1UCLA

Mutants of rnase sa
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
96
structure length
96
Chain Sequence
DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTTITPGARTRGTRRIITGEATQEDYYTGDHYATFSLIDQTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Guanyl-specific ribonuclease Sa
publication title The contribution of polar group burial to protein stability is strongly context-dependent
pubmed doi rcsb
source organism Streptomyces aureofaciens
total genus 24
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2003-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1uclA00
3BIRA 3AGOA 4BIRA 1I70A 1RGEA 3D4AA 1BRGA 2SARA 7RNTA 3DH2A 3WR2A 1B2XA 1GOVA 2KF5A 1BSDA 3D5GA 1BSBA 2ZA4A 1RN1A 1RMSA 1PYLA 1SARA 1I3FA 3AHSA 1G02A 4J5GA 1X1YA 3KCHA 1B2UA 3BU4A 1RSNA 1RN4A 3GSPA 6GSPA 1RGKA 2C4BA 1C54A 1UCLA 2KF4A 4J5KA 1RNBA 1Q9EA 1TTOA 3WHOA 1BIRA 3URPA 2AAEA 1BRHA 4HOHA 5BIRA 1X1WA 1YGWA 2BIRA 1I8VA 1GMRA 1B20A 1RGGA 5RNTA 1AY7A 6RNTA 1B21A 1B2ZA 1HZ1A 1I0XA 1HYFA 1DE3A 1B27A 1BRIA 1BNGA 1RHLA 2BU4A 1BANA 1LOYA 3A5EA 3Q3FA 1X1UA 1RGFA 1MGWA 1I2FA 7GSPA 9RNTA 1FUTA 1JBSA 1RTUA 1YNVX 5HOHA 2F4YA 1BNSA 3AGNA 2KF6A 1YVSA 1GOUA 5BU4A 1I2GA 1RLSA 1ZGXA 8RNTA 1BSAA 3AHWA 1I3IA 4RNTA 1FZUA 1LOWA 3RNTA 1BRSA 1DETA 1IYYA 1LOVA 1R4YA 4HAAA 1B2MA 1BSEA 1RGAA 1JBTA 1FW7A 2GSPA 1JBRA 1MGRA 1B3SA 1FUSA 2AADA 1UCJA 1BNIA 4GHOA 1T2HA 1RGLA 2F5MA 1BRJA 1TRQA 1GOYA 1RGHA 1UCKA 2HOHA 1GSPA 3DGYA 1BRKA 1BNFA 1BSCA 1GMQA 3SYUA 4GSPA 1RNTA 1BVIA 1BAOA 2KF3A 1AQZA 1BNRA 1RDSA 1FYSA 1RCLA 3D5IA 1BUJA 1BNEA 1RGCA 1BOXA 1RCKA 2F5WA 1X1XA 2RBIA 2RNTA 1LNIA 5GSPA 1I0VA 1A2PA 1CH0A 1LRAA 1BRNL 3HOHA 2F56A 1GMPA 1BNJA 1B2SA 1PY3A 1T2IA 4BU4A 1BGSA 1BU4A 1TRPA 1I2EA 2KAAA 1UCIA
chains in the Genus database with same CATH superfamily
2QEX3 1SPUA 1JRQA 1RGEA 3I563 1BRGA 2F86B 1OCVA 2KCDA 3KFQC 3DH2A 4PEJA 3WR2A 2L1SA 2W9PA 2XGLA 2BMOB 4L8OA 1MWSA 2K3DA 3NQYA 1SQWA 1WMPA 2CFWA 3N54B 3IJEB 4JRFA 4HKVB 2UUGC 3PS8A 4O02B 4EXRA 2C10A 4WYKB 1IT8A 3MWZA 5BXQA 1HKXA 3FG1A 1N9EA 3BU4A 4KFEA 3SOYA 3JUOA 5M19A 1RN4A 2M7OA 2P05A 5IERA 1BUQA 1RGKA 1IV7A 3PCRA 5CLKA 4XBTA 2XH9A 4U13A 1YJN3 1W4NA 2XFTA 4HJLB 1LQMB 1S723 1T3BA 3NUVA 1E3VA 1IVUA 2OQEC 2AAEA 3Q90A 2W2CA 1KSIA 4HOHA 2A15A 4NHFA 1U8CB 4HZBB 4EV2A 1RGGA 2QIYA 3HZPA 5M1AA 1L5GB 2YFJB 4DKIA 3MG2A 3OV4A 1CQSA 3TDGA 2XSHB 3EJVA 3OWSA 4K1UA 2BU4A 1OH0A 3CCR3 1LOYA 1N8R4 2GXFA 5A0OB 1US1A 3PYJA 3EQQB 2B24B 1D6ZA 2XF3A 1KQS2 4RZMA 1FUTA 3LT8A 9RNTA 1JBSA 1J2BA 5HOHA 3A76A 2H0HA 2RGQA 1E97A 1JN5A 2F98A 2KF6A 5LC7A 1UDII 3B4PA 4CDLA 3CCV3 1W6YA 3V98A 1U5OA 4OVMA 5EQLA 1NJI4 1OACA 3CNMA 4O3VA 4LZIA 5IG4A 3F14A 3LZAA 2P09A 1QMAA 3JVCA 3BLZA 3S28A 3K7CA 3M8CA 1VQ83 2OOVA 1LOVA 1R4YA 3UB1A 4MMYB 1JBTA 1FW7A 1Z1SA 3DGOA 2GSPA 4N6MA 1MGRA 1B3SA 1FUSA 1GD3A 1O7PB 2AADA 2E2VA 3BNEA 4GHOA 1ZX2A 1T2HA 3F8XA 5CK6A 3BB9A 1BRJA 1GYBA 4WWUC 4KZ1A 3X40A 3EE1A 2HOHA 1MWUA 1NDOB 3WOFB 1BRKA 3LT9A 5AIHA 4RNYA 1VQ43 3G8ZA 4L8PA 4GSPA 2ML6A 3Q2PA 3CCE3 1BAOA 1DYUA 1AQZA 4GB5A 3CNXA 1BNRA 3PXMA 3NHXA 2JDIH 4N6UA 1VQO3 1KD14 1RDSA 2R41A 2ZDJA 3KN4A 2CG1A 3D5IA 4MMZB 1BUJA 4TX4A 2Z7AA 1RGCA 1OGZA 2STDA 1JV2B 3N9HA 3OWUA 4BL3A 8CHOA 1IT7A 1X1XA 1JN5B 2RNTA 3LTDA 1QAFA 5AIIA 2UGIA 1W01A 4QWTA 2Z6BA 1M1XB 5DREA 1CH0A 2GBXB 1LRAA 5IG0A 4N6LA 2BNGA 3VF1A 1MNLA 1YIJ3 1VQQA 1IVVA 2CC3A 4R9LA 3CCJ3 4OUQA 3FG4A 3NXJA 2YFLB 1T5YA 2HMNB 3G16A 3JUQA 2CWTA 1UGHI 2KRTA 3OW22 2WGOA 5CF2A 3D4AA 1Q7HA 1STDA 2RSXA 2J8XB 3X3YA 3OWYA 1G96A 4HM1B 1AVLA 2GBWB 3FZWA 2MC8A 4ZM8A 1BSDA 4X2HA 1FGQA 1W02A 1RN1A 4CPKA 4FCZA 1GY5A 1AV4A 1MWRA 3KSED 1OGXA 3FF0A 1Q7Y4 1Y4KA 1NB5I 2BMQB 3AHSA 3EB8A 4H3UA 2W6JH 4H61A 4MJDA 3ZG5A 3CCQ3 5CXOA 1KWIA 2JQ5A 2W0QA 3STDA 3DGNA 4LYLB 1C54A 3SXXA 3CXC2 1VQM3 1RNBA 1Q9EA 3S29A 5KP1A 2GEXA 3WHOA 2CHCA 2D42A 5IEOA 2P38A 1BRHA 4FR9A 4R4KA 3KKGA 1QAKA 2E2UA 3LMLA 2OCTA 1YGWA 3KE7A 1RRHA 4G1MB 3ALAA 3BNCA 1JKGA 3LXUX 3CCL3 1JNQA 1Q864 3WA2X 1B20A 3RGAA 5RNTA 1D6UA 5FGOA 1FGMA 1QJGA 1TJDA 2OWPA 3F9SA 1B27A 1BRIA 3NV0A 1AVKA 3CC73 1YJW3 2BHMA 1ZS7A 3F40A 5HGRA 3SVAA 1FGOA 4CCVA 1ROAA 4JF8A 1VQP3 1N5PA 4FMDA 2E2TA 1GY6A 3ER7A 1FA3A 1YNVX 2Z76A 1Q40A 3SOAA 4AKZA 1RKYA 1BNSA 1WMNA 3DGMA 1GOUA 3B7CA 1CYVA 1NB3I 2MF7A 3GZXB 1A90A 1SJWA 2XSOB 3AHWA 2BT3A 2PNCA 4HM7B 4RNTA 4WHAA 5G1LA 3CME3 3SX1A 1LNHA 1DMNA 3RNTA 3Q1CA 2BMRB 3FKAA 1RJOA 4XB5A 1YI23 4AKYA 1DETA 3G4S3 2WOFA 4HAAA 7STDA 3T0UA 1BSEA 3D79A 1B2MA 3JUNA 5TGNA 3WODG 4KFFA 4O8SA 1GD4A 1A67A 1IQXA 2OQEA 1JKGB 1N9JA 4EBGA 1TRQA 2Y74A 1RGHA 1UCKA 1M1K4 4HM5B 4EC6A 3CPW2 4CJNA 1WQLB 5KP3A 4XBXA 5AI1A 3LTBA 3K9MC 3NV0B 3SYUA 1V57A 2IA7A 1RNTA 2KF3A 1TFOA 3IMAB 3MG1A 1GY7A 4HYZA 1FYSA 2CG0A 3CCS3 3NQZA 1HU9A 3PCSA 4IPBA 1Q40B 1RCKA 2INXA 1IDPA 4HM3B 1UUGB 3WA3A 2CFDA 5GSPA 4HZ9B 4L7KA 1A2PA 3S67A 3D3LA 5M18A 3K63A 2BO9B 2YFIB 3HOHA 3FH1A 1IU7A 2V1LA 5ELJA 1BNJA 3H51A 2QGUA 1CEWI 1T2IA 3F7SA 1BGSA 1FGRA 1UI8A 1TRPA 5JPUA 1RRLA 3GWRA 3T8NA 1I2EA 4K61A 3G713 2W03A 1O7WB 2KAAA 1UCIA 3EC9A 3BIRA 4LSOA 4NREA 4FMBA 5ELUA 3WOEB 1I70A 4BIRA 1LXEA 3DZLA 4EYCA 2CW9A 2SARA 5AYRB 3DMCA 1YHQ3 1QVG2 1B2XA 1GOVA 1N8QA 2GU3A 2KF5A 2P0XA 2ZA4A 3GAXA 1W7CA 3LYGA 4FCJA 4HM4B 3HIGA 4J8TA 1RMSA 4STDA 3V92A 3N8BA 3CC23 1Q42A 4HBRA 1W6GA 1SARA 3PZWA 3WMDA 1I3FA 1K734 1G02A 1UI7A 3KCHA 1GS3A 4J5GA 1O7NB 3E99A 1OHPA 1JB5A 3GSPA 1TP6A 1NO3A 3F7XA 6GSPA 5IEPA 3LTCA 5DRVA 2K54A 2KF4A 2CFKA 2IMJA 2Q07A 1W00A 1TTOA 3B4OA 3EN8A 1Q824 1UGIA 1BIRA 1MOLA 3GRDA 1JJ22 4K1VA 2WO0A 2LYXA 5BIRA 3GZRA 3CC43 1OF5A 3ECFA 2BIRA 3MYTA 3G0KA 1I8VA 2HMLB 3CU3A 1A2KA 4I5QA 4WP5A 1LOXA 2LQVA 3GZBA 1VQ53 3UNLA 2OTL3 1AY7A 1IQYA 5IF6A 5D83A 1I0XA 2L4VA 3U1WA 1HYFA 2UX0A 5AYSC 1DE3A 1JZOA 1BNGA 1QALA 4LMIA 1RHLA 3A5EA 2ZL8A 2FXTA 3NM7A 3D9RA 2HMJB 3DGLA 5G1KA 1MGWA 7GSPA 4FMAA 4KFDA 5LC6A 1CYUA 3X42A 1RTUA 1E3RA 1IQ8A 3S5CA 1S5AA 3NX0A 1EG9B 4N6V0 1FGTA 2W9QA 1UW1A 5BU4A 1YIT3 2GU1A 1ZGXA 2WOHA 3PGBA 1OHSA 1AR0A 3VSYA 4BL2A 3WDGB 1BSAA 3FF2A 4EW5A 4BTYA 8RNTA 5EVHA 5CF1A 4IT7A 5IG5A 4HM2B 3HX8A 3CPOA 1LOWA 5JBSA 2H0GA 3T8UA 1BRSA 4OK0A 4WFOA 4RBNA 2GEYA 4HM6B 2IYJA 3OXAA 1OF5B 1IVWA 1PFPA 2CX1A 1BNIA 1O7HB 2F5MA 3NBRA 1GOYA 3SEDA 1EQKA 2CH9A 1GSPA 2HMMB 4GL6A 1R4CA 1BNFA 4FMCA 3JUMA 1GMQA 5EEOA 3ZG0A 5AEWB 4Q53A 1YJ93 3EN1B 1A2VA 3UL5A 1ULJB 1OPYA 1EUIC 2C11A 4LGQA 5AIFA 1DVCA 3CD63 1UUVB 1IK3A 1BOXA 2B1XB 3FGYA 1SIHA 4NPBA 3X3ZA 2F5WA 2HMOB 1IVXA 3KSPA 3HIIA 1YGEA 1I0VA 3AMOA 1ISKA 3J7Yd 2F56A 1GMPA 1W2ZA 3K0ZA 1PY3A 2XFSA 3DUKA 3VGNA 2HMKB 2W56A 2W04A 1BU4A 1JB2A 4HM0B 1K9M4 1ROVA 4HM8B 4XM4A 1VQ93 2CWUA 3FSDA 4R1KA 3DXOA 1VQK3 3AGOA 1V58A 1OUNA 2CFLA 3ZFZA 1W6CA 3CMA3 4BTWA 7RNTA 2XEPA 5D82A 3D5GA 1BSBA 3EHCA 4O2HA 3EF8A 1OHOA 3S27A 4AEQA 3EBYA 1PYLA 2CKFB 1QVF2 2PZVA 5STDA 5KP4A 1X1YA 2CIUA 1B2UA 4EV5A 5BVBA 2O3OA 1RSNA 2FGTA 3EBTA 2C4BA 2OOVC 2CK3H 1UCLA 2SBLA 3MHEA 2I9WA 3QK9A 4J5KA 3LH4A 4K90B 3CCU3 2OTJ3 3URPA 3FLJA 3AMOB 3F8HA 2H0IA 1X1WA 1F8NA 1M9GA 1WMOA 3V99A 1NNVA 1N5HA 4N6NB 3BNDA 1DMMA 3G6E3 1GMRA 2W56B 3MPHA 4XBYA 3I553 5FW5A 6RNTA 3UL6A 1B21A 1B2ZA 1HZ1A 2CFGA 2IUJA 1M904 1EA2A 1SIIA 2K0MA 2FNQA 3UJMA 2ML5A 4FCMA 1BANA 3KZTA 3Q3FA 3RDEA 2XGNA 1KC84 5AIGA 4MEIA 1X1UA 1RGFA 3MG3A 1VQ73 1I2FA 1WNHA 3HK4A 1C7HA 3X41A 3DM8A 1VZZA 1K28A 2F4YA 1YVBI 1DMQA 3AGNA 1YVSA 1NWWA 2R4IA 1I2GA 1RLSA 1STFI 3K5TA 3QRDA 3NBBA 4N3VA 3SLUA 3CCM3 2Z77A 3LOYA 1V74A 5D81A 3HI7A 1PU4A 4RNZA 1RN7A 4MMXB 4ILFA 1I3IA 2F99A 2WGQA 3I0YA 1IV9A 3FG3A 1FZUA 3BNBA 1DVDA 1ZO2A 4KT3B 2RFRA 1EEJA 3O8YA 1EKMA 1IYYA 1RGAA 1LQGC 3NM2A 4IIAA 1G0TA 1JBRA 3GZYB 4HVNA 1MWTA 3RGRA 1TFKA 4X2OA 1UCJA 2YX9A 1RGLA 6STDA 1NU3A 2CWVA 1O7MB 3B8LA 3H3HA 1LVNA 4XDWA 4I4KA 1JB4A 1WTHA 3DGYA 1FUWA 1JZDA 3LTAA 1VQN3 1BSCA 3JUPA 1D6YA 2RCDA 4WYKA 3U97A 2IUKA 2IY2A 5JPPA 1W5ZA 4R80A 4LEHA 2O9UX 1BVIA 1ASKA 2P0MA 3X3XA 3ROBA 2Y73A 3IPTA 1RCLA 5IW9A 1K41A 3NBJA 5I97A 1BNEA 1TU5A 3DY5A 4BTXA 2ZHXB 3L0RA 4KVHA 3MKIA 2XRXB 2RBIA 1K8A4 1LNIA 4N6TA 4ORLA 4XDVA 5AEUB 2KXGA 1O7GB 3EX9A 1ULIB 4R9KA 5IENA 1UUWB 1BRNL 4N6OB 5G2GA 1TUHA 3FCSB 1B2SA 3MSOA 5IG3A 1VQL3 3OX9A 2D1WA 4BU4A 2XR8B 4J9AA 3KIIA 1W2B2 1TIJA 2QA43 1VQ63 1Q814 2CX0A
chains in the Genus database with same CATH topology
3BIRA 3AGOA 4BIRA 1I70A 1RGEA 3D4AA 1BRGA 2SARA 7RNTA 3DH2A 3WR2A 1B2XA 1GOVA 2KF5A 1BSDA 3D5GA 1BSBA 2ZA4A 1RN1A 1RMSA 1PYLA 1SARA 1I3FA 3AHSA 1G02A 4J5GA 1X1YA 3KCHA 1B2UA 3BU4A 1RSNA 1RN4A 3GSPA 6GSPA 1RGKA 2C4BA 1C54A 1UCLA 2KF4A 4J5KA 1RNBA 1Q9EA 1TTOA 3WHOA 1BIRA 3URPA 2AAEA 1BRHA 4HOHA 5BIRA 1X1WA 1YGWA 2BIRA 1I8VA 1GMRA 1B20A 1RGGA 5RNTA 1AY7A 6RNTA 1B21A 1B2ZA 1HZ1A 1I0XA 1HYFA 1DE3A 1B27A 1BRIA 1BNGA 1RHLA 2BU4A 1BANA 1LOYA 3A5EA 3Q3FA 1X1UA 1RGFA 1MGWA 1I2FA 7GSPA 9RNTA 1FUTA 1JBSA 1RTUA 1YNVX 5HOHA 2F4YA 1BNSA 3AGNA 2KF6A 1YVSA 1GOUA 5BU4A 1I2GA 1RLSA 1ZGXA 8RNTA 1BSAA 3AHWA 1I3IA 4RNTA 1FZUA 1LOWA 3RNTA 1BRSA 1DETA 1IYYA 1LOVA 1R4YA 4HAAA 1B2MA 1BSEA 1RGAA 1JBTA 1FW7A 2GSPA 1JBRA 1MGRA 1B3SA 1FUSA 2AADA 1UCJA 1BNIA 4GHOA 1T2HA 1RGLA 2F5MA 1BRJA 1TRQA 1GOYA 1RGHA 1UCKA 2HOHA 1GSPA 3DGYA 1BRKA 1BNFA 1BSCA 1GMQA 3SYUA 4GSPA 1RNTA 1BVIA 1BAOA 2KF3A 1AQZA 1BNRA 1RDSA 1FYSA 1RCLA 3D5IA 1BUJA 1BNEA 1RGCA 1BOXA 1RCKA 2F5WA 1X1XA 2RBIA 2RNTA 1LNIA 5GSPA 1I0VA 1A2PA 1CH0A 1LRAA 1BRNL 3HOHA 2F56A 1GMPA 1BNJA 1B2SA 1PY3A 1T2IA 4BU4A 1BGSA 1BU4A 1TRPA 1I2EA 2KAAA 1UCIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BIR A;  3AGO A;  4BIR A;  1I70 A;  1RGE A;  3D4A A;  1BRG A;  2SAR A;  7RNT A;  3DH2 A;  3WR2 A;  1B2X A;  1GOV A;  2KF5 A;  1BSD A;  3D5G A;  1BSB A;  2ZA4 A;  1RN1 A;  1RMS A;  1PYL A;  1SAR A;  1I3F A;  3AHS A;  1G02 A;  4J5G A;  1X1Y A;  3KCH A;  1B2U A;  3BU4 A;  1RSN A;  1RN4 A;  3GSP A;  6GSP A;  1RGK A;  2C4B A;  1C54 A;  1UCL A;  2KF4 A;  4J5K A;  1RNB A;  1Q9E A;  1TTO A;  3WHO A;  1BIR A;  3URP A;  2AAE A;  1BRH A;  4HOH A;  5BIR A;  1X1W A;  1YGW A;  2BIR A;  1I8V A;  1GMR A;  1B20 A;  1RGG A;  5RNT A;  1AY7 A;  6RNT A;  1B21 A;  1B2Z A;  1HZ1 A;  1I0X A;  1HYF A;  1DE3 A;  1B27 A;  1BRI A;  1BNG A;  1RHL A;  2BU4 A;  1BAN A;  1LOY A;  3A5E A;  3Q3F A;  1X1U A;  1RGF A;  1MGW A;  1I2F A;  7GSP A;  9RNT A;  1FUT A;  1JBS A;  1RTU A;  1YNV X;  5HOH A;  2F4Y A;  1BNS A;  3AGN A;  2KF6 A;  1YVS A;  1GOU A;  5BU4 A;  1I2G A;  1RLS A;  1ZGX A;  8RNT A;  1BSA A;  3AHW A;  1I3I A;  4RNT A;  1FZU A;  1LOW A;  3RNT A;  1BRS A;  1DET A;  1IYY A;  1LOV A;  1R4Y A;  4HAA A;  1B2M A;  1BSE A;  1RGA A;  1JBT A;  1FW7 A;  2GSP A;  1JBR A;  1MGR A;  1B3S A;  1FUS A;  2AAD A;  1UCJ A;  1BNI A;  4GHO A;  1T2H A;  1RGL A;  2F5M A;  1BRJ A;  1TRQ A;  1GOY A;  1RGH A;  1UCK A;  2HOH A;  1GSP A;  3DGY A;  1BRK A;  1BNF A;  1BSC A;  1GMQ A;  3SYU A;  4GSP A;  1RNT A;  1BVI A;  1BAO A;  2KF3 A;  1AQZ A;  1BNR A;  1RDS A;  1FYS A;  1RCL A;  3D5I A;  1BUJ A;  1BNE A;  1RGC A;  1BOX A;  1RCK A;  2F5W A;  1X1X A;  2RBI A;  2RNT A;  1LNI A;  5GSP A;  1I0V A;  1A2P A;  1CH0 A;  1LRA A;  1BRN L;  3HOH A;  2F56 A;  1GMP A;  1BNJ A;  1B2S A;  1PY3 A;  1T2I A;  4BU4 A;  1BGS A;  1BU4 A;  1TRP A;  1I2E A;  2KAA A;  1UCI A; 
#chains in the Genus database with same CATH topology
 2QEX 3;  1SPU A;  1JRQ A;  1RGE A;  3I56 3;  1BRG A;  2F86 B;  1OCV A;  2KCD A;  3KFQ C;  3DH2 A;  4PEJ A;  3WR2 A;  2L1S A;  2W9P A;  2XGL A;  2BMO B;  4L8O A;  1MWS A;  2K3D A;  3NQY A;  1SQW A;  1WMP A;  2CFW A;  3N54 B;  3IJE B;  4JRF A;  4HKV B;  2UUG C;  3PS8 A;  4O02 B;  4EXR A;  2C10 A;  4WYK B;  1IT8 A;  3MWZ A;  5BXQ A;  1HKX A;  3FG1 A;  1N9E A;  3BU4 A;  4KFE A;  3SOY A;  3JUO A;  5M19 A;  1RN4 A;  2M7O A;  2P05 A;  5IER A;  1BUQ A;  1RGK A;  1IV7 A;  3PCR A;  5CLK A;  4XBT A;  2XH9 A;  4U13 A;  1YJN 3;  1W4N A;  2XFT A;  4HJL B;  1LQM B;  1S72 3;  1T3B A;  3NUV A;  1E3V A;  1IVU A;  2OQE C;  2AAE A;  3Q90 A;  2W2C A;  1KSI A;  4HOH A;  2A15 A;  4NHF A;  1U8C B;  4HZB B;  4EV2 A;  1RGG A;  2QIY A;  3HZP A;  5M1A A;  1L5G B;  2YFJ B;  4DKI A;  3MG2 A;  3OV4 A;  1CQS A;  3TDG A;  2XSH B;  3EJV A;  3OWS A;  4K1U A;  2BU4 A;  1OH0 A;  3CCR 3;  1LOY A;  1N8R 4;  2GXF A;  5A0O B;  1US1 A;  3PYJ A;  3EQQ B;  2B24 B;  1D6Z A;  2XF3 A;  1KQS 2;  4RZM A;  1FUT A;  3LT8 A;  9RNT A;  1JBS A;  1J2B A;  5HOH A;  3A76 A;  2H0H A;  2RGQ A;  1E97 A;  1JN5 A;  2F98 A;  2KF6 A;  5LC7 A;  1UDI I;  3B4P A;  4CDL A;  3CCV 3;  1W6Y A;  3V98 A;  1U5O A;  4OVM A;  5EQL A;  1NJI 4;  1OAC A;  3CNM A;  4O3V A;  4LZI A;  5IG4 A;  3F14 A;  3LZA A;  2P09 A;  1QMA A;  3JVC A;  3BLZ A;  3S28 A;  3K7C A;  3M8C A;  1VQ8 3;  2OOV A;  1LOV A;  1R4Y A;  3UB1 A;  4MMY B;  1JBT A;  1FW7 A;  1Z1S A;  3DGO A;  2GSP A;  4N6M A;  1MGR A;  1B3S A;  1FUS A;  1GD3 A;  1O7P B;  2AAD A;  2E2V A;  3BNE A;  4GHO A;  1ZX2 A;  1T2H A;  3F8X A;  5CK6 A;  3BB9 A;  1BRJ A;  1GYB A;  4WWU C;  4KZ1 A;  3X40 A;  3EE1 A;  2HOH A;  1MWU A;  1NDO B;  3WOF B;  1BRK A;  3LT9 A;  5AIH A;  4RNY A;  1VQ4 3;  3G8Z A;  4L8P A;  4GSP A;  2ML6 A;  3Q2P A;  3CCE 3;  1BAO A;  1DYU A;  1AQZ A;  4GB5 A;  3CNX A;  1BNR A;  3PXM A;  3NHX A;  2JDI H;  4N6U A;  1VQO 3;  1KD1 4;  1RDS A;  2R41 A;  2ZDJ A;  3KN4 A;  2CG1 A;  3D5I A;  4MMZ B;  1BUJ A;  4TX4 A;  2Z7A A;  1RGC A;  1OGZ A;  2STD A;  1JV2 B;  3N9H A;  3OWU A;  4BL3 A;  8CHO A;  1IT7 A;  1X1X A;  1JN5 B;  2RNT A;  3LTD A;  1QAF A;  5AII A;  2UGI A;  1W01 A;  4QWT A;  2Z6B A;  1M1X B;  5DRE A;  1CH0 A;  2GBX B;  1LRA A;  5IG0 A;  4N6L A;  2BNG A;  3VF1 A;  1MNL A;  1YIJ 3;  1VQQ A;  1IVV A;  2CC3 A;  4R9L A;  3CCJ 3;  4OUQ A;  3FG4 A;  3NXJ A;  2YFL B;  1T5Y A;  2HMN B;  3G16 A;  3JUQ A;  2CWT A;  1UGH I;  2KRT A;  3OW2 2;  2WGO A;  5CF2 A;  3D4A A;  1Q7H A;  1STD A;  2RSX A;  2J8X B;  3X3Y A;  3OWY A;  1G96 A;  4HM1 B;  1AVL A;  2GBW B;  3FZW A;  2MC8 A;  4ZM8 A;  1BSD A;  4X2H A;  1FGQ A;  1W02 A;  1RN1 A;  4CPK A;  4FCZ A;  1GY5 A;  1AV4 A;  1MWR A;  3KSE D;  1OGX A;  3FF0 A;  1Q7Y 4;  1Y4K A;  1NB5 I;  2BMQ B;  3AHS A;  3EB8 A;  4H3U A;  2W6J H;  4H61 A;  4MJD A;  3ZG5 A;  3CCQ 3;  5CXO A;  1KWI A;  2JQ5 A;  2W0Q A;  3STD A;  3DGN A;  4LYL B;  1C54 A;  3SXX A;  3CXC 2;  1VQM 3;  1RNB A;  1Q9E A;  3S29 A;  5KP1 A;  2GEX A;  3WHO A;  2CHC A;  2D42 A;  5IEO A;  2P38 A;  1BRH A;  4FR9 A;  4R4K A;  3KKG A;  1QAK A;  2E2U A;  3LML A;  2OCT A;  1YGW A;  3KE7 A;  1RRH A;  4G1M B;  3ALA A;  3BNC A;  1JKG A;  3LXU X;  3CCL 3;  1JNQ A;  1Q86 4;  3WA2 X;  1B20 A;  3RGA A;  5RNT A;  1D6U A;  5FGO A;  1FGM A;  1QJG A;  1TJD A;  2OWP A;  3F9S A;  1B27 A;  1BRI A;  3NV0 A;  1AVK A;  3CC7 3;  1YJW 3;  2BHM A;  1ZS7 A;  3F40 A;  5HGR A;  3SVA A;  1FGO A;  4CCV A;  1ROA A;  4JF8 A;  1VQP 3;  1N5P A;  4FMD A;  2E2T A;  1GY6 A;  3ER7 A;  1FA3 A;  1YNV X;  2Z76 A;  1Q40 A;  3SOA A;  4AKZ A;  1RKY A;  1BNS A;  1WMN A;  3DGM A;  1GOU A;  3B7C A;  1CYV A;  1NB3 I;  2MF7 A;  3GZX B;  1A90 A;  1SJW A;  2XSO B;  3AHW A;  2BT3 A;  2PNC A;  4HM7 B;  4RNT A;  4WHA A;  5G1L A;  3CME 3;  3SX1 A;  1LNH A;  1DMN A;  3RNT A;  3Q1C A;  2BMR B;  3FKA A;  1RJO A;  4XB5 A;  1YI2 3;  4AKY A;  1DET A;  3G4S 3;  2WOF A;  4HAA A;  7STD A;  3T0U A;  1BSE A;  3D79 A;  1B2M A;  3JUN A;  5TGN A;  3WOD G;  4KFF A;  4O8S A;  1GD4 A;  1A67 A;  1IQX A;  2OQE A;  1JKG B;  1N9J A;  4EBG A;  1TRQ A;  2Y74 A;  1RGH A;  1UCK A;  1M1K 4;  4HM5 B;  4EC6 A;  3CPW 2;  4CJN A;  1WQL B;  5KP3 A;  4XBX A;  5AI1 A;  3LTB A;  3K9M C;  3NV0 B;  3SYU A;  1V57 A;  2IA7 A;  1RNT A;  2KF3 A;  1TFO A;  3IMA B;  3MG1 A;  1GY7 A;  4HYZ A;  1FYS A;  2CG0 A;  3CCS 3;  3NQZ A;  1HU9 A;  3PCS A;  4IPB A;  1Q40 B;  1RCK A;  2INX A;  1IDP A;  4HM3 B;  1UUG B;  3WA3 A;  2CFD A;  5GSP A;  4HZ9 B;  4L7K A;  1A2P A;  3S67 A;  3D3L A;  5M18 A;  3K63 A;  2BO9 B;  2YFI B;  3HOH A;  3FH1 A;  1IU7 A;  2V1L A;  5ELJ A;  1BNJ A;  3H51 A;  2QGU A;  1CEW I;  1T2I A;  3F7S A;  1BGS A;  1FGR A;  1UI8 A;  1TRP A;  5JPU A;  1RRL A;  3GWR A;  3T8N A;  1I2E A;  4K61 A;  3G71 3;  2W03 A;  1O7W B;  2KAA A;  1UCI A;  3EC9 A;  3BIR A;  4LSO A;  4NRE A;  4FMB A;  5ELU A;  3WOE B;  1I70 A;  4BIR A;  1LXE A;  3DZL A;  4EYC A;  2CW9 A;  2SAR A;  5AYR B;  3DMC A;  1YHQ 3;  1QVG 2;  1B2X A;  1GOV A;  1N8Q A;  2GU3 A;  2KF5 A;  2P0X A;  2ZA4 A;  3GAX A;  1W7C A;  3LYG A;  4FCJ A;  4HM4 B;  3HIG A;  4J8T A;  1RMS A;  4STD A;  3V92 A;  3N8B A;  3CC2 3;  1Q42 A;  4HBR A;  1W6G A;  1SAR A;  3PZW A;  3WMD A;  1I3F A;  1K73 4;  1G02 A;  1UI7 A;  3KCH A;  1GS3 A;  4J5G A;  1O7N B;  3E99 A;  1OHP A;  1JB5 A;  3GSP A;  1TP6 A;  1NO3 A;  3F7X A;  6GSP A;  5IEP A;  3LTC A;  5DRV A;  2K54 A;  2KF4 A;  2CFK A;  2IMJ A;  2Q07 A;  1W00 A;  1TTO A;  3B4O A;  3EN8 A;  1Q82 4;  1UGI A;  1BIR A;  1MOL A;  3GRD A;  1JJ2 2;  4K1V A;  2WO0 A;  2LYX A;  5BIR A;  3GZR A;  3CC4 3;  1OF5 A;  3ECF A;  2BIR A;  3MYT A;  3G0K A;  1I8V A;  2HML B;  3CU3 A;  1A2K A;  4I5Q A;  4WP5 A;  1LOX A;  2LQV A;  3GZB A;  1VQ5 3;  3UNL A;  2OTL 3;  1AY7 A;  1IQY A;  5IF6 A;  5D83 A;  1I0X A;  2L4V A;  3U1W A;  1HYF A;  2UX0 A;  5AYS C;  1DE3 A;  1JZO A;  1BNG A;  1QAL A;  4LMI A;  1RHL A;  3A5E A;  2ZL8 A;  2FXT A;  3NM7 A;  3D9R A;  2HMJ B;  3DGL A;  5G1K A;  1MGW A;  7GSP A;  4FMA A;  4KFD A;  5LC6 A;  1CYU A;  3X42 A;  1RTU A;  1E3R A;  1IQ8 A;  3S5C A;  1S5A A;  3NX0 A;  1EG9 B;  4N6V 0;  1FGT A;  2W9Q A;  1UW1 A;  5BU4 A;  1YIT 3;  2GU1 A;  1ZGX A;  2WOH A;  3PGB A;  1OHS A;  1AR0 A;  3VSY A;  4BL2 A;  3WDG B;  1BSA A;  3FF2 A;  4EW5 A;  4BTY A;  8RNT A;  5EVH A;  5CF1 A;  4IT7 A;  5IG5 A;  4HM2 B;  3HX8 A;  3CPO A;  1LOW A;  5JBS A;  2H0G A;  3T8U A;  1BRS A;  4OK0 A;  4WFO A;  4RBN A;  2GEY A;  4HM6 B;  2IYJ A;  3OXA A;  1OF5 B;  1IVW A;  1PFP A;  2CX1 A;  1BNI A;  1O7H B;  2F5M A;  3NBR A;  1GOY A;  3SED A;  1EQK A;  2CH9 A;  1GSP A;  2HMM B;  4GL6 A;  1R4C A;  1BNF A;  4FMC A;  3JUM A;  1GMQ A;  5EEO A;  3ZG0 A;  5AEW B;  4Q53 A;  1YJ9 3;  3EN1 B;  1A2V A;  3UL5 A;  1ULJ B;  1OPY A;  1EUI C;  2C11 A;  4LGQ A;  5AIF A;  1DVC A;  3CD6 3;  1UUV B;  1IK3 A;  1BOX A;  2B1X B;  3FGY A;  1SIH A;  4NPB A;  3X3Z A;  2F5W A;  2HMO B;  1IVX A;  3KSP A;  3HII A;  1YGE A;  1I0V A;  3AMO A;  1ISK A;  3J7Y d;  2F56 A;  1GMP A;  1W2Z A;  3K0Z A;  1PY3 A;  2XFS A;  3DUK A;  3VGN A;  2HMK B;  2W56 A;  2W04 A;  1BU4 A;  1JB2 A;  4HM0 B;  1K9M 4;  1ROV A;  4HM8 B;  4XM4 A;  1VQ9 3;  2CWU A;  3FSD A;  4R1K A;  3DXO A;  1VQK 3;  3AGO A;  1V58 A;  1OUN A;  2CFL A;  3ZFZ A;  1W6C A;  3CMA 3;  4BTW A;  7RNT A;  2XEP A;  5D82 A;  3D5G A;  1BSB A;  3EHC A;  4O2H A;  3EF8 A;  1OHO A;  3S27 A;  4AEQ A;  3EBY A;  1PYL A;  2CKF B;  1QVF 2;  2PZV A;  5STD A;  5KP4 A;  1X1Y A;  2CIU A;  1B2U A;  4EV5 A;  5BVB A;  2O3O A;  1RSN A;  2FGT A;  3EBT A;  2C4B A;  2OOV C;  2CK3 H;  1UCL A;  2SBL A;  3MHE A;  2I9W A;  3QK9 A;  4J5K A;  3LH4 A;  4K90 B;  3CCU 3;  2OTJ 3;  3URP A;  3FLJ A;  3AMO B;  3F8H A;  2H0I A;  1X1W A;  1F8N A;  1M9G A;  1WMO A;  3V99 A;  1NNV A;  1N5H A;  4N6N B;  3BND A;  1DMM A;  3G6E 3;  1GMR A;  2W56 B;  3MPH A;  4XBY A;  3I55 3;  5FW5 A;  6RNT A;  3UL6 A;  1B21 A;  1B2Z A;  1HZ1 A;  2CFG A;  2IUJ A;  1M90 4;  1EA2 A;  1SII A;  2K0M A;  2FNQ A;  3UJM A;  2ML5 A;  4FCM A;  1BAN A;  3KZT A;  3Q3F A;  3RDE A;  2XGN A;  1KC8 4;  5AIG A;  4MEI A;  1X1U A;  1RGF A;  3MG3 A;  1VQ7 3;  1I2F A;  1WNH A;  3HK4 A;  1C7H A;  3X41 A;  3DM8 A;  1VZZ A;  1K28 A;  2F4Y A;  1YVB I;  1DMQ A;  3AGN A;  1YVS A;  1NWW A;  2R4I A;  1I2G A;  1RLS A;  1STF I;  3K5T A;  3QRD A;  3NBB A;  4N3V A;  3SLU A;  3CCM 3;  2Z77 A;  3LOY A;  1V74 A;  5D81 A;  3HI7 A;  1PU4 A;  4RNZ A;  1RN7 A;  4MMX B;  4ILF A;  1I3I A;  2F99 A;  2WGQ A;  3I0Y A;  1IV9 A;  3FG3 A;  1FZU A;  3BNB A;  1DVD A;  1ZO2 A;  4KT3 B;  2RFR A;  1EEJ A;  3O8Y A;  1EKM A;  1IYY A;  1RGA A;  1LQG C;  3NM2 A;  4IIA A;  1G0T A;  1JBR A;  3GZY B;  4HVN A;  1MWT A;  3RGR A;  1TFK A;  4X2O A;  1UCJ A;  2YX9 A;  1RGL A;  6STD A;  1NU3 A;  2CWV A;  1O7M B;  3B8L A;  3H3H A;  1LVN A;  4XDW A;  4I4K A;  1JB4 A;  1WTH A;  3DGY A;  1FUW A;  1JZD A;  3LTA A;  1VQN 3;  1BSC A;  3JUP A;  1D6Y A;  2RCD A;  4WYK A;  3U97 A;  2IUK A;  2IY2 A;  5JPP A;  1W5Z A;  4R80 A;  4LEH A;  2O9U X;  1BVI A;  1ASK A;  2P0M A;  3X3X A;  3ROB A;  2Y73 A;  3IPT A;  1RCL A;  5IW9 A;  1K41 A;  3NBJ A;  5I97 A;  1BNE A;  1TU5 A;  3DY5 A;  4BTX A;  2ZHX B;  3L0R A;  4KVH A;  3MKI A;  2XRX B;  2RBI A;  1K8A 4;  1LNI A;  4N6T A;  4ORL A;  4XDV A;  5AEU B;  2KXG A;  1O7G B;  3EX9 A;  1ULI B;  4R9K A;  5IEN A;  1UUW B;  1BRN L;  4N6O B;  5G2G A;  1TUH A;  3FCS B;  1B2S A;  3MSO A;  5IG3 A;  1VQL 3;  3OX9 A;  2D1W A;  4BU4 A;  2XR8 B;  4J9A A;  3KII A;  1W2B 2;  1TIJ A;  2QA4 3;  1VQ6 3;  1Q81 4;  2CX0 A; 
#chains in the Genus database with same CATH homology
 3BIR A;  3AGO A;  4BIR A;  1I70 A;  1RGE A;  3D4A A;  1BRG A;  2SAR A;  7RNT A;  3DH2 A;  3WR2 A;  1B2X A;  1GOV A;  2KF5 A;  1BSD A;  3D5G A;  1BSB A;  2ZA4 A;  1RN1 A;  1RMS A;  1PYL A;  1SAR A;  1I3F A;  3AHS A;  1G02 A;  4J5G A;  1X1Y A;  3KCH A;  1B2U A;  3BU4 A;  1RSN A;  1RN4 A;  3GSP A;  6GSP A;  1RGK A;  2C4B A;  1C54 A;  1UCL A;  2KF4 A;  4J5K A;  1RNB A;  1Q9E A;  1TTO A;  3WHO A;  1BIR A;  3URP A;  2AAE A;  1BRH A;  4HOH A;  5BIR A;  1X1W A;  1YGW A;  2BIR A;  1I8V A;  1GMR A;  1B20 A;  1RGG A;  5RNT A;  1AY7 A;  6RNT A;  1B21 A;  1B2Z A;  1HZ1 A;  1I0X A;  1HYF A;  1DE3 A;  1B27 A;  1BRI A;  1BNG A;  1RHL A;  2BU4 A;  1BAN A;  1LOY A;  3A5E A;  3Q3F A;  1X1U A;  1RGF A;  1MGW A;  1I2F A;  7GSP A;  9RNT A;  1FUT A;  1JBS A;  1RTU A;  1YNV X;  5HOH A;  2F4Y A;  1BNS A;  3AGN A;  2KF6 A;  1YVS A;  1GOU A;  5BU4 A;  1I2G A;  1RLS A;  1ZGX A;  8RNT A;  1BSA A;  3AHW A;  1I3I A;  4RNT A;  1FZU A;  1LOW A;  3RNT A;  1BRS A;  1DET A;  1IYY A;  1LOV A;  1R4Y A;  4HAA A;  1B2M A;  1BSE A;  1RGA A;  1JBT A;  1FW7 A;  2GSP A;  1JBR A;  1MGR A;  1B3S A;  1FUS A;  2AAD A;  1UCJ A;  1BNI A;  4GHO A;  1T2H A;  1RGL A;  2F5M A;  1BRJ A;  1TRQ A;  1GOY A;  1RGH A;  1UCK A;  2HOH A;  1GSP A;  3DGY A;  1BRK A;  1BNF A;  1BSC A;  1GMQ A;  3SYU A;  4GSP A;  1RNT A;  1BVI A;  1BAO A;  2KF3 A;  1AQZ A;  1BNR A;  1RDS A;  1FYS A;  1RCL A;  3D5I A;  1BUJ A;  1BNE A;  1RGC A;  1BOX A;  1RCK A;  2F5W A;  1X1X A;  2RBI A;  2RNT A;  1LNI A;  5GSP A;  1I0V A;  1A2P A;  1CH0 A;  1LRA A;  1BRN L;  3HOH A;  2F56 A;  1GMP A;  1BNJ A;  1B2S A;  1PY3 A;  1T2I A;  4BU4 A;  1BGS A;  1BU4 A;  1TRP A;  1I2E A;  2KAA A;  1UCI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...