA 1X1UA 3D4AA 1RHLA 2AADA 1B2ZA 1YNVX 1RMSA 1C54A 1R4YA 2F5WA 3WHOA 2F56A 1B21A 1RNTA 3A5EA 8RNTA 1RN4A 3URPA 2RNTA 4J5KA 1BANA 3RNTA 1UCLA 2KF4A 1A2PA 6RNTA 1BRNL 1MGWA 1JBSA 1BNGA 1BRGA 6GSPA 5RNTA 1I70A 4BIRA 2F4YA 1BSCA 1DE3A 1B2UA 1BSBA 1BNJA 1HZ1A 1BNIA 1BRIA 1IYYA 1B3SA 1T2HA 1TRPA 1ZGXA 1BRHA 2BU4A 1PYLA 4BU4A 2SARA 1B27A 1FUTA 1FUSA 2HOHA 1X1WA 1LOYA 4HOHA 4RNTA 1AQZA 1TTOA 2BIRA 1RN1A 4GSPA 1I2GA 1GOVA 1BNFA 1BSDA 1GSPA 2RBIA 1FZUA 1HYFA 2GSPA 1CH0A 1B2MA 5BU4A 1BRKA 3DGYA 1LOVA 2ZA4A 1FYSA 1I0VA 7GSPA 1RGCA 1RGEA 2KAAA 1YVSA 5HOHA 4J5GA 9RNTA 1YGWA 1RNBA 1RGFA 1LNIA 2KF6A 2KF3A 3Q3FA 2F5MA 1B2XA 1FW7A 1BGSA 1UCKA 1GOUA 1JBTA 3AHSA 1RSNA 1BIRA 2AAEA 1Q9EA 1I2FA 1G02A 1RGKA 1TRQA 1RCLA 1LOWA 3AGNA 3KCHA 2KF5A 3BIRA 1I3IA 1X1YA 1B20A 1BVIA 1GMQA 1GMPA 1I3FA 3SYUA 1BSAA 3D5GA 1DETA 1BOXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BNS A;  1RGA A;  1BAO A;  1UCI A;  1T2I A;  1GOY A;  1I8V A;  1PY3 A;  1RGH A;  1BUJ A;  1JBR A;  1B2S A;  1BRS A;  1RGL A;  4HAA A;  3WR2 A;  1BRJ A;  3AHW A;  5BIR A;  1I2E A;  1RDS A;  1BSE A;  1MGR A;  3GSP A;  1BNR A;  1AY7 A;  1RGG A;  5GSP A;  1RTU A;  3HOH A;  1I0X A;  3D5I A;  1UCJ A;  1BU4 A;  1RLS A;  4GHO A;  2C4B A;  3DH2 A;  1X1X A;  1SAR A;  1GMR A;  3BU4 A;  3AGO A;  7RNT A;  1RCK A;  1BNE A;  1LRA A;  1X1U A;  3D4A A;  1RHL A;  2AAD A;  1B2Z A;  1YNV X;  1RMS A;  1C54 A;  1R4Y A;  2F5W A;  3WHO A;  2F56 A;  1B21 A;  1RNT A;  3A5E A;  8RNT A;  1RN4 A;  3URP A;  2RNT A;  4J5K A;  1BAN A;  3RNT A;  1UCL A;  2KF4 A;  1A2P A;  6RNT A;  1BRN L;  1MGW A;  1JBS A;  1BNG A;  1BRG A;  6GSP A;  5RNT A;  1I70 A;  4BIR A;  2F4Y A;  1BSC A;  1DE3 A;  1B2U A;  1BSB A;  1BNJ A;  1HZ1 A;  1BNI A;  1BRI A;  1IYY A;  1B3S A;  1T2H A;  1TRP A;  1ZGX A;  1BRH A;  2BU4 A;  1PYL A;  4BU4 A;  2SAR A;  1B27 A;  1FUT A;  1FUS A;  2HOH A;  1X1W A;  1LOY A;  4HOH A;  4RNT A;  1AQZ A;  1TTO A;  2BIR A;  1RN1 A;  4GSP A;  1I2G A;  1GOV A;  1BNF A;  1BSD A;  1GSP A;  2RBI A;  1FZU A;  1HYF A;  2GSP A;  1CH0 A;  1B2M A;  5BU4 A;  1BRK A;  3DGY A;  1LOV A;  2ZA4 A;  1FYS A;  1I0V A;  7GSP A;  1RGC A;  1RGE A;  2KAA A;  1YVS A;  5HOH A;  4J5G A;  9RNT A;  1YGW A;  1RNB A;  1RGF A;  1LNI A;  2KF6 A;  2KF3 A;  3Q3F A;  2F5M A;  1B2X A;  1FW7 A;  1BGS A;  1UCK A;  1GOU A;  1JBT A;  3AHS A;  1RSN A;  1BIR A;  2AAE A;  1Q9E A;  1I2F A;  1G02 A;  1RGK A;  1TRQ A;  1RCL A;  1LOW A;  3AGN A;  3KCH A;  2KF5 A;  3BIR A;  1I3I A;  1X1Y A;  1B20 A;  1BVI A;  1GMQ A;  1GMP A;  1I3F A;  3SYU A;  1BSA A;  3D5G A;  1DET A;  1BOX A; 
#chains in the Genus database with same CATH topology
 4U13 A;  1BNS A;  4L8O A;  1O7G B;  3UB1 A;  4BTY A;  1Q81 4;  3DXO A;  1GOY A;  2B24 B;  3D3L A;  3OX9 A;  2H0H A;  1I8V A;  4BL2 A;  1BUJ A;  4KT3 B;  1JBR A;  1B2S A;  3FF0 A;  2OWP A;  2E2T A;  5EQL A;  1NB3 I;  3H51 A;  1RDS A;  2B1X B;  1BSE A;  2INX A;  4ILF A;  4KFE A;  4R9L A;  5DRE A;  1YJN 3;  1IVV A;  1Q40 B;  1BNR A;  2CHC A;  1ZX2 A;  5GSP A;  4O8S A;  2XGN A;  3K5T A;  3X40 A;  1FGR A;  1I0X A;  1U5O A;  1W6C A;  1WMO A;  2Z76 A;  2Z77 A;  3UJM A;  2WOF A;  5EEO A;  4K1V A;  1SAR A;  1JRQ A;  3BU4 A;  1YI2 3;  3AGO A;  3S67 A;  7RNT A;  3DY5 A;  3CNX A;  5G1L A;  2XH9 A;  3CD6 3;  1W6G A;  2GXF A;  3NBB A;  3HZP A;  2XR8 B;  2H0G A;  1B2Z A;  1ZO2 A;  1S5A A;  2F5W A;  1GD4 A;  3T0U A;  3V98 A;  1W2Z A;  3LOY A;  1JB2 A;  1FGM A;  1JN5 B;  1OHO A;  1KQS 2;  3NV0 A;  1DVD A;  1RN4 A;  3FZW A;  4J5K A;  1EKM A;  1SQW A;  4FCJ A;  1BAN A;  4N6T A;  2XSO B;  3RNT A;  5JPP A;  1JB5 A;  2P05 A;  4IPB A;  1UCL A;  5I97 A;  3FCS B;  3NBR A;  4G1M B;  3LML A;  5TGN A;  3X3Y A;  1BRN L;  2CG0 A;  4FMD A;  3EF8 A;  1ULJ B;  1KC8 4;  6GSP A;  3LTD A;  5LC6 A;  4BIR A;  1VQO 3;  1NDO B;  3TDG A;  3N54 B;  1BSC A;  1UUG B;  4QWT A;  2W04 A;  1WMP A;  4WFO A;  1IQY A;  1HZ1 A;  1HU9 A;  1TIJ A;  3CPO A;  2KRT A;  2Y74 A;  2C10 A;  1WTH A;  1T2H A;  4LGQ A;  2CIU A;  3Q90 A;  1TRP A;  1ZGX A;  2BU4 A;  1PYL A;  1EA2 A;  3HX8 A;  3B4P A;  1GS3 A;  1M1X B;  1OHP A;  2HOH A;  2D1W A;  2KCD A;  4FCM A;  4HM7 B;  1E3R A;  3X3Z A;  4RNT A;  1LXE A;  2ZDJ A;  1SPU A;  4OVM A;  5IEO A;  2BIR A;  5IG3 A;  3F14 A;  5FGO A;  2ML6 A;  4EV5 A;  1GOV A;  3KZT A;  3CC2 3;  5STD A;  1BSD A;  1GSP A;  4K61 A;  3SLU A;  1CH0 A;  4K90 B;  3V92 A;  3ZG5 A;  1BRK A;  2HMN B;  1LOV A;  1QVG 2;  1YIT 3;  1FYS A;  7GSP A;  3G4S 3;  1GD3 A;  1BUQ A;  5HOH A;  4KVH A;  1RNB A;  1E97 A;  2HMO B;  2BMR B;  3ZG0 A;  2KF6 A;  4LMI A;  2V1L A;  4XM4 A;  4BL3 A;  5DRV A;  3NHX A;  1UUW B;  2KXG A;  4HZ9 B;  1V74 A;  1GOU A;  2HMJ B;  3J7Y d;  1ASK A;  3WA3 A;  3WMD A;  4OUQ A;  5IEN A;  3RDE A;  1Z1S A;  4EW5 A;  5IG0 A;  5IW9 A;  1TRQ A;  2GU3 A;  3KCH A;  5D83 A;  2KF5 A;  1MWT A;  4FMB A;  4WHA A;  5AII A;  4HBR A;  3FG1 A;  3EX9 A;  1K28 A;  1M1K 4;  1GMP A;  1O7N B;  2CFD A;  4N6U A;  5JPU A;  1BSA A;  5IG4 A;  2XEP A;  1LOX A;  1BOX A;  3D4A A;  4L8P A;  4O02 B;  3N8B A;  3F8H A;  1PFP A;  1DVC A;  4XB5 A;  2QGU A;  4ORL A;  3WDG B;  2XFT A;  2YFJ B;  3X42 A;  1S72 3;  2K0M A;  3KFQ C;  4HM8 B;  2F86 B;  3IPT A;  1N8R 4;  3K7C A;  3MG1 A;  3NXJ A;  4LZI A;  4R80 A;  1EG9 B;  3MG3 A;  2R41 A;  3WOD G;  4R9K A;  1MGR A;  4KZ1 A;  1MNL A;  2YFI B;  1AY7 A;  3FSD A;  2XF3 A;  3D79 A;  1MWU A;  1IVX A;  3HOH A;  4R1K A;  3AMO A;  3X3X A;  2UGI A;  1QMA A;  1YIJ 3;  4GHO A;  4KFF A;  2MC8 A;  4CDL A;  1VZZ A;  1X1X A;  2YFL B;  3I56 3;  2Y73 A;  1OCV A;  3QRD A;  3OWY A;  3KSP A;  1X1U A;  2MF7 A;  2AAD A;  3KKG A;  4XDV A;  1KD1 4;  3HII A;  1PU4 A;  2JDI H;  3U97 A;  2IA7 A;  1ROV A;  1TP6 A;  1C54 A;  1N9J A;  1B21 A;  1LQG C;  3KE7 A;  1N5H A;  1WMN A;  3PGB A;  3URP A;  1JB4 A;  3WOE B;  4LYL B;  1NJI 4;  1LVN A;  3CCM 3;  4HM5 B;  1K41 A;  1NNV A;  2L4V A;  1G96 A;  2W2C A;  1AR0 A;  1A2V A;  3QK9 A;  3KN4 A;  3DGL A;  5LC7 A;  1DMN A;  2PZV A;  3K9M C;  5IG5 A;  1VQ7 3;  1JBS A;  1VQ4 3;  1BNG A;  2BMO B;  1VQ6 3;  4RZM A;  1FGO A;  1IDP A;  4H3U A;  1IV7 A;  1IQX A;  2FGT A;  3G0K A;  4NPB A;  1A67 A;  4R4K A;  1M9G A;  3OWU A;  1Q7Y 4;  1BSB A;  3PYJ A;  3Q2P A;  3FG3 A;  1W4N A;  2RSX A;  2CH9 A;  2K3D A;  3DUK A;  1QAF A;  4AKY A;  5AEU B;  3NM2 A;  1TU5 A;  1STF I;  3DGN A;  2BO9 B;  2SAR A;  2A15 A;  1B27 A;  1QAL A;  2W9P A;  5M1A A;  1Q40 A;  2Z7A A;  3IJE B;  3LTA A;  1X1W A;  1W7C A;  3A76 A;  4MMX B;  1A2K A;  4RNY A;  1Q86 4;  5ELU A;  3JUP A;  2P38 A;  1FZU A;  1CYV A;  3FKA A;  2GEY A;  4CPK A;  3DGY A;  1OF5 A;  4K1U A;  2O3O A;  3BLZ A;  3LTC A;  1RGE A;  3CMA 3;  1YVS A;  1YJW 3;  1ISK A;  4J5G A;  1O7M B;  3K63 A;  4STD A;  3DGO A;  3GRD A;  5CF2 A;  1RKY A;  4FCZ A;  2KF3 A;  3BB9 A;  2F5M A;  1B2X A;  1JN5 A;  3UL5 A;  1FUW A;  1FW7 A;  2E2V A;  1UCK A;  3B4O A;  4ZM8 A;  1MWS A;  1IT8 A;  4FR9 A;  3AHS A;  3LXU X;  4J8T A;  2I9W A;  3UNL A;  1FGQ A;  3CNM A;  1G02 A;  3PCS A;  1TUH A;  3ZFZ A;  1RCL A;  2HMK B;  1LOW A;  4XBY A;  1JKG A;  1SIH A;  3BIR A;  5AYR B;  1STD A;  1VQL 3;  1I3I A;  1X1Y A;  1B20 A;  4J9A A;  3FH1 A;  3LH4 A;  3FG4 A;  3G8Z A;  1MWR A;  1DET A;  3NQY A;  3SOA A;  4WWU C;  3F7S A;  1ULI B;  5JBS A;  4EC6 A;  2OOV C;  2IYJ A;  3FGY A;  1T2I A;  2OQE C;  5KP3 A;  1Y4K A;  1VQK 3;  1AVL A;  3MSO A;  3OW2 2;  3CU3 A;  5A0O B;  1BRS A;  1LQM B;  4HM1 B;  4HAA A;  4HZB B;  1KSI A;  3WR2 A;  1VQP 3;  1BRJ A;  3AHW A;  1O7W B;  2RCD A;  3SED A;  3CCR 3;  3VSY A;  2CC3 A;  2HMM B;  2CWT A;  4XBT A;  1FA3 A;  3JUN A;  1RTU A;  2XGL A;  3UL6 A;  4HM6 B;  3X41 A;  4LEH A;  1JNQ A;  1RLS A;  3ECF A;  4N6N B;  2SBL A;  2XFS A;  3EN1 B;  3I0Y A;  3H3H A;  1D6U A;  1GY7 A;  1GMR A;  1VQN 3;  1BNE A;  1QVF 2;  1LRA A;  5G1K A;  1OUN A;  2BMQ B;  1ROA A;  1SJW A;  3EQQ B;  3U1W A;  3E99 A;  1RHL A;  4JRF A;  1YHQ 3;  2FNQ A;  2WO0 A;  1IT7 A;  1RRL A;  1YNV X;  2CFG A;  1RMS A;  2Q07 A;  1K73 4;  4L7K A;  5AIG A;  2QIY A;  3WHO A;  2OOV A;  5CXO A;  1JV2 B;  3WA2 X;  2OQE A;  1IU7 A;  3A5E A;  3F8X A;  3F9S A;  4MEI A;  3DGM A;  3SVA A;  1F8N A;  4WYK A;  2W0Q A;  1D6Z A;  3DMC A;  3LTB A;  2JQ5 A;  2F99 A;  3NX0 A;  3AMO B;  4BTW A;  3NQZ A;  3JUO A;  3OWS A;  1A90 A;  2Z6B A;  1UGH I;  3CXC 2;  1CQS A;  1DYU A;  1MGW A;  1K9M 4;  2W56 B;  4EXR A;  1NWW A;  1BRG A;  1LNH A;  2O9U X;  2P0X A;  1IQ8 A;  4HM4 B;  5BXQ A;  1SII A;  5RNT A;  6STD A;  2CFL A;  4BTX A;  1DE3 A;  1CEW I;  5CF1 A;  1RJO A;  1YVB I;  2P09 A;  2W9Q A;  1TFO A;  3MHE A;  4RNZ A;  1B2U A;  1N8Q A;  5M18 A;  3CCJ 3;  3CCE 3;  3EHC A;  1BNI A;  2K54 A;  2WOH A;  2QEX 3;  2D42 A;  3MPH A;  2P0M A;  3HI7 A;  7STD A;  8CHO A;  3VGN A;  1BRH A;  4BU4 A;  4DKI A;  1JZO A;  3ROB A;  1UI8 A;  3HK4 A;  2GU1 A;  1OH0 A;  1EUI C;  2R4I A;  2RFR A;  5AI1 A;  3T8U A;  1FUS A;  3CCU 3;  4CCV A;  5IEP A;  1LOY A;  1UUV B;  3BNB A;  3BNE A;  1OAC A;  2LYX A;  2GEX A;  1TTO A;  1RN1 A;  4GSP A;  1Q7H A;  5M19 A;  3NBJ A;  1I2G A;  1RRH A;  4HM3 B;  1B2M A;  1HYF A;  2GSP A;  2BNG A;  2YX9 A;  4EV2 A;  4MMZ B;  5BU4 A;  1N9E A;  3G16 A;  1NO3 A;  1GYB A;  1WQL B;  3GZY B;  1I0V A;  5D82 A;  1NB5 I;  3S29 A;  2BHM A;  2KAA A;  2CW9 A;  5EVH A;  3RGA A;  4O3V A;  4MJD A;  1YGW A;  4HYZ A;  3NV0 B;  1LNI A;  1EEJ A;  3FLJ A;  3GZX B;  1OHS A;  5BVB A;  4X2H A;  3Q3F A;  1L5G B;  5IER A;  4Q53 A;  3EB8 A;  4LSO A;  3CC7 3;  1Q82 4;  1MOL A;  1GY5 A;  1RSN A;  3B7C A;  1BIR A;  2QA4 3;  2AAE A;  1O7P B;  2CKF B;  1Q9E A;  4N6L A;  1OPY A;  2IUJ A;  1VQM 3;  1VQ5 3;  3BNC A;  3CPW 2;  3AGN A;  3LZA A;  4HJL B;  3G71 3;  2IMJ A;  3N9H A;  3PXM A;  4WP5 A;  3M8C A;  1BVI A;  1OF5 B;  1GMQ A;  1QJG A;  3EE1 A;  4IT7 A;  3SX1 A;  3I55 3;  3DZL A;  4KFD A;  3D5G A;  4N6M A;  3S28 A;  2ZL8 A;  1TJD A;  2F98 A;  2ZHX B;  1RGA A;  1BAO A;  1UCI A;  4GB5 A;  4OK0 A;  4XDW A;  3D9R A;  3KSE D;  3EBT A;  1PY3 A;  4HKV B;  1RGH A;  4XBX A;  1U8C B;  1RGL A;  1W6Y A;  5KP4 A;  1D6Y A;  3L0R A;  5AIH A;  5IF6 A;  2H0I A;  5BIR A;  1I2E A;  4NRE A;  2CX1 A;  2WGQ A;  3GSP A;  4I4K A;  2LQV A;  1RGG A;  1T5Y A;  1T3B A;  4TX4 A;  2ML5 A;  5ELJ A;  4AKZ A;  1JKG B;  3OV4 A;  1DMM A;  3EBY A;  1US1 A;  2M7O A;  3EJV A;  3D5I A;  1UCJ A;  3CCV 3;  1BU4 A;  3NM7 A;  1IK3 A;  2C4B A;  2CFK A;  1V58 A;  3DH2 A;  1TFK A;  4FMC A;  5FW5 A;  1ZS7 A;  1YGE A;  3G6E 3;  1VQ9 3;  2CG1 A;  3NUV A;  4IIA A;  1RCK A;  1WNH A;  2GBW B;  1W01 A;  1OGZ A;  1UGI A;  3DM8 A;  2OCT A;  4O2H A;  1VQQ A;  4JF8 A;  1YJ9 3;  1G0T A;  1R4Y A;  3MWZ A;  2F56 A;  3KII A;  4MMY B;  3GZB A;  3LYG A;  2UX0 A;  1RNT A;  2OTJ 3;  1OGX A;  8RNT A;  3CCL 3;  2RGQ A;  1CYU A;  2HML B;  2CWU A;  1EQK A;  2IUK A;  3LT9 A;  5CK6 A;  2RNT A;  1O7H B;  1GY6 A;  1W5Z A;  3GAX A;  3SOY A;  4X2O A;  3F7X A;  2KF4 A;  4I5Q A;  1A2P A;  1QAK A;  1UW1 A;  2PNC A;  2W03 A;  6RNT A;  1UDI I;  4EBG A;  3ALA A;  3CCQ 3;  2FXT A;  3STD A;  5KP1 A;  4HM2 B;  1I70 A;  1NU3 A;  3RGR A;  3F40 A;  4NHF A;  2F4Y A;  2XSH B;  5CLK A;  3ER7 A;  3V99 A;  3HIG A;  5AYS C;  1BNJ A;  3B8L A;  4N3V A;  1BRI A;  1C7H A;  3BND A;  4WYK B;  2OTL 3;  3PCR A;  1B3S A;  1AVK A;  1IVW A;  1IYY A;  2XRX B;  1IV9 A;  1V57 A;  4PEJ A;  2J8X B;  3CCS 3;  3LT8 A;  1R4C A;  2IY2 A;  1HKX A;  3EN8 A;  1N5P A;  1W00 A;  3PS8 A;  3PZW A;  1M90 4;  1FUT A;  2C11 A;  2BT3 A;  1K8A 4;  3CC4 3;  3EC9 A;  4HOH A;  5G2G A;  1AQZ A;  3S27 A;  1FGT A;  4FMA A;  5AEW B;  1BNF A;  2L1S A;  2RBI A;  4AEQ A;  1VQ8 3;  4CJN A;  3MYT A;  2ZA4 A;  5HGR A;  3WOF B;  1RGC A;  1JJ2 2;  3FF2 A;  4N6O B;  4EYC A;  3JUM A;  1JZD A;  1W2B 2;  4H61 A;  9RNT A;  1RN7 A;  3Q1C A;  3CME 3;  1RGF A;  3JUQ A;  3K0Z A;  2CX0 A;  4GL6 A;  1UI7 A;  2CK3 H;  3OXA A;  1DMQ A;  5AIF A;  1Q42 A;  3GZR A;  3MKI A;  3JVC A;  1BGS A;  4HM0 B;  3SXX A;  2WGO A;  1E3V A;  3O8Y A;  3T8N A;  1JBT A;  4RBN A;  1KWI A;  3VF1 A;  4HVN A;  2STD A;  3MG2 A;  2CWV A;  1AV4 A;  2W6J H;  1I2F A;  1RGK A;  2E2U A;  2CFW A;  4N6V 0;  1J2B A;  3GWR A;  5D81 A;  1W02 A;  1I3F A;  2UUG C;  2W56 A;  2GBX B;  3SYU A;  3S5C A;  1IVU A;  3IMA B; 
#chains in the Genus database with same CATH homology
 1BNS A;  1RGA A;  1BAO A;  1UCI A;  1T2I A;  1GOY A;  1I8V A;  1PY3 A;  1RGH A;  1BUJ A;  1JBR A;  1B2S A;  1BRS A;  1RGL A;  4HAA A;  3WR2 A;  1BRJ A;  3AHW A;  5BIR A;  1I2E A;  1RDS A;  1BSE A;  1MGR A;  3GSP A;  1BNR A;  1AY7 A;  1RGG A;  5GSP A;  1RTU A;  3HOH A;  1I0X A;  3D5I A;  1UCJ A;  1BU4 A;  1RLS A;  4GHO A;  2C4B A;  3DH2 A;  1X1X A;  1SAR A;  1GMR A;  3BU4 A;  3AGO A;  7RNT A;  1RCK A;  1BNE A;  1LRA A;  1X1U A;  3D4A A;  1RHL A;  2AAD A;  1B2Z A;  1YNV X;  1RMS A;  1C54 A;  1R4Y A;  2F5W A;  3WHO A;  2F56 A;  1B21 A;  1RNT A;  3A5E A;  8RNT A;  1RN4 A;  3URP A;  2RNT A;  4J5K A;  1BAN A;  3RNT A;  1UCL A;  2KF4 A;  1A2P A;  6RNT A;  1BRN L;  1MGW A;  1JBS A;  1BNG A;  1BRG A;  6GSP A;  5RNT A;  1I70 A;  4BIR A;  2F4Y A;  1BSC A;  1DE3 A;  1B2U A;  1BSB A;  1BNJ A;  1HZ1 A;  1BNI A;  1BRI A;  1IYY A;  1B3S A;  1T2H A;  1TRP A;  1ZGX A;  1BRH A;  2BU4 A;  1PYL A;  4BU4 A;  2SAR A;  1B27 A;  1FUT A;  1FUS A;  2HOH A;  1X1W A;  1LOY A;  4HOH A;  4RNT A;  1AQZ A;  1TTO A;  2BIR A;  1RN1 A;  4GSP A;  1I2G A;  1GOV A;  1BNF A;  1BSD A;  1GSP A;  2RBI A;  1FZU A;  1HYF A;  2GSP A;  1CH0 A;  1B2M A;  5BU4 A;  1BRK A;  3DGY A;  1LOV A;  2ZA4 A;  1FYS A;  1I0V A;  7GSP A;  1RGC A;  1RGE A;  2KAA A;  1YVS A;  5HOH A;  4J5G A;  9RNT A;  1YGW A;  1RNB A;  1RGF A;  1LNI A;  2KF6 A;  2KF3 A;  3Q3F A;  2F5M A;  1B2X A;  1FW7 A;  1BGS A;  1UCK A;  1GOU A;  1JBT A;  3AHS A;  1RSN A;  1BIR A;  2AAE A;  1Q9E A;  1I2F A;  1G02 A;  1RGK A;  1TRQ A;  1RCL A;  1LOW A;  3AGN A;  3KCH A;  2KF5 A;  3BIR A;  1I3I A;  1X1Y A;  1B20 A;  1BVI A;  1GMQ A;  1GMP A;  1I3F A;  3SYU A;  1BSA A;  3D5G A;  1DET A;  1BOX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...