5G1LA

A double mutant of dsbg engineered for denitrosylation
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
228
structure length
228
Chain Sequence
b'LPAPVKAIEKQGITIIKTFDAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNTLIEKEIYAPAGREMWQRMEQSHWLLDGKKDAPVIVYVFADPFCGPCKQFWQQARPWVDSGKVQLRTLLVGVIKPESPATAAAILASKDPAKTWQQYEASGGKLKLNVPANVSTEQMKVLSDNEKLMDDLGANVTPAIYYMSKENTLQQAVGLPDQKTLNIIMGN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOL DISULFIDE INTERCHANGE PROTEIN DSBG
publication title Sulfur Denitrosylation by an Engineered Trx-Like Dsbg Enzyme Identifies Nucleophilic Cysteine Hydrogen Bonds as Key Functional Determinant.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 67
structure length 228
sequence length 228
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 5g1lA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5g1lA02
3IAS2 5AIXA 2KP1A 4IP1A 3O3TA 2C0DA 3P7XA 5B7CA 1G6WA 2JADA 2OE1A 2V41A 5ECLB 4HUAA 2CT6A 3RDWA 2OE3A 3HJOA 2GVPA 4E8EA 3TB2A 3IV4A 3FYGA 4KH7A 5IO2A 1ZGNA 4WR5A 2IMEA 3DD3A 3L9SA 2R2JA 3KD0A 1UN2A 2A2SA 3CMIA 3FY7A 4RQRA 1QUWA 1G7OA 1ABAA 2VM2A 1TI3A 14GSA 5COHA 1K3LA 2B5EA 2EIRA 4PQHA 16GSA 1HYUA 3U6VA 1NM3A 5ECSA 2GSSA 4GLTA 4AJ7A 4LA1A 4HQSA 3CRTA 1NSWA 4K7IA 4KX4A 2YOIA 3LQ7A 3QCPA 1ZOFA 2AUVA 1NHYA 5J3RA 4OFTA 1X5DA 2PBJA 2IMKA 4BWSA 1TTZA 1ERVA 2PU9C 1OC8A 3HJPA 2F8AA 1ERWA 3C8EA 2IL3A 4RI6A 5J41A 1JZWA 4JZQA 4D73A 4AJ8A 3F8UA 1HD2A 3H4KA 1C72A 1AUCA 2LKUA 1USBA 1MDKA 2MMAA 4WR4A 3C7MA 3GL3A 3J7Yk 1V40A 2LQOA 1JZOA 5DBQA 5JCWA 2DLXA 1SL2B 1M2DA 1ERUA 3TOTA 1A2JA 1ZYEA 2YWMA 1XZOA 3APQA 5GAPD 3TJKA 1THXA 3DVXA 3G9BA 2DJ3A 4N10A 5FT3A 2REMA 1J9BA 4P3YB 19GSA 2R4VA 3D4MA 4NXIA 3EU4A 5JCGA 1NW2A 1O85A 2MZCA 1BQ7A 2YP6A 4IBPA 3IRAA 3IA1A 4IQAA 3ZTLA 2D2ZA 2H6XA 2OJLA 3BOAA 4IJIA 1ZZYA 2LRCA 4FIWA 5AGYA 2GT5A 2GZZA 2PGTA 2QGVA 4GCIA 4Q5FA 3HA9A 3GKXA 1ILOA 3GKNA 1FVJA 3D22A 3C1RA 1OC9B 5D93A 3E0UA 3GHAA 1OKDA 1WE0A 5IMZA 1R4WA 4MP4A 1RK4A 5F0GA 1GSQA 5H5RA 1WJKA 3NOFA 2CA8A 2IN3A 3CSHA 5AIVA 4MZCA 2BMXA 4LMWA 5F8BA 2MMZA 4BPYA 1DE1A 1KNGA 3IK7A 1JZRA 2RM6A 1B8XA 2FY6A 3LFLA 2VOCA 5HR3A 5INYA 3VK9A 1XW9A 4ZBAA 5D96A 1T7PB 2DMLA 2CAIA 4FO5A 4BVXA 6GSTA 2GT6A 3N9JA 3QAGA 1O81A 2GTUA 1KBNA 1Q4JA 1E6BA 2GQMA 13GSA 5ENUA 1WPIA 1MD3A 2CAQA 3FRCA 5HFGA 4E8HA 2PPTA 3J7Yb 5HR0A 1K3YA 2PVOC 1AQWA 1SJ6A 2OKAA 3I9V2 5ELGA 3MWHA 5B8AA 4G19A 4KAEA 3UARA 1F6MC 4WBJA 4AF2A 2KLXA 2QKEA 4HJMA 3F63A 3GFKA 3TJFA 3C71A 4ZXGA 1B4QA 4LL1B 4I8BA 2LS5A 5D8IA 4O92A 1YF0A 4POKA 4L8EA 3ZRDA 4KDUA 3H79A 1EV4A 1GWCA 5DALB 4QL7A 4ISDA 2HRFA 4N0VA 5E4WA 3MNGA 1ZMAA 1GLPA 4QQ7A 2OADA 3IAM2 3WGEA 3M8NA 5CRWA 1OC9A 4XCSA 3TRQA 6GSXA 4N30A 2X99A 3GH9A 5IOXA 4KCAA 5G30A 1XXUA 1M2AA 4NAXA 2VCTA 3LXZA 4I2UA 2N5FA 5HR1A 2L59A 1MDJA 1X5CA 4ZBBA 2K9FA 4HI7A 3IOSA 2HI7A 5DJMA 4MH2A 7GSSA 2A4VA 2V32A 5G31A 2ZUPA 4JE1A 4IJ3A 2C8UA 2PERA 3EMXA 3L0HA 1QMVA 3HZ8A 2YZHA 4AJ6A 1ZL9A 2C0GA 3DKSA 4GQFA 1VF1A 1TRUA 4OD7A 3PINA 1WRYA 3RPNA 4HU9A 3QFBC 2ON7A 5HQPA 4CHSA 1X9SB 2P5RA 3VPTA 1ZYQB 1JFUA 4DSSB 4L0WA 2DJ0A 5D9WA 2DSAA 1TK0B 4H86A 3VI7A 1SJIA 2FWGA 3GL5A 3QDNA 4KE3A 3W6GA 3FZ5A 4TW5A 3GIXA 4TOPA 4F2IA 1YZXA 2F51A 2AYTA 3IC4A 3F4TA 2H1BA 3RPPA 2EC4A 2B5XA 1YY7A 1A23A 3D6IA 4MCUA 5KN0A 12GSA 5DALA 2LTKA 2YWIA 1V2AA 4MDCA 1GUKA 2KUCA 4OWYA 1HQOA 1LBKA 1PN9A 3M1GA 1TK8B 5ECMB 3I43A 3VWUA 3L78A 2GLRA 3FW2A 2VLUA 2XBIA 2IJYA 4ECJA 4V1Ag 4IHUA 3DYRA 4TR4A 5ELAA 2ZCTA 1YKAA 3GN3A 4KGIA 2E7PA 1THOA 1I5GA 3KP9A 2CVDA 4DSRA 3D5JA 5EVOA 5HR2A 1X9MB 3ZMLA 3UBKA 4YQVA 1M99A 4KA0A 2JSYA 4MJAA 2XPDA 4NHWA 4EDYA 2GZYA 4GSSA 3UL3A 2HT9A 8GSSA 2F9SA 2VLVA 2IY2A 4ML6A 4GRFA 2WDUA 2IIYA 3KZQA 4KW6A 2YNXA 1PSQA 4BWQA 4DSSA 3QAVA 1BG5A 1H4OA 3CBUA 3EE2A 1O6JA 5F06A 1SKRB 4EVMA 4CDOA 4BL7A 1Z7RA 1PA3A 4QL9A 1A0RP 2IWTA 2C0EA 3IK9A 1TOFA 2H71A 5LNKe 2LQQA 2VD1A 1SL0B 2WFCA 3BD2A 3ZYWA 4XS1A 3PR8A 1YEXA 4O5RA 3DMLA 4I97A 2YWNA 3TKSC 1FB0A 1RQMA 2A2RA 2P5QA 3KTLA 1GTBA 4TR0A 5IPHA 1GULA 4BA7A 4GTUA 5IIZA 2B3SA 3EURA 2B1KA 1VGLA 2FGXA 4XS4B 5ECOB 5G1KA 4N11A 2VL3A 1B4PA 4IKHA 2LRNA 3F3QA 4MZBA 5D9XA 1H75A 1Q98A 3LG6A 4XRAA 1T3BA 5KN1A 5DQSA 5L71A 5GAND 5IPGA 2C3QA 1VF2A 1XCCA 3D4TA 4HJ2A 2KOKA 1B48A 1OYJA 2KHPA 1R26A 1URMA 4PURA 5ABRA 4OCFA 1FG4A 4KSMA 2HE3A 2DJKA 5CRHA 3ZIVA 2H75A 1Y6EA 2LV3A 4TVEA 2X64A 2L4QA 3D0ZA 1O73A 1VF4A 5J9CA 4FYCA 1Z6MA 5ECIB 5G5FA 5IMAA 2H0HA 2YZUA 3ME7A 4RI7A 3CSIA 3TKSE 4JR6A 1K0MA 4KDXA 1N8JA 2G0FA 3FHKA 4L5OA 4I6XA 4EUYA 1SD9A 2O7KA 3FR6A 2B7KA 4ULXA 3E3EA 1SYRA 3LEFA 3DEXA 4X1UA 4TR3A 1XWKA 1Z5YE 4ECCA 2H72A 5DQYA 3TJJA 2LNTA 3TKRA 1TU7A 1S3AA 1XVQA 6GSWA 1DUGA 3KIJA 5JWOB 4K2DA 2H1GA 1EP7A 3HYPA 2MBSA 1ZCPA 4MH3A 1F3AA 3VWVA 4TRXA 4XS4A 4MF6A 3KP8A 3G7IA 5H5SA 4EE0A 1GTUA 5HFIA 1LU4A 1ERTA 5EY6A 4OO4A 3IR4A 1Z6NA 2XHFA 2ALBA 5LD0A 1Z3EA 3GX8A 2ON5A 3APOA 2JZTA 2TRCP 3IDVA 3E9JB 4ILFA 2DIZA 1TKDB 1GL8A 3M9KA 4PQIA 4PNGA 1AIUA 2HSYA 3QR6A 3G7YA 3EMPA 3DGQA 4WF5A 4NV5A 6GSSA 3RHCA 3HZ4A 4JEDA 3HKRA 4POBA 2CZ3A 3OR5A 3F4RA 1OE8A 3CTFA 2GQKA 4MZWA 4MJCA 4KCEA 1SK2A 4FYBA 1K0BA 3IXRA 2M46A 3LJRA 1F3BA 2WGRA 1F37A 2CQ9A 4PUAA 1W89A 2H0IA 1FHEA 1W4VA 3BCKA 3LYPA 3BCIA 1V9WA 4ZB6A 2GGTA 3KCMA 2FHEA 5C00A 2IFQB 3LORA 1SKWB 4EKZA 5A4WA 4GXZA 3M9JA 2X8GA 5KN2A 2YV9A 4K0GA 2IMDA 2K6VA 1Z9HA 3PH9A 4I2TA 2I81A 2WB9A 3AY8A 3IHQA 4XRDA 2PUKC 5F07A 2K8VA 1K0OA 3TJGA 3F6DA 5EPFA 1U88A 2ES7A 1AAZA 4IP6A 4CW9A 1GH2A 1HNBA 1WWJA 2CX4A 2PWJA 1S3DA 4MLYA 3MSZA 3ERFA 2VCZA 2DJ2A 3UVHA 3HY2A 3WYWA 2VCVA 5ECNB 1J0FA 2GS3A 3ERWA 4J56E 1PGTA 2WRTA 4HDEA 1MEKA 4ZL9A 2VAFA 3APSA 2NVLA 4BVYA 3TKSA 3W8SA 5GSSA 4TXVA 2C80A 5ECKB 3IPZA 2FLSA 1FO5A 3GMFA 4XS6A 2PVQA 10GSA 4L0UA 3VWWA 1KEBA 3GRXA 3WD6A 4MA9A 1JZDA 3UVTA 1EZKA 2LUSA 3GUSA 2DMMA 3FZAA 1AXDA 4DVCA 1PL2A 2DC5A 2DJ1A 4POMA 5CYYA 3P8WA 3QD9A 3ZREA 2TIRA 2FD3A 1BX9A 2YN1A 4GF0A 2X8CA 1MTCA 2IFQA 5G5EA 1EOGA 2N5BA 3NIVA 1XW6A 3TJBA 6GSVA 2RIIA 1CQHA 1SL1B 4YQMA 4LL4B 5B8BA 5DAKB 3C1SA 1HNCA 5LCZA 1BJXA 2HZFA 3DXBA 1XPVA 1ML6A 3EINA 4WETA 2GZPA 4WKWA 4OMVA 2WZ9A 3ZITA 4LLRA 1B9XC 1OVNA 3H1NA 3A3TA 1SJZA 4DSQA 5JCUA 4J2FA 3WT1A 1VF3A 2NTOA 2YPMA 3PGTA 1PQNA 1YKCA 1PL1A 2FWEA 5G2ZA 3F9UA 2JL4A 1X5EA 2C4JA 1AC1A 1YEPA 2C3TA 3TGZA 3EC3A 2LRTA 4IW9A 1GTAA 3KTBA 3O6TA 2IMFA 3V1WA 3K8NA 4JBBA 3KH7A 3MAKA 2LNSA 2YCDA 2OACA 1A2MA 3DVWA 3LGCA 1GNWA 5ECRB 2QSIA 2G2QA 4K7NA 1A0FA 2OA7A 1GSYA 1GRXA 1PX6A 1GTIA 2V1MA 4KB3A 1OKTA 1UVZA 2VIMA 1OC3A 3UEMA 3GH6A 2GSRA 5E59A 4Q5QA 2WJUA 1A8LA 1QGVA 5IMCA 2H6ZA 2I4AA 2VL9A 1XIYA 1WIKA 2R37A 4EXJA 3NZNA 2GSTA 2MMNA 3H93A 5AISA 1WOUA 5J9BA 1QXHA 1QFNA 4JR4A 2HLSA 1OAZA 2F8FA 2VLTA 5DAKA 2GSQA 3ZFBA 3A2WA 1YQ1A 17GSA 5CAXA 3ZFLA 3GURA 2CVBA 5KEJA 3GX0A 1GSEA 1G0TA 1A8YA 3KJYA 1B9YC 1MDIA 4YQUA 1PKWA 3RHBA 4EL1A 3TKQA 5D9TA 1I9DA 3HCZA 9GSSA 4MK3A 2RM5A 3F0IA 1TK5B 3Q74A 1OE7A 5G1LA 1PKZA 2I1UA 5IM9A 4V2NA 2R3XA 3VWXA 3S9FA 1EGRA 1TU8A 3GTUB 1TW9A 4F82A 1S3CA 3EVIA 4TN8A 2L5LA 2FWFA 2IPAA 1R5PA 2AB6A 2VO4A 2E2MA 1ACVA 1PX7A 2OE0A 3CSJA 3RBTA 4F9ZA 3P2AA 3WT2A 5GZZB 2P31A 1IYIA 4GSNA 3CRUA 4EDZA 3GV1A 4FYUA 4ZIJA 2H8LA 2O89A 2H76A 3DIEA 2L5OA 2AV4A 1SKSB 2EIQA 3HXSA 5J5NA 1CQGA 1TRVA 4YAVA 1K0AA 4IQ1A 1WMJA 5GSTA 2XC2A 4MPGA 4ZL8A 1M7TA 1XWGA 2IYJA 3KMNA 2LJRA 1FVKA 3P90A 1U6TA 3KEBA 3N5OA 3UMAA 3FR9A 4NPBA 2J23A 4F0CA 5DCGA 2L6DA 3KM6A 2L6CA 1IYHA 5JWRB 2HXKA 2AJQB 1K3OA 1EWXA 3ZL5A 1FOVA 1JHBA 2VM1A 5IO0A 3BJ5A 4YAPA 4J57E 4EF0A 2IMIA 3IBHA 4K1FA 1GUHA 4OCEA 2LSTA 1J08A 4JU5A 2I3YA 3LYKA 2WULA 4ECBA 5HFKA 4XIHA 1GSDA 2FA4A 2CX3A 3KXOA 4WEYA 2VUPA 3I69A 3VLNA 2RLIA 3UBLA 3UAPA 4IELA 2B6MA 1U3AA 1YJ6A 3GTUA 2GQLA 3UJ1A 3Q18A 1FW1A 1QQ2A 3ZVJD 2AHEA 2R6KA 1TXXA 3IE3A 1GSUA 4I5QA 1TJDA 2L57A 4GQCA 2MMOA 1A24A 4IN0A 2HYXA 4K6XA 4MABA 1K0DA 2JZRA 1T00A 3SWLA 6GSUA 3CTGA 5ECHB 2V6OA 1G7EA 3ZZXA 1EEMA 4NWYA 4KSOA 3F4SA 1PD21 4LMVA 1XW5A 3GYKA 1XFLA 3L9VA 2NDOA 5ECPB 5A4VA 1SK0A 3KMOA 3EU3A 2PMTA 3G7JA 5CRDA 1GP1A 3F3RA 1X0RA 5JWQB 2NPBA 2VD0A 1AW9A 3FK8A 3ZVJA 3HVXA 2FCHA 4G10A 2K18A 3ME8A 4K8MA 3HVSA 4F03A 5DDLA 4OFMA 3HDCA 22GSA 1GLQA 1XWBA 3R2QA 1DE2A 1WP0A 1K0CA 3LWAA 2H6YA 4K7OA 2H01A 2H0GA 1EOHA 4ML1A 1SENA 1YF1A 2TRXA 1XVWA 3I6AA 4XTSA 2H70A 2RUFA 1SU9A 4HU7A 3US3A 1V58A 4KUNA 4V2LA 2LJAA 5F05A 3BBYA 4PX1A 4ECIA 3LSZA 4K0NA 1GUMA 1GSSA 2O85A 4K9ZA 2HFDA 3ISOA 2VCWA 2M80A 2K8SA 3QMXA 4EC0A 3QOUA 2XBQA 3FZ4A 2OBIA 2C1YA 2H74A 1ON4A 3ZLPA 3HHVA 4X43A 2PN8A 4POLA 2YJHA 2JZSA 5CRGA 1TI1A 5C04A 1EGOA 3ZIJA 2VL2C 3FKFA 3VPQA 1PMTA 2FA8A 3ZMKA 3DRNA 1F2EA 4KNDA 3QPMA 3TRPA 4KDYA 2CV4A 5DCHA 4PNFA 3WGDA 4ZB8A 2LJKA 2C0FA 4XHMA 3UIWA 1F9MA 2H30A 2O87A 5KN3A 4TXOB 5ECQB 3M3MA 3JCML 2VCQA 3M0FA 3A2VA 1XWCA 4PQ1A 2YJ7A 4HZ2A 3Q19A 2DBCA 2KP2A 3VURA 4Z7XA 3FR3A 2HNLA 1FAAA 1GSFA 6GSYA 2P0GA 1QK8A 3KGKA 3GSTA 2O8VB 1XOAA 1DBYA 2HZEB 2YWOA 4ZBDA 4GWRA 1O8XA 4HZ4A 2OBKA 3L4NA 4V2MA 1UC7A 4MJBA 2EIOA 2C3NA 1GNEA 4MMMA 4ID0A 3A5WA 4ZL7A 5DJLA 1O7UA 3U5RE 5D9VA 4OFNA 3TOUA 2HRNA 18GSA 3CXGA 2FWHA 5CNWA 3O76A 4HS1A 2FNOA 1T1VA 20GSA 3HD5A 4RQXA 2JU5A 5EL8A 3GNJA 4V1Ap 4WF4A 2BJXA 3EYTA 4NHZA 4ZILA 4X0XA 1E2YA 1XWAA 4FH8A 2H66A 5IMVA 4TR1B 3H8QA 2HSHA 4AGSA 1M9AA 2AAWA 3RAZA 3A2XA 3EWLA 3GSSA 2WS2A 1XOBA 5B6NA 1AQXA 4WXTA 3GKMA 3WGXA 3DWVA 3HVVA 2H73A 4TXOA 4YH2A 2H1AA 5IMDA 2ZNMA 1A2LA 4MF5A 5IQYA 5FHIA 1VRSD 4HOJA 3HJMA 1V98A 4PUFC 1EV9A 3QFAC 5B6MA 3C73A 1PRXA 1LJRA 1NHOA 1BEDA 2MBTA 1AQVA 4WBRD 5DVBA 2HZEA 4IGJA 1U3IA 2J9HA 2H1DA 2V6KA 2Z9SA 1XBSA 1SD8A 1TRSA 2H19A 2I9HA 5D73A 4L5LA 3W8JA 1T8EB 3TRXA 1JLWA 2B5YA 3CYNA 4ACSA 3VI5A 3GA4A 2YANA 2YV7A 5ID2B 1TP9A 1O8WA 1T4YA 4NMUA 1N2AA 3D21A 5CREA 1DSBA 5A5KA 1HNAA 2LEGA 2V2GA 2BTOT 5IOWA 3L9UA 2XPEA 1TRWA 5A4UA 1G6YA 2B7JA 2JACA 1UA5A 1M9BA 1RW1A 2DIYA 5CP1A 2E0QA 4JRRA 1U87A 2B1LA 1FB6A 2R5GA 4TR1A 4ZB9A 4MJEA 2NBSA 1EP8A 2F3MA 2QC7A 2E2GA 5J4UA 3TUEA 1ST9A 4IS0A 2CZ2A 1Z7PA 2N5AA 4O7HA 1R7HA 4F0BA 3F6FA 1Y25A 4NV2A 3Q6OA 1V57A 3MDKA 1TDIA 4O32A 2M72A 3FZ9A 3TKPA 2FUG2 1SK1A 3GKKA 1BYEA 2RUEA 4IVFA 1X9WB 1M0UA 4PXOA 2DJJA 5IMFA 4DEJA 1R5AA 1BAYA 3FEUA 3TDGA 3VFIA 4OO5A 2GDRA 4Q5RA 1EEJA 1SYXA 2VL2A 2CVKA 4G2EA 1YDKA 3TCOA 4HEA2 2WCIA 5ID2A 4MPFA 4GSTA 4TKYA 1M2BA 3QAWA 1JLVA 1K0NA 1MD4A 3UOMA 4Q5NA 3KH9A 3SBCA 11GSA 5AN1A 3ED3A 5FWGA 4D73B 3LXTA 4EO3A 1T4ZA 1KTEA 4N0ZA 4MF7A 2VCXA 2MYGA 3ERGA 4PGTA 4HQZA 4G9HA 2L4CA 2X8HA 5CO3A 5H5QA 4RUVA 2JSZA
chains in the Genus database with same CATH superfamily
3MYTA 1ZX2A 4LYLB 3IAS2 5AIXA 3EHCA 2KP1A 4WFOA 4IP1A 3O3TA 2C0DA 4XDWA 3P7XA 5B7CA 1G6WA 2P09A 2JADA 2F5MA 2OE1A 3CPW2 2V41A 2F4YA 5FW5A 4LEHA 1BRNL 4HVNA 2CT6A 4HUAA 5ECLB 3BB9A 2OE3A 3RDWA 3HJOA 2GVPA 4E8EA 1BNSA 3TB2A 3IV4A 1FGQA 5HOHA 3FYGA 4KH7A 5IO2A 1ZGNA 4EV5A 1UUGB 1VQQA 1IV7A 4WR5A 1FGRA 2CFWA 4EC6A 2IMEA 3EPTA 3DD3A 1IQYA 3L9SA 2R2JA 3KD0A 4HM0B 1UN2A 2A2SA 1GOUA 3CMIA 4GL6A 3FY7A 3X3XA 1PFPA 4RQRA 3SYUA 2HMJB 3CCR3 1QUWA 1ABAA 2VM2A 1TI3A 4K2XA 1G7OA 14GSA 5COHA 1K3LA 2B5EA 2EIRA 4PQHA 1BRHA 16GSA 1HYUA 2X4AA 2HRKA 3U6VA 1NM3A 3CPOA 5ECSA 2GSSA 1ZS7A 4GLTA 1O7PB 4AJ7A 4N6LA 4LA1A 4HQSA 3CRTA 1NSWA 4K7IA 4KX4A 4GB5A 2YOIA 3EX9A 1LNIA 3LQ7A 3OX9A 3QCPA 1ZOFA 2AUVA 1NHYA 3UL6A 4OFTA 5J3RA 4J5GA 1X5DA 2PBJA 2IMKA 4BWSA 1OH0A 1TTZA 1RGGA 1ERVA 2PU9C 2E2VA 1OC8A 3HJPA 2F8AA 4ORLA 4RZMA 1ERWA 1B21A 3C8EA 2IL3A 1RGCA 4BTYA 4RI6A 5J41A 1JZWA 4JZQA 4D73A 4AJ8A 3F8UA 1HD2A 3H4KA 1BSBA 1O7GB 4BVXB 2FNQA 1UCLA 3QK9A 1C72A 1AUCA 2XFSA 3CCE3 1USBA 2LKUA 1MDKA 1X1XA 2MMAA 4WP5A 3C7MA 4WR4A 3GL3A 3J7Yk 1V40A 2LQOA 1JZOA 1JBTA 1OHOA 5DBQA 5JCWA 2DLXA 1SL2B 1M2DA 3PCSA 1ERUA 3TOTA 2P05A 1FW7A 1A2JA 1ZYEA 2YWMA 3FKAA 1XZOA 3KE7A 3S27A 4XBTA 1IT7A 3OW22 3APQA 3DGMA 5G2GA 5GAPD 3TJKA 1THXA 3DVXA 1R4CA 3G9BA 1BIRA 2DJ3A 4N10A 5FT3A 2REMA 5BRTA 1J9BA 4P3YB 1TUHA 1YJW3 19GSA 2R4VA 3D4MA 4NXIA 3S28A 3EU4A 3DGYA 1BOXA 5JCGA 4N6NB 4MNNA 4AEQA 4K1UA 1NW2A 1O85A 2MZCA 1BQ7A 2YP6A 2W0QA 4IBPA 3IRAA 3IA1A 4IQAA 3ZTLA 3LMLA 2D2ZA 2H6XA 2OJLA 1K28A 3BOAA 4IJIA 1YJN3 1ZZYA 1KQS2 2LRCA 4FIWA 5AGYA 2GT5A 2GZZA 2PGTA 2QGVA 4GCIA 1BSDA 4Q5FA 3CC23 3CCS3 3HA9A 1UDII 3GKXA 1ILOA 3GKNA 2OOVA 1FVJA 3BIRA 3HX8A 3D22A 3C1RA 1OC9B 4XBYA 5D93A 3E0UA 3GHAA 3CCJ3 1OKDA 2K0MA 2XGNA 1WE0A 5IMZA 1R4WA 4MP4A 1RK4A 5F0GA 1GSQA 5H5RA 1WJKA 3NOFA 5M19A 2CA8A 2IN3A 3URPA 3CSHA 1YGWA 1Q40B 5AIVA 4MZCA 2BMXA 3FZWA 3SOAA 4LMWA 5KP3A 5F8BA 2MMZA 4BPYA 1DE1A 1KNGA 3IK7A 1JZRA 2RM6A 1B8XA 1TFKA 4N6UA 2D42A 2FY6A 3LFLA 2VOCA 5HR3A 3GZRA 3FF2A 3VF1A 1RN1A 3X41A 5INYA 3NUVA 3VK9A 1XW9A 4ZBAA 5D96A 1T7PB 1PN0A 4HM8B 2DMLA 2CAIA 4FO5A 4BVXA 6GSTA 2GT6A 3N9JA 3PPUA 3QAGA 1O81A 2GTUA 1KBNA 1Q4JA 1E6BA 2CKFB 5IG0A 2GQMA 3Q1CA 13GSA 5ENUA 1RSNA 2BU4A 2GEYA 1WPIA 3I0YA 1MD3A 2CAQA 3FRCA 3G4S3 5HFGA 4E8HA 2PPTA 3F7SA 3J7Yb 5HR0A 1K3YA 2A15A 3GZYB 3AGNA 3G16A 1IK3A 2W56B 2PVOC 1AQWA 1SJ6A 4EIPA 2OKAA 3I9V2 5ELGA 3MWHA 5B8AA 2OQEA 1QMAA 4HM4B 4G19A 4KAEA 3UARA 2F56A 1TFOA 1F6MC 4HKVB 4WBJA 4AF2A 3MG2A 1Q824 2KLXA 2QKEA 4HJMA 3F63A 1UCIA 3GFKA 3TJFA 3C71A 1LOVA 4ZXGA 4LL1B 1B4QA 4I8BA 4EBGA 2LS5A 1RRHA 1FA3A 5D8IA 4K1VA 1NWWA 4O92A 2Q07A 2HOHA 1YF0A 4POKA 5TGNA 4L8EA 3ZRDA 4KDUA 3H79A 1EV4A 1GWCA 2Z76A 5DALB 4QL7A 1VQN3 2BMOB 4ISDA 2HRFA 1VQO3 1A90A 4N0VA 5E4WA 3MNGA 1ZMAA 1X1WA 1GLPA 4QQ7A 2OADA 3KFQC 3IAM2 1OGZA 1U5OA 3NQZA 5AYRB 3WGEA 3M8NA 5CRWA 1OC9A 4XCSA 1VQ53 3TRQA 6GSXA 1T5YA 4N30A 2X99A 3GH9A 5IOXA 4KCAA 2FXTA 5G30A 1XXUA 1M2AA 4NAXA 1DETA 2VCTA 1X1UA 3LXZA 2WGQA 4I2UA 4XDVA 2MF7A 2N5FA 5HR1A 1RCKA 2L59A 1Q40A 1MDJA 1X5CA 4ZBBA 3X3YA 1EQKA 5CF2A 2K9FA 4EYCA 4HI7A 3IOSA 1FGTA 2XSHB 2HI7A 1HYFA 5DJMA 4MH2A 7GSSA 4HM6B 2PNCA 1SJWA 2A4VA 3FG3A 4Z2UA 2V32A 5G31A 2ZUPA 4JE1A 2IMJA 4IJ3A 2C8UA 1NO3A 2PERA 3EMXA 3L0HA 1J2BA 1QMVA 3HZ8A 2RBIA 2YZHA 4AJ6A 1ZL9A 2C0GA 3DKSA 4STDA 4GQFA 1VF1A 1TRUA 4OD7A 3PINA 3KIIA 3HIGA 3I563 1WRYA 5IF6A 3RPNA 4HU9A 3QFBC 2ON7A 5HQPA 4CHSA 1X9SB 2P5RA 3MG3A 3VPTA 2QIYA 1ZYQB 1JFUA 4DSSB 4L0WA 2QGUA 2DJ0A 2W56A 2OCTA 5D9WA 2DSAA 1TK0B 4H86A 3VI7A 1SJIA 2GBXB 4BL7B 2FWGA 3GL5A 3QDNA 4R9LA 4KE3A 3W6GA 3FZ5A 5JBSA 2BHMA 4TW5A 1N9JA 3GIXA 4TOPA 4F2IA 3MKIA 2L4VA 4A5PA 3K5TA 1YZXA 3LW9A 2F51A 2AYTA 4HZ9B 2CWTA 3IC4A 3F4TA 4L8OA 2BMRB 2H1BA 3RPPA 2EC4A 2CH9A 2B5XA 3FGYA 4BIKA 4Z2TA 1YY7A 1A23A 2BIRA 3D6IA 3RGRA 4MCUA 5KN0A 3JVCA 12GSA 3HZPA 5DALA 2LTKA 2YWIA 1VQK3 3E99A 1V2AA 4MDCA 3EN1B 1GUKA 1DMQA 2KUCA 4OWYA 1HQOA 1RLSA 3LXUX 1BUQA 1LBKA 1PN9A 3M1GA 3R3EA 1TK8B 2XF3A 5ECMB 3I43A 1NB5I 1UW1A 3VWUA 3L78A 1SQWA 2GLRA 3FW2A 2VLUA 1ASKA 2F98A 2XBIA 4BU4A 2IJYA 4ECJA 3JUMA 4V1Ag 3EF8A 4IHUA 3DYRA 1AY7A 4TR4A 3S29A 2QA43 4KF9A 2Y74A 4YKFA 5ELAA 2ZCTA 1OHSA 1YKAA 1K8A4 5STDA 3GN3A 4KGIA 2E7PA 1IQ8A 4OK0A 1THOA 1I5GA 3KP9A 1UI7A 2CVDA 4DSRA 1NJI4 3D5JA 3MIXA 5D83A 5EVOA 2HMKB 3QRDA 5HR2A 4L8PA 4MMXB 1X9MB 1G96A 3ZMLA 3LTCA 3UBKA 4YQVA 3N54B 4N3VA 1M99A 1PFOA 4KA0A 2JSYA 5AIIA 1BRGA 4MJAA 2JQ5A 1A2KA 2XPDA 4FR9A 4NHWA 2A2PA 4EDYA 2GZYA 1SIHA 2KXGA 4GSSA 3UL3A 4K5RA 1DYUA 2HT9A 8GSSA 2F9SA 4KVHA 2VLVA 2IY2A 4ML6A 4GRFA 5BIRA 2WDUA 2IIYA 3KZQA 4EIQA 3GWRA 4KW6A 3G6E3 2YNXA 1PSQA 4BWQA 4DSSA 3QAVA 1BG5A 1H4OA 4JF8A 3CBUA 1O6JA 3EE2A 5F06A 6RNTA 4O8SA 1SKRB 3FLJA 4EVMA 3CXC2 4CDOA 1TIJA 4BL7A 1Z7RA 4OVMA 1PA3A 4QL9A 1BNFA 1A0RP 4MMZB 2IWTA 2RNTA 2C0EA 3IK9A 5AIFA 1TOFA 2H71A 5LNKe 2B24B 2LQQA 5D81A 2VD1A 3D9RA 1SL0B 1E3RA 2WFCA 3BD2A 3ZYWA 3NBBA 4XS1A 3PR8A 4HM1B 2J8XB 1YEXA 4O5RA 3DMLA 4I97A 2YWNA 3TKSC 1FB0A 1RQMA 2A2RA 2P5QA 3KTLA 1GTBA 4TR0A 1IVXA 1GULA 5IPHA 4BA7A 4GTUA 4USSA 1YI23 4XB5A 5IIZA 1W00A 4RUVA 1NDOB 2B3SA 2GSPA 1DMNA 2B1KA 3EURA 1VGLA 2FGXA 2GXFA 4XS4B 5ECOB 5G1KA 1B2MA 4N11A 2VL3A 1B4PA 4IKHA 1U8CB 2LRNA 3F3QA 4MZBA 5D9XA 1H75A 1Q98A 3LG6A 3T8UA 4XRAA 1B2SA 1T3BA 5KN1A 5DQSA 1KC84 1GY5A 5L71A 2DKHA 1KD14 2O9UX 3N8BA 5IPGA 5GAND 1PYLA 2C3QA 1VF2A 1XCCA 5RNTA 3D4TA 4HJ2A 2KOKA 1B48A 2Y73A 1OYJA 2KHPA 1R26A 3HVNA 2KF4A 1URMA 1L5GB 1IVWA 3UNLA 4PURA 1M3JA 2F99A 2XH9A 1S723 4OCFA 5ABRA 1FG4A 2WOHA 4KSMA 2HE3A 2DJKA 3NQYA 5CRHA 3ZIVA 2H75A 4J9AA 1Y6EA 2LV3A 3K0ZA 2CX1A 3UB1A 4TVEA 2X64A 1PY3A 2L4QA 3EJVA 3LOYA 2SBLA 3D0ZA 1O73A 1VF4A 1M1XB 2XSOB 5J9CA 1TRQA 3NV0B 4FYCA 1Z6MA 3PS8A 2DKIA 3NM2A 1KSIA 5ECIB 5G5FA 5IMAA 2H0HA 2R0CA 2YZUA 3FH1A 3ME7A 4RI7A 4HM3B 3CD63 3KKGA 3CSIA 3CC73 3TKSE 1D6YA 4JR6A 1K0MA 1WMPA 4KDXA 1N8JA 2G0FA 5AEWB 1BU4A 3LZAA 3FHKA 4L5OA 4I6XA 4EUYA 1HZ1A 1SD9A 2O7KA 5KOXA 3FR6A 2B7KA 3NX0A 4ULXA 3E3EA 1SYRA 3LEFA 3DEXA 1WNHA 4X1UA 5IG4A 3LT9A 1XWKA 4TR3A 1BRKA 3F8HA 3UL5A 2HMNB 1Z5YE 1IYYA 4ECCA 2H72A 5DQYA 3TJJA 2LNTA 1B2XA 3TKRA 1TU7A 1S3AA 1XVQA 3GZXB 5AYSC 6GSWA 1DUGA 1GD3A 4Q53A 3KIJA 5JWOB 4K2DA 2H1GA 1EP7A 3HYPA 2MBSA 1ZCPA 1A67A 4MH3A 1LQMB 1F3AA 1JV2B 1WQLB 3VWVA 4TRXA 2L1SA 1Q42A 4XS4A 4MF6A 3KP8A 3G7IA 5H5SA 3EC9A 1QJGA 4EE0A 1GTUA 5HFIA 1Q9EA 1ULIB 2QA1A 3JUOA 1ERTA 2AAEA 3RDEA 1LU4A 5EY6A 4WYKB 4OO4A 3IR4A 1Z6NA 3F14A 1ULJB 2OTJ3 4PEJA 2XHFA 2ALBA 5LD0A 3WA3A 1Z3EA 4HJLB 3GX8A 2ON5A 3APOA 2JZTA 5M18A 5BXQA 2TRCP 3IDVA 3E9JB 4ILFA 3WOEB 2K54A 2LQVA 3AMOB 1ZO2A 2DIZA 3M9KA 4PQIA 1TKDB 1GL8A 4PNGA 3FG4A 1AIUA 1ROVA 2HSYA 2ZL8A 3QR6A 3G7YA 3J7Yd 3EMPA 3B4PA 3LTBA 5LC6A 3DGQA 4WF5A 4NV5A 6GSSA 2UGIA 2GBWB 3CQFA 3RHCA 3T8NA 3HZ4A 4JEDA 5DREA 4MEIA 2P0MA 3HOHA 4BVYB 3HKRA 4POBA 3U97A 1K734 3NV0A 2CZ3A 3OR5A 7RNTA 3F8XA 1RGHA 1TTOA 3MPHA 1OE8A 2OWPA 3CTFA 3F4RA 3PGBA 2GQKA 4MZWA 4FMBA 4MJCA 4KCEA 1SK2A 4FYBA 3WA2X 1K0BA 3A5IA 4DKIA 1RNBA 3B8LA 3IXRA 3CC43 2M46A 3LH4A 3LJRA 1F3BA 3NXJA 1QAKA 1F37A 2WGRA 3AHSA 2CQ9A 4Z2RA 2CW9A 1BUJA 3D3LA 4PUAA 1W89A 2H0IA 3SLUA 4HZBB 2BMQB 1FHEA 1Z1SA 8CHOA 8RNTA 4R1KA 1W4VA 3BCKA 1C54A 3LYPA 3BCIA 1V9WA 4ZB6A 2GGTA 3KCMA 1EG9B 2FHEA 2IFQB 5C00A 3LORA 5EEOA 1SKWB 1FUSA 4EKZA 3ZFZA 5A4WA 4GXZA 3M9JA 2X8GA 5KN2A 2YV9A 4FQUA 4K0GA 5AI1A 1MGRA 4FMAA 2IMDA 2K6VA 1Z9HA 3PH9A 1HKXA 4I2TA 1MWTA 2I81A 2WB9A 2WGOA 3AY8A 1W6YA 3IHQA 2CFGA 1LOYA 4XRDA 2PUKC 4R4KA 5F07A 4WYKA 4WHAA 2K8VA 3L0RA 1K0OA 3TJGA 3F6DA 1QVG2 5EPFA 1U88A 2ES7A 1AAZA 2IA7A 4IP6A 1FUTA 4KFEA 4CW9A 1GH2A 1O7HB 1HNBA 1STDA 2P0XA 1WWJA 2CX4A 3G8ZA 1LVNA 2PWJA 4AKZA 1BRIA 1S3DA 2Z6BA 3WR2A 4MLYA 3MSZA 3ERFA 2VCZA 2DJ2A 3DZLA 3UVHA 3HY2A 3WYWA 2VCVA 1VQL3 4BL2A 2KF5A 5AIHA 5ECNB 1J0FA 3DGOA 2GS3A 3ERWA 3STDA 1PGTA 4J56E 2WRTA 4HDEA 1MEKA 5BMUA 4ZL9A 2VAFA 3APSA 3CCV3 2NVLA 1OCVA 2CX0A 4BVYA 1IU7A 3TKSA 3W8SA 1RTUA 5GSSA 1QALA 4TXVA 3ECFA 2C80A 1M904 5ECKB 3IPZA 2FLSA 4J5KA 4KT3B 3H3HA 1FO5A 3KCHA 3GMFA 1Q7HA 4XS6A 3OXAA 5IENA 2PVQA 3LYGA 10GSA 4L0UA 3VWWA 4QWTA 1KEBA 3GRXA 1RGAA 3WD6A 4MA9A 3LT8A 1JZDA 4CY8A 4XM4A 1EZKA 2LUSA 3GUSA 3UVTA 1AV4A 4FMDA 3BNEA 2DMMA 1JBSA 3FZAA 1AXDA 4DVCA 1PL2A 2DC5A 1I0XA 2DJ1A 5EVHA 4POMA 1GMRA 1OACA 5CYYA 3P8WA 3QD9A 3ZREA 2TIRA 2FD3A 1BX9A 4FCZA 1YJ93 5AEUB 2YN1A 1RGEA 4GF0A 1I2FA 2X8CA 1IQXA 1MTCA 2IFQA 5G5EA 1EOGA 1W6GA 2N5BA 3NIVA 1XW6A 3TJBA 6GSVA 1VZZA 2RIIA 1CQHA 1SL1B 1ZGXA 4YQMA 4LL4B 2I9WA 4O5UA 5B8BA 5DAKB 3C1SA 1HNCA 5LCZA 1BJXA 5IEPA 2D1WA 3CNXA 2HZFA 4RNZA 1IVUA 3IC8A 3DXBA 1UGIA 6STDA 1XPVA 3OV4A 1ML6A 3EINA 4WETA 2GZPA 3BNDA 4WKWA 2CWUA 1S5AA 3NHXA 4O5QA 4OMVA 2WZ9A 1N9EA 3ZITA 3DGNA 1B9XC 4LLRA 1OVNA 3CU3A 1VQ43 3H1NA 3CMA3 3A3TA 1SJZA 4DSQA 2C10A 2KCDA 3SVAA 5JCUA 1M9GA 3F9SA 3JUQA 4CCVA 4J2FA 2KF6A 3WT1A 1VF3A 2NTOA 2YPMA 3PGTA 1PQNA 1YKCA 1PL1A 2FWEA 5G2ZA 3F9UA 3CNMA 1US1A 2JL4A 5IG3A 1VQ63 1X5EA 1GSPA 2C4JA 1GMPA 3MYDA 1AC1A 1YEPA 1LOXA 2C3TA 3TGZA 3EC3A 4GSPA 2CFLA 2XRXB 1Q7Y4 2LRTA 4IW9A 1GTAA 3KTBA 3O6TA 5CXOA 3D79A 2IMFA 1M3IA 3V1WA 3K8NA 5JPPA 4HYZA 1SIIA 4JBBA 3KH7A 3MAKA 2LNSA 3RGAA 2YCDA 2OACA 1N5HA 1A2MA 3DVWA 3LGCA 2F86B 1GNWA 5ECRB 2QSIA 2G2QA 4O2HA 4K7NA 1A0FA 2OA7A 1GSYA 3CME3 1GRXA 1PX6A 1GTIA 2V1MA 4KB3A 1I8VA 1OKTA 4K90B 1UVZA 2VIMA 1OC3A 3UEMA 1MWSA 3S5CA 3WODG 3GH6A 4I4KA 2GSRA 5E59A 4Q5QA 2BT3A 2WJUA 1JRQA 1W6CA 1A8LA 1O7WB 1QGVA 5IMCA 2H6ZA 2I4AA 2YFLB 2VL9A 1XIYA 2XEPA 1WIKA 2R37A 4EXJA 3NZNA 1B20A 2YX9A 2GSTA 2MMNA 1Y4KA 1W4NA 3H93A 1WOUA 5AISA 5J9BA 1PU4A 1JN5B 1QXHA 3ZG5A 1QFNA 3GAXA 4JR4A 2RCDA 2HLSA 1OAZA 2F8FA 2VLTA 5DAKA 2GSQA 1R4YA 3ZFBA 1DMMA 3A2WA 1NB3I 2UX0A 17GSA 5CAXA 3ZFLA 1BANA 3GURA 3V98A 3G0KA 2CVBA 5KEJA 4BL3A 1JB4A 3GX0A 1GSEA 1G0TA 1A8YA 3KJYA 1B9YC 1MDIA 2E2UA 4YQUA 1PKWA 3RHBA 4EL1A 1BNRA 3TKQA 5D9TA 1RDSA 4RNTA 7GSPA 1I9DA 4CY6A 2CG0A 4BTWA 3HCZA 4G0LA 9GSSA 5FGOA 1TP6A 4MK3A 2RM5A 3F0IA 1UCKA 3A5EA 1TK5B 3KSPA 1OGXA 3Q74A 1OE7A 5G1LA 5ELJA 1PKZA 2I1UA 5IM9A 4V2NA 4J8TA 1V74A 2R3XA 3WOFB 1GOVA 4ICYA 3VWXA 3S9FA 2CG1A 1UI8A 1EGRA 3Q2PA 1TU8A 3GTUB 1TW9A 4F82A 1S3CA 3EVIA 4TN8A 2L5LA 2FWFA 2IPAA 1R5PA 2E2TA 2AB6A 1I2GA 4K5SA 2VO4A 2E2MA 1ACVA 1RGFA 1PX7A 3IPTA 1RCLA 5JPUA 2B1XB 4BIRA 2OE0A 3CSJA 3RBTA 4F9ZA 2BO9B 3P2AA 3WT2A 5GZZB 2P31A 1IYIA 4GSNA 3CRUA 1Q864 3AHWA 1FYSA 1FUWA 4EDZA 3GV1A 4FYUA 4ZIJA 3IMAB 3CCQ3 3PXMA 2H8LA 2O89A 3GSPA 2H76A 1JBRA 1T2HA 3UJMA 1LXEA 3S67A 2C4BA 3H51A 3DIEA 2L5OA 2AV4A 1SKSB 2EIQA 4HM5B 3HXSA 4CDLA 5J5NA 1CQGA 1DVCA 3B4OA 1TRVA 4YAVA 2XFTA 1K0AA 1BGSA 3JUPA 4IQ1A 1WMJA 5GSTA 2XC2A 4MPGA 5M1AA 3Q90A 4ZL8A 1WTHA 1M7TA 1JN5A 1XWGA 2IYJA 1BSEA 1BSAA 3KMNA 2LJRA 1O7NB 1FVKA 3V99A 3P90A 1U6TA 3KEBA 3N5OA 3UMAA 1RGKA 1CYUA 2UZ8A 1WMOA 4IIAA 4NPBA 3FR9A 1W2B2 2J23A 4F0CA 5DCGA 2L6DA 3KM6A 2L6CA 4N6TA 1IYHA 5JWRB 2HXKA 2AJQB 1K3OA 1EWXA 3ZL5A 1FOVA 1JHBA 2VM1A 5IO0A 2R41A 4K61A 3BJ5A 3NBJA 1N5PA 3V92A 4YAPA 4J57E 4EF0A 2IMIA 3SXXA 3IBHA 4K1FA 2IUJA 1GUHA 4HM2B 2KAAA 4N6V0 4OCEA 1RRLA 2LSTA 1J08A 2A4HA 4JU5A 5IG5A 2I3YA 3LYKA 2WULA 4ECBA 5HFKA 4XIHA 5IEOA 1GSDA 2FA4A 2CX3A 3KXOA 4WEYA 3BNCA 2VUPA 3I69A 5CLKA 5ELUA 3VLNA 2RLIA 3UBLA 1GMQA 3UAPA 2HSMA 4IELA 1GD4A 2B6MA 2W2CA 4RNYA 1U3AA 4L7KA 1YJ6A 3GTUA 1ISKA 5KP1A 1XG8A 3Q3FA 2GQLA 3UJ1A 3Q18A 1FW1A 3IHGA 1QQ2A 3K63A 1BNEA 3ZVJD 1CH0A 2AHEA 2R6KA 1TXXA 3IE3A 4G0IA 1EKMA 3HK4A 1GSUA 3BU4A 4I5QA 1TJDA 2GU3A 2L57A 4N6OB 4GQCA 4R9KA 2MMOA 3EBTA 1A24A 4IN0A 2CWVA 2HYXA 4K6XA 1C7HA 4MABA 1AVKA 1K0DA 5CK6A 4HOHA 3WHOA 2HMOB 2JZRA 1T00A 3SWLA 6GSUA 3CTGA 5LC7A 4KFDA 4O02B 2M7OA 4G0KA 2ML6A 4FCMA 6GSPA 5ECHB 1JB2A 2V6OA 1G7EA 3ZZXA 1EEMA 1YIT3 3FCSB 4IT7A 4NWYA 1OF5B 3F4SA 4KSOA 1PD21 4LMVA 1XW5A 3HIIA 3GYKA 1I3IA 4JRFA 1XFLA 4HSCX 2R0GA 1MGWA 1VQP3 3L9VA 3EN8A 2NDOA 2SARA 3N9HA 2W9PA 5ECPB 5A4VA 1VQ93 1SK0A 3KMOA 4YKGA 3X42A 3EU3A 2PMTA 1RN7A 3G7JA 5CRDA 3KN4A 1EUIC 1UUVB 3DM8A 1GP1A 1D6UA 3F3RA 1X0RA 5JWQB 2RFRA 4EXRA 2NPBA 2VD0A 1AW9A 4XBXA 3FK8A 3ZVJA 2XGLA 2ZHXB 1W5ZA 2FCHA 3HVXA 4G10A 2K18A 3ME8A 4K8MA 3HVSA 2QEX3 5DDLA 4F03A 4OFMA 3HDCA 22GSA 1GLQA 1XWBA 1IVVA 2CC3A 1GS3A 2X49A 3R2QA 3X40A 1B3SA 1DE2A 3MWZA 1WP0A 3FMWA 2W03A 1K0CA 3LWAA 2H6YA 4K7OA 3CCL3 3EQQB 5IW9A 4G1MB 3DUKA 2H01A 4H61A 2H0GA 1WMNA 1EOHA 4ML1A 1SENA 2OTL3 1YF1A 2TRXA 3O8YA 4IPBA 3WDGB 1XVWA 3I6AA 4XTSA 2H70A 4EV2A 2RUFA 1SU9A 4HU7A 3US3A 1TRPA 3EBYA 1V58A 4KUNA 4PTSA 2LJAA 3EB8A 3BBYA 4PX1A 4V2LA 3PYJA 3LSZA 5F05A 4ECIA 4K0NA 1GUMA 1GSSA 2O85A 4K9ZA 2HFDA 3ISOA 1UCJA 1RMSA 2VCWA 5DRVA 2W6JH 4FCJA 1NNVA 2M80A 2K8SA 3QMXA 1A2PA 4EC0A 3QOUA 2XBQA 3FZ4A 2OBIA 2C1YA 3IJEB 1VQ73 4LSOA 2H74A 1CEWI 1ON4A 3ZLPA 3HHVA 5IERA 4X43A 2RSXA 2PN8A 1SARA 4POLA 3F7XA 2YJHA 1MNLA 2JZSA 5CRGA 1TI1A 5C04A 4X2OA 3CCM3 1X1YA 1EGOA 3ZIJA 2VL2C 3FKFA 4X4JA 3VPQA 1FZUA 1KWIA 1OF5A 3U1WA 3D5IA 1PMTA 2FA8A 5AIGA 1NU3A 3ZMKA 1YVBI 7STDA 3DRNA 1F2EA 4KNDA 3QPMA 3TRPA 1IT8A 4KDYA 2RGQA 1JJ22 3AMOA 1QAFA 2CV4A 4LZIA 5DCHA 1GYBA 4PNFA 3WGDA 2ML5A 1UUWB 4N6MA 4ZB8A 2LJKA 4GHOA 2C0FA 2BNGA 3JUNA 4XHMA 3UIWA 1F9MA 2H30A 3DY5A 2O87A 5KN3A 4TXOB 5ECQB 3LTDA 3M3MA 3JCML 2VCQA 3M0FA 3A2VA 1XWCA 4PQ1A 2YJ7A 4HZ2A 3Q19A 2GU1A 1O7MB 2DBCA 2KP2A 3OWSA 3VURA 4Z7XA 3FR3A 2HNLA 1W02A 1FAAA 1BRJA 1RGLA 1GSFA 1BNIA 6GSYA 3ALAA 1BNGA 3SX1A 1QK8A 2YFIB 2P0GA 3KGKA 3GSTA 1OUNA 2O8VB 3WMDA 1W2ZA 3KZTA 1XOAA 1BAOA 1DBYA 1AVLA 2HZEB 1BNJA 1YIJ3 2YWOA 1I2EA 3FSDA 4ZBDA 3K7CA 3DMCA 5GSPA 4GWRA 1O8XA 4HZ4A 3I553 2OBKA 1MWUA 3L4NA 4V2MA 1UC7A 4MJBA 2W04A 4LMIA 1BSCA 2EIOA 2C3NA 5HGRA 1GNEA 1LOWA 4MMMA 4ID0A 5KP4A 3A5WA 4ZL7A 1E3VA 4CPKA 2INXA 5DJLA 4EW5A 1O7UA 3U5RE 1OHPA 4KZ1A 3G713 3OWYA 5D9VA 3BLZA 1SPUA 9RNTA 1Q814 4OFNA 3TOUA 2Z7AA 4FMCA 3X3ZA 2HRNA 18GSA 1MOLA 3CXGA 2FWHA 2QA2A 5CNWA 3O76A 3D4AA 2LYXA 2STDA 4HS1A 2FNOA 1T1VA 2CFDA 1G02A 2ZDJA 20GSA 3FF0A 3HD5A 4LGQA 4RQXA 2C11A 2JU5A 5EL8A 3GNJA 4V1Ap 4WF4A 1BRSA 2BJXA 3EYTA 4NHZA 4ZILA 4X0XA 1E2YA 1XWAA 1RKYA 1RHLA 4FH8A 2H66A 5IMVA 4TR1B 3H8QA 3GRDA 2HSHA 4AGSA 3K9MC 4CJNA 1M1K4 1VQ83 1M9AA 2K3DA 1E97A 2AAWA 5EQLA 3M8CA 3RAZA 3A2XA 3EWLA 3GSSA 2WS2A 1CYVA 1D6ZA 1XOBA 1YGEA 1UGHI 5B6NA 1AQXA 4WXTA 5CF1A 4MJDA 3GKMA 3WGXA 3T0UA 3DWVA 3HVVA 2H73A 4TXOA 4YH2A 2CK3H 4HM7B 4HAAA 1JNQA 2H1AA 5IMDA 2ZNMA 2P38A 1B2ZA 1A2LA 4BTXA 1YNVX 4MF5A 5IQYA 5FHIA 1VRSD 4HOJA 3HJMA 5A0OB 1V98A 4PUFC 1EV9A 3QFAC 5B6MA 3C73A 2KRTA 3OWUA 1OPYA 1PRXA 1LJRA 1NHOA 1BEDA 2MBTA 1AQVA 4WBRD 5DVBA 2HZEA 4IGJA 1U3IA 2J9HA 1A2VA 4HBRA 1K41A 2CHCA 1FGOA 3MSOA 2H1DA 1GY7A 2V6KA 2Z9SA 1XBSA 1SD8A 2ZA4A 1TRSA 2H19A 2W9QA 3A76A 2I9HA 1AR0A 2V1LA 5D73A 3ER7A 4L5LA 1LQGC 3MG1A 4AKYA 3W8JA 1T8EB 3CCU3 3TRXA 1JLWA 1FGMA 2GEXA 1ZYPA 2B5YA 4U13A 3CYNA 4ACSA 3VI5A 3GA4A 2YANA 2YV7A 5ID2B 1MWRA 1TP9A 3HI7A 1TU5A 5BU4A 1O8WA 1T4YA 1W7CA 4NMUA 1N2AA 3D21A 5CREA 1DSBA 1B27A 4MMYB 1N8R4 1RNTA 5A5KA 1HNAA 3EE1A 3ZG0A 2LEGA 2V2GA 2OOVC 2BTOT 3FG1A 3PCRA 5IOWA 2AADA 1STFI 1YHQ3 4NHFA 3L9UA 2XPEA 1JKGB 4R80A 3RNTA 1TRWA 3GZBA 5A4UA 1G6YA 2O3OA 2B7JA 2JACA 3BNBA 1UA5A 3PZWA 1M9BA 2CIUA 1RW1A 2DIYA 5CP1A 2E0QA 1ZYNA 1LRAA 2R4IA 4JRRA 1U87A 4X2HA 2B1LA 1FB6A 2R5GA 4TR1A 1EA2A 4ZB9A 1GY6A 4MJEA 2NBSA 1AQZA 3VSYA 1EP8A 2F3MA 2QC7A 2E2GA 5J4UA 3DGLA 3NBRA 3TUEA 2JDIH 1ST9A 1QVF2 1B2UA 4IS0A 2CZ2A 1I3FA 2XR8B 1Z7PA 3DXOA 2N5AA 4KFFA 4H3UA 4O7HA 1R7HA 3DH2A 3SEDA 4F0BA 3F6FA 1CQSA 2WO0A 1S3RA 1IV9A 1N8QA 1Y25A 3D5GA 4NV2A 1VQM3 1IDPA 3Q6OA 1V57A 3MDKA 5KOWA 1TDIA 4O32A 3KSED 2M72A 3FZ9A 2IUKA 3TKPA 1F8NA 2FUG2 1SK1A 3GKKA 2R0PA 1GOYA 2HMMB 4NREA 1BYEA 2RUEA 3NM7A 4TX4A 2MC8A 4OUQA 1BVIA 1YVSA 2PZVA 4IVFA 1X9WB 5BVBA 1RJOA 1M0UA 4PXOA 3SOYA 1DVDA 2OQEC 2DJJA 4RBNA 1DE3A 5IMFA 1K9M4 4DEJA 1JB5A 1R5AA 2HMLB 1BAYA 2Z77A 3FEUA 4WWUC 3TDGA 1FOHA 3VFIA 4OO5A 2GDRA 4Q5RA 1EEJA 2F5WA 1SYXA 1ROAA 2VL2A 4O3VA 2CVKA 4G2EA 1YDKA 3TCOA 4HEA2 2WCIA 5ID2A 1I0VA 1LNHA 1RN4A 4MPFA 4GSTA 4TKYA 1M2BA 3QAWA 3B7CA 1JLVA 1K0NA 1MD4A 3UOMA 4Q5NA 3KH9A 3SBCA 2FGTA 11GSA 2UUGC 1W01A 3VGNA 2CFKA 5AN1A 3ED3A 2KF3A 5FWGA 4D73B 1JKGA 3F40A 3AGOA 4ZM8A 3LXTA 4EO3A 1T2IA 1T4ZA 2WOFA 1KTEA 4N0ZA 2YFJB 3LTAA 4MF7A 2HRAA 2VCXA 2MYGA 3ERGA 1HU9A 4PGTA 5D82A 1I70A 5I97A 4HQZA 3MHEA 4G9HA 2L4CA 3ROBA 2X8HA 5CO3A 5H5QA 1YQ1A 2JSZA
chains in the Genus database with same CATH topology
3IAS2 5AIXA 2KP1A 4IP1A 3O3TA 2C0DA 3P7XA 5B7CA 1G6WA 2JADA 2OE1A 2V41A 5ECLB 4HUAA 2CT6A 3RDWA 2OE3A 3HJOA 2GVPA 4E8EA 3TB2A 3IV4A 3FYGA 4KH7A 5IO2A 1ZGNA 4WR5A 2IMEA 3EPTA 3DD3A 3L9SA 2R2JA 3KD0A 1UN2A 2A2SA 3CMIA 3FY7A 4RQRA 1QUWA 4K2XA 1G7OA 1ABAA 2VM2A 1TI3A 14GSA 5COHA 1K3LA 2B5EA 2EIRA 4PQHA 16GSA 1HYUA 2X4AA 2HRKA 3U6VA 1NM3A 5ECSA 2GSSA 4GLTA 4AJ7A 4LA1A 4HQSA 3CRTA 1NSWA 4K7IA 4KX4A 2YOIA 3LQ7A 3QCPA 1ZOFA 2AUVA 1NHYA 5J3RA 4OFTA 1X5DA 2PBJA 2IMKA 4BWSA 1TTZA 1ERVA 2PU9C 1OC8A 3HJPA 2F8AA 1ERWA 3C8EA 2IL3A 4RI6A 5J41A 1JZWA 4JZQA 4D73A 4AJ8A 3F8UA 1HD2A 3H4KA 4BVXB 1C72A 1AUCA 2LKUA 1USBA 1MDKA 2MMAA 4WR4A 3C7MA 3GL3A 3J7Yk 1V40A 2LQOA 1JZOA 5DBQA 5JCWA 2DLXA 1SL2B 1M2DA 1ERUA 3TOTA 1A2JA 1ZYEA 2YWMA 1XZOA 3APQA 5GAPD 3TJKA 1THXA 3DVXA 3G9BA 2DJ3A 4N10A 5FT3A 2REMA 5BRTA 1J9BA 4P3YB 19GSA 2R4VA 3D4MA 4NXIA 3EU4A 5JCGA 4MNNA 1NW2A 1O85A 2MZCA 1BQ7A 2YP6A 4IBPA 3IRAA 3IA1A 4IQAA 3ZTLA 2D2ZA 2H6XA 2OJLA 3BOAA 4IJIA 1ZZYA 2LRCA 4FIWA 5AGYA 2GT5A 2GZZA 2PGTA 2QGVA 4GCIA 4Q5FA 3HA9A 3GKXA 1ILOA 3GKNA 1FVJA 3D22A 3C1RA 1OC9B 5D93A 3E0UA 3GHAA 1OKDA 1WE0A 5IMZA 1R4WA 4MP4A 1RK4A 5F0GA 1GSQA 5H5RA 1WJKA 3NOFA 2CA8A 2IN3A 3CSHA 5AIVA 4MZCA 2BMXA 4LMWA 5F8BA 2MMZA 4BPYA 1DE1A 1KNGA 3IK7A 1JZRA 2RM6A 1B8XA 2FY6A 3LFLA 2VOCA 5HR3A 5INYA 3VK9A 1XW9A 4ZBAA 5D96A 1T7PB 1PN0A 2DMLA 2CAIA 4FO5A 4BVXA 6GSTA 2GT6A 3N9JA 3PPUA 3QAGA 1O81A 2GTUA 1KBNA 1Q4JA 1E6BA 2GQMA 13GSA 5ENUA 1WPIA 1MD3A 2CAQA 3FRCA 5HFGA 4E8HA 2PPTA 3J7Yb 5HR0A 1K3YA 2PVOC 1AQWA 1SJ6A 4EIPA 2OKAA 3I9V2 5ELGA 3MWHA 5B8AA 4G19A 4KAEA 3UARA 1F6MC 4WBJA 4AF2A 2KLXA 2QKEA 4HJMA 3F63A 3GFKA 3TJFA 3C71A 4ZXGA 1B4QA 4LL1B 4I8BA 2LS5A 5D8IA 4O92A 1YF0A 4POKA 4L8EA 3ZRDA 4KDUA 3H79A 1EV4A 1GWCA 5DALB 4QL7A 4ISDA 2HRFA 4N0VA 5E4WA 3MNGA 1ZMAA 1GLPA 4QQ7A 2OADA 3IAM2 3WGEA 3M8NA 5CRWA 1OC9A 4XCSA 3TRQA 6GSXA 4N30A 2X99A 3GH9A 5IOXA 4KCAA 5G30A 1XXUA 1M2AA 4NAXA 2VCTA 3LXZA 4I2UA 2N5FA 5HR1A 2L59A 1MDJA 1X5CA 4ZBBA 2K9FA 4HI7A 3IOSA 2HI7A 5DJMA 4MH2A 7GSSA 2A4VA 4Z2UA 2V32A 5G31A 2ZUPA 4JE1A 4IJ3A 2C8UA 2PERA 3EMXA 3L0HA 1QMVA 3HZ8A 2YZHA 4AJ6A 1ZL9A 2C0GA 3DKSA 4GQFA 1VF1A 1TRUA 4OD7A 3PINA 1WRYA 3RPNA 4HU9A 3QFBC 2ON7A 5HQPA 4CHSA 1X9SB 2P5RA 3VPTA 1ZYQB 1JFUA 4DSSB 4L0WA 2DJ0A 5D9WA 2DSAA 1TK0B 4H86A 3VI7A 1SJIA 4BL7B 2FWGA 3GL5A 3QDNA 4KE3A 3W6GA 3FZ5A 4TW5A 3GIXA 4TOPA 4F2IA 4A5PA 1YZXA 3LW9A 2F51A 2AYTA 3IC4A 3F4TA 2H1BA 3RPPA 2EC4A 2B5XA 4Z2TA 1YY7A 1A23A 3D6IA 4MCUA 5KN0A 12GSA 5DALA 2LTKA 2YWIA 1V2AA 4MDCA 1GUKA 2KUCA 4OWYA 1HQOA 1LBKA 1PN9A 3M1GA 3R3EA 1TK8B 5ECMB 3I43A 3VWUA 3L78A 2GLRA 3FW2A 2VLUA 2XBIA 2IJYA 4ECJA 4V1Ag 4IHUA 3DYRA 4TR4A 4KF9A 4YKFA 5ELAA 2ZCTA 1YKAA 3GN3A 4KGIA 2E7PA 1THOA 1I5GA 3KP9A 2CVDA 4DSRA 3D5JA 3MIXA 5EVOA 5HR2A 1X9MB 3ZMLA 3UBKA 4YQVA 1M99A 4KA0A 2JSYA 4MJAA 2XPDA 4NHWA 2A2PA 4EDYA 2GZYA 4GSSA 3UL3A 4K5RA 2HT9A 8GSSA 2F9SA 2VLVA 2IY2A 4ML6A 4GRFA 2WDUA 2IIYA 3KZQA 4EIQA 4KW6A 2YNXA 1PSQA 4BWQA 4DSSA 3QAVA 1BG5A 1H4OA 3CBUA 3EE2A 1O6JA 5F06A 1SKRB 4EVMA 4CDOA 4BL7A 1Z7RA 1PA3A 4QL9A 1A0RP 2IWTA 2C0EA 3IK9A 1TOFA 2H71A 5LNKe 2LQQA 2VD1A 1SL0B 2WFCA 3BD2A 3ZYWA 4XS1A 3PR8A 1YEXA 4O5RA 3DMLA 4I97A 2YWNA 3TKSC 1FB0A 1RQMA 2A2RA 2P5QA 3KTLA 1GTBA 4TR0A 5IPHA 1GULA 4BA7A 4GTUA 4USSA 5IIZA 2B3SA 3EURA 2B1KA 1VGLA 4XS4B 2FGXA 5ECOB 5G1KA 4N11A 2VL3A 1B4PA 4IKHA 2LRNA 3F3QA 4MZBA 5D9XA 1H75A 1Q98A 3LG6A 4XRAA 1T3BA 5KN1A 5DQSA 5L71A 2DKHA 5GAND 5IPGA 2C3QA 1VF2A 1XCCA 3D4TA 4HJ2A 2KOKA 1B48A 1OYJA 2KHPA 1R26A 1URMA 4PURA 5ABRA 4OCFA 1FG4A 4KSMA 2HE3A 2DJKA 5CRHA 3ZIVA 2H75A 1Y6EA 2LV3A 4TVEA 2X64A 2L4QA 3D0ZA 1O73A 1VF4A 5J9CA 4FYCA 1Z6MA 2DKIA 5ECIB 5G5FA 5IMAA 2H0HA 2R0CA 2YZUA 3ME7A 4RI7A 3CSIA 3TKSE 4JR6A 1K0MA 4KDXA 1N8JA 2G0FA 3FHKA 4L5OA 4I6XA 4EUYA 1SD9A 2O7KA 5KOXA 3FR6A 2B7KA 4ULXA 3E3EA 1SYRA 3LEFA 3DEXA 4X1UA 4TR3A 1XWKA 1Z5YE 4ECCA 2H72A 5DQYA 3TJJA 2LNTA 3TKRA 1TU7A 1S3AA 1XVQA 6GSWA 1DUGA 3KIJA 5JWOB 4K2DA 2H1GA 1EP7A 3HYPA 2MBSA 1ZCPA 4MH3A 1F3AA 3VWVA 4TRXA 4XS4A 4MF6A 3KP8A 3G7IA 5H5SA 4EE0A 1GTUA 5HFIA 2QA1A 1LU4A 1ERTA 5EY6A 4OO4A 3IR4A 1Z6NA 2XHFA 2ALBA 5LD0A 1Z3EA 3GX8A 2ON5A 3APOA 2JZTA 2TRCP 3IDVA 3E9JB 4ILFA 2DIZA 1TKDB 1GL8A 3M9KA 4PQIA 4PNGA 1AIUA 2HSYA 3QR6A 3G7YA 3EMPA 3DGQA 4WF5A 4NV5A 6GSSA 3RHCA 3HZ4A 4JEDA 4BVYB 3HKRA 4POBA 2CZ3A 3OR5A 3F4RA 1OE8A 3CTFA 2GQKA 4MZWA 4MJCA 4KCEA 1SK2A 4FYBA 1K0BA 3A5IA 3IXRA 2M46A 3LJRA 1F3BA 2WGRA 1F37A 2CQ9A 4Z2RA 4PUAA 1W89A 2H0IA 1FHEA 1W4VA 3BCKA 3LYPA 3BCIA 1V9WA 4ZB6A 2GGTA 3KCMA 2FHEA 5C00A 2IFQB 3LORA 1SKWB 4EKZA 5A4WA 4GXZA 3M9JA 2X8GA 5KN2A 2YV9A 4FQUA 4K0GA 2IMDA 2K6VA 1Z9HA 3PH9A 4I2TA 2I81A 2WB9A 3AY8A 3IHQA 4XRDA 2PUKC 5F07A 2K8VA 1K0OA 3TJGA 3F6DA 5EPFA 1U88A 2ES7A 1AAZA 4IP6A 4CW9A 1GH2A 1HNBA 1WWJA 2CX4A 2PWJA 1S3DA 4MLYA 3MSZA 3ERFA 2VCZA 2DJ2A 3UVHA 3HY2A 3WYWA 2VCVA 5ECNB 1J0FA 2GS3A 3ERWA 4J56E 1PGTA 2WRTA 4HDEA 1MEKA 5BMUA 4ZL9A 2VAFA 3APSA 2NVLA 4BVYA 3TKSA 3W8SA 5GSSA 4TXVA 2C80A 5ECKB 3IPZA 2FLSA 1FO5A 3GMFA 4XS6A 2PVQA 10GSA 4L0UA 3VWWA 1KEBA 3GRXA 3WD6A 4MA9A 1JZDA 4CY8A 3UVTA 1EZKA 2LUSA 3GUSA 2DMMA 3FZAA 1AXDA 4DVCA 1PL2A 2DC5A 2DJ1A 4POMA 5CYYA 3P8WA 3QD9A 3ZREA 2TIRA 2FD3A 1BX9A 2YN1A 4GF0A 2X8CA 1MTCA 2IFQA 5G5EA 1EOGA 2N5BA 3NIVA 1XW6A 3TJBA 6GSVA 2RIIA 1CQHA 1SL1B 4YQMA 4LL4B 4O5UA 5B8BA 5DAKB 3C1SA 1HNCA 5LCZA 1BJXA 2HZFA 3IC8A 3DXBA 1XPVA 1ML6A 3EINA 4WETA 2GZPA 4WKWA 4O5QA 4OMVA 2WZ9A 3ZITA 4LLRA 1B9XC 1OVNA 3H1NA 3A3TA 1SJZA 4DSQA 5JCUA 4J2FA 3WT1A 1VF3A 2NTOA 2YPMA 3PGTA 1PQNA 1YKCA 1PL1A 2FWEA 5G2ZA 3F9UA 2JL4A 1X5EA 2C4JA 3MYDA 1AC1A 1YEPA 2C3TA 3TGZA 3EC3A 2LRTA 4IW9A 1GTAA 3KTBA 3O6TA 2IMFA 3V1WA 3K8NA 4JBBA 3KH7A 3MAKA 2LNSA 2YCDA 2OACA 1A2MA 3DVWA 3LGCA 1GNWA 5ECRB 2QSIA 2G2QA 4K7NA 1A0FA 2OA7A 1GSYA 1GRXA 1PX6A 1GTIA 2V1MA 4KB3A 1OKTA 1UVZA 2VIMA 1OC3A 3UEMA 3GH6A 2GSRA 5E59A 4Q5QA 2WJUA 1A8LA 1QGVA 5IMCA 2H6ZA 2I4AA 2VL9A 1XIYA 1WIKA 2R37A 4EXJA 3NZNA 2GSTA 2MMNA 3H93A 5AISA 1WOUA 5J9BA 1QXHA 1QFNA 4JR4A 2HLSA 1OAZA 2F8FA 2VLTA 5DAKA 2GSQA 3ZFBA 3A2WA 1YQ1A 17GSA 5CAXA 3ZFLA 3GURA 2CVBA 5KEJA 3GX0A 1GSEA 1G0TA 1A8YA 3KJYA 1B9YC 1MDIA 4YQUA 1PKWA 3RHBA 4EL1A 3TKQA 5D9TA 1I9DA 4CY6A 3HCZA 4G0LA 9GSSA 4MK3A 2RM5A 3F0IA 1TK5B 3Q74A 1OE7A 5G1LA 1PKZA 2I1UA 5IM9A 4V2NA 2R3XA 4ICYA 3VWXA 3S9FA 1EGRA 1TU8A 3GTUB 1TW9A 4F82A 1S3CA 3EVIA 4TN8A 2L5LA 2FWFA 2IPAA 1R5PA 2AB6A 4K5SA 2VO4A 2E2MA 1ACVA 1PX7A 2OE0A 3CSJA 3RBTA 4F9ZA 3P2AA 3WT2A 5GZZB 2P31A 1IYIA 4GSNA 3CRUA 4EDZA 3GV1A 4FYUA 4ZIJA 2H8LA 2O89A 2H76A 3DIEA 2L5OA 2AV4A 1SKSB 2EIQA 3HXSA 5J5NA 1CQGA 1TRVA 4YAVA 1K0AA 4IQ1A 1WMJA 5GSTA 2XC2A 4MPGA 4ZL8A 1M7TA 1XWGA 2IYJA 3KMNA 2LJRA 1FVKA 3P90A 1U6TA 3KEBA 3N5OA 3UMAA 2UZ8A 3FR9A 4NPBA 2J23A 4F0CA 5DCGA 2L6DA 3KM6A 2L6CA 1IYHA 5JWRB 2HXKA 2AJQB 1K3OA 1EWXA 3ZL5A 1FOVA 1JHBA 2VM1A 5IO0A 3BJ5A 4YAPA 4J57E 4EF0A 2IMIA 3IBHA 4K1FA 1GUHA 4OCEA 2LSTA 1J08A 2A4HA 4JU5A 2I3YA 3LYKA 2WULA 4ECBA 5HFKA 4XIHA 1GSDA 2FA4A 2CX3A 3KXOA 4WEYA 2VUPA 3I69A 3VLNA 2RLIA 3UBLA 3UAPA 2HSMA 4IELA 2B6MA 1U3AA 1YJ6A 3GTUA 2GQLA 3UJ1A 3Q18A 1FW1A 3IHGA 1QQ2A 3ZVJD 2AHEA 2R6KA 1TXXA 3IE3A 4G0IA 1GSUA 4I5QA 1TJDA 2L57A 4GQCA 2MMOA 1A24A 4IN0A 2HYXA 4K6XA 4MABA 1K0DA 2JZRA 1T00A 3SWLA 6GSUA 3CTGA 4G0KA 5ECHB 2V6OA 1G7EA 3ZZXA 1EEMA 4NWYA 4KSOA 3F4SA 1PD21 4LMVA 1XW5A 3GYKA 1XFLA 2R0GA 3L9VA 2NDOA 5ECPB 5A4VA 1SK0A 3KMOA 4YKGA 3EU3A 2PMTA 3G7JA 5CRDA 1GP1A 3F3RA 1X0RA 5JWQB 2NPBA 2VD0A 1AW9A 3FK8A 3ZVJA 3HVXA 2FCHA 4G10A 2K18A 3ME8A 4K8MA 3HVSA 4F03A 5DDLA 4OFMA 3HDCA 22GSA 1GLQA 1XWBA 2X49A 3R2QA 1DE2A 1WP0A 3FMWA 1K0CA 3LWAA 2H6YA 4K7OA 2H01A 2H0GA 1EOHA 4ML1A 1SENA 1YF1A 2TRXA 1XVWA 3I6AA 4XTSA 2H70A 2RUFA 1SU9A 4HU7A 3US3A 1V58A 4KUNA 4PTSA 2LJAA 4V2LA 3BBYA 4PX1A 5F05A 4ECIA 3LSZA 4K0NA 1GUMA 1GSSA 2O85A 4K9ZA 2HFDA 3ISOA 2VCWA 2M80A 2K8SA 3QMXA 4EC0A 3QOUA 2XBQA 3FZ4A 2OBIA 2C1YA 2H74A 1ON4A 3ZLPA 3HHVA 4X43A 2PN8A 4POLA 2YJHA 2JZSA 5CRGA 1TI1A 5C04A 1EGOA 3ZIJA 2VL2C 3FKFA 4X4JA 3VPQA 1PMTA 2FA8A 3ZMKA 3DRNA 1F2EA 4KNDA 3QPMA 3TRPA 4KDYA 2CV4A 5DCHA 4PNFA 3WGDA 4ZB8A 2LJKA 2C0FA 4XHMA 3UIWA 1F9MA 2H30A 2O87A 5KN3A 4TXOB 5ECQB 3M3MA 3JCML 2VCQA 3M0FA 3A2VA 1XWCA 4PQ1A 2YJ7A 4HZ2A 3Q19A 2DBCA 2KP2A 3VURA 4Z7XA 3FR3A 2HNLA 1FAAA 1GSFA 6GSYA 2P0GA 1QK8A 3KGKA 3GSTA 2O8VB 1XOAA 1DBYA 2HZEB 2YWOA 4ZBDA 4GWRA 1O8XA 4HZ4A 2OBKA 3L4NA 4V2MA 1UC7A 4MJBA 2EIOA 2C3NA 1GNEA 4MMMA 4ID0A 3A5WA 4ZL7A 5DJLA 1O7UA 3U5RE 5D9VA 4OFNA 3TOUA 2HRNA 18GSA 3CXGA 2FWHA 2QA2A 5CNWA 3O76A 4HS1A 2FNOA 1T1VA 20GSA 3HD5A 4RQXA 2JU5A 5EL8A 3GNJA 4V1Ap 4WF4A 2BJXA 3EYTA 4NHZA 4ZILA 4X0XA 1E2YA 1XWAA 4FH8A 2H66A 5IMVA 4TR1B 3H8QA 2HSHA 4AGSA 1M9AA 2AAWA 3RAZA 3A2XA 3EWLA 3GSSA 2WS2A 1XOBA 5B6NA 1AQXA 4WXTA 3GKMA 3WGXA 3DWVA 3HVVA 2H73A 4TXOA 4YH2A 2H1AA 5IMDA 2ZNMA 1A2LA 4MF5A 5IQYA 5FHIA 1VRSD 4HOJA 3HJMA 1V98A 4PUFC 1EV9A 3QFAC 5B6MA 3C73A 1PRXA 1LJRA 1NHOA 1BEDA 2MBTA 1AQVA 4WBRD 5DVBA 2HZEA 4IGJA 1U3IA 2J9HA 2H1DA 2V6KA 2Z9SA 1XBSA 1SD8A 1TRSA 2H19A 2I9HA 5D73A 4L5LA 3W8JA 1T8EB 3TRXA 1JLWA 1ZYPA 2B5YA 3CYNA 4ACSA 3VI5A 3GA4A 2YANA 2YV7A 5ID2B 1TP9A 1O8WA 1T4YA 4NMUA 1N2AA 3D21A 5CREA 1DSBA 5A5KA 1HNAA 2LEGA 2V2GA 2BTOT 5IOWA 3L9UA 2XPEA 1TRWA 5A4UA 1G6YA 2B7JA 2JACA 1UA5A 1M9BA 1RW1A 2DIYA 5CP1A 2E0QA 1ZYNA 4JRRA 1U87A 2B1LA 1FB6A 2R5GA 4TR1A 4ZB9A 4MJEA 2NBSA 1EP8A 2F3MA 2QC7A 2E2GA 5J4UA 3TUEA 1ST9A 4IS0A 2CZ2A 1Z7PA 2N5AA 4O7HA 1R7HA 4F0BA 3F6FA 1Y25A 4NV2A 3Q6OA 1V57A 3MDKA 5KOWA 1TDIA 4O32A 2M72A 3FZ9A 3TKPA 2FUG2 1SK1A 3GKKA 2R0PA 1BYEA 2RUEA 4IVFA 1X9WB 1M0UA 4PXOA 2DJJA 5IMFA 4DEJA 1R5AA 1BAYA 3FEUA 1FOHA 3TDGA 3VFIA 4OO5A 2GDRA 4Q5RA 1EEJA 1SYXA 2VL2A 2CVKA 4G2EA 1YDKA 3TCOA 4HEA2 2WCIA 5ID2A 4MPFA 4GSTA 4TKYA 1M2BA 3QAWA 1JLVA 1K0NA 1MD4A 3UOMA 4Q5NA 3KH9A 3SBCA 11GSA 5AN1A 3ED3A 5FWGA 4D73B 3LXTA 4EO3A 1T4ZA 1KTEA 4N0ZA 4MF7A 2HRAA 2VCXA 2MYGA 3ERGA 4PGTA 4HQZA 4G9HA 2L4CA 2X8HA 5CO3A 5H5QA 4RUVA 2JSZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IAS 2;  5AIX A;  2KP1 A;  4IP1 A;  3O3T A;  2C0D A;  3P7X A;  5B7C A;  1G6W A;  2JAD A;  2OE1 A;  2V41 A;  5ECL B;  4HUA A;  2CT6 A;  3RDW A;  2OE3 A;  3HJO A;  2GVP A;  4E8E A;  3TB2 A;  3IV4 A;  3FYG A;  4KH7 A;  5IO2 A;  1ZGN A;  4WR5 A;  2IME A;  3DD3 A;  3L9S A;  2R2J A;  3KD0 A;  1UN2 A;  2A2S A;  3CMI A;  3FY7 A;  4RQR A;  1QUW A;  1G7O A;  1ABA A;  2VM2 A;  1TI3 A;  14GS A;  5COH A;  1K3L A;  2B5E A;  2EIR A;  4PQH A;  16GS A;  1HYU A;  3U6V A;  1NM3 A;  5ECS A;  2GSS A;  4GLT A;  4AJ7 A;  4LA1 A;  4HQS A;  3CRT A;  1NSW A;  4K7I A;  4KX4 A;  2YOI A;  3LQ7 A;  3QCP A;  1ZOF A;  2AUV A;  1NHY A;  5J3R A;  4OFT A;  1X5D A;  2PBJ A;  2IMK A;  4BWS A;  1TTZ A;  1ERV A;  2PU9 C;  1OC8 A;  3HJP A;  2F8A A;  1ERW A;  3C8E A;  2IL3 A;  4RI6 A;  5J41 A;  1JZW A;  4JZQ A;  4D73 A;  4AJ8 A;  3F8U A;  1HD2 A;  3H4K A;  1C72 A;  1AUC A;  2LKU A;  1USB A;  1MDK A;  2MMA A;  4WR4 A;  3C7M A;  3GL3 A;  3J7Y k;  1V40 A;  2LQO A;  1JZO A;  5DBQ A;  5JCW A;  2DLX A;  1SL2 B;  1M2D A;  1ERU A;  3TOT A;  1A2J A;  1ZYE A;  2YWM A;  1XZO A;  3APQ A;  5GAP D;  3TJK A;  1THX A;  3DVX A;  3G9B A;  2DJ3 A;  4N10 A;  5FT3 A;  2REM A;  1J9B A;  4P3Y B;  19GS A;  2R4V A;  3D4M A;  4NXI A;  3EU4 A;  5JCG A;  1NW2 A;  1O85 A;  2MZC A;  1BQ7 A;  2YP6 A;  4IBP A;  3IRA A;  3IA1 A;  4IQA A;  3ZTL A;  2D2Z A;  2H6X A;  2OJL A;  3BOA A;  4IJI A;  1ZZY A;  2LRC A;  4FIW A;  5AGY A;  2GT5 A;  2GZZ A;  2PGT A;  2QGV A;  4GCI A;  4Q5F A;  3HA9 A;  3GKX A;  1ILO A;  3GKN A;  1FVJ A;  3D22 A;  3C1R A;  1OC9 B;  5D93 A;  3E0U A;  3GHA A;  1OKD A;  1WE0 A;  5IMZ A;  1R4W A;  4MP4 A;  1RK4 A;  5F0G A;  1GSQ A;  5H5R A;  1WJK A;  3NOF A;  2CA8 A;  2IN3 A;  3CSH A;  5AIV A;  4MZC A;  2BMX A;  4LMW A;  5F8B A;  2MMZ A;  4BPY A;  1DE1 A;  1KNG A;  3IK7 A;  1JZR A;  2RM6 A;  1B8X A;  2FY6 A;  3LFL A;  2VOC A;  5HR3 A;  5INY A;  3VK9 A;  1XW9 A;  4ZBA A;  5D96 A;  1T7P B;  2DML A;  2CAI A;  4FO5 A;  4BVX A;  6GST A;  2GT6 A;  3N9J A;  3QAG A;  1O81 A;  2GTU A;  1KBN A;  1Q4J A;  1E6B A;  2GQM A;  13GS A;  5ENU A;  1WPI A;  1MD3 A;  2CAQ A;  3FRC A;  5HFG A;  4E8H A;  2PPT A;  3J7Y b;  5HR0 A;  1K3Y A;  2PVO C;  1AQW A;  1SJ6 A;  2OKA A;  3I9V 2;  5ELG A;  3MWH A;  5B8A A;  4G19 A;  4KAE A;  3UAR A;  1F6M C;  4WBJ A;  4AF2 A;  2KLX A;  2QKE A;  4HJM A;  3F63 A;  3GFK A;  3TJF A;  3C71 A;  4ZXG A;  1B4Q A;  4LL1 B;  4I8B A;  2LS5 A;  5D8I A;  4O92 A;  1YF0 A;  4POK A;  4L8E A;  3ZRD A;  4KDU A;  3H79 A;  1EV4 A;  1GWC A;  5DAL B;  4QL7 A;  4ISD A;  2HRF A;  4N0V A;  5E4W A;  3MNG A;  1ZMA A;  1GLP A;  4QQ7 A;  2OAD A;  3IAM 2;  3WGE A;  3M8N A;  5CRW A;  1OC9 A;  4XCS A;  3TRQ A;  6GSX A;  4N30 A;  2X99 A;  3GH9 A;  5IOX A;  4KCA A;  5G30 A;  1XXU A;  1M2A A;  4NAX A;  2VCT A;  3LXZ A;  4I2U A;  2N5F A;  5HR1 A;  2L59 A;  1MDJ A;  1X5C A;  4ZBB A;  2K9F A;  4HI7 A;  3IOS A;  2HI7 A;  5DJM A;  4MH2 A;  7GSS A;  2A4V A;  2V32 A;  5G31 A;  2ZUP A;  4JE1 A;  4IJ3 A;  2C8U A;  2PER A;  3EMX A;  3L0H A;  1QMV A;  3HZ8 A;  2YZH A;  4AJ6 A;  1ZL9 A;  2C0G A;  3DKS A;  4GQF A;  1VF1 A;  1TRU A;  4OD7 A;  3PIN A;  1WRY A;  3RPN A;  4HU9 A;  3QFB C;  2ON7 A;  5HQP A;  4CHS A;  1X9S B;  2P5R A;  3VPT A;  1ZYQ B;  1JFU A;  4DSS B;  4L0W A;  2DJ0 A;  5D9W A;  2DSA A;  1TK0 B;  4H86 A;  3VI7 A;  1SJI A;  2FWG A;  3GL5 A;  3QDN A;  4KE3 A;  3W6G A;  3FZ5 A;  4TW5 A;  3GIX A;  4TOP A;  4F2I A;  1YZX A;  2F51 A;  2AYT A;  3IC4 A;  3F4T A;  2H1B A;  3RPP A;  2EC4 A;  2B5X A;  1YY7 A;  1A23 A;  3D6I A;  4MCU A;  5KN0 A;  12GS A;  5DAL A;  2LTK A;  2YWI A;  1V2A A;  4MDC A;  1GUK A;  2KUC A;  4OWY A;  1HQO A;  1LBK A;  1PN9 A;  3M1G A;  1TK8 B;  5ECM B;  3I43 A;  3VWU A;  3L78 A;  2GLR A;  3FW2 A;  2VLU A;  2XBI A;  2IJY A;  4ECJ A;  4V1A g;  4IHU A;  3DYR A;  4TR4 A;  5ELA A;  2ZCT A;  1YKA A;  3GN3 A;  4KGI A;  2E7P A;  1THO A;  1I5G A;  3KP9 A;  2CVD A;  4DSR A;  3D5J A;  5EVO A;  5HR2 A;  1X9M B;  3ZML A;  3UBK A;  4YQV A;  1M99 A;  4KA0 A;  2JSY A;  4MJA A;  2XPD A;  4NHW A;  4EDY A;  2GZY A;  4GSS A;  3UL3 A;  2HT9 A;  8GSS A;  2F9S A;  2VLV A;  2IY2 A;  4ML6 A;  4GRF A;  2WDU A;  2IIY A;  3KZQ A;  4KW6 A;  2YNX A;  1PSQ A;  4BWQ A;  4DSS A;  3QAV A;  1BG5 A;  1H4O A;  3CBU A;  3EE2 A;  1O6J A;  5F06 A;  1SKR B;  4EVM A;  4CDO A;  4BL7 A;  1Z7R A;  1PA3 A;  4QL9 A;  1A0R P;  2IWT A;  2C0E A;  3IK9 A;  1TOF A;  2H71 A;  5LNK e;  2LQQ A;  2VD1 A;  1SL0 B;  2WFC A;  3BD2 A;  3ZYW A;  4XS1 A;  3PR8 A;  1YEX A;  4O5R A;  3DML A;  4I97 A;  2YWN A;  3TKS C;  1FB0 A;  1RQM A;  2A2R A;  2P5Q A;  3KTL A;  1GTB A;  4TR0 A;  5IPH A;  1GUL A;  4BA7 A;  4GTU A;  5IIZ A;  2B3S A;  3EUR A;  2B1K A;  1VGL A;  2FGX A;  4XS4 B;  5ECO B;  5G1K A;  4N11 A;  2VL3 A;  1B4P A;  4IKH A;  2LRN A;  3F3Q A;  4MZB A;  5D9X A;  1H75 A;  1Q98 A;  3LG6 A;  4XRA A;  1T3B A;  5KN1 A;  5DQS A;  5L71 A;  5GAN D;  5IPG A;  2C3Q A;  1VF2 A;  1XCC A;  3D4T A;  4HJ2 A;  2KOK A;  1B48 A;  1OYJ A;  2KHP A;  1R26 A;  1URM A;  4PUR A;  5ABR A;  4OCF A;  1FG4 A;  4KSM A;  2HE3 A;  2DJK A;  5CRH A;  3ZIV A;  2H75 A;  1Y6E A;  2LV3 A;  4TVE A;  2X64 A;  2L4Q A;  3D0Z A;  1O73 A;  1VF4 A;  5J9C A;  4FYC A;  1Z6M A;  5ECI B;  5G5F A;  5IMA A;  2H0H A;  2YZU A;  3ME7 A;  4RI7 A;  3CSI A;  3TKS E;  4JR6 A;  1K0M A;  4KDX A;  1N8J A;  2G0F A;  3FHK A;  4L5O A;  4I6X A;  4EUY A;  1SD9 A;  2O7K A;  3FR6 A;  2B7K A;  4ULX A;  3E3E A;  1SYR A;  3LEF A;  3DEX A;  4X1U A;  4TR3 A;  1XWK A;  1Z5Y E;  4ECC A;  2H72 A;  5DQY A;  3TJJ A;  2LNT A;  3TKR A;  1TU7 A;  1S3A A;  1XVQ A;  6GSW A;  1DUG A;  3KIJ A;  5JWO B;  4K2D A;  2H1G A;  1EP7 A;  3HYP A;  2MBS A;  1ZCP A;  4MH3 A;  1F3A A;  3VWV A;  4TRX A;  4XS4 A;  4MF6 A;  3KP8 A;  3G7I A;  5H5S A;  4EE0 A;  1GTU A;  5HFI A;  1LU4 A;  1ERT A;  5EY6 A;  4OO4 A;  3IR4 A;  1Z6N A;  2XHF A;  2ALB A;  5LD0 A;  1Z3E A;  3GX8 A;  2ON5 A;  3APO A;  2JZT A;  2TRC P;  3IDV A;  3E9J B;  4ILF A;  2DIZ A;  1TKD B;  1GL8 A;  3M9K A;  4PQI A;  4PNG A;  1AIU A;  2HSY A;  3QR6 A;  3G7Y A;  3EMP A;  3DGQ A;  4WF5 A;  4NV5 A;  6GSS A;  3RHC A;  3HZ4 A;  4JED A;  3HKR A;  4POB A;  2CZ3 A;  3OR5 A;  3F4R A;  1OE8 A;  3CTF A;  2GQK A;  4MZW A;  4MJC A;  4KCE A;  1SK2 A;  4FYB A;  1K0B A;  3IXR A;  2M46 A;  3LJR A;  1F3B A;  2WGR A;  1F37 A;  2CQ9 A;  4PUA A;  1W89 A;  2H0I A;  1FHE A;  1W4V A;  3BCK A;  3LYP A;  3BCI A;  1V9W A;  4ZB6 A;  2GGT A;  3KCM A;  2FHE A;  5C00 A;  2IFQ B;  3LOR A;  1SKW B;  4EKZ A;  5A4W A;  4GXZ A;  3M9J A;  2X8G A;  5KN2 A;  2YV9 A;  4K0G A;  2IMD A;  2K6V A;  1Z9H A;  3PH9 A;  4I2T A;  2I81 A;  2WB9 A;  3AY8 A;  3IHQ A;  4XRD A;  2PUK C;  5F07 A;  2K8V A;  1K0O A;  3TJG A;  3F6D A;  5EPF A;  1U88 A;  2ES7 A;  1AAZ A;  4IP6 A;  4CW9 A;  1GH2 A;  1HNB A;  1WWJ A;  2CX4 A;  2PWJ A;  1S3D A;  4MLY A;  3MSZ A;  3ERF A;  2VCZ A;  2DJ2 A;  3UVH A;  3HY2 A;  3WYW A;  2VCV A;  5ECN B;  1J0F A;  2GS3 A;  3ERW A;  4J56 E;  1PGT A;  2WRT A;  4HDE A;  1MEK A;  4ZL9 A;  2VAF A;  3APS A;  2NVL A;  4BVY A;  3TKS A;  3W8S A;  5GSS A;  4TXV A;  2C80 A;  5ECK B;  3IPZ A;  2FLS A;  1FO5 A;  3GMF A;  4XS6 A;  2PVQ A;  10GS A;  4L0U A;  3VWW A;  1KEB A;  3GRX A;  3WD6 A;  4MA9 A;  1JZD A;  3UVT A;  1EZK A;  2LUS A;  3GUS A;  2DMM A;  3FZA A;  1AXD A;  4DVC A;  1PL2 A;  2DC5 A;  2DJ1 A;  4POM A;  5CYY A;  3P8W A;  3QD9 A;  3ZRE A;  2TIR A;  2FD3 A;  1BX9 A;  2YN1 A;  4GF0 A;  2X8C A;  1MTC A;  2IFQ A;  5G5E A;  1EOG A;  2N5B A;  3NIV A;  1XW6 A;  3TJB A;  6GSV A;  2RII A;  1CQH A;  1SL1 B;  4YQM A;  4LL4 B;  5B8B A;  5DAK B;  3C1S A;  1HNC A;  5LCZ A;  1BJX A;  2HZF A;  3DXB A;  1XPV A;  1ML6 A;  3EIN A;  4WET A;  2GZP A;  4WKW A;  4OMV A;  2WZ9 A;  3ZIT A;  4LLR A;  1B9X C;  1OVN A;  3H1N A;  3A3T A;  1SJZ A;  4DSQ A;  5JCU A;  4J2F A;  3WT1 A;  1VF3 A;  2NTO A;  2YPM A;  3PGT A;  1PQN A;  1YKC A;  1PL1 A;  2FWE A;  5G2Z A;  3F9U A;  2JL4 A;  1X5E A;  2C4J A;  1AC1 A;  1YEP A;  2C3T A;  3TGZ A;  3EC3 A;  2LRT A;  4IW9 A;  1GTA A;  3KTB A;  3O6T A;  2IMF A;  3V1W A;  3K8N A;  4JBB A;  3KH7 A;  3MAK A;  2LNS A;  2YCD A;  2OAC A;  1A2M A;  3DVW A;  3LGC A;  1GNW A;  5ECR B;  2QSI A;  2G2Q A;  4K7N A;  1A0F A;  2OA7 A;  1GSY A;  1GRX A;  1PX6 A;  1GTI A;  2V1M A;  4KB3 A;  1OKT A;  1UVZ A;  2VIM A;  1OC3 A;  3UEM A;  3GH6 A;  2GSR A;  5E59 A;  4Q5Q A;  2WJU A;  1A8L A;  1QGV A;  5IMC A;  2H6Z A;  2I4A A;  2VL9 A;  1XIY A;  1WIK A;  2R37 A;  4EXJ A;  3NZN A;  2GST A;  2MMN A;  3H93 A;  5AIS A;  1WOU A;  5J9B A;  1QXH A;  1QFN A;  4JR4 A;  2HLS A;  1OAZ A;  2F8F A;  2VLT A;  5DAK A;  2GSQ A;  3ZFB A;  3A2W A;  1YQ1 A;  17GS A;  5CAX A;  3ZFL A;  3GUR A;  2CVB A;  5KEJ A;  3GX0 A;  1GSE A;  1G0T A;  1A8Y A;  3KJY A;  1B9Y C;  1MDI A;  4YQU A;  1PKW A;  3RHB A;  4EL1 A;  3TKQ A;  5D9T A;  1I9D A;  3HCZ A;  9GSS A;  4MK3 A;  2RM5 A;  3F0I A;  1TK5 B;  3Q74 A;  1OE7 A;  5G1L A;  1PKZ A;  2I1U A;  5IM9 A;  4V2N A;  2R3X A;  3VWX A;  3S9F A;  1EGR A;  1TU8 A;  3GTU B;  1TW9 A;  4F82 A;  1S3C A;  3EVI A;  4TN8 A;  2L5L A;  2FWF A;  2IPA A;  1R5P A;  2AB6 A;  2VO4 A;  2E2M A;  1ACV A;  1PX7 A;  2OE0 A;  3CSJ A;  3RBT A;  4F9Z A;  3P2A A;  3WT2 A;  5GZZ B;  2P31 A;  1IYI A;  4GSN A;  3CRU A;  4EDZ A;  3GV1 A;  4FYU A;  4ZIJ A;  2H8L A;  2O89 A;  2H76 A;  3DIE A;  2L5O A;  2AV4 A;  1SKS B;  2EIQ A;  3HXS A;  5J5N A;  1CQG A;  1TRV A;  4YAV A;  1K0A A;  4IQ1 A;  1WMJ A;  5GST A;  2XC2 A;  4MPG A;  4ZL8 A;  1M7T A;  1XWG A;  2IYJ A;  3KMN A;  2LJR A;  1FVK A;  3P90 A;  1U6T A;  3KEB A;  3N5O A;  3UMA A;  3FR9 A;  4NPB A;  2J23 A;  4F0C A;  5DCG A;  2L6D A;  3KM6 A;  2L6C A;  1IYH A;  5JWR B;  2HXK A;  2AJQ B;  1K3O A;  1EWX A;  3ZL5 A;  1FOV A;  1JHB A;  2VM1 A;  5IO0 A;  3BJ5 A;  4YAP A;  4J57 E;  4EF0 A;  2IMI A;  3IBH A;  4K1F A;  1GUH A;  4OCE A;  2LST A;  1J08 A;  4JU5 A;  2I3Y A;  3LYK A;  2WUL A;  4ECB A;  5HFK A;  4XIH A;  1GSD A;  2FA4 A;  2CX3 A;  3KXO A;  4WEY A;  2VUP A;  3I69 A;  3VLN A;  2RLI A;  3UBL A;  3UAP A;  4IEL A;  2B6M A;  1U3A A;  1YJ6 A;  3GTU A;  2GQL A;  3UJ1 A;  3Q18 A;  1FW1 A;  1QQ2 A;  3ZVJ D;  2AHE A;  2R6K A;  1TXX A;  3IE3 A;  1GSU A;  4I5Q A;  1TJD A;  2L57 A;  4GQC A;  2MMO A;  1A24 A;  4IN0 A;  2HYX A;  4K6X A;  4MAB A;  1K0D A;  2JZR A;  1T00 A;  3SWL A;  6GSU A;  3CTG A;  5ECH B;  2V6O A;  1G7E A;  3ZZX A;  1EEM A;  4NWY A;  4KSO A;  3F4S A;  1PD2 1;  4LMV A;  1XW5 A;  3GYK A;  1XFL A;  3L9V A;  2NDO A;  5ECP B;  5A4V A;  1SK0 A;  3KMO A;  3EU3 A;  2PMT A;  3G7J A;  5CRD A;  1GP1 A;  3F3R A;  1X0R A;  5JWQ B;  2NPB A;  2VD0 A;  1AW9 A;  3FK8 A;  3ZVJ A;  3HVX A;  2FCH A;  4G10 A;  2K18 A;  3ME8 A;  4K8M A;  3HVS A;  4F03 A;  5DDL A;  4OFM A;  3HDC A;  22GS A;  1GLQ A;  1XWB A;  3R2Q A;  1DE2 A;  1WP0 A;  1K0C A;  3LWA A;  2H6Y A;  4K7O A;  2H01 A;  2H0G A;  1EOH A;  4ML1 A;  1SEN A;  1YF1 A;  2TRX A;  1XVW A;  3I6A A;  4XTS A;  2H70 A;  2RUF A;  1SU9 A;  4HU7 A;  3US3 A;  1V58 A;  4KUN A;  4V2L A;  2LJA A;  5F05 A;  3BBY A;  4PX1 A;  4ECI A;  3LSZ A;  4K0N A;  1GUM A;  1GSS A;  2O85 A;  4K9Z A;  2HFD A;  3ISO A;  2VCW A;  2M80 A;  2K8S A;  3QMX A;  4EC0 A;  3QOU A;  2XBQ A;  3FZ4 A;  2OBI A;  2C1Y A;  2H74 A;  1ON4 A;  3ZLP A;  3HHV A;  4X43 A;  2PN8 A;  4POL A;  2YJH A;  2JZS A;  5CRG A;  1TI1 A;  5C04 A;  1EGO A;  3ZIJ A;  2VL2 C;  3FKF A;  3VPQ A;  1PMT A;  2FA8 A;  3ZMK A;  3DRN A;  1F2E A;  4KND A;  3QPM A;  3TRP A;  4KDY A;  2CV4 A;  5DCH A;  4PNF A;  3WGD A;  4ZB8 A;  2LJK A;  2C0F A;  4XHM A;  3UIW A;  1F9M A;  2H30 A;  2O87 A;  5KN3 A;  4TXO B;  5ECQ B;  3M3M A;  3JCM L;  2VCQ A;  3M0F A;  3A2V A;  1XWC A;  4PQ1 A;  2YJ7 A;  4HZ2 A;  3Q19 A;  2DBC A;  2KP2 A;  3VUR A;  4Z7X A;  3FR3 A;  2HNL A;  1FAA A;  1GSF A;  6GSY A;  2P0G A;  1QK8 A;  3KGK A;  3GST A;  2O8V B;  1XOA A;  1DBY A;  2HZE B;  2YWO A;  4ZBD A;  4GWR A;  1O8X A;  4HZ4 A;  2OBK A;  3L4N A;  4V2M A;  1UC7 A;  4MJB A;  2EIO A;  2C3N A;  1GNE A;  4MMM A;  4ID0 A;  3A5W A;  4ZL7 A;  5DJL A;  1O7U A;  3U5R E;  5D9V A;  4OFN A;  3TOU A;  2HRN A;  18GS A;  3CXG A;  2FWH A;  5CNW A;  3O76 A;  4HS1 A;  2FNO A;  1T1V A;  20GS A;  3HD5 A;  4RQX A;  2JU5 A;  5EL8 A;  3GNJ A;  4V1A p;  4WF4 A;  2BJX A;  3EYT A;  4NHZ A;  4ZIL A;  4X0X A;  1E2Y A;  1XWA A;  4FH8 A;  2H66 A;  5IMV A;  4TR1 B;  3H8Q A;  2HSH A;  4AGS A;  1M9A A;  2AAW A;  3RAZ A;  3A2X A;  3EWL A;  3GSS A;  2WS2 A;  1XOB A;  5B6N A;  1AQX A;  4WXT A;  3GKM A;  3WGX A;  3DWV A;  3HVV A;  2H73 A;  4TXO A;  4YH2 A;  2H1A A;  5IMD A;  2ZNM A;  1A2L A;  4MF5 A;  5IQY A;  5FHI A;  1VRS D;  4HOJ A;  3HJM A;  1V98 A;  4PUF C;  1EV9 A;  3QFA C;  5B6M A;  3C73 A;  1PRX A;  1LJR A;  1NHO A;  1BED A;  2MBT A;  1AQV A;  4WBR D;  5DVB A;  2HZE A;  4IGJ A;  1U3I A;  2J9H A;  2H1D A;  2V6K A;  2Z9S A;  1XBS A;  1SD8 A;  1TRS A;  2H19 A;  2I9H A;  5D73 A;  4L5L A;  3W8J A;  1T8E B;  3TRX A;  1JLW A;  2B5Y A;  3CYN A;  4ACS A;  3VI5 A;  3GA4 A;  2YAN A;  2YV7 A;  5ID2 B;  1TP9 A;  1O8W A;  1T4Y A;  4NMU A;  1N2A A;  3D21 A;  5CRE A;  1DSB A;  5A5K A;  1HNA A;  2LEG A;  2V2G A;  2BTO T;  5IOW A;  3L9U A;  2XPE A;  1TRW A;  5A4U A;  1G6Y A;  2B7J A;  2JAC A;  1UA5 A;  1M9B A;  1RW1 A;  2DIY A;  5CP1 A;  2E0Q A;  4JRR A;  1U87 A;  2B1L A;  1FB6 A;  2R5G A;  4TR1 A;  4ZB9 A;  4MJE A;  2NBS A;  1EP8 A;  2F3M A;  2QC7 A;  2E2G A;  5J4U A;  3TUE A;  1ST9 A;  4IS0 A;  2CZ2 A;  1Z7P A;  2N5A A;  4O7H A;  1R7H A;  4F0B A;  3F6F A;  1Y25 A;  4NV2 A;  3Q6O A;  1V57 A;  3MDK A;  1TDI A;  4O32 A;  2M72 A;  3FZ9 A;  3TKP A;  2FUG 2;  1SK1 A;  3GKK A;  1BYE A;  2RUE A;  4IVF A;  1X9W B;  1M0U A;  4PXO A;  2DJJ A;  5IMF A;  4DEJ A;  1R5A A;  1BAY A;  3FEU A;  3TDG A;  3VFI A;  4OO5 A;  2GDR A;  4Q5R A;  1EEJ A;  1SYX A;  2VL2 A;  2CVK A;  4G2E A;  1YDK A;  3TCO A;  4HEA 2;  2WCI A;  5ID2 A;  4MPF A;  4GST A;  4TKY A;  1M2B A;  3QAW A;  1JLV A;  1K0N A;  1MD4 A;  3UOM A;  4Q5N A;  3KH9 A;  3SBC A;  11GS A;  5AN1 A;  3ED3 A;  5FWG A;  4D73 B;  3LXT A;  4EO3 A;  1T4Z A;  1KTE A;  4N0Z A;  4MF7 A;  2VCX A;  2MYG A;  3ERG A;  4PGT A;  4HQZ A;  4G9H A;  2L4C A;  2X8H A;  5CO3 A;  5H5Q A;  4RUV A;  2JSZ A; 
#chains in the Genus database with same CATH topology
 3MYT A;  1ZX2 A;  4LYL B;  3IAS 2;  5AIX A;  3EHC A;  2KP1 A;  4WFO A;  4IP1 A;  3O3T A;  2C0D A;  4XDW A;  3P7X A;  5B7C A;  1G6W A;  2P09 A;  2JAD A;  2F5M A;  2OE1 A;  3CPW 2;  2V41 A;  2F4Y A;  5FW5 A;  4LEH A;  1BRN L;  4HVN A;  2CT6 A;  4HUA A;  5ECL B;  3BB9 A;  2OE3 A;  3RDW A;  3HJO A;  2GVP A;  4E8E A;  1BNS A;  3TB2 A;  3IV4 A;  1FGQ A;  5HOH A;  3FYG A;  4KH7 A;  5IO2 A;  1ZGN A;  4EV5 A;  1UUG B;  1VQQ A;  1IV7 A;  4WR5 A;  1FGR A;  2CFW A;  4EC6 A;  2IME A;  3EPT A;  3DD3 A;  1IQY A;  3L9S A;  2R2J A;  3KD0 A;  4HM0 B;  1UN2 A;  2A2S A;  1GOU A;  3CMI A;  4GL6 A;  3FY7 A;  3X3X A;  1PFP A;  4RQR A;  3SYU A;  2HMJ B;  3CCR 3;  1QUW A;  1ABA A;  2VM2 A;  1TI3 A;  4K2X A;  1G7O A;  14GS A;  5COH A;  1K3L A;  2B5E A;  2EIR A;  4PQH A;  1BRH A;  16GS A;  1HYU A;  2X4A A;  2HRK A;  3U6V A;  1NM3 A;  3CPO A;  5ECS A;  2GSS A;  1ZS7 A;  4GLT A;  1O7P B;  4AJ7 A;  4N6L A;  4LA1 A;  4HQS A;  3CRT A;  1NSW A;  4K7I A;  4KX4 A;  4GB5 A;  2YOI A;  3EX9 A;  1LNI A;  3LQ7 A;  3OX9 A;  3QCP A;  1ZOF A;  2AUV A;  1NHY A;  3UL6 A;  4OFT A;  5J3R A;  4J5G A;  1X5D A;  2PBJ A;  2IMK A;  4BWS A;  1OH0 A;  1TTZ A;  1RGG A;  1ERV A;  2PU9 C;  2E2V A;  1OC8 A;  3HJP A;  2F8A A;  4ORL A;  4RZM A;  1ERW A;  1B21 A;  3C8E A;  2IL3 A;  1RGC A;  4BTY A;  4RI6 A;  5J41 A;  1JZW A;  4JZQ A;  4D73 A;  4AJ8 A;  3F8U A;  1HD2 A;  3H4K A;  1BSB A;  1O7G B;  4BVX B;  2FNQ A;  1UCL A;  3QK9 A;  1C72 A;  1AUC A;  2XFS A;  3CCE 3;  1USB A;  2LKU A;  1MDK A;  1X1X A;  2MMA A;  4WP5 A;  3C7M A;  4WR4 A;  3GL3 A;  3J7Y k;  1V40 A;  2LQO A;  1JZO A;  1JBT A;  1OHO A;  5DBQ A;  5JCW A;  2DLX A;  1SL2 B;  1M2D A;  3PCS A;  1ERU A;  3TOT A;  2P05 A;  1FW7 A;  1A2J A;  1ZYE A;  2YWM A;  3FKA A;  1XZO A;  3KE7 A;  3S27 A;  4XBT A;  1IT7 A;  3OW2 2;  3APQ A;  3DGM A;  5G2G A;  5GAP D;  3TJK A;  1THX A;  3DVX A;  1R4C A;  3G9B A;  1BIR A;  2DJ3 A;  4N10 A;  5FT3 A;  2REM A;  5BRT A;  1J9B A;  4P3Y B;  1TUH A;  1YJW 3;  19GS A;  2R4V A;  3D4M A;  4NXI A;  3S28 A;  3EU4 A;  3DGY A;  1BOX A;  5JCG A;  4N6N B;  4MNN A;  4AEQ A;  4K1U A;  1NW2 A;  1O85 A;  2MZC A;  1BQ7 A;  2YP6 A;  2W0Q A;  4IBP A;  3IRA A;  3IA1 A;  4IQA A;  3ZTL A;  3LML A;  2D2Z A;  2H6X A;  2OJL A;  1K28 A;  3BOA A;  4IJI A;  1YJN 3;  1ZZY A;  1KQS 2;  2LRC A;  4FIW A;  5AGY A;  2GT5 A;  2GZZ A;  2PGT A;  2QGV A;  4GCI A;  1BSD A;  4Q5F A;  3CC2 3;  3CCS 3;  3HA9 A;  1UDI I;  3GKX A;  1ILO A;  3GKN A;  2OOV A;  1FVJ A;  3BIR A;  3HX8 A;  3D22 A;  3C1R A;  1OC9 B;  4XBY A;  5D93 A;  3E0U A;  3GHA A;  3CCJ 3;  1OKD A;  2K0M A;  2XGN A;  1WE0 A;  5IMZ A;  1R4W A;  4MP4 A;  1RK4 A;  5F0G A;  1GSQ A;  5H5R A;  1WJK A;  3NOF A;  5M19 A;  2CA8 A;  2IN3 A;  3URP A;  3CSH A;  1YGW A;  1Q40 B;  5AIV A;  4MZC A;  2BMX A;  3FZW A;  3SOA A;  4LMW A;  5KP3 A;  5F8B A;  2MMZ A;  4BPY A;  1DE1 A;  1KNG A;  3IK7 A;  1JZR A;  2RM6 A;  1B8X A;  1TFK A;  4N6U A;  2D42 A;  2FY6 A;  3LFL A;  2VOC A;  5HR3 A;  3GZR A;  3FF2 A;  3VF1 A;  1RN1 A;  3X41 A;  5INY A;  3NUV A;  3VK9 A;  1XW9 A;  4ZBA A;  5D96 A;  1T7P B;  1PN0 A;  4HM8 B;  2DML A;  2CAI A;  4FO5 A;  4BVX A;  6GST A;  2GT6 A;  3N9J A;  3PPU A;  3QAG A;  1O81 A;  2GTU A;  1KBN A;  1Q4J A;  1E6B A;  2CKF B;  5IG0 A;  2GQM A;  3Q1C A;  13GS A;  5ENU A;  1RSN A;  2BU4 A;  2GEY A;  1WPI A;  3I0Y A;  1MD3 A;  2CAQ A;  3FRC A;  3G4S 3;  5HFG A;  4E8H A;  2PPT A;  3F7S A;  3J7Y b;  5HR0 A;  1K3Y A;  2A15 A;  3GZY B;  3AGN A;  3G16 A;  1IK3 A;  2W56 B;  2PVO C;  1AQW A;  1SJ6 A;  4EIP A;  2OKA A;  3I9V 2;  5ELG A;  3MWH A;  5B8A A;  2OQE A;  1QMA A;  4HM4 B;  4G19 A;  4KAE A;  3UAR A;  2F56 A;  1TFO A;  1F6M C;  4HKV B;  4WBJ A;  4AF2 A;  3MG2 A;  1Q82 4;  2KLX A;  2QKE A;  4HJM A;  3F63 A;  1UCI A;  3GFK A;  3TJF A;  3C71 A;  1LOV A;  4ZXG A;  4LL1 B;  1B4Q A;  4I8B A;  4EBG A;  2LS5 A;  1RRH A;  1FA3 A;  5D8I A;  4K1V A;  1NWW A;  4O92 A;  2Q07 A;  2HOH A;  1YF0 A;  4POK A;  5TGN A;  4L8E A;  3ZRD A;  4KDU A;  3H79 A;  1EV4 A;  1GWC A;  2Z76 A;  5DAL B;  4QL7 A;  1VQN 3;  2BMO B;  4ISD A;  2HRF A;  1VQO 3;  1A90 A;  4N0V A;  5E4W A;  3MNG A;  1ZMA A;  1X1W A;  1GLP A;  4QQ7 A;  2OAD A;  3KFQ C;  3IAM 2;  1OGZ A;  1U5O A;  3NQZ A;  5AYR B;  3WGE A;  3M8N A;  5CRW A;  1OC9 A;  4XCS A;  1VQ5 3;  3TRQ A;  6GSX A;  1T5Y A;  4N30 A;  2X99 A;  3GH9 A;  5IOX A;  4KCA A;  2FXT A;  5G30 A;  1XXU A;  1M2A A;  4NAX A;  1DET A;  2VCT A;  1X1U A;  3LXZ A;  2WGQ A;  4I2U A;  4XDV A;  2MF7 A;  2N5F A;  5HR1 A;  1RCK A;  2L59 A;  1Q40 A;  1MDJ A;  1X5C A;  4ZBB A;  3X3Y A;  1EQK A;  5CF2 A;  2K9F A;  4EYC A;  4HI7 A;  3IOS A;  1FGT A;  2XSH B;  2HI7 A;  1HYF A;  5DJM A;  4MH2 A;  7GSS A;  4HM6 B;  2PNC A;  1SJW A;  2A4V A;  3FG3 A;  4Z2U A;  2V32 A;  5G31 A;  2ZUP A;  4JE1 A;  2IMJ A;  4IJ3 A;  2C8U A;  1NO3 A;  2PER A;  3EMX A;  3L0H A;  1J2B A;  1QMV A;  3HZ8 A;  2RBI A;  2YZH A;  4AJ6 A;  1ZL9 A;  2C0G A;  3DKS A;  4STD A;  4GQF A;  1VF1 A;  1TRU A;  4OD7 A;  3PIN A;  3KII A;  3HIG A;  3I56 3;  1WRY A;  5IF6 A;  3RPN A;  4HU9 A;  3QFB C;  2ON7 A;  5HQP A;  4CHS A;  1X9S B;  2P5R A;  3MG3 A;  3VPT A;  2QIY A;  1ZYQ B;  1JFU A;  4DSS B;  4L0W A;  2QGU A;  2DJ0 A;  2W56 A;  2OCT A;  5D9W A;  2DSA A;  1TK0 B;  4H86 A;  3VI7 A;  1SJI A;  2GBX B;  4BL7 B;  2FWG A;  3GL5 A;  3QDN A;  4R9L A;  4KE3 A;  3W6G A;  3FZ5 A;  5JBS A;  2BHM A;  4TW5 A;  1N9J A;  3GIX A;  4TOP A;  4F2I A;  3MKI A;  2L4V A;  4A5P A;  3K5T A;  1YZX A;  3LW9 A;  2F51 A;  2AYT A;  4HZ9 B;  2CWT A;  3IC4 A;  3F4T A;  4L8O A;  2BMR B;  2H1B A;  3RPP A;  2EC4 A;  2CH9 A;  2B5X A;  3FGY A;  4BIK A;  4Z2T A;  1YY7 A;  1A23 A;  2BIR A;  3D6I A;  3RGR A;  4MCU A;  5KN0 A;  3JVC A;  12GS A;  3HZP A;  5DAL A;  2LTK A;  2YWI A;  1VQK 3;  3E99 A;  1V2A A;  4MDC A;  3EN1 B;  1GUK A;  1DMQ A;  2KUC A;  4OWY A;  1HQO A;  1RLS A;  3LXU X;  1BUQ A;  1LBK A;  1PN9 A;  3M1G A;  3R3E A;  1TK8 B;  2XF3 A;  5ECM B;  3I43 A;  1NB5 I;  1UW1 A;  3VWU A;  3L78 A;  1SQW A;  2GLR A;  3FW2 A;  2VLU A;  1ASK A;  2F98 A;  2XBI A;  4BU4 A;  2IJY A;  4ECJ A;  3JUM A;  4V1A g;  3EF8 A;  4IHU A;  3DYR A;  1AY7 A;  4TR4 A;  3S29 A;  2QA4 3;  4KF9 A;  2Y74 A;  4YKF A;  5ELA A;  2ZCT A;  1OHS A;  1YKA A;  1K8A 4;  5STD A;  3GN3 A;  4KGI A;  2E7P A;  1IQ8 A;  4OK0 A;  1THO A;  1I5G A;  3KP9 A;  1UI7 A;  2CVD A;  4DSR A;  1NJI 4;  3D5J A;  3MIX A;  5D83 A;  5EVO A;  2HMK B;  3QRD A;  5HR2 A;  4L8P A;  4MMX B;  1X9M B;  1G96 A;  3ZML A;  3LTC A;  3UBK A;  4YQV A;  3N54 B;  4N3V A;  1M99 A;  1PFO A;  4KA0 A;  2JSY A;  5AII A;  1BRG A;  4MJA A;  2JQ5 A;  1A2K A;  2XPD A;  4FR9 A;  4NHW A;  2A2P A;  4EDY A;  2GZY A;  1SIH A;  2KXG A;  4GSS A;  3UL3 A;  4K5R A;  1DYU A;  2HT9 A;  8GSS A;  2F9S A;  4KVH A;  2VLV A;  2IY2 A;  4ML6 A;  4GRF A;  5BIR A;  2WDU A;  2IIY A;  3KZQ A;  4EIQ A;  3GWR A;  4KW6 A;  3G6E 3;  2YNX A;  1PSQ A;  4BWQ A;  4DSS A;  3QAV A;  1BG5 A;  1H4O A;  4JF8 A;  3CBU A;  1O6J A;  3EE2 A;  5F06 A;  6RNT A;  4O8S A;  1SKR B;  3FLJ A;  4EVM A;  3CXC 2;  4CDO A;  1TIJ A;  4BL7 A;  1Z7R A;  4OVM A;  1PA3 A;  4QL9 A;  1BNF A;  1A0R P;  4MMZ B;  2IWT A;  2RNT A;  2C0E A;  3IK9 A;  5AIF A;  1TOF A;  2H71 A;  5LNK e;  2B24 B;  2LQQ A;  5D81 A;  2VD1 A;  3D9R A;  1SL0 B;  1E3R A;  2WFC A;  3BD2 A;  3ZYW A;  3NBB A;  4XS1 A;  3PR8 A;  4HM1 B;  2J8X B;  1YEX A;  4O5R A;  3DML A;  4I97 A;  2YWN A;  3TKS C;  1FB0 A;  1RQM A;  2A2R A;  2P5Q A;  3KTL A;  1GTB A;  4TR0 A;  1IVX A;  1GUL A;  5IPH A;  4BA7 A;  4GTU A;  4USS A;  1YI2 3;  4XB5 A;  5IIZ A;  1W00 A;  4RUV A;  1NDO B;  2B3S A;  2GSP A;  1DMN A;  2B1K A;  3EUR A;  1VGL A;  2FGX A;  2GXF A;  4XS4 B;  5ECO B;  5G1K A;  1B2M A;  4N11 A;  2VL3 A;  1B4P A;  4IKH A;  1U8C B;  2LRN A;  3F3Q A;  4MZB A;  5D9X A;  1H75 A;  1Q98 A;  3LG6 A;  3T8U A;  4XRA A;  1B2S A;  1T3B A;  5KN1 A;  5DQS A;  1KC8 4;  1GY5 A;  5L71 A;  2DKH A;  1KD1 4;  2O9U X;  3N8B A;  5IPG A;  5GAN D;  1PYL A;  2C3Q A;  1VF2 A;  1XCC A;  5RNT A;  3D4T A;  4HJ2 A;  2KOK A;  1B48 A;  2Y73 A;  1OYJ A;  2KHP A;  1R26 A;  3HVN A;  2KF4 A;  1URM A;  1L5G B;  1IVW A;  3UNL A;  4PUR A;  1M3J A;  2F99 A;  2XH9 A;  1S72 3;  4OCF A;  5ABR A;  1FG4 A;  2WOH A;  4KSM A;  2HE3 A;  2DJK A;  3NQY A;  5CRH A;  3ZIV A;  2H75 A;  4J9A A;  1Y6E A;  2LV3 A;  3K0Z A;  2CX1 A;  3UB1 A;  4TVE A;  2X64 A;  1PY3 A;  2L4Q A;  3EJV A;  3LOY A;  2SBL A;  3D0Z A;  1O73 A;  1VF4 A;  1M1X B;  2XSO B;  5J9C A;  1TRQ A;  3NV0 B;  4FYC A;  1Z6M A;  3PS8 A;  2DKI A;  3NM2 A;  1KSI A;  5ECI B;  5G5F A;  5IMA A;  2H0H A;  2R0C A;  2YZU A;  3FH1 A;  3ME7 A;  4RI7 A;  4HM3 B;  3CD6 3;  3KKG A;  3CSI A;  3CC7 3;  3TKS E;  1D6Y A;  4JR6 A;  1K0M A;  1WMP A;  4KDX A;  1N8J A;  2G0F A;  5AEW B;  1BU4 A;  3LZA A;  3FHK A;  4L5O A;  4I6X A;  4EUY A;  1HZ1 A;  1SD9 A;  2O7K A;  5KOX A;  3FR6 A;  2B7K A;  3NX0 A;  4ULX A;  3E3E A;  1SYR A;  3LEF A;  3DEX A;  1WNH A;  4X1U A;  5IG4 A;  3LT9 A;  1XWK A;  4TR3 A;  1BRK A;  3F8H A;  3UL5 A;  2HMN B;  1Z5Y E;  1IYY A;  4ECC A;  2H72 A;  5DQY A;  3TJJ A;  2LNT A;  1B2X A;  3TKR A;  1TU7 A;  1S3A A;  1XVQ A;  3GZX B;  5AYS C;  6GSW A;  1DUG A;  1GD3 A;  4Q53 A;  3KIJ A;  5JWO B;  4K2D A;  2H1G A;  1EP7 A;  3HYP A;  2MBS A;  1ZCP A;  1A67 A;  4MH3 A;  1LQM B;  1F3A A;  1JV2 B;  1WQL B;  3VWV A;  4TRX A;  2L1S A;  1Q42 A;  4XS4 A;  4MF6 A;  3KP8 A;  3G7I A;  5H5S A;  3EC9 A;  1QJG A;  4EE0 A;  1GTU A;  5HFI A;  1Q9E A;  1ULI B;  2QA1 A;  3JUO A;  1ERT A;  2AAE A;  3RDE A;  1LU4 A;  5EY6 A;  4WYK B;  4OO4 A;  3IR4 A;  1Z6N A;  3F14 A;  1ULJ B;  2OTJ 3;  4PEJ A;  2XHF A;  2ALB A;  5LD0 A;  3WA3 A;  1Z3E A;  4HJL B;  3GX8 A;  2ON5 A;  3APO A;  2JZT A;  5M18 A;  5BXQ A;  2TRC P;  3IDV A;  3E9J B;  4ILF A;  3WOE B;  2K54 A;  2LQV A;  3AMO B;  1ZO2 A;  2DIZ A;  3M9K A;  4PQI A;  1TKD B;  1GL8 A;  4PNG A;  3FG4 A;  1AIU A;  1ROV A;  2HSY A;  2ZL8 A;  3QR6 A;  3G7Y A;  3J7Y d;  3EMP A;  3B4P A;  3LTB A;  5LC6 A;  3DGQ A;  4WF5 A;  4NV5 A;  6GSS A;  2UGI A;  2GBW B;  3CQF A;  3RHC A;  3T8N A;  3HZ4 A;  4JED A;  5DRE A;  4MEI A;  2P0M A;  3HOH A;  4BVY B;  3HKR A;  4POB A;  3U97 A;  1K73 4;  3NV0 A;  2CZ3 A;  3OR5 A;  7RNT A;  3F8X A;  1RGH A;  1TTO A;  3MPH A;  1OE8 A;  2OWP A;  3CTF A;  3F4R A;  3PGB A;  2GQK A;  4MZW A;  4FMB A;  4MJC A;  4KCE A;  1SK2 A;  4FYB A;  3WA2 X;  1K0B A;  3A5I A;  4DKI A;  1RNB A;  3B8L A;  3IXR A;  3CC4 3;  2M46 A;  3LH4 A;  3LJR A;  1F3B A;  3NXJ A;  1QAK A;  1F37 A;  2WGR A;  3AHS A;  2CQ9 A;  4Z2R A;  2CW9 A;  1BUJ A;  3D3L A;  4PUA A;  1W89 A;  2H0I A;  3SLU A;  4HZB B;  2BMQ B;  1FHE A;  1Z1S A;  8CHO A;  8RNT A;  4R1K A;  1W4V A;  3BCK A;  1C54 A;  3LYP A;  3BCI A;  1V9W A;  4ZB6 A;  2GGT A;  3KCM A;  1EG9 B;  2FHE A;  2IFQ B;  5C00 A;  3LOR A;  5EEO A;  1SKW B;  1FUS A;  4EKZ A;  3ZFZ A;  5A4W A;  4GXZ A;  3M9J A;  2X8G A;  5KN2 A;  2YV9 A;  4FQU A;  4K0G A;  5AI1 A;  1MGR A;  4FMA A;  2IMD A;  2K6V A;  1Z9H A;  3PH9 A;  1HKX A;  4I2T A;  1MWT A;  2I81 A;  2WB9 A;  2WGO A;  3AY8 A;  1W6Y A;  3IHQ A;  2CFG A;  1LOY A;  4XRD A;  2PUK C;  4R4K A;  5F07 A;  4WYK A;  4WHA A;  2K8V A;  3L0R A;  1K0O A;  3TJG A;  3F6D A;  1QVG 2;  5EPF A;  1U88 A;  2ES7 A;  1AAZ A;  2IA7 A;  4IP6 A;  1FUT A;  4KFE A;  4CW9 A;  1GH2 A;  1O7H B;  1HNB A;  1STD A;  2P0X A;  1WWJ A;  2CX4 A;  3G8Z A;  1LVN A;  2PWJ A;  4AKZ A;  1BRI A;  1S3D A;  2Z6B A;  3WR2 A;  4MLY A;  3MSZ A;  3ERF A;  2VCZ A;  2DJ2 A;  3DZL A;  3UVH A;  3HY2 A;  3WYW A;  2VCV A;  1VQL 3;  4BL2 A;  2KF5 A;  5AIH A;  5ECN B;  1J0F A;  3DGO A;  2GS3 A;  3ERW A;  3STD A;  1PGT A;  4J56 E;  2WRT A;  4HDE A;  1MEK A;  5BMU A;  4ZL9 A;  2VAF A;  3APS A;  3CCV 3;  2NVL A;  1OCV A;  2CX0 A;  4BVY A;  1IU7 A;  3TKS A;  3W8S A;  1RTU A;  5GSS A;  1QAL A;  4TXV A;  3ECF A;  2C80 A;  1M90 4;  5ECK B;  3IPZ A;  2FLS A;  4J5K A;  4KT3 B;  3H3H A;  1FO5 A;  3KCH A;  3GMF A;  1Q7H A;  4XS6 A;  3OXA A;  5IEN A;  2PVQ A;  3LYG A;  10GS A;  4L0U A;  3VWW A;  4QWT A;  1KEB A;  3GRX A;  1RGA A;  3WD6 A;  4MA9 A;  3LT8 A;  1JZD A;  4CY8 A;  4XM4 A;  1EZK A;  2LUS A;  3GUS A;  3UVT A;  1AV4 A;  4FMD A;  3BNE A;  2DMM A;  1JBS A;  3FZA A;  1AXD A;  4DVC A;  1PL2 A;  2DC5 A;  1I0X A;  2DJ1 A;  5EVH A;  4POM A;  1GMR A;  1OAC A;  5CYY A;  3P8W A;  3QD9 A;  3ZRE A;  2TIR A;  2FD3 A;  1BX9 A;  4FCZ A;  1YJ9 3;  5AEU B;  2YN1 A;  1RGE A;  4GF0 A;  1I2F A;  2X8C A;  1IQX A;  1MTC A;  2IFQ A;  5G5E A;  1EOG A;  1W6G A;  2N5B A;  3NIV A;  1XW6 A;  3TJB A;  6GSV A;  1VZZ A;  2RII A;  1CQH A;  1SL1 B;  1ZGX A;  4YQM A;  4LL4 B;  2I9W A;  4O5U A;  5B8B A;  5DAK B;  3C1S A;  1HNC A;  5LCZ A;  1BJX A;  5IEP A;  2D1W A;  3CNX A;  2HZF A;  4RNZ A;  1IVU A;  3IC8 A;  3DXB A;  1UGI A;  6STD A;  1XPV A;  3OV4 A;  1ML6 A;  3EIN A;  4WET A;  2GZP A;  3BND A;  4WKW A;  2CWU A;  1S5A A;  3NHX A;  4O5Q A;  4OMV A;  2WZ9 A;  1N9E A;  3ZIT A;  3DGN A;  1B9X C;  4LLR A;  1OVN A;  3CU3 A;  1VQ4 3;  3H1N A;  3CMA 3;  3A3T A;  1SJZ A;  4DSQ A;  2C10 A;  2KCD A;  3SVA A;  5JCU A;  1M9G A;  3F9S A;  3JUQ A;  4CCV A;  4J2F A;  2KF6 A;  3WT1 A;  1VF3 A;  2NTO A;  2YPM A;  3PGT A;  1PQN A;  1YKC A;  1PL1 A;  2FWE A;  5G2Z A;  3F9U A;  3CNM A;  1US1 A;  2JL4 A;  5IG3 A;  1VQ6 3;  1X5E A;  1GSP A;  2C4J A;  1GMP A;  3MYD A;  1AC1 A;  1YEP A;  1LOX A;  2C3T A;  3TGZ A;  3EC3 A;  4GSP A;  2CFL A;  2XRX B;  1Q7Y 4;  2LRT A;  4IW9 A;  1GTA A;  3KTB A;  3O6T A;  5CXO A;  3D79 A;  2IMF A;  1M3I A;  3V1W A;  3K8N A;  5JPP A;  4HYZ A;  1SII A;  4JBB A;  3KH7 A;  3MAK A;  2LNS A;  3RGA A;  2YCD A;  2OAC A;  1N5H A;  1A2M A;  3DVW A;  3LGC A;  2F86 B;  1GNW A;  5ECR B;  2QSI A;  2G2Q A;  4O2H A;  4K7N A;  1A0F A;  2OA7 A;  1GSY A;  3CME 3;  1GRX A;  1PX6 A;  1GTI A;  2V1M A;  4KB3 A;  1I8V A;  1OKT A;  4K90 B;  1UVZ A;  2VIM A;  1OC3 A;  3UEM A;  1MWS A;  3S5C A;  3WOD G;  3GH6 A;  4I4K A;  2GSR A;  5E59 A;  4Q5Q A;  2BT3 A;  2WJU A;  1JRQ A;  1W6C A;  1A8L A;  1O7W B;  1QGV A;  5IMC A;  2H6Z A;  2I4A A;  2YFL B;  2VL9 A;  1XIY A;  2XEP A;  1WIK A;  2R37 A;  4EXJ A;  3NZN A;  1B20 A;  2YX9 A;  2GST A;  2MMN A;  1Y4K A;  1W4N A;  3H93 A;  1WOU A;  5AIS A;  5J9B A;  1PU4 A;  1JN5 B;  1QXH A;  3ZG5 A;  1QFN A;  3GAX A;  4JR4 A;  2RCD A;  2HLS A;  1OAZ A;  2F8F A;  2VLT A;  5DAK A;  2GSQ A;  1R4Y A;  3ZFB A;  1DMM A;  3A2W A;  1NB3 I;  2UX0 A;  17GS A;  5CAX A;  3ZFL A;  1BAN A;  3GUR A;  3V98 A;  3G0K A;  2CVB A;  5KEJ A;  4BL3 A;  1JB4 A;  3GX0 A;  1GSE A;  1G0T A;  1A8Y A;  3KJY A;  1B9Y C;  1MDI A;  2E2U A;  4YQU A;  1PKW A;  3RHB A;  4EL1 A;  1BNR A;  3TKQ A;  5D9T A;  1RDS A;  4RNT A;  7GSP A;  1I9D A;  4CY6 A;  2CG0 A;  4BTW A;  3HCZ A;  4G0L A;  9GSS A;  5FGO A;  1TP6 A;  4MK3 A;  2RM5 A;  3F0I A;  1UCK A;  3A5E A;  1TK5 B;  3KSP A;  1OGX A;  3Q74 A;  1OE7 A;  5G1L A;  5ELJ A;  1PKZ A;  2I1U A;  5IM9 A;  4V2N A;  4J8T A;  1V74 A;  2R3X A;  3WOF B;  1GOV A;  4ICY A;  3VWX A;  3S9F A;  2CG1 A;  1UI8 A;  1EGR A;  3Q2P A;  1TU8 A;  3GTU B;  1TW9 A;  4F82 A;  1S3C A;  3EVI A;  4TN8 A;  2L5L A;  2FWF A;  2IPA A;  1R5P A;  2E2T A;  2AB6 A;  1I2G A;  4K5S A;  2VO4 A;  2E2M A;  1ACV A;  1RGF A;  1PX7 A;  3IPT A;  1RCL A;  5JPU A;  2B1X B;  4BIR A;  2OE0 A;  3CSJ A;  3RBT A;  4F9Z A;  2BO9 B;  3P2A A;  3WT2 A;  5GZZ B;  2P31 A;  1IYI A;  4GSN A;  3CRU A;  1Q86 4;  3AHW A;  1FYS A;  1FUW A;  4EDZ A;  3GV1 A;  4FYU A;  4ZIJ A;  3IMA B;  3CCQ 3;  3PXM A;  2H8L A;  2O89 A;  3GSP A;  2H76 A;  1JBR A;  1T2H A;  3UJM A;  1LXE A;  3S67 A;  2C4B A;  3H51 A;  3DIE A;  2L5O A;  2AV4 A;  1SKS B;  2EIQ A;  4HM5 B;  3HXS A;  4CDL A;  5J5N A;  1CQG A;  1DVC A;  3B4O A;  1TRV A;  4YAV A;  2XFT A;  1K0A A;  1BGS A;  3JUP A;  4IQ1 A;  1WMJ A;  5GST A;  2XC2 A;  4MPG A;  5M1A A;  3Q90 A;  4ZL8 A;  1WTH A;  1M7T A;  1JN5 A;  1XWG A;  2IYJ A;  1BSE A;  1BSA A;  3KMN A;  2LJR A;  1O7N B;  1FVK A;  3V99 A;  3P90 A;  1U6T A;  3KEB A;  3N5O A;  3UMA A;  1RGK A;  1CYU A;  2UZ8 A;  1WMO A;  4IIA A;  4NPB A;  3FR9 A;  1W2B 2;  2J23 A;  4F0C A;  5DCG A;  2L6D A;  3KM6 A;  2L6C A;  4N6T A;  1IYH A;  5JWR B;  2HXK A;  2AJQ B;  1K3O A;  1EWX A;  3ZL5 A;  1FOV A;  1JHB A;  2VM1 A;  5IO0 A;  2R41 A;  4K61 A;  3BJ5 A;  3NBJ A;  1N5P A;  3V92 A;  4YAP A;  4J57 E;  4EF0 A;  2IMI A;  3SXX A;  3IBH A;  4K1F A;  2IUJ A;  1GUH A;  4HM2 B;  2KAA A;  4N6V 0;  4OCE A;  1RRL A;  2LST A;  1J08 A;  2A4H A;  4JU5 A;  5IG5 A;  2I3Y A;  3LYK A;  2WUL A;  4ECB A;  5HFK A;  4XIH A;  5IEO A;  1GSD A;  2FA4 A;  2CX3 A;  3KXO A;  4WEY A;  3BNC A;  2VUP A;  3I69 A;  5CLK A;  5ELU A;  3VLN A;  2RLI A;  3UBL A;  1GMQ A;  3UAP A;  2HSM A;  4IEL A;  1GD4 A;  2B6M A;  2W2C A;  4RNY A;  1U3A A;  4L7K A;  1YJ6 A;  3GTU A;  1ISK A;  5KP1 A;  1XG8 A;  3Q3F A;  2GQL A;  3UJ1 A;  3Q18 A;  1FW1 A;  3IHG A;  1QQ2 A;  3K63 A;  1BNE A;  3ZVJ D;  1CH0 A;  2AHE A;  2R6K A;  1TXX A;  3IE3 A;  4G0I A;  1EKM A;  3HK4 A;  1GSU A;  3BU4 A;  4I5Q A;  1TJD A;  2GU3 A;  2L57 A;  4N6O B;  4GQC A;  4R9K A;  2MMO A;  3EBT A;  1A24 A;  4IN0 A;  2CWV A;  2HYX A;  4K6X A;  1C7H A;  4MAB A;  1AVK A;  1K0D A;  5CK6 A;  4HOH A;  3WHO A;  2HMO B;  2JZR A;  1T00 A;  3SWL A;  6GSU A;  3CTG A;  5LC7 A;  4KFD A;  4O02 B;  2M7O A;  4G0K A;  2ML6 A;  4FCM A;  6GSP A;  5ECH B;  1JB2 A;  2V6O A;  1G7E A;  3ZZX A;  1EEM A;  1YIT 3;  3FCS B;  4IT7 A;  4NWY A;  1OF5 B;  3F4S A;  4KSO A;  1PD2 1;  4LMV A;  1XW5 A;  3HII A;  3GYK A;  1I3I A;  4JRF A;  1XFL A;  4HSC X;  2R0G A;  1MGW A;  1VQP 3;  3L9V A;  3EN8 A;  2NDO A;  2SAR A;  3N9H A;  2W9P A;  5ECP B;  5A4V A;  1VQ9 3;  1SK0 A;  3KMO A;  4YKG A;  3X42 A;  3EU3 A;  2PMT A;  1RN7 A;  3G7J A;  5CRD A;  3KN4 A;  1EUI C;  1UUV B;  3DM8 A;  1GP1 A;  1D6U A;  3F3R A;  1X0R A;  5JWQ B;  2RFR A;  4EXR A;  2NPB A;  2VD0 A;  1AW9 A;  4XBX A;  3FK8 A;  3ZVJ A;  2XGL A;  2ZHX B;  1W5Z A;  2FCH A;  3HVX A;  4G10 A;  2K18 A;  3ME8 A;  4K8M A;  3HVS A;  2QEX 3;  5DDL A;  4F03 A;  4OFM A;  3HDC A;  22GS A;  1GLQ A;  1XWB A;  1IVV A;  2CC3 A;  1GS3 A;  2X49 A;  3R2Q A;  3X40 A;  1B3S A;  1DE2 A;  3MWZ A;  1WP0 A;  3FMW A;  2W03 A;  1K0C A;  3LWA A;  2H6Y A;  4K7O A;  3CCL 3;  3EQQ B;  5IW9 A;  4G1M B;  3DUK A;  2H01 A;  4H61 A;  2H0G A;  1WMN A;  1EOH A;  4ML1 A;  1SEN A;  2OTL 3;  1YF1 A;  2TRX A;  3O8Y A;  4IPB A;  3WDG B;  1XVW A;  3I6A A;  4XTS A;  2H70 A;  4EV2 A;  2RUF A;  1SU9 A;  4HU7 A;  3US3 A;  1TRP A;  3EBY A;  1V58 A;  4KUN A;  4PTS A;  2LJA A;  3EB8 A;  3BBY A;  4PX1 A;  4V2L A;  3PYJ A;  3LSZ A;  5F05 A;  4ECI A;  4K0N A;  1GUM A;  1GSS A;  2O85 A;  4K9Z A;  2HFD A;  3ISO A;  1UCJ A;  1RMS A;  2VCW A;  5DRV A;  2W6J H;  4FCJ A;  1NNV A;  2M80 A;  2K8S A;  3QMX A;  1A2P A;  4EC0 A;  3QOU A;  2XBQ A;  3FZ4 A;  2OBI A;  2C1Y A;  3IJE B;  1VQ7 3;  4LSO A;  2H74 A;  1CEW I;  1ON4 A;  3ZLP A;  3HHV A;  5IER A;  4X43 A;  2RSX A;  2PN8 A;  1SAR A;  4POL A;  3F7X A;  2YJH A;  1MNL A;  2JZS A;  5CRG A;  1TI1 A;  5C04 A;  4X2O A;  3CCM 3;  1X1Y A;  1EGO A;  3ZIJ A;  2VL2 C;  3FKF A;  4X4J A;  3VPQ A;  1FZU A;  1KWI A;  1OF5 A;  3U1W A;  3D5I A;  1PMT A;  2FA8 A;  5AIG A;  1NU3 A;  3ZMK A;  1YVB I;  7STD A;  3DRN A;  1F2E A;  4KND A;  3QPM A;  3TRP A;  1IT8 A;  4KDY A;  2RGQ A;  1JJ2 2;  3AMO A;  1QAF A;  2CV4 A;  4LZI A;  5DCH A;  1GYB A;  4PNF A;  3WGD A;  2ML5 A;  1UUW B;  4N6M A;  4ZB8 A;  2LJK A;  4GHO A;  2C0F A;  2BNG A;  3JUN A;  4XHM A;  3UIW A;  1F9M A;  2H30 A;  3DY5 A;  2O87 A;  5KN3 A;  4TXO B;  5ECQ B;  3LTD A;  3M3M A;  3JCM L;  2VCQ A;  3M0F A;  3A2V A;  1XWC A;  4PQ1 A;  2YJ7 A;  4HZ2 A;  3Q19 A;  2GU1 A;  1O7M B;  2DBC A;  2KP2 A;  3OWS A;  3VUR A;  4Z7X A;  3FR3 A;  2HNL A;  1W02 A;  1FAA A;  1BRJ A;  1RGL A;  1GSF A;  1BNI A;  6GSY A;  3ALA A;  1BNG A;  3SX1 A;  1QK8 A;  2YFI B;  2P0G A;  3KGK A;  3GST A;  1OUN A;  2O8V B;  3WMD A;  1W2Z A;  3KZT A;  1XOA A;  1BAO A;  1DBY A;  1AVL A;  2HZE B;  1BNJ A;  1YIJ 3;  2YWO A;  1I2E A;  3FSD A;  4ZBD A;  3K7C A;  3DMC A;  5GSP A;  4GWR A;  1O8X A;  4HZ4 A;  3I55 3;  2OBK A;  1MWU A;  3L4N A;  4V2M A;  1UC7 A;  4MJB A;  2W04 A;  4LMI A;  1BSC A;  2EIO A;  2C3N A;  5HGR A;  1GNE A;  1LOW A;  4MMM A;  4ID0 A;  5KP4 A;  3A5W A;  4ZL7 A;  1E3V A;  4CPK A;  2INX A;  5DJL A;  4EW5 A;  1O7U A;  3U5R E;  1OHP A;  4KZ1 A;  3G71 3;  3OWY A;  5D9V A;  3BLZ A;  1SPU A;  9RNT A;  1Q81 4;  4OFN A;  3TOU A;  2Z7A A;  4FMC A;  3X3Z A;  2HRN A;  18GS A;  1MOL A;  3CXG A;  2FWH A;  2QA2 A;  5CNW A;  3O76 A;  3D4A A;  2LYX A;  2STD A;  4HS1 A;  2FNO A;  1T1V A;  2CFD A;  1G02 A;  2ZDJ A;  20GS A;  3FF0 A;  3HD5 A;  4LGQ A;  4RQX A;  2C11 A;  2JU5 A;  5EL8 A;  3GNJ A;  4V1A p;  4WF4 A;  1BRS A;  2BJX A;  3EYT A;  4NHZ A;  4ZIL A;  4X0X A;  1E2Y A;  1XWA A;  1RKY A;  1RHL A;  4FH8 A;  2H66 A;  5IMV A;  4TR1 B;  3H8Q A;  3GRD A;  2HSH A;  4AGS A;  3K9M C;  4CJN A;  1M1K 4;  1VQ8 3;  1M9A A;  2K3D A;  1E97 A;  2AAW A;  5EQL A;  3M8C A;  3RAZ A;  3A2X A;  3EWL A;  3GSS A;  2WS2 A;  1CYV A;  1D6Z A;  1XOB A;  1YGE A;  1UGH I;  5B6N A;  1AQX A;  4WXT A;  5CF1 A;  4MJD A;  3GKM A;  3WGX A;  3T0U A;  3DWV A;  3HVV A;  2H73 A;  4TXO A;  4YH2 A;  2CK3 H;  4HM7 B;  4HAA A;  1JNQ A;  2H1A A;  5IMD A;  2ZNM A;  2P38 A;  1B2Z A;  1A2L A;  4BTX A;  1YNV X;  4MF5 A;  5IQY A;  5FHI A;  1VRS D;  4HOJ A;  3HJM A;  5A0O B;  1V98 A;  4PUF C;  1EV9 A;  3QFA C;  5B6M A;  3C73 A;  2KRT A;  3OWU A;  1OPY A;  1PRX A;  1LJR A;  1NHO A;  1BED A;  2MBT A;  1AQV A;  4WBR D;  5DVB A;  2HZE A;  4IGJ A;  1U3I A;  2J9H A;  1A2V A;  4HBR A;  1K41 A;  2CHC A;  1FGO A;  3MSO A;  2H1D A;  1GY7 A;  2V6K A;  2Z9S A;  1XBS A;  1SD8 A;  2ZA4 A;  1TRS A;  2H19 A;  2W9Q A;  3A76 A;  2I9H A;  1AR0 A;  2V1L A;  5D73 A;  3ER7 A;  4L5L A;  1LQG C;  3MG1 A;  4AKY A;  3W8J A;  1T8E B;  3CCU 3;  3TRX A;  1JLW A;  1FGM A;  2GEX A;  1ZYP A;  2B5Y A;  4U13 A;  3CYN A;  4ACS A;  3VI5 A;  3GA4 A;  2YAN A;  2YV7 A;  5ID2 B;  1MWR A;  1TP9 A;  3HI7 A;  1TU5 A;  5BU4 A;  1O8W A;  1T4Y A;  1W7C A;  4NMU A;  1N2A A;  3D21 A;  5CRE A;  1DSB A;  1B27 A;  4MMY B;  1N8R 4;  1RNT A;  5A5K A;  1HNA A;  3EE1 A;  3ZG0 A;  2LEG A;  2V2G A;  2OOV C;  2BTO T;  3FG1 A;  3PCR A;  5IOW A;  2AAD A;  1STF I;  1YHQ 3;  4NHF A;  3L9U A;  2XPE A;  1JKG B;  4R80 A;  3RNT A;  1TRW A;  3GZB A;  5A4U A;  1G6Y A;  2O3O A;  2B7J A;  2JAC A;  3BNB A;  1UA5 A;  3PZW A;  1M9B A;  2CIU A;  1RW1 A;  2DIY A;  5CP1 A;  2E0Q A;  1ZYN A;  1LRA A;  2R4I A;  4JRR A;  1U87 A;  4X2H A;  2B1L A;  1FB6 A;  2R5G A;  4TR1 A;  1EA2 A;  4ZB9 A;  1GY6 A;  4MJE A;  2NBS A;  1AQZ A;  3VSY A;  1EP8 A;  2F3M A;  2QC7 A;  2E2G A;  5J4U A;  3DGL A;  3NBR A;  3TUE A;  2JDI H;  1ST9 A;  1QVF 2;  1B2U A;  4IS0 A;  2CZ2 A;  1I3F A;  2XR8 B;  1Z7P A;  3DXO A;  2N5A A;  4KFF A;  4H3U A;  4O7H A;  1R7H A;  3DH2 A;  3SED A;  4F0B A;  3F6F A;  1CQS A;  2WO0 A;  1S3R A;  1IV9 A;  1N8Q A;  1Y25 A;  3D5G A;  4NV2 A;  1VQM 3;  1IDP A;  3Q6O A;  1V57 A;  3MDK A;  5KOW A;  1TDI A;  4O32 A;  3KSE D;  2M72 A;  3FZ9 A;  2IUK A;  3TKP A;  1F8N A;  2FUG 2;  1SK1 A;  3GKK A;  2R0P A;  1GOY A;  2HMM B;  4NRE A;  1BYE A;  2RUE A;  3NM7 A;  4TX4 A;  2MC8 A;  4OUQ A;  1BVI A;  1YVS A;  2PZV A;  4IVF A;  1X9W B;  5BVB A;  1RJO A;  1M0U A;  4PXO A;  3SOY A;  1DVD A;  2OQE C;  2DJJ A;  4RBN A;  1DE3 A;  5IMF A;  1K9M 4;  4DEJ A;  1JB5 A;  1R5A A;  2HML B;  1BAY A;  2Z77 A;  3FEU A;  4WWU C;  3TDG A;  1FOH A;  3VFI A;  4OO5 A;  2GDR A;  4Q5R A;  1EEJ A;  2F5W A;  1SYX A;  1ROA A;  2VL2 A;  4O3V A;  2CVK A;  4G2E A;  1YDK A;  3TCO A;  4HEA 2;  2WCI A;  5ID2 A;  1I0V A;  1LNH A;  1RN4 A;  4MPF A;  4GST A;  4TKY A;  1M2B A;  3QAW A;  3B7C A;  1JLV A;  1K0N A;  1MD4 A;  3UOM A;  4Q5N A;  3KH9 A;  3SBC A;  2FGT A;  11GS A;  2UUG C;  1W01 A;  3VGN A;  2CFK A;  5AN1 A;  3ED3 A;  2KF3 A;  5FWG A;  4D73 B;  1JKG A;  3F40 A;  3AGO A;  4ZM8 A;  3LXT A;  4EO3 A;  1T2I A;  1T4Z A;  2WOF A;  1KTE A;  4N0Z A;  2YFJ B;  3LTA A;  4MF7 A;  2HRA A;  2VCX A;  2MYG A;  3ERG A;  1HU9 A;  4PGT A;  5D82 A;  1I70 A;  5I97 A;  4HQZ A;  3MHE A;  4G9H A;  2L4C A;  3ROB A;  2X8H A;  5CO3 A;  5H5Q A;  1YQ1 A;  2JSZ A; 
#chains in the Genus database with same CATH homology
 3IAS 2;  5AIX A;  2KP1 A;  4IP1 A;  3O3T A;  2C0D A;  3P7X A;  5B7C A;  1G6W A;  2JAD A;  2OE1 A;  2V41 A;  5ECL B;  4HUA A;  2CT6 A;  3RDW A;  2OE3 A;  3HJO A;  2GVP A;  4E8E A;  3TB2 A;  3IV4 A;  3FYG A;  4KH7 A;  5IO2 A;  1ZGN A;  4WR5 A;  2IME A;  3EPT A;  3DD3 A;  3L9S A;  2R2J A;  3KD0 A;  1UN2 A;  2A2S A;  3CMI A;  3FY7 A;  4RQR A;  1QUW A;  4K2X A;  1G7O A;  1ABA A;  2VM2 A;  1TI3 A;  14GS A;  5COH A;  1K3L A;  2B5E A;  2EIR A;  4PQH A;  16GS A;  1HYU A;  2X4A A;  2HRK A;  3U6V A;  1NM3 A;  5ECS A;  2GSS A;  4GLT A;  4AJ7 A;  4LA1 A;  4HQS A;  3CRT A;  1NSW A;  4K7I A;  4KX4 A;  2YOI A;  3LQ7 A;  3QCP A;  1ZOF A;  2AUV A;  1NHY A;  5J3R A;  4OFT A;  1X5D A;  2PBJ A;  2IMK A;  4BWS A;  1TTZ A;  1ERV A;  2PU9 C;  1OC8 A;  3HJP A;  2F8A A;  1ERW A;  3C8E A;  2IL3 A;  4RI6 A;  5J41 A;  1JZW A;  4JZQ A;  4D73 A;  4AJ8 A;  3F8U A;  1HD2 A;  3H4K A;  4BVX B;  1C72 A;  1AUC A;  2LKU A;  1USB A;  1MDK A;  2MMA A;  4WR4 A;  3C7M A;  3GL3 A;  3J7Y k;  1V40 A;  2LQO A;  1JZO A;  5DBQ A;  5JCW A;  2DLX A;  1SL2 B;  1M2D A;  1ERU A;  3TOT A;  1A2J A;  1ZYE A;  2YWM A;  1XZO A;  3APQ A;  5GAP D;  3TJK A;  1THX A;  3DVX A;  3G9B A;  2DJ3 A;  4N10 A;  5FT3 A;  2REM A;  5BRT A;  1J9B A;  4P3Y B;  19GS A;  2R4V A;  3D4M A;  4NXI A;  3EU4 A;  5JCG A;  4MNN A;  1NW2 A;  1O85 A;  2MZC A;  1BQ7 A;  2YP6 A;  4IBP A;  3IRA A;  3IA1 A;  4IQA A;  3ZTL A;  2D2Z A;  2H6X A;  2OJL A;  3BOA A;  4IJI A;  1ZZY A;  2LRC A;  4FIW A;  5AGY A;  2GT5 A;  2GZZ A;  2PGT A;  2QGV A;  4GCI A;  4Q5F A;  3HA9 A;  3GKX A;  1ILO A;  3GKN A;  1FVJ A;  3D22 A;  3C1R A;  1OC9 B;  5D93 A;  3E0U A;  3GHA A;  1OKD A;  1WE0 A;  5IMZ A;  1R4W A;  4MP4 A;  1RK4 A;  5F0G A;  1GSQ A;  5H5R A;  1WJK A;  3NOF A;  2CA8 A;  2IN3 A;  3CSH A;  5AIV A;  4MZC A;  2BMX A;  4LMW A;  5F8B A;  2MMZ A;  4BPY A;  1DE1 A;  1KNG A;  3IK7 A;  1JZR A;  2RM6 A;  1B8X A;  2FY6 A;  3LFL A;  2VOC A;  5HR3 A;  5INY A;  3VK9 A;  1XW9 A;  4ZBA A;  5D96 A;  1T7P B;  1PN0 A;  2DML A;  2CAI A;  4FO5 A;  4BVX A;  6GST A;  2GT6 A;  3N9J A;  3PPU A;  3QAG A;  1O81 A;  2GTU A;  1KBN A;  1Q4J A;  1E6B A;  2GQM A;  13GS A;  5ENU A;  1WPI A;  1MD3 A;  2CAQ A;  3FRC A;  5HFG A;  4E8H A;  2PPT A;  3J7Y b;  5HR0 A;  1K3Y A;  2PVO C;  1AQW A;  1SJ6 A;  4EIP A;  2OKA A;  3I9V 2;  5ELG A;  3MWH A;  5B8A A;  4G19 A;  4KAE A;  3UAR A;  1F6M C;  4WBJ A;  4AF2 A;  2KLX A;  2QKE A;  4HJM A;  3F63 A;  3GFK A;  3TJF A;  3C71 A;  4ZXG A;  1B4Q A;  4LL1 B;  4I8B A;  2LS5 A;  5D8I A;  4O92 A;  1YF0 A;  4POK A;  4L8E A;  3ZRD A;  4KDU A;  3H79 A;  1EV4 A;  1GWC A;  5DAL B;  4QL7 A;  4ISD A;  2HRF A;  4N0V A;  5E4W A;  3MNG A;  1ZMA A;  1GLP A;  4QQ7 A;  2OAD A;  3IAM 2;  3WGE A;  3M8N A;  5CRW A;  1OC9 A;  4XCS A;  3TRQ A;  6GSX A;  4N30 A;  2X99 A;  3GH9 A;  5IOX A;  4KCA A;  5G30 A;  1XXU A;  1M2A A;  4NAX A;  2VCT A;  3LXZ A;  4I2U A;  2N5F A;  5HR1 A;  2L59 A;  1MDJ A;  1X5C A;  4ZBB A;  2K9F A;  4HI7 A;  3IOS A;  2HI7 A;  5DJM A;  4MH2 A;  7GSS A;  2A4V A;  4Z2U A;  2V32 A;  5G31 A;  2ZUP A;  4JE1 A;  4IJ3 A;  2C8U A;  2PER A;  3EMX A;  3L0H A;  1QMV A;  3HZ8 A;  2YZH A;  4AJ6 A;  1ZL9 A;  2C0G A;  3DKS A;  4GQF A;  1VF1 A;  1TRU A;  4OD7 A;  3PIN A;  1WRY A;  3RPN A;  4HU9 A;  3QFB C;  2ON7 A;  5HQP A;  4CHS A;  1X9S B;  2P5R A;  3VPT A;  1ZYQ B;  1JFU A;  4DSS B;  4L0W A;  2DJ0 A;  5D9W A;  2DSA A;  1TK0 B;  4H86 A;  3VI7 A;  1SJI A;  4BL7 B;  2FWG A;  3GL5 A;  3QDN A;  4KE3 A;  3W6G A;  3FZ5 A;  4TW5 A;  3GIX A;  4TOP A;  4F2I A;  4A5P A;  1YZX A;  3LW9 A;  2F51 A;  2AYT A;  3IC4 A;  3F4T A;  2H1B A;  3RPP A;  2EC4 A;  2B5X A;  4Z2T A;  1YY7 A;  1A23 A;  3D6I A;  4MCU A;  5KN0 A;  12GS A;  5DAL A;  2LTK A;  2YWI A;  1V2A A;  4MDC A;  1GUK A;  2KUC A;  4OWY A;  1HQO A;  1LBK A;  1PN9 A;  3M1G A;  3R3E A;  1TK8 B;  5ECM B;  3I43 A;  3VWU A;  3L78 A;  2GLR A;  3FW2 A;  2VLU A;  2XBI A;  2IJY A;  4ECJ A;  4V1A g;  4IHU A;  3DYR A;  4TR4 A;  4KF9 A;  4YKF A;  5ELA A;  2ZCT A;  1YKA A;  3GN3 A;  4KGI A;  2E7P A;  1THO A;  1I5G A;  3KP9 A;  2CVD A;  4DSR A;  3D5J A;  3MIX A;  5EVO A;  5HR2 A;  1X9M B;  3ZML A;  3UBK A;  4YQV A;  1M99 A;  4KA0 A;  2JSY A;  4MJA A;  2XPD A;  4NHW A;  2A2P A;  4EDY A;  2GZY A;  4GSS A;  3UL3 A;  4K5R A;  2HT9 A;  8GSS A;  2F9S A;  2VLV A;  2IY2 A;  4ML6 A;  4GRF A;  2WDU A;  2IIY A;  3KZQ A;  4EIQ A;  4KW6 A;  2YNX A;  1PSQ A;  4BWQ A;  4DSS A;  3QAV A;  1BG5 A;  1H4O A;  3CBU A;  3EE2 A;  1O6J A;  5F06 A;  1SKR B;  4EVM A;  4CDO A;  4BL7 A;  1Z7R A;  1PA3 A;  4QL9 A;  1A0R P;  2IWT A;  2C0E A;  3IK9 A;  1TOF A;  2H71 A;  5LNK e;  2LQQ A;  2VD1 A;  1SL0 B;  2WFC A;  3BD2 A;  3ZYW A;  4XS1 A;  3PR8 A;  1YEX A;  4O5R A;  3DML A;  4I97 A;  2YWN A;  3TKS C;  1FB0 A;  1RQM A;  2A2R A;  2P5Q A;  3KTL A;  1GTB A;  4TR0 A;  5IPH A;  1GUL A;  4BA7 A;  4GTU A;  4USS A;  5IIZ A;  2B3S A;  3EUR A;  2B1K A;  1VGL A;  4XS4 B;  2FGX A;  5ECO B;  5G1K A;  4N11 A;  2VL3 A;  1B4P A;  4IKH A;  2LRN A;  3F3Q A;  4MZB A;  5D9X A;  1H75 A;  1Q98 A;  3LG6 A;  4XRA A;  1T3B A;  5KN1 A;  5DQS A;  5L71 A;  2DKH A;  5GAN D;  5IPG A;  2C3Q A;  1VF2 A;  1XCC A;  3D4T A;  4HJ2 A;  2KOK A;  1B48 A;  1OYJ A;  2KHP A;  1R26 A;  1URM A;  4PUR A;  5ABR A;  4OCF A;  1FG4 A;  4KSM A;  2HE3 A;  2DJK A;  5CRH A;  3ZIV A;  2H75 A;  1Y6E A;  2LV3 A;  4TVE A;  2X64 A;  2L4Q A;  3D0Z A;  1O73 A;  1VF4 A;  5J9C A;  4FYC A;  1Z6M A;  2DKI A;  5ECI B;  5G5F A;  5IMA A;  2H0H A;  2R0C A;  2YZU A;  3ME7 A;  4RI7 A;  3CSI A;  3TKS E;  4JR6 A;  1K0M A;  4KDX A;  1N8J A;  2G0F A;  3FHK A;  4L5O A;  4I6X A;  4EUY A;  1SD9 A;  2O7K A;  5KOX A;  3FR6 A;  2B7K A;  4ULX A;  3E3E A;  1SYR A;  3LEF A;  3DEX A;  4X1U A;  4TR3 A;  1XWK A;  1Z5Y E;  4ECC A;  2H72 A;  5DQY A;  3TJJ A;  2LNT A;  3TKR A;  1TU7 A;  1S3A A;  1XVQ A;  6GSW A;  1DUG A;  3KIJ A;  5JWO B;  4K2D A;  2H1G A;  1EP7 A;  3HYP A;  2MBS A;  1ZCP A;  4MH3 A;  1F3A A;  3VWV A;  4TRX A;  4XS4 A;  4MF6 A;  3KP8 A;  3G7I A;  5H5S A;  4EE0 A;  1GTU A;  5HFI A;  2QA1 A;  1LU4 A;  1ERT A;  5EY6 A;  4OO4 A;  3IR4 A;  1Z6N A;  2XHF A;  2ALB A;  5LD0 A;  1Z3E A;  3GX8 A;  2ON5 A;  3APO A;  2JZT A;  2TRC P;  3IDV A;  3E9J B;  4ILF A;  2DIZ A;  1TKD B;  1GL8 A;  3M9K A;  4PQI A;  4PNG A;  1AIU A;  2HSY A;  3QR6 A;  3G7Y A;  3EMP A;  3DGQ A;  4WF5 A;  4NV5 A;  6GSS A;  3RHC A;  3HZ4 A;  4JED A;  4BVY B;  3HKR A;  4POB A;  2CZ3 A;  3OR5 A;  3F4R A;  1OE8 A;  3CTF A;  2GQK A;  4MZW A;  4MJC A;  4KCE A;  1SK2 A;  4FYB A;  1K0B A;  3A5I A;  3IXR A;  2M46 A;  3LJR A;  1F3B A;  2WGR A;  1F37 A;  2CQ9 A;  4Z2R A;  4PUA A;  1W89 A;  2H0I A;  1FHE A;  1W4V A;  3BCK A;  3LYP A;  3BCI A;  1V9W A;  4ZB6 A;  2GGT A;  3KCM A;  2FHE A;  5C00 A;  2IFQ B;  3LOR A;  1SKW B;  4EKZ A;  5A4W A;  4GXZ A;  3M9J A;  2X8G A;  5KN2 A;  2YV9 A;  4FQU A;  4K0G A;  2IMD A;  2K6V A;  1Z9H A;  3PH9 A;  4I2T A;  2I81 A;  2WB9 A;  3AY8 A;  3IHQ A;  4XRD A;  2PUK C;  5F07 A;  2K8V A;  1K0O A;  3TJG A;  3F6D A;  5EPF A;  1U88 A;  2ES7 A;  1AAZ A;  4IP6 A;  4CW9 A;  1GH2 A;  1HNB A;  1WWJ A;  2CX4 A;  2PWJ A;  1S3D A;  4MLY A;  3MSZ A;  3ERF A;  2VCZ A;  2DJ2 A;  3UVH A;  3HY2 A;  3WYW A;  2VCV A;  5ECN B;  1J0F A;  2GS3 A;  3ERW A;  4J56 E;  1PGT A;  2WRT A;  4HDE A;  1MEK A;  5BMU A;  4ZL9 A;  2VAF A;  3APS A;  2NVL A;  4BVY A;  3TKS A;  3W8S A;  5GSS A;  4TXV A;  2C80 A;  5ECK B;  3IPZ A;  2FLS A;  1FO5 A;  3GMF A;  4XS6 A;  2PVQ A;  10GS A;  4L0U A;  3VWW A;  1KEB A;  3GRX A;  3WD6 A;  4MA9 A;  1JZD A;  4CY8 A;  3UVT A;  1EZK A;  2LUS A;  3GUS A;  2DMM A;  3FZA A;  1AXD A;  4DVC A;  1PL2 A;  2DC5 A;  2DJ1 A;  4POM A;  5CYY A;  3P8W A;  3QD9 A;  3ZRE A;  2TIR A;  2FD3 A;  1BX9 A;  2YN1 A;  4GF0 A;  2X8C A;  1MTC A;  2IFQ A;  5G5E A;  1EOG A;  2N5B A;  3NIV A;  1XW6 A;  3TJB A;  6GSV A;  2RII A;  1CQH A;  1SL1 B;  4YQM A;  4LL4 B;  4O5U A;  5B8B A;  5DAK B;  3C1S A;  1HNC A;  5LCZ A;  1BJX A;  2HZF A;  3IC8 A;  3DXB A;  1XPV A;  1ML6 A;  3EIN A;  4WET A;  2GZP A;  4WKW A;  4O5Q A;  4OMV A;  2WZ9 A;  3ZIT A;  4LLR A;  1B9X C;  1OVN A;  3H1N A;  3A3T A;  1SJZ A;  4DSQ A;  5JCU A;  4J2F A;  3WT1 A;  1VF3 A;  2NTO A;  2YPM A;  3PGT A;  1PQN A;  1YKC A;  1PL1 A;  2FWE A;  5G2Z A;  3F9U A;  2JL4 A;  1X5E A;  2C4J A;  3MYD A;  1AC1 A;  1YEP A;  2C3T A;  3TGZ A;  3EC3 A;  2LRT A;  4IW9 A;  1GTA A;  3KTB A;  3O6T A;  2IMF A;  3V1W A;  3K8N A;  4JBB A;  3KH7 A;  3MAK A;  2LNS A;  2YCD A;  2OAC A;  1A2M A;  3DVW A;  3LGC A;  1GNW A;  5ECR B;  2QSI A;  2G2Q A;  4K7N A;  1A0F A;  2OA7 A;  1GSY A;  1GRX A;  1PX6 A;  1GTI A;  2V1M A;  4KB3 A;  1OKT A;  1UVZ A;  2VIM A;  1OC3 A;  3UEM A;  3GH6 A;  2GSR A;  5E59 A;  4Q5Q A;  2WJU A;  1A8L A;  1QGV A;  5IMC A;  2H6Z A;  2I4A A;  2VL9 A;  1XIY A;  1WIK A;  2R37 A;  4EXJ A;  3NZN A;  2GST A;  2MMN A;  3H93 A;  5AIS A;  1WOU A;  5J9B A;  1QXH A;  1QFN A;  4JR4 A;  2HLS A;  1OAZ A;  2F8F A;  2VLT A;  5DAK A;  2GSQ A;  3ZFB A;  3A2W A;  1YQ1 A;  17GS A;  5CAX A;  3ZFL A;  3GUR A;  2CVB A;  5KEJ A;  3GX0 A;  1GSE A;  1G0T A;  1A8Y A;  3KJY A;  1B9Y C;  1MDI A;  4YQU A;  1PKW A;  3RHB A;  4EL1 A;  3TKQ A;  5D9T A;  1I9D A;  4CY6 A;  3HCZ A;  4G0L A;  9GSS A;  4MK3 A;  2RM5 A;  3F0I A;  1TK5 B;  3Q74 A;  1OE7 A;  5G1L A;  1PKZ A;  2I1U A;  5IM9 A;  4V2N A;  2R3X A;  4ICY A;  3VWX A;  3S9F A;  1EGR A;  1TU8 A;  3GTU B;  1TW9 A;  4F82 A;  1S3C A;  3EVI A;  4TN8 A;  2L5L A;  2FWF A;  2IPA A;  1R5P A;  2AB6 A;  4K5S A;  2VO4 A;  2E2M A;  1ACV A;  1PX7 A;  2OE0 A;  3CSJ A;  3RBT A;  4F9Z A;  3P2A A;  3WT2 A;  5GZZ B;  2P31 A;  1IYI A;  4GSN A;  3CRU A;  4EDZ A;  3GV1 A;  4FYU A;  4ZIJ A;  2H8L A;  2O89 A;  2H76 A;  3DIE A;  2L5O A;  2AV4 A;  1SKS B;  2EIQ A;  3HXS A;  5J5N A;  1CQG A;  1TRV A;  4YAV A;  1K0A A;  4IQ1 A;  1WMJ A;  5GST A;  2XC2 A;  4MPG A;  4ZL8 A;  1M7T A;  1XWG A;  2IYJ A;  3KMN A;  2LJR A;  1FVK A;  3P90 A;  1U6T A;  3KEB A;  3N5O A;  3UMA A;  2UZ8 A;  3FR9 A;  4NPB A;  2J23 A;  4F0C A;  5DCG A;  2L6D A;  3KM6 A;  2L6C A;  1IYH A;  5JWR B;  2HXK A;  2AJQ B;  1K3O A;  1EWX A;  3ZL5 A;  1FOV A;  1JHB A;  2VM1 A;  5IO0 A;  3BJ5 A;  4YAP A;  4J57 E;  4EF0 A;  2IMI A;  3IBH A;  4K1F A;  1GUH A;  4OCE A;  2LST A;  1J08 A;  2A4H A;  4JU5 A;  2I3Y A;  3LYK A;  2WUL A;  4ECB A;  5HFK A;  4XIH A;  1GSD A;  2FA4 A;  2CX3 A;  3KXO A;  4WEY A;  2VUP A;  3I69 A;  3VLN A;  2RLI A;  3UBL A;  3UAP A;  2HSM A;  4IEL A;  2B6M A;  1U3A A;  1YJ6 A;  3GTU A;  2GQL A;  3UJ1 A;  3Q18 A;  1FW1 A;  3IHG A;  1QQ2 A;  3ZVJ D;  2AHE A;  2R6K A;  1TXX A;  3IE3 A;  4G0I A;  1GSU A;  4I5Q A;  1TJD A;  2L57 A;  4GQC A;  2MMO A;  1A24 A;  4IN0 A;  2HYX A;  4K6X A;  4MAB A;  1K0D A;  2JZR A;  1T00 A;  3SWL A;  6GSU A;  3CTG A;  4G0K A;  5ECH B;  2V6O A;  1G7E A;  3ZZX A;  1EEM A;  4NWY A;  4KSO A;  3F4S A;  1PD2 1;  4LMV A;  1XW5 A;  3GYK A;  1XFL A;  2R0G A;  3L9V A;  2NDO A;  5ECP B;  5A4V A;  1SK0 A;  3KMO A;  4YKG A;  3EU3 A;  2PMT A;  3G7J A;  5CRD A;  1GP1 A;  3F3R A;  1X0R A;  5JWQ B;  2NPB A;  2VD0 A;  1AW9 A;  3FK8 A;  3ZVJ A;  3HVX A;  2FCH A;  4G10 A;  2K18 A;  3ME8 A;  4K8M A;  3HVS A;  4F03 A;  5DDL A;  4OFM A;  3HDC A;  22GS A;  1GLQ A;  1XWB A;  2X49 A;  3R2Q A;  1DE2 A;  1WP0 A;  3FMW A;  1K0C A;  3LWA A;  2H6Y A;  4K7O A;  2H01 A;  2H0G A;  1EOH A;  4ML1 A;  1SEN A;  1YF1 A;  2TRX A;  1XVW A;  3I6A A;  4XTS A;  2H70 A;  2RUF A;  1SU9 A;  4HU7 A;  3US3 A;  1V58 A;  4KUN A;  4PTS A;  2LJA A;  4V2L A;  3BBY A;  4PX1 A;  5F05 A;  4ECI A;  3LSZ A;  4K0N A;  1GUM A;  1GSS A;  2O85 A;  4K9Z A;  2HFD A;  3ISO A;  2VCW A;  2M80 A;  2K8S A;  3QMX A;  4EC0 A;  3QOU A;  2XBQ A;  3FZ4 A;  2OBI A;  2C1Y A;  2H74 A;  1ON4 A;  3ZLP A;  3HHV A;  4X43 A;  2PN8 A;  4POL A;  2YJH A;  2JZS A;  5CRG A;  1TI1 A;  5C04 A;  1EGO A;  3ZIJ A;  2VL2 C;  3FKF A;  4X4J A;  3VPQ A;  1PMT A;  2FA8 A;  3ZMK A;  3DRN A;  1F2E A;  4KND A;  3QPM A;  3TRP A;  4KDY A;  2CV4 A;  5DCH A;  4PNF A;  3WGD A;  4ZB8 A;  2LJK A;  2C0F A;  4XHM A;  3UIW A;  1F9M A;  2H30 A;  2O87 A;  5KN3 A;  4TXO B;  5ECQ B;  3M3M A;  3JCM L;  2VCQ A;  3M0F A;  3A2V A;  1XWC A;  4PQ1 A;  2YJ7 A;  4HZ2 A;  3Q19 A;  2DBC A;  2KP2 A;  3VUR A;  4Z7X A;  3FR3 A;  2HNL A;  1FAA A;  1GSF A;  6GSY A;  2P0G A;  1QK8 A;  3KGK A;  3GST A;  2O8V B;  1XOA A;  1DBY A;  2HZE B;  2YWO A;  4ZBD A;  4GWR A;  1O8X A;  4HZ4 A;  2OBK A;  3L4N A;  4V2M A;  1UC7 A;  4MJB A;  2EIO A;  2C3N A;  1GNE A;  4MMM A;  4ID0 A;  3A5W A;  4ZL7 A;  5DJL A;  1O7U A;  3U5R E;  5D9V A;  4OFN A;  3TOU A;  2HRN A;  18GS A;  3CXG A;  2FWH A;  2QA2 A;  5CNW A;  3O76 A;  4HS1 A;  2FNO A;  1T1V A;  20GS A;  3HD5 A;  4RQX A;  2JU5 A;  5EL8 A;  3GNJ A;  4V1A p;  4WF4 A;  2BJX A;  3EYT A;  4NHZ A;  4ZIL A;  4X0X A;  1E2Y A;  1XWA A;  4FH8 A;  2H66 A;  5IMV A;  4TR1 B;  3H8Q A;  2HSH A;  4AGS A;  1M9A A;  2AAW A;  3RAZ A;  3A2X A;  3EWL A;  3GSS A;  2WS2 A;  1XOB A;  5B6N A;  1AQX A;  4WXT A;  3GKM A;  3WGX A;  3DWV A;  3HVV A;  2H73 A;  4TXO A;  4YH2 A;  2H1A A;  5IMD A;  2ZNM A;  1A2L A;  4MF5 A;  5IQY A;  5FHI A;  1VRS D;  4HOJ A;  3HJM A;  1V98 A;  4PUF C;  1EV9 A;  3QFA C;  5B6M A;  3C73 A;  1PRX A;  1LJR A;  1NHO A;  1BED A;  2MBT A;  1AQV A;  4WBR D;  5DVB A;  2HZE A;  4IGJ A;  1U3I A;  2J9H A;  2H1D A;  2V6K A;  2Z9S A;  1XBS A;  1SD8 A;  1TRS A;  2H19 A;  2I9H A;  5D73 A;  4L5L A;  3W8J A;  1T8E B;  3TRX A;  1JLW A;  1ZYP A;  2B5Y A;  3CYN A;  4ACS A;  3VI5 A;  3GA4 A;  2YAN A;  2YV7 A;  5ID2 B;  1TP9 A;  1O8W A;  1T4Y A;  4NMU A;  1N2A A;  3D21 A;  5CRE A;  1DSB A;  5A5K A;  1HNA A;  2LEG A;  2V2G A;  2BTO T;  5IOW A;  3L9U A;  2XPE A;  1TRW A;  5A4U A;  1G6Y A;  2B7J A;  2JAC A;  1UA5 A;  1M9B A;  1RW1 A;  2DIY A;  5CP1 A;  2E0Q A;  1ZYN A;  4JRR A;  1U87 A;  2B1L A;  1FB6 A;  2R5G A;  4TR1 A;  4ZB9 A;  4MJE A;  2NBS A;  1EP8 A;  2F3M A;  2QC7 A;  2E2G A;  5J4U A;  3TUE A;  1ST9 A;  4IS0 A;  2CZ2 A;  1Z7P A;  2N5A A;  4O7H A;  1R7H A;  4F0B A;  3F6F A;  1Y25 A;  4NV2 A;  3Q6O A;  1V57 A;  3MDK A;  5KOW A;  1TDI A;  4O32 A;  2M72 A;  3FZ9 A;  3TKP A;  2FUG 2;  1SK1 A;  3GKK A;  2R0P A;  1BYE A;  2RUE A;  4IVF A;  1X9W B;  1M0U A;  4PXO A;  2DJJ A;  5IMF A;  4DEJ A;  1R5A A;  1BAY A;  3FEU A;  1FOH A;  3TDG A;  3VFI A;  4OO5 A;  2GDR A;  4Q5R A;  1EEJ A;  1SYX A;  2VL2 A;  2CVK A;  4G2E A;  1YDK A;  3TCO A;  4HEA 2;  2WCI A;  5ID2 A;  4MPF A;  4GST A;  4TKY A;  1M2B A;  3QAW A;  1JLV A;  1K0N A;  1MD4 A;  3UOM A;  4Q5N A;  3KH9 A;  3SBC A;  11GS A;  5AN1 A;  3ED3 A;  5FWG A;  4D73 B;  3LXT A;  4EO3 A;  1T4Z A;  1KTE A;  4N0Z A;  4MF7 A;  2HRA A;  2VCX A;  2MYG A;  3ERG A;  4PGT A;  4HQZ A;  4G9H A;  2L4C A;  2X8H A;  5CO3 A;  5H5Q A;  4RUV A;  2JSZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...