5G1LA

A double mutant of dsbg engineered for denitrosylation
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
228
structure length
228
Chain Sequence
LPAPVKAIEKQGITIIKTFDAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNTLIEKEIYAPAGREMWQRMEQSHWLLDGKKDAPVIVYVFADPFCGPCKQFWQQARPWVDSGKVQLRTLLVGVIKPESPATAAAILASKDPAKTWQQYEASGGKLKLNVPANVSTEQMKVLSDNEKLMDDLGANVTPAIYYMSKENTLQQAVGLPDQKTLNIIMGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sulfur Denitrosylation by an Engineered Trx-Like Dsbg Enzyme Identifies Nucleophilic Cysteine Hydrogen Bonds as Key Functional Determinant.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords THIOL DISULFIDE INTERCHANGE PROTEIN DSBG
total genus 67
structure length 228
sequence length 228
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 5g1lA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5g1lA02
2OE1A 5DDLA 2R3XA 2JADA 1A0RP 1ZOFA 3MDKA 4K8MA 3UARA 4HS1A 3ZVJD 4I6XA 4JZQA 3P7XA 5GZZB 4E8EA 4TXOA 1OYJA 1FOVA 5HFKA 1HNAA 3KH7A 1X9SB 4WKWA 4ECCA 3ED3A 4GXZA 3L4NA 1ZYQB 1E2YA 2ON5A 2AHEA 1S3DA 3HDCA 3H1NA 2B5YA 2B1KA 1B4QA 3F4TA 4NHZA 4HZ2A 1GTBA 1M99A 4HOJA 3VI7A 3O76A 4OMVA 3M9JA 2TRXA 3F9UA 2J23A 4J57E 3QFBC 4MABA 2AYTA 5DCHA 4F0BA 2ZCTA 1BJXA 3EURA 5FHIA 1SJZA 2VLTA 4X43A 4NPBA 3OR5A 1O8WA 1VGLA 3F63A 1HNCA 2TIRA 4EL1A 1ON4A 4MJBA 2VIMA 3L9VA 1TK5B 1XBSA 4MJEA 2EIQA 1UC7A 2VCZA 4JR4A 1A8LA 4JE1A 2HLSA 3IA1A 1ACVA 1MD4A 2IY2A 2L5LA 4HUAA 5G1LA 2HNLA 3ZLPA 4N30A 1H75A 17GSA 1PX6A 3UIWA 1F2EA 2K18A 2LUSA 1ZMAA 2MMZA 4IJ3A 3U6VA 3GKMA 1NSWA 4TXOB 4KUNA 2N5BA 3G9BA 1ZYEA 1X9MB 1SD9A 3BOAA 2MBSA 4ZL9A 3N5OA 1LU4A 1SK0A 2I1UA 2EIOA 1TU8A 4XTSA 1V57A 4JU5A 4GSTA 4TW5A 2G0FA 3L9UA 1O7UA 2PVOC 5B6NA 2L57A 3EU3A 5ECIB 5KN0A 2FY6A 3TJGA 1MEKA 1B9XC 5G5FA 4DEJA 1SKRB 3C73A 5A4VA 2P5RA 4J56E 7GSSA 1B9YC 1G0TA 1AQWA 2KP1A 5A5KA 2IMKA 4KW6A 4MH3A 2HYXA 1SL2B 1U3AA 4MJAA 1GLQA 5IMAA 5ID2B 2ALBA 3EVIA 2GSSA 2GSQA 1JZOA 3M9KA 2GZPA 1YEPA 1F37A 2F8AA 2V6KA 3JCML 4XCSA 5H5RA 5JWOB 3NIVA 4WETA 3VFIA 4CHSA 5GAPD 3G7JA 3LXZA 2YWMA 4IKHA 2H19A 4K6XA 1PGTA 5IQYA 4OO5A 5D8IA 2AV4A 3IOSA 4YAVA 3GFKA 4PQHA 3DEXA 1QQ2A 4MF6A 3RAZA 4ILFA 2H6YA 2K6VA 4FYBA 5JCWA 5G30A 2OJLA 1QGVA 2LRTA 4IBPA 2CQ9A 4KGIA 1M0UA 1URMA 2V2GA 2WJUA 1QMVA 3EMXA 4MDCA 2PGTA 1OC9B 2IJYA 2MMNA 3HJMA 5CRDA 2FWHA 2VD1A 4RI7A 4X1UA 1GSFA 4IQ1A 1K0OA 3NOFA 2QSIA 3IK7A 2DIYA 1ERUA 2ON7A 3PINA 3TUEA 2H01A 4KA0A 1X0RA 1YF1A 3M1GA 3D0ZA 1FVJA 5IMVA 4XHMA 4LL4B 3D5JA 2H73A 1HNBA 3UMAA 4BVXA 3EYTA 1SKWB 1WWJA 3RBTA 1GTUA 4I5QA 5H5SA 2YWOA 5B7CA 3EWLA 3RDWA 1TW9A 3CTGA 4KX4A 4G2EA 1SU9A 3LJRA 2K8SA 2CZ3A 1JLWA 4HZ4A 1PQNA 4I97A 5G2ZA 4BVYA 5JWQB 2R2JA 4OD7A 2BJXA 2PU9C 2ES7A 4ML1A 2K9FA 4XS1A 4ZXGA 2FWEA 1CQHA 3W6GA 1OE7A 3WT1A 4O32A 1IYHA 2AAWA 3FEUA 3J7Yb 2YOIA 5IIZA 5L71A 5AIXA 3UOMA 3WGDA 5CREA 2E2MA 4TN8A 2HZEA 2HSHA 3VPQA 4MF7A 3KD0A 1OC8A 2B6MA 4WR4A 1PL1A 1ABAA 4TR4A 2R6KA 4BPYA 2AUVA 5IMCA 2Z9SA 5F8BA 2C1YA 2FA8A 1W89A 1VRSD 1B8XA 5KN2A 1HD2A 1XWGA 2RUFA 1XWCA 4HU9A 2YJ7A 2R4VA 4MPFA 3M8NA 3ZMKA 2PMTA 2BTOT 1PSQA 2K8VA 3ZYWA 1JZRA 4GCIA 3IBHA 3DYRA 1ERWA 2GS3A 3TGZA 4KNDA 3IAM2 5F0GA 1DE2A 2IPAA 4LMVA 2H0HA 3BCIA 4N0ZA 4GRFA 1PKZA 4EXJA 4HQSA 1PN9A 4GSNA 3IDVA 1F9MA 1ZL9A 3DVXA 2JZTA 4EDZA 2MMAA 5ELAA 4TR1B 4KE3A 5COHA 5DQYA 4I2UA 2OE0A 1N8JA 1TDIA 5ECHB 2HE3A 2CAQA 1K0MA 3CSHA 2HI7A 3E9JB 4PQ1A 3EU4A 1XXUA 4XIHA 2VD0A 1OVNA 1G6YA 2FCHA 1ST9A 1DSBA 3QMXA 5GSTA 4QL9A 3ZREA 1V98A 3C71A 1Z5YE 3P2AA 4ECIA 2C4JA 4LLRA 2X8HA 5ECSA 4KH7A 4O5RA 1K0AA 3TJFA 3IC4A 3ME8A 2XC2A 4GTUA 4XRAA 2H8LA 3LSZA 1XZOA 3V1WA 4JBBA 2DLXA 4AJ7A 1YQ1A 2L59A 2OE3A 1G6WA 1GNEA 2PERA 1X5EA 5JCUA 3LYKA 4CW9A 1SYRA 1OKTA 5D73A 4OFTA 4EO3A 5CNWA 6GSWA 5CAXA 4NWYA 5E59A 3FR6A 2XHFA 3CRTA 1CQGA 1GTAA 4RQXA 5D96A 3CYNA 1PD21 3FHKA 5EPFA 4PX1A 2FNOA 5EY6A 3M0FA 3GKNA 2YN1A 2C0FA 1M7TA 3EE2A 2HT9A 4F03A 3DMLA 1THOA 3ERFA 3WGEA 4NV5A 2G2QA 1USBA 5JWRB 16GSA 4Q5RA 4PUAA 4EC0A 4K7NA 3ZIVA 4DSQA 4DVCA 3LG6A 2CV4A 4ZL8A 1BQ7A 5B6MA 1FB0A 3MAKA 3WYWA 3O3TA 5ENUA 4N11A 2GZZA 3WT2A 3P8WA 1TP9A 5LCZA 3KZQA 3VK9A 4ZIJA 1X5CA 5FWGA 2O85A 4L0WA 4GF0A 5GSSA 3QAVA 1GUMA 1VF2A 2GQKA 4TRXA 3TKSE 2GQLA 2L5OA 2KLXA 2QC7A 4HU7A 1J9BA 2F9SA 3TOTA 4MF5A 4KSMA 3O6TA 1VF4A 3H8QA 1UN2A 1NHYA 4BWQA 1S3AA 3I69A 3GL5A 4ML6A 4ZBAA 1TOFA 3L0HA 1H4OA 3CTFA 1AW9A 3QCPA 1GRXA 3GYKA 2IWTA 2DJ1A 2RUEA 4POMA 3A2VA 3N9JA 4RI6A 3LWAA 5AN1A 2VL3A 4WBRD 1T7PB 2OA7A 3A2XA 1VF3A 2GTUA 3FKFA 2LJKA 3ZTLA 1O6JA 3D22A 3Q74A 4K0NA 2XBQA 5ECLB 3KM6A 5HR0A 2KOKA 6GSYA 4TR3A 1ERVA 3TRPA 5LD0A 2IFQB 3VWWA 4ID0A 3I6AA 2IMDA 5ECPB 3GTUB 5DVBA 1FHEA 3BD2A 3QAGA 1XPVA 2JSZA 2H70A 4GLTA 2DSAA 4KB3A 5AGYA 2V32A 2O8VB 2PN8A 1I9DA 2VM2A 5J3RA 1SK1A 1KTEA 2X64A 1T8EB 1Z7PA 4H86A 3FYGA 2GDRA 1GSUA 2E0QA 2IIYA 5INYA 5IMFA 2HRNA 2LQQA 3KMOA 2RIIA 2FHEA 5CRHA 1YF0A 1FO5A 1V2AA 1RK4A 4O7HA 2OKAA 2LNSA 4XS4B 4JEDA 2GSTA 2VAFA 3FR9A 2YCDA 4POKA 4K1FA 3QR6A 1PX7A 1NW2A 5HFIA 5KEJA 1XVWA 4PGTA 3DWVA 4MP4A 3UVHA 4OFMA 1B48A 6GSVA 1TI1A 2GGTA 1EGOA 2WFCA 2X8CA 2E7PA 3EINA 1XWKA 3R2QA 3DRNA 4WEYA 3DXBA 2B7KA 1EEJA 1ZCPA 4GQCA 2CZ2A 2CX4A 1O8XA 4OCEA 4MMMA 3PR8A 2KUCA 1WRYA 2A4VA 2IMIA 3TJBA 5DBQA 1SJ6A 3G7YA 5ELGA 2YWNA 1GL8A 3WD6A 4IS0A 5DJLA 4PNFA 1BG5A 1WP0A 3MWHA 1MD3A 4AJ8A 2O87A 3HYPA 2VCTA 1GLPA 3KMNA 5G31A 3S9FA 3BJ5A 1QXHA 2IMEA 1HYUA 4GSSA 1XWAA 3VPTA 3PGTA 1PA3A 1EEMA 2AB6A 4F82A 4DSSA 4MLYA 2WRTA 4DSSB 5B8BA 3IR4A 3FK8A 1K0CA 19GSA 3GKKA 4YAPA 5KN1A 2V41A 5IO2A 2HZEB 4NAXA 1THXA 3GIXA 3Q18A 2JSYA 3NZNA 1ERTA 1J0FA 1O73A 1FG4A 3HA9A 1M9BA 2RM5A 1JHBA 1PRXA 1I5GA 3HVXA 1XOAA 2FWFA 4EF0A 3P90A 3QAWA 5DAKB 3HZ4A 2FWGA 2DBCA 1AQXA 2H1DA 3WGXA 3GKXA 4G9HA 2LJAA 1TTZA 4MPGA 2R5GA 1QK8A 2QKEA 3SBCA 3ZITA 3GNJA 1K0DA 2H6XA 3GRXA 1ZGNA 1F6MC 3IRAA 4ULXA 2E2GA 5AIVA 2KHPA 3FZAA 3GURA 2DIZA 1PMTA 2X8GA 1XFLA 4ZBBA 3LORA 2YV7A 1F3BA 2IN3A 3TKSC 1XW6A 2I9HA 2CT6A 3CSJA 4IW9A 3UEMA 9GSSA 1FVKA 4EVMA 1YJ6A 2H71A 2PUKC 4BWSA 3UBKA 3UVTA 2MZCA 5J9CA 2WB9A 2MYGA 1SK2A 4ECJA 2EC4A 5ECRB 2VO4A 3FRCA 3A5WA 3D4MA 5J4UA 1E6BA 1SL1B 2DJ3A 3KTLA 5J5NA 2P0GA 2HZFA 2CX3A 3HKRA 3D4TA 1F3AA 1BAYA 18GSA 4K0GA 1FAAA 1K3YA 2BMXA 3I9V2 3HZ8A 1KNGA 2LJRA 1A24A 4LMWA 4ZL7A 2CA8A 4I2TA 3TRQA 5IPHA 2MMOA 3BBYA 10GSA 1XOBA 3IV4A 4MZCA 1JFUA 3QPMA 1R5AA 4K7IA 2RLIA 4MH2A 4WF4A 5ABRA 1N2AA 2NDOA 5GAND 1XIYA 5F07A 2RM6A 2FD3A 2LRCA 2TRCP 3KEBA 3HJOA 2YNXA 4KCAA 1M2AA 4FH8A 4HDEA 5ID2A 4V2LA 1FW1A 3DKSA 4L5OA 3FW2A 2LKUA 3TJJA 2JACA 1BEDA 4IVFA 3F4RA 2GT6A 3ZRDA 2N5AA 3RHBA 3RPPA 2VCVA 4PURA 3KP9A 2WS2A 3U5RE 3QFAC 3KTBA 1GUKA 4N0VA 2YWIA 3K8NA 2VL9A 2L6DA 3SWLA 3VLNA 1A0FA 3F3QA 1XW9A 2CVBA 3KGKA 1M2BA 2B3SA 4LA1A 2HSYA 3L9SA 3H79A 3HXSA 2VCQA 4ACSA 1K0BA 3CBUA 3ZFLA 2PVQA 2VUPA 1OAZA 2WCIA 4CDOA 2DMLA 3ME7A 1DBYA 2LTKA 1TJDA 1YKCA 4OFNA 3TOUA 3ZVJA 2ZUPA 4D73B 4XS4A 3DD3A 3H4KA 2KP2A 5KN3A 5IPGA 3HCZA 2VCXA 4TOPA 2I81A 3G7IA 5F06A 5IO0A 4FO5A 3TKQA 3LGCA 3FZ5A 2MBTA 4OO4A 2M72A 3F6FA 3LFLA 1AQVA 1G7EA 20GSA 3Q6OA 3PH9A 1U3IA 4BL7A 1WOUA 3LYPA 1Z6MA 1AIUA 4OWYA 1AAZA 3ZMLA 1KEBA 1Z7RA 1NM3A 3BCKA 1WJKA 1M2DA 1HQOA 2GVPA 4Z7XA 3MNGA 2LV3A 3W8SA 1X9WB 2DJJA 3TJKA 5D9WA 4NXIA 4RUVA 4KDUA 4ISDA 2H66A 3UL3A 2P31A 2VCWA 1V9WA 2L4QA 3VWVA 3W8JA 1TRVA 4TR0A 3ERGA 4K9ZA 4YQMA 1LBKA 4IHUA 1KBNA 2H0GA 2YJHA 3VWXA 1SJIA 2CAIA 3UAPA 11GSA 4FIWA 4POBA 5CYYA 5J9BA 3GX0A 4GQFA 3DIEA 1Y6EA 4MK3A 2CVDA 3TDGA 2IYJA 4J2FA 2EIRA 3HY2A 4YQVA 3D21A 4TVEA 5HR1A 2J9HA 5G5EA 3GA4A 4MJCA 1AXDA 1JZDA 1GULA 3CSIA 5IMZA 2AJQB 1XVQA 4ECBA 6GSXA 3GH9A 2DMMA 5D9VA 3MSZA 2H6ZA 1Z9HA 1OC9A 4TXVA 2JL4A 3C8EA 4AGSA 1X5DA 2HFDA 3IE3A 4FYUA 1U88A 3ISOA 3KXOA 3HD5A 1WIKA 1MDKA 1EV4A 2PPTA 4DSRA 2N5FA 1A8YA 13GSA 1O81A 1T1VA 1A2JA 3TCOA 1EGRA 2VL2C 2YZHA 1NHOA 3KJYA 3TKSA 4KDYA 2V1MA 3ZL5A 3ZIJA 4AF2A 1SL0B 3APQA 5DCGA 4G19A 2C0GA 1TRWA 3UJ1A 3HJPA 1WMJA 2B5XA 6GSTA 1WPIA 4JRRA 2OADA 2H72A 2NTOA 4P3YB 3GMFA 1LJRA 1TRSA 4TKYA 3F3RA 2C80A 2H1BA 5DALA 4WR5A 3ZZXA 1MDJA 4YH2A 2LQOA 3GUSA 1JLVA 2I3YA 4XRDA 2HRFA 3H93A 1B4PA 1ML6A 2O7KA 1A2MA 3D6IA 4NHWA 5C04A 5IOXA 3A2WA 1Z6NA 5D93A 1GSYA 1GH2A 5CRGA 3FZ4A 2V6OA 4QQ7A 1DUGA 1SKSB 3UBLA 1GSQA 2WDUA 1R26A 4OCFA 4NV2A 4V1Ap 1U6TA 8GSSA 3KP8A 3KH9A 4WBJA 1JZWA 2GSRA 4YQUA 2NVLA 5HFGA 4HI7A 1OE8A 2F51A 3QOUA 2VOCA 3E3EA 1V58A 2OBIA 1EZKA 2YPMA 2XPEA 1GSDA 4HEA2 2JZRA 3ERWA 2IMFA 3TRXA 4PNGA 3E0UA 4PUFC 3CMIA 1GTIA 6GSUA 3C1RA 2FGXA 1AC1A 2H74A 5CP1A 4JR6A 2H0IA 2FA4A 5FT3A 5LNKe 3C1SA 4L5LA 2VLVA 5HQPA 1XWBA 1AUCA 1YY7A 4MA9A 2R37A 4IP1A 1ILOA 3VWUA 1EV9A 1RQMA 1FB6A 5C00A 3TKPA 2GT5A 5AISA 3C7MA 1PL2A 2YV9A 2C3NA 1EOGA 5A4WA 4LL1B 2C8UA 3A3TA 2QGVA 4TR1A 4E8HA 1GWCA 3APSA 1A2LA 5IM9A 1XW5A 5DQSA 2FLSA 14GSA 4N10A 1K3LA 5ECMB 3FY7A 2IL3A 2REMA 4QL7A 2P5QA 3HVSA 5ECNB 1Z3EA 5JCGA 5IMDA 2OBKA 2A2RA 5F05A 3GTUA 3EC3A 1SD8A 2XPDA 2DJ0A 1TK8B 4KCEA 1EWXA 4BA7A 3TB2A 3F8UA 3Q19A 3QDNA 1K3OA 1EP8A 4PXOA 3IAS2 22GSA 4HJ2A 4X0XA 1A23A 4V2NA 3HVVA 1DE1A 1PKWA 2PWJA 1V40A 3VURA 4AJ6A 5E4WA 5CRWA 1WE0A 2LS5A 1R5PA 4HQZA 2JZSA 1GP1A 4WXTA 2D2ZA 5IOWA 5H5QA 1O85A 5HR3A 3GL3A 1ZZYA 1TRUA 4HJMA 4PQIA 4ZB6A 3IXRA 1G7OA 4ZBDA 3I43A 3F4SA 3LQ7A 1OC3A 2VL2A 4IP6A 4V2MA 1YZXA 5EVOA 3GSTA 4EE0A 4O92A 1Q4JA 1W4VA 2O89A 3GH6A 2H1AA 1BX9A 3FR3A 1BYEA 2VM1A 4MCUA 2OACA 1RW1A 3KIJA 5D9XA 1C72A 1R7HA 2B1LA 4IN0A 3GX8A 3AY8A 4KSOA 2HXKA 5EL8A 2PBJA 5CO3A 2DC5A 3CRUA 2C3QA 2C3TA 3TKRA 4FYCA 1TI3A 1T3BA 1Y25A 1MDIA 4KDXA 3FZ9A 4ZB8A 5J41A 2WZ9A 3F6DA 3VI5A 2WGRA 4L0UA 2YZUA 5ECOB 1T00A 2YANA 1M9AA 3LEFA 3DVWA 3GN3A 4F9ZA 2GZYA 1Q98A 1T4YA 4MZBA 3L78A 2M46A 1T4ZA 5DJMA 4F2IA 1SYXA 3IK9A 2L4CA 2LEGA 3DGQA 1U87A 4V1Ag 4D73A 3QD9A 1GSSA 5G1KA 2LNTA 1EOHA 2GLRA 2YP6A 1TXXA 3M3MA 4EUYA 4Q5QA 4WF5A 1GUHA 4MZWA 2VLUA 3GV1A 1YEXA 3HHVA 2H1GA 4G10A 3LXTA 2LSTA 1OKDA 1UA5A 2JU5A 5ECQB 4GWRA 3GSSA 2H75A 4ZB9A 1VF1A 2GQMA 1YKAA 4F0CA 3KCMA 3CXGA 2C0EA 2FUG2 5DAKA 6GSSA 1GNWA 4XS6A 3J7Yk 2H30A 1QUWA 3RHCA 1EP7A 4IJIA 4KAEA 3GHAA 4IGJA 1YDKA 2F8FA 5D9TA 3US3A 5B8AA 2NPBA 2I4AA 1J08A 5HR2A 3F0IA 2LRNA 4EDYA 2IFQA 1TKDB 1K0NA 2L6CA 4ZILA 1IYIA 2B7JA 2ZNMA 3RPNA 1S3CA 3APOA 2XBIA 1QFNA 1SENA 1TK0B 3IHQA 3ZFBA 4L8EA 5ECKB 4NMUA 4IELA 2NBSA 2F3MA 2X99A 4RQRA 12GSA 2M80A 4K2DA 4K7OA 5DALB 1XCCA 3EMPA 1MTCA 2C0DA 4I8BA 4IQAA 1R4WA 2A2SA 2DJ2A 2H76A 1UVZA 2WULA 4Q5NA 5A4UA 1TU7A 3IPZA 4Q5FA 4EKZA 1GSEA 2B5EA 4POLA 2DJKA 2CVKA
chains in the Genus database with same CATH superfamily
4K90B 2JQ5A 1FA3A 2OE1A 5DDLA 2R3XA 2JADA 3E99A 1A0RP 1ZOFA 3T8UA 3MDKA 1ZO2A 4K8MA 3UARA 1Q7Y4 3EPTA 4HS1A 3ZVJD 1UGHI 4I6XA 5AIGA 4JZQA 4H3UA 3P7XA 3NQZA 2CWUA 1FUSA 5GZZB 1SJWA 4E8EA 4TXOA 1OYJA 2CFDA 1FOVA 5HFKA 3JUQA 1HNAA 1A2KA 3KH7A 1X9SB 3N9HA 4WKWA 4ECCA 3ED3A 1BVIA 4GXZA 3L4NA 1M3JA 1UCJA 1ZYQB 1GOVA 1E2YA 2ON5A 9RNTA 1K28A 1MWTA 2AHEA 1S3DA 3HDCA 3H1NA 2B5YA 2B1KA 3NV0A 4Z2UA 1B4QA 3PGBA 1BUJA 2F86B 3F4TA 2GXFA 4HZ2A 4NHZA 5TGNA 1GTBA 1M99A 4HOJA 3CXC2 3VI7A 3IHGA 4XBTA 1W5ZA 3Q1CA 3M9JA 3O76A 4OMVA 1EKMA 2TRXA 3F9UA 1IVUA 2J23A 4G0KA 4IT7A 4J57E 3QFBC 4MABA 3EX9A 2AYTA 2UX0A 1BSEA 1RGCA 5DCHA 4ICYA 2ZCTA 4F0BA 1BJXA 3CD63 2BIRA 4BTWA 3EURA 5FHIA 1UUGB 3CC43 1SJZA 2VLTA 4X43A 4NPBA 3OR5A 2XSHB 1KQS2 2RGQA 1O8WA 1VGLA 3F63A 1HNCA 5AI1A 2TIRA 1CEWI 3SEDA 4EL1A 1ON4A 4MMZB 4MJBA 2VIMA 3L9VA 1TK5B 1KD14 1XBSA 4MJEA 2EIQA 1UC7A 2VCZA 4O5QA 1GMRA 3RGAA 4JR4A 2P09A 1A8LA 4JE1A 1ULJB 3X3XA 2HLSA 3OX9A 3IA1A 1ACVA 1MD4A 5AIHA 1VQP3 4L8PA 2IY2A 2L5LA 4HUAA 1QAFA 5G1LA 2HNLA 1DMQA 3ZLPA 1IVXA 4N30A 4HAAA 1H75A 17GSA 1PX6A 3UIWA 1F2EA 2K18A 2LUSA 4IPBA 1ZMAA 2MMZA 4IJ3A 3U6VA 3GKMA 1NSWA 2W56B 4TXOB 4KUNA 2N5BA 3G9BA 3X40A 1JRQA 1ZYEA 3WR2A 1X9MB 4HM0B 1SD9A 3BOAA 2MBSA 4ZL9A 3DGMA 3N5OA 1LU4A 1SK0A 3AHWA 2I1UA 2EIOA 3EQQB 1ZS7A 1TU8A 4XTSA 1V57A 4JU5A 3S5CA 1JN5B 4GSTA 4XBXA 3OW22 1MOLA 4LMIA 4TW5A 2C4BA 2G0FA 3L9UA 1O7UA 4HKVB 2PVOC 4AKYA 5B6NA 2L57A 3NM2A 3EU3A 5ECIB 5KN0A 2FY6A 1MEKA 1B9XC 3TJGA 5G5FA 4DEJA 1RJOA 1SKRB 4RNZA 3C73A 5A4VA 2P5RA 4J56E 2ML5A 2RCDA 1B9YC 1G0TA 1AQWA 2KP1A 7GSSA 5M18A 3JUOA 5A5KA 2IMKA 1OPYA 4KW6A 4MH3A 1LQMB 3LW9A 2HYXA 4HM6B 1SL2B 1U3AA 1RGGA 3UB1A 1WQLB 4MMXB 4MJAA 1GLQA 5IMAA 1W01A 5ID2B 2ALBA 3MKIA 3EVIA 2GSSA 2GSQA 1JZOA 3WDGB 3M9KA 4EC6A 2GZPA 1YEPA 2XRXB 3K5TA 4Z2TA 1F37A 2F8AA 2V6KA 3JCML 3WOEB 2X49A 2X4AA 4XCSA 4FMCA 2GBXB 5H5RA 1BRHA 5JWOB 3NIVA 4WETA 3VFIA 1A67A 4CHSA 1NB3I 5GAPD 3G7JA 2GEYA 3LXZA 2YWMA 2A15A 4IKHA 2R0GA 2H19A 3CCQ3 4K6XA 1EUIC 1PGTA 5IQYA 4OO5A 5D8IA 2AV4A 3F7SA 3FH1A 3IOSA 1JB2A 4YAVA 3GFKA 5BU4A 4PQHA 3DEXA 1QQ2A 4MF6A 3RAZA 1RCLA 4ILFA 2H6YA 2K6VA 4FYBA 5JCWA 5G30A 1MWUA 1NO3A 2OJLA 3I553 1Q40B 1QGVA 2LRTA 4IBPA 1IQ8A 1LOWA 2CQ9A 2ML6A 1NDOB 4KGIA 1BNSA 1Z1SA 1M0UA 1URMA 2V2GA 2WJUA 1OHSA 1QMVA 3EMXA 4MDCA 2PGTA 3V92A 3PS8A 1OC9B 4GHOA 2IJYA 4EBGA 2MMNA 3HJMA 3PXMA 5CRDA 2FWHA 2VD1A 4RI7A 4X1UA 1GSFA 1RGKA 4IQ1A 1K0OA 3NOFA 2QSIA 3IK7A 2DIYA 1ERUA 4AEQA 3OWYA 2ON7A 1OACA 3PINA 3TUEA 4USSA 2H01A 4KA0A 1X0RA 2CFWA 3BNEA 1DETA 2W9PA 1YF1A 3M1GA 3D0ZA 1FVJA 3LOYA 4XHMA 5IMVA 4LL4B 3D5JA 1STFI 2H73A 1HNBA 4FMDA 4WYKA 1BSCA 3UMAA 4BVXB 4WYKB 4BVXA 1VQN3 2GEXA 4I4KA 3OWSA 1BAOA 3EYTA 1SKWB 2HMMB 1BSBA 1WWJA 2HMLB 4STDA 3RBTA 2P0MA 1VQM3 1GTUA 1UUVB 1RLSA 3QK9A 4I5QA 1GMPA 3UJMA 5H5SA 3PCRA 4N6OB 2YWOA 1B3SA 5B7CA 3URPA 3EWLA 1B2XA 3RDWA 1IT7A 1TW9A 3CTGA 4KX4A 4FCJA 3MYDA 4XM4A 1SU9A 3LJRA 4G2EA 2K8SA 4J5KA 2CWVA 3X3ZA 2CZ3A 1JLWA 1GY6A 4HZ4A 1PQNA 4I97A 1NJI4 2YFLB 3LH4A 5G2ZA 4CCVA 1BSDA 1BUQA 4BVYA 5JWQB 1FOHA 2R2JA 4OD7A 3SXXA 5LC6A 2BJXA 1GOUA 2PU9C 1B20A 4XDVA 3HVNA 2ES7A 4ML1A 2K9FA 4XS1A 4ZXGA 3NBJA 2FWEA 1AVLA 1I3FA 1CQHA 3W6GA 4FCMA 3KSPA 3F40A 1OE7A 3WT1A 4O32A 1IYHA 2AAWA 3LTBA 4HM4B 3FEUA 3J7Yb 2YOIA 5IIZA 5L71A 5AIXA 3UOMA 3WGDA 5CREA 4R4KA 1IT8A 2E2MA 4TN8A 3B4PA 2HZEA 2HSHA 3CPW2 1TP6A 3CNMA 4MF7A 3VPQA 3KD0A 3DY5A 1OC8A 1X1WA 1M9GA 2B6MA 4ZM8A 4WR4A 1PL1A 1ABAA 4TR4A 4WP5A 1O7HB 4R9LA 3H3HA 2CC3A 2AAEA 3WODG 1VQL3 1K734 1C7HA 2R6KA 1JNQA 4BPYA 2Z76A 2AUVA 1UGIA 5IMCA 3J7Yd 4BL2A 2Z9SA 3D4AA 4L7KA 5F8BA 2C1YA 2FA8A 1X1XA 1JBRA 1W89A 1VRSD 1B8XA 5KN2A 3MG2A 1HD2A 2ZDJA 3GZBA 1XWGA 4KZ1A 4BTXA 1W2ZA 4O5UA 2RUFA 1XWCA 4HU9A 1JN5A 2YJ7A 1JBSA 2R4VA 4MPFA 2CK3H 3M8NA 1E3RA 1VQ53 3ZMKA 3SOAA 2FXTA 5A0OB 3X42A 2PMTA 2YFIB 1G96A 2BTOT 4X4JA 1PSQA 1JJ22 4R1KA 2K8VA 2KAAA 3ZYWA 1ZX2A 1OHOA 1JZRA 4GCIA 3IBHA 3CPOA 3UL5A 3DYRA 1ERWA 1RMSA 2GS3A 3TGZA 4KNDA 7GSPA 3IAM2 5F0GA 3GZXB 1DE2A 2IPAA 2HMKB 4LMVA 2H0HA 2IA7A 3BCIA 4N0ZA 4GRFA 1PKZA 4EXJA 4HQSA 3HX8A 1PN9A 4GSNA 3IDVA 4N6UA 1F9MA 3FMWA 1ZL9A 1Q42A 4EV2A 3DVXA 2JZTA 4EDZA 1CQSA 1BRIA 2MMAA 1TFOA 2R0CA 5ELAA 3MG1A 4TR1B 4CY8A 4KE3A 4G0LA 2LYXA 5COHA 5DQYA 3ECFA 4I2UA 4NHFA 2OE0A 1N8JA 1TDIA 5ECHB 1PY3A 3ZG0A 2HE3A 2CAQA 1K0MA 3CSHA 2HI7A 3E9JB 3ZFZA 4PQ1A 2OCTA 3EU4A 1XXUA 3KCHA 3K63A 2B1XB 4XIHA 4BVYB 2K0MA 2VD0A 1OVNA 1G6YA 2FCHA 5HGRA 1B21A 1ST9A 3BNCA 4N6V0 1DSBA 3QMXA 5GSTA 4QL9A 3ZREA 1V98A 3C71A 1Z5YE 1WTHA 3P2AA 3PZWA 4ECIA 2C4JA 4LLRA 1AVKA 1NB5I 2X8HA 2HMJB 4K5SA 5ECSA 1O7NB 4KH7A 4O5RA 1K0AA 3BNDA 3TJFA 3IC4A 3ME8A 5AYSC 2XC2A 4LYLB 4GTUA 1IVWA 4XRAA 2H8LA 3LSZA 1KSIA 1XZOA 3V1WA 4JBBA 2DLXA 4AJ7A 2XR8B 4R9KA 1YQ1A 2L59A 1S723 1QALA 1JBTA 1BOXA 4PTSA 2F98A 2OE3A 1G6WA 1GNEA 1UCKA 2PERA 1X5EA 1IU7A 5JCUA 3LYKA 4CW9A 1O7GB 4LEHA 4EXRA 1SYRA 1OKTA 5D73A 4OFTA 3RNTA 4EO3A 5CNWA 6GSWA 5CAXA 3AGNA 5FGOA 4NWYA 5E59A 3FR6A 3FF0A 2XHFA 3CRTA 5BRTA 1CQGA 1GTAA 4RQXA 2PNCA 5D96A 3CYNA 2XSOB 1PD21 3FHKA 5EPFA 2Y73A 4PX1A 2FNOA 3FG4A 1QMAA 5EY6A 1ROVA 3M0FA 1QVF2 3WA3A 3GKNA 2YN1A 2C0FA 1M7TA 4A5PA 3EN1B 3EE2A 2HT9A 5BIRA 4F03A 1RNBA 1LOXA 1GSPA 3H51A 1LVNA 4RZMA 2WOFA 4WWUC 3DMLA 1THOA 3ERFA 4BIKA 3WGEA 4NV5A 2G2QA 1USBA 5JWRB 16GSA 4Q5RA 2CHCA 4PUAA 1SIHA 1Q824 1JB4A 3N8BA 4EC0A 4K7NA 1W6GA 5ELUA 3ZIVA 4DSQA 4DVCA 3LG6A 2CV4A 4ZL8A 1BQ7A 5B6MA 1FB0A 3MAKA 3WYWA 3O3TA 1ROAA 4FCZA 5ENUA 4N11A 1UW1A 1VQ83 2GZZA 3WT2A 3P8WA 1TP9A 5LCZA 3KZQA 3VK9A 2R41A 4ZIJA 1X5CA 5FWGA 2CX0A 2O85A 4L0WA 4GF0A 5GSSA 1RN1A 1GUMA 3QAVA 3CCR3 3OV4A 8RNTA 1S5AA 3T0UA 5RNTA 1VF2A 2GQKA 3ZG5A 1RRLA 4TRXA 3TKSE 1BNEA 5CF2A 2GQLA 3CC73 2L5OA 1HYFA 2KLXA 4HOHA 2QC7A 4HU7A 1VQ43 2BT3A 1J9BA 1C54A 4K2XA 1OUNA 2F9SA 4HSCX 3TOTA 4MF5A 4KSMA 1LNHA 2WGQA 1QJGA 3O6TA 1VF4A 2MF7A 1W2B2 3H8QA 1UN2A 2Z6BA 1NHYA 1LOVA 1OCVA 4BWQA 1S3AA 4CJNA 1EA2A 3I69A 2DKHA 3GL5A 4LZIA 2STDA 2W0QA 5IENA 4ML6A 4ZBAA 1TOFA 2FGTA 3CQFA 1H4OA 3L0HA 4ORLA 3CTFA 1AW9A 1RRHA 3QCPA 1GRXA 3GYKA 1OH0A 2IWTA 1I2FA 2F5WA 2DJ1A 1U8CB 2RUEA 4POMA 1YJ93 1WNHA 3A2VA 3N9JA 4RI6A 3LWAA 2CKFB 2L1SA 1I2EA 5AN1A 3X3YA 2VL3A 3STDA 4WBRD 1T7PB 2OA7A 3D9RA 3A2XA 1VF3A 2GTUA 4O2HA 4HYZA 2LJKA 4O02B 3FKFA 3ZTLA 1M904 1O6JA 3D22A 3Q74A 4K0NA 4N6MA 2GU1A 2XBQA 3FCSB 2C11A 5ECLB 3EE1A 3KM6A 5IEPA 5HR0A 2KOKA 1RCKA 6GSYA 3JUMA 4TR3A 1ERVA 3TRPA 5LD0A 2IFQB 3G713 5GSPA 3UNLA 3DMCA 3LZAA 3VWWA 4ID0A 3I6AA 3MIXA 3LT9A 2IMDA 4EIQA 4BTYA 5ECPB 1OGZA 3GTUB 2SBLA 5DVBA 1DE3A 1FHEA 3BD2A 3QAGA 3IPTA 3HOHA 1XPVA 4XDWA 2H70A 2JSZA 2XGLA 4GLTA 2DSAA 4KB3A 3G16A 5AGYA 4FQUA 1UCIA 5DREA 2V32A 2W56A 2SARA 1US1A 2O8VB 4OK0A 1I9DA 1QAKA 2PN8A 2VM2A 5J3RA 1BRGA 3DH2A 1SK1A 4GB5A 4FR9A 1KTEA 2L4VA 2X64A 1Z7PA 1T8EB 4H86A 4MJDA 3WOFB 3FYGA 2GDRA 1Q7HA 3AHSA 2QEX3 1GSUA 3CCL3 2CG1A 1TFKA 2E0QA 2IIYA 5INYA 2P0XA 5BVBA 5IMFA 2P05A 1BRNL 3PPUA 2HRNA 4HM8B 2LQQA 2D1WA 2P38A 4HM2B 3KMOA 4OUQA 1Q814 2RIIA 2F56A 2FHEA 5CRHA 1YF0A 1FO5A 1V2AA 1RK4A 5D82A 1E97A 1Q864 4O7HA 2OKAA 2LNSA 4XS4B 4JEDA 2GSTA 1I0VA 2VAFA 3JUNA 3MSOA 3FR9A 2YCDA 4POKA 4K1FA 3DM8A 3QR6A 1IQXA 1PX7A 1NW2A 5HFIA 1LRAA 2MC8A 4AKZA 5KEJA 1XVWA 1N5HA 4PGTA 3DWVA 3NX0A 4N6TA 3S67A 4MP4A 3GWRA 3WA2X 3UVHA 4OFMA 3QRDA 1B48A 6GSVA 1MGRA 1TI1A 2GGTA 1EGOA 2WFCA 2X8CA 2E7PA 1ASKA 1DMMA 3EINA 1XWKA 1JKGB 3B7CA 3DRNA 3R2QA 4WEYA 4HM1B 3DXBA 2B7KA 1YGWA 1ZCPA 1EEJA 1FYSA 2F99A 4GQCA 5CK6A 2CZ2A 2CX4A 1O8XA 5D83A 1ZGXA 4OCEA 4MMMA 3PR8A 2KUCA 1WRYA 2A4VA 2IMIA 3TJBA 3MHEA 5DBQA 1TIJA 1RN7A 1S3RA 1SJ6A 1RGHA 3G7YA 5ELGA 2YWNA 1A2VA 1GL8A 3CMA3 3WD6A 3LMLA 4IS0A 5DJLA 4PNFA 1BG5A 3EHCA 1WP0A 3MWHA 1MD3A 4AJ8A 1D6UA 2E2VA 1O7PB 2O87A 3HYPA 2VCTA 1GLPA 1IV7A 3KMNA 5G31A 3S9FA 3BJ5A 1QXHA 1W02A 1GS3A 3BIRA 1HYUA 1XWAA 2IMEA 3PGTA 4GSSA 3VPTA 1PA3A 1EEMA 2AB6A 4F82A 4DSSA 1PYLA 4MLYA 3K7CA 2WRTA 4DKIA 4DSSB 5B8BA 3IR4A 3FK8A 3K9MC 3HIGA 1K0CA 3A5EA 19GSA 3GKKA 4YAPA 2CFGA 5KN1A 2V41A 5IO2A 3CU3A 2HZEB 4NAXA 4N3VA 5JBSA 1THXA 3GIXA 3Q18A 3VGNA 2JSYA 1BANA 1D6YA 5HOHA 3NZNA 3B8LA 1ERTA 3AMOA 1J0FA 5KP4A 4BU4A 1O73A 3EBYA 2CFKA 1FG4A 3HA9A 1M9BA 1AQZA 1DYUA 5ELJA 2RM5A 1JHBA 5JPUA 1PRXA 2KXGA 1I5GA 2E2UA 3HVXA 1XOAA 2FWFA 1T2IA 4EF0A 3P90A 3HZPA 3QAWA 5DAKB 3F9SA 1MGWA 1W7CA 2CG0A 2RNTA 1CYVA 3HZ4A 2FWGA 2DBCA 1AQXA 2H1DA 3WGXA 3GKXA 4G9HA 2LJAA 1TTZA 3GZRA 4MPGA 2R5GA 1QK8A 6STDA 3KE7A 2QKEA 1T5YA 1SQWA 1YNVX 3SBCA 3ZITA 3GNJA 1K0DA 2H6XA 3GRXA 1GD4A 1ZGNA 2KF6A 3EJVA 3EC9A 1F6MC 4EYCA 1M3IA 7STDA 2O9UX 3IRAA 4ULXA 3BLZA 2XEPA 3R3EA 2E2GA 3CCJ3 5AIVA 2KHPA 2B24B 4EW5A 1W4NA 7RNTA 3FZAA 3GURA 2DIZA 1PMTA 2X8GA 1XFLA 4ZBBA 1BNGA 3LORA 3F7XA 2YV7A 1F3BA 2IN3A 1BU4A 3TKSC 5IERA 1XW6A 2OTL3 3FG1A 2XFTA 2I9HA 1B27A 2CT6A 3CSJA 4IW9A 3UEMA 9GSSA 3EN8A 2W9QA 3OXAA 3NV0B 1FVKA 3S29A 3KSED 4EVMA 4GL6A 1YJ6A 2H71A 4KT3B 2PUKC 4BWSA 1TU5A 3UBKA 3UVTA 4J9AA 2MZCA 4YKFA 1JB5A 5J9CA 5CXOA 5CLKA 2WB9A 2MYGA 2QA1A 1SK2A 3OWUA 1IVVA 2Z77A 2BU4A 4O8SA 4ECJA 2EC4A 1STDA 5ECRB 2VO4A 3FRCA 4IIAA 2UGIA 1ISKA 3AMOB 3A5WA 3D4MA 5J4UA 1E6BA 1SL1B 2DJ3A 3KTLA 5J5NA 1FUWA 2P0GA 2HZFA 3CME3 2CX3A 5I97A 3HKRA 3D4TA 1XG8A 1F3AA 1BAYA 5IG4A 18GSA 4K0GA 1FAAA 3LYGA 1K3YA 2BMXA 3I9V2 1B2SA 4HJLB 3HZ8A 1KNGA 2LJRA 3GAXA 1A24A 5JPPA 4LMWA 4ZL7A 2CA8A 1NWWA 1DMNA 4I2TA 1UDII 3TRQA 5IPHA 4HM3B 2W6JH 2MMOA 3BBYA 10GSA 1XOBA 3U97A 3PYJA 3IV4A 1W00A 4MZCA 1JFUA 2V1LA 3QPMA 2I9WA 1R5AA 3CC23 1TRQA 4K7IA 2RLIA 4MH2A 4WF4A 3KIIA 5ABRA 1N2AA 2NDOA 5GAND 4HBRA 1XIYA 5F07A 3EF8A 1BRSA 2RM6A 4LGQA 2FD3A 2LRCA 2TRCP 3KEBA 1BNJA 3HJOA 2YNXA 4KCAA 1GY5A 4LSOA 1I3IA 4FMAA 1M2AA 5M1AA 4FH8A 4HDEA 3HI7A 5ID2A 4V2LA 1FW1A 1RKYA 3DKSA 4L5OA 4K61A 3FW2A 3CCM3 5EVHA 2LKUA 2ZHXB 3TJJA 2JACA 1BEDA 4IVFA 3F4RA 2GT6A 3ZRDA 2N5AA 1TRPA 3RHBA 3RPPA 2VCVA 4PURA 3KP9A 1BNRA 3N54B 2WS2A 3U5RE 1FGTA 3QFAC 3D5GA 3KTBA 1GUKA 4G0IA 4N0VA 3SX1A 2KF4A 5IW9A 2YWIA 3K8NA 2VL9A 2L6DA 3SWLA 3VLNA 1A0FA 1I2GA 3F3QA 1XW9A 2CVBA 1K41A 3KGKA 1M2BA 2CX1A 1RGFA 2B3SA 4LA1A 3SVAA 2HSYA 1PFOA 3L9SA 4N6NB 3CCV3 1YVBI 1K9M4 1JKGA 3H79A 2QA2A 4JF8A 2BMOB 1VQ63 4TX4A 3HXSA 5KOXA 2VCQA 4ACSA 6RNTA 1K0BA 3RDEA 3MYTA 3LTAA 3M8CA 3CBUA 3ZFLA 2PVQA 2VUPA 1BRKA 1N8QA 1OAZA 2WCIA 4JRFA 2A4HA 4CDOA 2DMLA 1RGLA 1YIJ3 3ME7A 1RHLA 1DBYA 5EEOA 1BSAA 2LTKA 1TJDA 1YKCA 1MWRA 1IV9A 4OFNA 3TOUA 3VF1A 4KVHA 5AIFA 2RSXA 3ZVJA 4HZBB 1I70A 1HKXA 3NHXA 2ZUPA 4D73B 4XS4A 1F8NA 2KRTA 3DD3A 3H4KA 5IG5A 2KP2A 1PU4A 5KN3A 2CWTA 5IG3A 5IPGA 3HCZA 1BNIA 2VCXA 4TOPA 2I81A 3G7IA 5F06A 2IUKA 1O7WB 5IO0A 4FO5A 5STDA 3TKQA 3LGCA 2J8XB 1T2HA 3FG3A 3FZ5A 2MBTA 4N6LA 4OO4A 3DUKA 2M72A 3F6FA 3LFLA 1AQVA 1G7EA 2PZVA 3D5IA 4X2OA 3O8YA 20GSA 3Q6OA 3NBRA 3PH9A 3CCE3 3NBBA 1U3IA 1DVCA 4R80A 4BL7A 4FMBA 3DGYA 1SARA 1WOUA 1EQKA 3LYPA 1Z6MA 2XFSA 2GU3A 1AIUA 4OWYA 1AAZA 3ZMLA 1KEBA 3SYUA 1Z7RA 2HMOB 1NM3A 3S27A 3BCKA 1WJKA 3K0ZA 1AR0A 1I8VA 1M2DA 1HQOA 2GVPA 3LTCA 1N5PA 4Z7XA 2HRKA 3MNGA 2LV3A 3W8SA 1X9WB 2DJJA 1B2ZA 3TJKA 1HZ1A 5D9WA 2RBIA 4NXIA 4RUVA 3FF2A 3FZWA 4KDUA 4ISDA 4U13A 2H66A 2JDIH 3UL3A 2P31A 2VCWA 3G6E3 3G8ZA 1V9WA 2L4QA 4YKGA 4KFFA 1FGMA 5IF6A 3VWVA 3W8JA 1TRVA 3NQYA 4TR0A 3ERGA 1JV2B 1UI8A 4K9ZA 1QVG2 4YQMA 1LBKA 3Q3FA 4IHUA 1KBNA 2H0GA 2YJHA 3VWXA 1SJIA 3WHOA 2CAIA 3UAPA 1BNFA 11GSA 4FIWA 2XF3A 3I0YA 4POBA 1PFPA 3KZTA 5CYYA 5J9BA 2FNQA 2OTJ3 3FKAA 4PEJA 3GX0A 3FLJA 1IDPA 2AADA 4GQFA 3DIEA 2K3DA 1Y6EA 1U5OA 4EIPA 4MK3A 2CVDA 3TDGA 4RNTA 5AEUB 2IYJA 4J2FA 2EIRA 3HY2A 4YQVA 3D21A 4TVEA 5HR1A 2OQEC 1IK3A 2J9HA 5G5EA 3GA4A 1ULIB 3ER7A 4MJCA 1AXDA 2F5MA 1JZDA 1A2PA 1GULA 3CSIA 5IMZA 3DXOA 1NNVA 2AJQB 2HMNB 1YVSA 4CDLA 1UI7A 1XVQA 4ECBA 6GSXA 3GH9A 1Y4KA 1TTOA 2DMMA 5D9VA 5FW5A 3MSZA 4BL3A 2H6ZA 1Z9HA 1OC9A 4TXVA 2JL4A 3C8EA 3GRDA 3EB8A 4AGSA 3B4OA 1X5DA 2HFDA 3IE3A 4FYUA 1U88A 3ISOA 3KXOA 3HD5A 1WIKA 1MDKA 1EV4A 2PPTA 4DSRA 1RGAA 2N5FA 1A8YA 3CCU3 13GSA 1O81A 1T1VA 1A2JA 2INXA 2CIUA 3TCOA 1EGRA 5BXQA 2VL2C 2YZHA 5IG0A 1UCLA 4KFDA 1NHOA 3KJYA 1RNTA 3TKSA 4KDYA 2V1MA 3NXJA 1YJN3 2QA43 3ZL5A 5D81A 3ZIJA 1ZYNA 4AF2A 1SL0B 3APQA 3DGOA 1VQK3 4EV5A 5DCGA 5KP3A 4OVMA 4G19A 2C0GA 1TRWA 3UJ1A 3DZLA 3HJPA 1WMJA 2B5XA 6GSTA 1WPIA 4JRRA 1RTUA 2QGUA 2OADA 2H72A 3CCS3 2NTOA 4P3YB 3GMFA 1LJRA 4K1UA 1TRSA 4TKYA 3MPHA 3F3RA 2C80A 2H1BA 5DALA 2RFRA 4WR5A 3ZZXA 1MDJA 4YH2A 2LQOA 3GUSA 2HRAA 1JLVA 2I3YA 4XRDA 2Q07A 4X2HA 2HRFA 3H93A 1W6YA 1B4PA 1ML6A 2O7KA 1A2MA 3D6IA 4NHWA 2BO9B 5C04A 5IOXA 3A2WA 1Z6NA 5D93A 1GSYA 1GH2A 2KF3A 5CRGA 3FZ4A 2V6OA 4QQ7A 1DUGA 1SKSB 3UBLA 3KN4A 2DKIA 1TUHA 1GSQA 2WDUA 3MG3A 1RN4A 1R26A 4OCFA 4NV2A 4V1Ap 1U6TA 8GSSA 3KP8A 3KH9A 4WBJA 3NUVA 1JZWA 2GSRA 4YQUA 1GMQA 4QWTA 2NVLA 5HFGA 4HI7A 1M1K4 1OE8A 3ALAA 3V98A 4KF9A 3I563 2F51A 3QOUA 2VOCA 3E3EA 1V58A 3HK4A 2UZ8A 5M19A 2OBIA 1EZKA 2YPMA 2XPEA 1GSDA 4HEA2 2JZRA 3ERWA 2IMFA 3TRXA 4PNGA 3HIIA 1IQYA 3E0UA 4PUFC 4O3VA 3CMIA 1GTIA 3JUPA 6GSUA 3C1RA 2FGXA 4J8TA 1AC1A 1YGEA 2H74A 1SIIA 1MWSA 1N9EA 2CH9A 1RGEA 5CP1A 1WMNA 1W6CA 2H0IA 1YHQ3 2FA4A 4JR6A 5FT3A 1IYYA 5LNKe 3C1SA 4L5LA 1CYUA 3FGYA 2VLVA 5HQPA 4Q53A 1XWBA 1AUCA 5KOWA 1YY7A 3RGRA 4MA9A 4BIRA 2R37A 3GSPA 4IP1A 1ILOA 3VWUA 1EV9A 1RQMA 1X1YA 1FB6A 5C00A 3D3LA 3TKPA 2GT5A 4CPKA 5AISA 2LQVA 3C7MA 2GBWB 1PL2A 2YV9A 2C3NA 1D6ZA 1V74A 1EOGA 5A4WA 2BMRB 4LL1B 2C8UA 3A3TA 2QGVA 4TR1A 6GSPA 4E8HA 1R4YA 1GWCA 3APSA 3UL6A 1A2LA 5IM9A 4RNYA 1KWIA 1XW5A 5DQSA 2FLSA 14GSA 4N10A 2BMQB 1K3LA 5ECMB 3FY7A 2Y74A 2IL3A 2IMJA 1FGQA 2REMA 4QL7A 2P5QA 3HVSA 3IMAB 1VQO3 5ECNB 1Z3EA 3G4S3 5JCGA 5IMDA 1B2MA 3D79A 5IEOA 2OBKA 3MWZA 2CW9A 1RSNA 2D42A 3F8HA 2A2RA 5F05A 3GTUA 5LC7A 1O7MB 3EC3A 4WHAA 1BRJA 1SD8A 2E2TA 2XPDA 2R0PA 2DJ0A 1TK8B 2OQEA 4L8OA 2W03A 4K5RA 4KCEA 1EWXA 4BA7A 3KKGA 1AY7A 3TB2A 3F8UA 4J5GA 3Q19A 1VQ93 5AIIA 1E3VA 3QDNA 1K3OA 1EP8A 1OF5B 4PXOA 3IAS2 22GSA 4HJ2A 4X0XA 1A23A 4V2NA 3HVVA 1DE1A 5CF1A 1PKWA 3F8XA 2PWJA 1V40A 3VURA 4AJ6A 2OWPA 4CY6A 2WGOA 2A2PA 5E4WA 1G02A 3LXUX 5CRWA 1WE0A 2LS5A 1R5PA 1M1XB 4HQZA 1N8R4 2JZSA 3Q90A 3FSDA 1GP1A 1EG9B 3F14A 4WXTA 4HVNA 2D2ZA 1N9JA 4GSPA 5IOWA 5H5QA 1O85A 1CH0A 5HR3A 3GL3A 1ZZYA 1TRUA 4HJMA 4PQIA 4ZB6A 2C10A 3IXRA 1G7OA 4ZBDA 1X1UA 3I43A 3GZYB 3F4SA 3LQ7A 1OC3A 2VL2A 4IP6A 4V2MA 1YZXA 5EVOA 3GSTA 4EE0A 4O92A 4KFEA 1Q4JA 1W4VA 4H61A 1PN0A 2O89A 1J2BA 3GH6A 8CHOA 1ZYPA 1L5GB 2OOVA 2H1AA 1BX9A 3FR3A 5KP1A 3DGNA 1BYEA 2VM1A 4MCUA 2OACA 2K54A 1RW1A 2ZA4A 3KIJA 5D9XA 1GY7A 1C72A 1R7HA 3SLUA 1YIT3 2B1LA 1R4CA 4IN0A 3GX8A 3BU4A 3AY8A 4KSOA 3LTDA 2WO0A 4XB5A 2HXKA 5EL8A 2PBJA 2DC5A 5CO3A 3CRUA 2C3QA 2C3TA 3TKRA 1MNLA 4FYCA 1TI3A 1T3BA 1Y25A 3NM7A 1MDIA 4MMYB 2HSMA 3FZ9A 4KDXA 4ZB8A 5J41A 1VQQA 2WZ9A 3U1WA 2YFJB 3F6DA 3VI5A 1KC84 2WGRA 1OGXA 4L0UA 2YZUA 5ECOB 1T00A 2YANA 1M9AA 1DVDA 3LEFA 5G2GA 1BIRA 3DVWA 3GN3A 2O3OA 4F9ZA 2GZYA 3IC8A 1OHPA 1Q98A 3KFQC 1T4YA 1RDSA 3BNBA 1OF5A 4MZBA 3L78A 5DRVA 2XGNA 3CNXA 3ROBA 2M46A 1T4ZA 5DJMA 4F2IA 1SYXA 3IK9A 1WMPA 3AGOA 1NU3A 2L4CA 2W04A 2LEGA 3DGQA 1LOYA 1GYBA 1U87A 4K1VA 4V1Ag 4D73A 4NREA 2XH9A 4XBYA 3QD9A 5AYRB 1GSSA 5G1KA 2LNTA 1EOHA 2GLRA 2YP6A 3BB9A 1TXXA 3M3MA 4EUYA 4WFOA 3S28A 1Q9EA 4Q5QA 4WF5A 1GUHA 4MZWA 2VLUA 3GV1A 1LXEA 1UUWB 1YEXA 2QIYA 3HHVA 2OOVC 2H1GA 4G10A 1GD3A 3LXTA 2LSTA 3X41A 1OKDA 4Z2RA 1UA5A 1B2UA 1WMOA 2JU5A 3VSYA 5ECQB 2IUJA 4GWRA 3GSSA 3IJEB 2H75A 2W2CA 4ZB9A 2KCDA 1VF1A 2GQMA 3JVCA 2Z7AA 1YKAA 4F0CA 2UUGC 3KCMA 3CXGA 5AEWB 2C0EA 2FUG2 2ZL8A 4HM5B 2M7OA 5DAKA 6GSSA 1FUTA 1GNWA 4XS6A 3J7Yk 3G0KA 2H30A 1QUWA 3V99A 4HM7B 3RHCA 1EP7A 2WOHA 4MNNA 4RBNA 4IJIA 3LT8A 4KAEA 1GOYA 3PCSA 3GHAA 1BGSA 4IGJA 1YDKA 2F8FA 5D9TA 2R4IA 3T8NA 2KF5A 3US3A 5B8AA 3A5IA 1K8A4 2NPBA 4G1MB 2I4AA 1J08A 2BHMA 5HR2A 3F0IA 2LRNA 4EDYA 1FGOA 2IFQA 3A76A 1TKDB 2YX9A 1K0NA 1LQGC 1YI23 3EBTA 2BNGA 1A90A 3SOYA 1VZZA 2L6CA 2CFLA 4ZILA 1IYIA 2B7JA 2ZNMA 3RPNA 1FZUA 1S3CA 3DGLA 3APOA 2XBIA 1QFNA 1SENA 1TK0B 3Q2PA 1SPUA 3WMDA 3IHQA 3ZFBA 4L8EA 5ECKB 2HOHA 2F4YA 1Q40A 4NMUA 4IELA 2NBSA 2F3MA 2X99A 4RQRA 12GSA 2M80A 4K2DA 1AV4A 4K7OA 5BMUA 5DALB 1XCCA 1I0XA 3EMPA 1HU9A 1MTCA 2C0DA 4I8BA 4IQAA 4BL7B 5EQLA 1LNIA 1R4WA 2A2SA 1FGRA 2DJ2A 2H76A 4HZ9B 1FW7A 1UVZA 3L0RA 4MEIA 1VQ73 2WULA 4Q5NA 1YJW3 5A4UA 1TU7A 3IPZA 4Q5FA 4EKZA 1GSEA 2B5EA 4POLA 2DJKA 2GSPA 2CVKA
chains in the Genus database with same CATH topology
2OE1A 5DDLA 2R3XA 2JADA 1A0RP 1ZOFA 3MDKA 4K8MA 3UARA 3EPTA 4HS1A 3ZVJD 4I6XA 4JZQA 3P7XA 5GZZB 4E8EA 4TXOA 1OYJA 1FOVA 5HFKA 1HNAA 3KH7A 1X9SB 4WKWA 4ECCA 3ED3A 4GXZA 3L4NA 1ZYQB 1E2YA 2ON5A 2AHEA 1S3DA 3HDCA 3H1NA 2B5YA 2B1KA 4Z2UA 1B4QA 3F4TA 4NHZA 4HZ2A 1GTBA 1M99A 4HOJA 3VI7A 3IHGA 3O76A 4OMVA 3M9JA 2TRXA 3F9UA 2J23A 4G0KA 4J57E 3QFBC 4MABA 2AYTA 5DCHA 4ICYA 2ZCTA 4F0BA 1BJXA 3EURA 5FHIA 1SJZA 2VLTA 4X43A 4NPBA 3OR5A 1O8WA 1VGLA 3F63A 1HNCA 2TIRA 4EL1A 1ON4A 4MJBA 2VIMA 3L9VA 1TK5B 1XBSA 4MJEA 2EIQA 1UC7A 2VCZA 4O5QA 4JR4A 1A8LA 4JE1A 2HLSA 3IA1A 1ACVA 1MD4A 2IY2A 2L5LA 4HUAA 5G1LA 2HNLA 3ZLPA 4N30A 1H75A 17GSA 1PX6A 3UIWA 1F2EA 2K18A 2LUSA 1ZMAA 2MMZA 4IJ3A 3U6VA 3GKMA 1NSWA 4TXOB 4KUNA 2N5BA 3G9BA 1ZYEA 1X9MB 1SD9A 3BOAA 2MBSA 4ZL9A 3N5OA 1LU4A 1SK0A 2I1UA 2EIOA 1TU8A 4XTSA 1V57A 4JU5A 4GSTA 4TW5A 2G0FA 3L9UA 1O7UA 2PVOC 5B6NA 2L57A 3EU3A 5ECIB 5KN0A 2FY6A 3TJGA 1MEKA 1B9XC 5G5FA 4DEJA 1SKRB 3C73A 5A4VA 2P5RA 4J56E 7GSSA 1B9YC 1G0TA 1AQWA 2KP1A 5A5KA 2IMKA 4KW6A 4MH3A 3LW9A 2HYXA 1SL2B 1U3AA 4MJAA 1GLQA 5IMAA 5ID2B 2ALBA 3EVIA 2GSSA 2GSQA 1JZOA 3M9KA 2GZPA 1YEPA 4Z2TA 1F37A 2F8AA 2V6KA 3JCML 2X49A 2X4AA 4XCSA 5H5RA 5JWOB 3NIVA 4WETA 3VFIA 4CHSA 5GAPD 3G7JA 3LXZA 2YWMA 4IKHA 2R0GA 2H19A 4K6XA 1PGTA 5IQYA 4OO5A 5D8IA 2AV4A 3IOSA 4YAVA 3GFKA 4PQHA 3DEXA 1QQ2A 4MF6A 3RAZA 4ILFA 2H6YA 2K6VA 4FYBA 5JCWA 5G30A 2OJLA 1QGVA 2LRTA 4IBPA 2CQ9A 4KGIA 1M0UA 1URMA 2V2GA 2WJUA 1QMVA 3EMXA 4MDCA 2PGTA 1OC9B 2IJYA 2MMNA 3HJMA 5CRDA 2FWHA 2VD1A 4RI7A 4X1UA 1GSFA 4IQ1A 1K0OA 3NOFA 2QSIA 3IK7A 2DIYA 1ERUA 2ON7A 3PINA 3TUEA 4USSA 2H01A 4KA0A 1X0RA 1YF1A 3M1GA 3D0ZA 1FVJA 5IMVA 4XHMA 4LL4B 3D5JA 2H73A 1HNBA 4BVXB 3UMAA 4BVXA 3EYTA 1SKWB 1WWJA 3RBTA 1GTUA 4I5QA 5H5SA 2YWOA 5B7CA 3EWLA 3RDWA 1TW9A 3CTGA 4KX4A 3MYDA 4G2EA 1SU9A 3LJRA 2K8SA 2CZ3A 1JLWA 4HZ4A 1PQNA 4I97A 5G2ZA 4BVYA 5JWQB 1FOHA 2R2JA 4OD7A 2BJXA 2PU9C 2ES7A 4ML1A 2K9FA 4XS1A 4ZXGA 2FWEA 1CQHA 3W6GA 1OE7A 3WT1A 4O32A 1IYHA 2AAWA 3FEUA 3J7Yb 2YOIA 5IIZA 5L71A 5AIXA 3UOMA 3WGDA 5CREA 2E2MA 4TN8A 2HZEA 2HSHA 3VPQA 4MF7A 3KD0A 1OC8A 2B6MA 4WR4A 1PL1A 1ABAA 4TR4A 2R6KA 4BPYA 2AUVA 5IMCA 2Z9SA 5F8BA 2C1YA 2FA8A 1W89A 1VRSD 1B8XA 5KN2A 1HD2A 1XWGA 4O5UA 2RUFA 1XWCA 4HU9A 2YJ7A 2R4VA 4MPFA 3M8NA 3ZMKA 2PMTA 2BTOT 4X4JA 1PSQA 2K8VA 3ZYWA 1JZRA 4GCIA 3IBHA 3DYRA 1ERWA 2GS3A 3TGZA 4KNDA 3IAM2 5F0GA 1DE2A 2IPAA 4LMVA 2H0HA 3BCIA 4N0ZA 4GRFA 1PKZA 4EXJA 4HQSA 1PN9A 4GSNA 3IDVA 3FMWA 1F9MA 1ZL9A 3DVXA 2JZTA 4EDZA 2MMAA 2R0CA 5ELAA 4TR1B 4CY8A 4KE3A 4G0LA 5COHA 5DQYA 4I2UA 2OE0A 1N8JA 1TDIA 5ECHB 2HE3A 2CAQA 1K0MA 3CSHA 2HI7A 3E9JB 4PQ1A 3EU4A 1XXUA 4XIHA 4BVYB 2VD0A 1OVNA 1G6YA 2FCHA 1ST9A 1DSBA 3QMXA 5GSTA 4QL9A 3ZREA 1V98A 3C71A 1Z5YE 3P2AA 4ECIA 2C4JA 4LLRA 2X8HA 4K5SA 5ECSA 4KH7A 4O5RA 1K0AA 3TJFA 3IC4A 3ME8A 2XC2A 4GTUA 4XRAA 2H8LA 3LSZA 1XZOA 3V1WA 4JBBA 2DLXA 4AJ7A 1YQ1A 2L59A 4PTSA 2OE3A 1G6WA 1GNEA 2PERA 1X5EA 5JCUA 3LYKA 4CW9A 1SYRA 1OKTA 5D73A 4OFTA 4EO3A 5CNWA 6GSWA 5CAXA 4NWYA 5E59A 3FR6A 2XHFA 3CRTA 5BRTA 1CQGA 1GTAA 4RQXA 5D96A 3CYNA 1PD21 3FHKA 5EPFA 4PX1A 2FNOA 5EY6A 3M0FA 3GKNA 2YN1A 2C0FA 1M7TA 4A5PA 3EE2A 2HT9A 4F03A 3DMLA 1THOA 3ERFA 3WGEA 4NV5A 2G2QA 1USBA 5JWRB 16GSA 4Q5RA 4PUAA 4EC0A 4K7NA 3ZIVA 4DSQA 4DVCA 3LG6A 2CV4A 4ZL8A 1BQ7A 5B6MA 1FB0A 3MAKA 3WYWA 3O3TA 5ENUA 4N11A 2GZZA 3WT2A 3P8WA 1TP9A 5LCZA 3KZQA 3VK9A 4ZIJA 1X5CA 5FWGA 2O85A 4L0WA 4GF0A 5GSSA 3QAVA 1GUMA 1VF2A 2GQKA 4TRXA 3TKSE 2GQLA 2L5OA 2KLXA 2QC7A 4HU7A 1J9BA 4K2XA 2F9SA 3TOTA 4MF5A 4KSMA 3O6TA 1VF4A 3H8QA 1UN2A 1NHYA 4BWQA 1S3AA 3I69A 2DKHA 3GL5A 4ML6A 4ZBAA 1TOFA 3L0HA 1H4OA 3CTFA 1AW9A 3QCPA 1GRXA 3GYKA 2IWTA 2DJ1A 2RUEA 4POMA 3A2VA 3N9JA 4RI6A 3LWAA 5AN1A 2VL3A 4WBRD 1T7PB 2OA7A 3A2XA 1VF3A 2GTUA 3FKFA 2LJKA 3ZTLA 1O6JA 3D22A 3Q74A 4K0NA 2XBQA 5ECLB 3KM6A 5HR0A 2KOKA 6GSYA 4TR3A 1ERVA 3TRPA 5LD0A 2IFQB 3VWWA 4ID0A 3I6AA 3MIXA 2IMDA 4EIQA 5ECPB 3GTUB 5DVBA 1FHEA 3BD2A 3QAGA 1XPVA 2JSZA 2H70A 4GLTA 2DSAA 4KB3A 5AGYA 4FQUA 2V32A 2O8VB 2PN8A 1I9DA 2VM2A 5J3RA 1SK1A 1KTEA 2X64A 1T8EB 1Z7PA 4H86A 3FYGA 2GDRA 1GSUA 2E0QA 2IIYA 5INYA 5IMFA 3PPUA 2HRNA 2LQQA 3KMOA 2RIIA 2FHEA 5CRHA 1YF0A 1FO5A 1V2AA 1RK4A 4O7HA 2OKAA 2LNSA 4XS4B 4JEDA 2GSTA 2VAFA 3FR9A 2YCDA 4POKA 4K1FA 3QR6A 1PX7A 1NW2A 5HFIA 5KEJA 1XVWA 4PGTA 3DWVA 4MP4A 3UVHA 4OFMA 1B48A 6GSVA 1TI1A 2GGTA 1EGOA 2WFCA 2X8CA 2E7PA 3EINA 1XWKA 3R2QA 3DRNA 4WEYA 3DXBA 2B7KA 1EEJA 1ZCPA 4GQCA 2CZ2A 2CX4A 1O8XA 4OCEA 4MMMA 3PR8A 2KUCA 1WRYA 2A4VA 2IMIA 3TJBA 5DBQA 1SJ6A 3G7YA 5ELGA 2YWNA 1GL8A 3WD6A 4IS0A 5DJLA 4PNFA 1BG5A 1WP0A 3MWHA 1MD3A 4AJ8A 2O87A 3HYPA 2VCTA 1GLPA 3KMNA 5G31A 3S9FA 3BJ5A 1QXHA 2IMEA 1HYUA 4GSSA 1XWAA 3VPTA 3PGTA 1PA3A 1EEMA 2AB6A 4F82A 4DSSA 4MLYA 2WRTA 4DSSB 5B8BA 3IR4A 3FK8A 1K0CA 19GSA 3GKKA 4YAPA 5KN1A 2V41A 5IO2A 2HZEB 4NAXA 1THXA 3GIXA 3Q18A 2JSYA 3NZNA 1ERTA 1J0FA 1O73A 1FG4A 3HA9A 1M9BA 2RM5A 1JHBA 1PRXA 1I5GA 3HVXA 1XOAA 2FWFA 4EF0A 3P90A 3QAWA 5DAKB 3HZ4A 2FWGA 2DBCA 1AQXA 2H1DA 3WGXA 3GKXA 4G9HA 2LJAA 1TTZA 4MPGA 2R5GA 1QK8A 2QKEA 3SBCA 3ZITA 3GNJA 1K0DA 2H6XA 3GRXA 1ZGNA 1F6MC 3IRAA 4ULXA 3R3EA 2E2GA 5AIVA 2KHPA 3FZAA 3GURA 2DIZA 1PMTA 2X8GA 1XFLA 4ZBBA 3LORA 2YV7A 1F3BA 2IN3A 3TKSC 1XW6A 2I9HA 2CT6A 3CSJA 4IW9A 3UEMA 9GSSA 1FVKA 4EVMA 1YJ6A 2H71A 2PUKC 4BWSA 3UBKA 3UVTA 2MZCA 4YKFA 5J9CA 2WB9A 2MYGA 2QA1A 1SK2A 4ECJA 2EC4A 5ECRB 2VO4A 3FRCA 3A5WA 3D4MA 5J4UA 1E6BA 1SL1B 2DJ3A 3KTLA 5J5NA 2P0GA 2HZFA 2CX3A 3HKRA 3D4TA 1F3AA 1BAYA 18GSA 4K0GA 1FAAA 1K3YA 2BMXA 3I9V2 3HZ8A 1KNGA 2LJRA 1A24A 4LMWA 4ZL7A 2CA8A 4I2TA 3TRQA 5IPHA 2MMOA 3BBYA 10GSA 1XOBA 3IV4A 4MZCA 1JFUA 3QPMA 1R5AA 4K7IA 2RLIA 4MH2A 4WF4A 5ABRA 1N2AA 2NDOA 5GAND 1XIYA 5F07A 2RM6A 2FD3A 2LRCA 2TRCP 3KEBA 3HJOA 2YNXA 4KCAA 1M2AA 4FH8A 4HDEA 5ID2A 4V2LA 1FW1A 3DKSA 4L5OA 3FW2A 2LKUA 3TJJA 2JACA 1BEDA 4IVFA 3F4RA 2GT6A 3ZRDA 2N5AA 3RHBA 3RPPA 2VCVA 4PURA 3KP9A 2WS2A 3U5RE 3QFAC 3KTBA 1GUKA 4G0IA 4N0VA 2YWIA 3K8NA 2VL9A 2L6DA 3SWLA 3VLNA 1A0FA 3F3QA 1XW9A 2CVBA 3KGKA 1M2BA 2B3SA 4LA1A 2HSYA 3L9SA 3H79A 2QA2A 3HXSA 5KOXA 2VCQA 4ACSA 1K0BA 3CBUA 3ZFLA 2PVQA 2VUPA 1OAZA 2WCIA 2A4HA 4CDOA 2DMLA 3ME7A 1DBYA 2LTKA 1TJDA 1YKCA 4OFNA 3TOUA 3ZVJA 2ZUPA 4D73B 4XS4A 3DD3A 3H4KA 2KP2A 5KN3A 5IPGA 3HCZA 2VCXA 4TOPA 2I81A 3G7IA 5F06A 5IO0A 4FO5A 3TKQA 3LGCA 3FZ5A 2MBTA 4OO4A 2M72A 3F6FA 3LFLA 1AQVA 1G7EA 20GSA 3Q6OA 3PH9A 1U3IA 4BL7A 1WOUA 3LYPA 1Z6MA 1AIUA 4OWYA 1AAZA 3ZMLA 1KEBA 1Z7RA 1NM3A 3BCKA 1WJKA 1M2DA 1HQOA 2GVPA 4Z7XA 2HRKA 3MNGA 2LV3A 3W8SA 1X9WB 2DJJA 3TJKA 5D9WA 4NXIA 4RUVA 4KDUA 4ISDA 3UL3A 2H66A 2P31A 2VCWA 1V9WA 2L4QA 4YKGA 3VWVA 3W8JA 1TRVA 4TR0A 3ERGA 4K9ZA 4YQMA 1LBKA 4IHUA 1KBNA 2H0GA 2YJHA 3VWXA 1SJIA 2CAIA 3UAPA 11GSA 4FIWA 4POBA 5CYYA 5J9BA 3GX0A 4GQFA 3DIEA 1Y6EA 4EIPA 4MK3A 2CVDA 3TDGA 2IYJA 4J2FA 2EIRA 3HY2A 4YQVA 3D21A 4TVEA 5HR1A 2J9HA 5G5EA 3GA4A 4MJCA 1AXDA 1JZDA 1GULA 3CSIA 5IMZA 2AJQB 1XVQA 4ECBA 6GSXA 3GH9A 2DMMA 5D9VA 3MSZA 2H6ZA 1Z9HA 1OC9A 4TXVA 2JL4A 3C8EA 4AGSA 1X5DA 2HFDA 3IE3A 4FYUA 1U88A 3ISOA 3KXOA 3HD5A 1WIKA 1MDKA 1EV4A 2PPTA 4DSRA 2N5FA 1A8YA 13GSA 1O81A 1T1VA 1A2JA 3TCOA 1EGRA 2VL2C 2YZHA 1NHOA 3KJYA 3TKSA 4KDYA 2V1MA 3ZL5A 3ZIJA 1ZYNA 4AF2A 1SL0B 3APQA 5DCGA 4G19A 2C0GA 1TRWA 3UJ1A 3HJPA 1WMJA 2B5XA 6GSTA 1WPIA 4JRRA 2OADA 2H72A 2NTOA 4P3YB 3GMFA 1LJRA 1TRSA 4TKYA 3F3RA 2C80A 2H1BA 5DALA 4WR5A 3ZZXA 1MDJA 4YH2A 2LQOA 3GUSA 2HRAA 1JLVA 2I3YA 4XRDA 2HRFA 3H93A 1B4PA 1ML6A 2O7KA 1A2MA 3D6IA 4NHWA 5C04A 5IOXA 3A2WA 1Z6NA 5D93A 1GSYA 1GH2A 5CRGA 3FZ4A 2V6OA 4QQ7A 1DUGA 1SKSB 3UBLA 2DKIA 1GSQA 2WDUA 1R26A 4OCFA 4NV2A 4V1Ap 1U6TA 8GSSA 3KP8A 3KH9A 4WBJA 1JZWA 2GSRA 4YQUA 2NVLA 5HFGA 4HI7A 1OE8A 4KF9A 2F51A 3QOUA 2VOCA 3E3EA 1V58A 2UZ8A 2OBIA 1EZKA 2YPMA 2XPEA 1GSDA 4HEA2 2JZRA 3ERWA 2IMFA 3TRXA 4PNGA 3E0UA 4PUFC 3CMIA 1GTIA 6GSUA 3C1RA 2FGXA 1AC1A 2H74A 5CP1A 4JR6A 2H0IA 2FA4A 5FT3A 5LNKe 3C1SA 4L5LA 2VLVA 5HQPA 1XWBA 5KOWA 1AUCA 1YY7A 4MA9A 2R37A 4IP1A 1ILOA 3VWUA 1EV9A 1RQMA 1FB6A 5C00A 3TKPA 2GT5A 5AISA 3C7MA 1PL2A 2YV9A 2C3NA 1EOGA 5A4WA 4LL1B 2C8UA 3A3TA 2QGVA 4TR1A 4E8HA 1GWCA 3APSA 1A2LA 5IM9A 1XW5A 5DQSA 2FLSA 14GSA 4N10A 1K3LA 5ECMB 3FY7A 2IL3A 2REMA 4QL7A 2P5QA 3HVSA 5ECNB 1Z3EA 5JCGA 5IMDA 2OBKA 2A2RA 5F05A 3GTUA 3EC3A 1SD8A 2XPDA 2R0PA 2DJ0A 1TK8B 4K5RA 4KCEA 1EWXA 4BA7A 3TB2A 3F8UA 3Q19A 3QDNA 1K3OA 1EP8A 4PXOA 3IAS2 22GSA 4HJ2A 4X0XA 1A23A 4V2NA 3HVVA 1DE1A 1PKWA 2PWJA 1V40A 3VURA 4AJ6A 4CY6A 2A2PA 5E4WA 5CRWA 1WE0A 2LS5A 1R5PA 4HQZA 2JZSA 1GP1A 4WXTA 2D2ZA 5IOWA 5H5QA 1O85A 5HR3A 3GL3A 1ZZYA 1TRUA 4HJMA 4PQIA 4ZB6A 3IXRA 1G7OA 4ZBDA 3I43A 3F4SA 3LQ7A 1OC3A 2VL2A 4IP6A 4V2MA 1YZXA 5EVOA 3GSTA 4EE0A 4O92A 1Q4JA 1W4VA 1PN0A 2O89A 3GH6A 1ZYPA 2H1AA 1BX9A 3FR3A 1BYEA 2VM1A 4MCUA 2OACA 1RW1A 3KIJA 5D9XA 1C72A 1R7HA 2B1LA 4IN0A 3GX8A 3AY8A 4KSOA 2HXKA 5EL8A 2PBJA 5CO3A 2DC5A 3CRUA 2C3QA 2C3TA 3TKRA 4FYCA 1TI3A 1T3BA 1Y25A 1MDIA 2HSMA 3FZ9A 4KDXA 4ZB8A 5J41A 2WZ9A 3F6DA 3VI5A 2WGRA 4L0UA 2YZUA 5ECOB 1T00A 2YANA 1M9AA 3LEFA 3DVWA 3GN3A 4F9ZA 2GZYA 3IC8A 1Q98A 1T4YA 4MZBA 3L78A 2M46A 1T4ZA 5DJMA 4F2IA 1SYXA 3IK9A 2L4CA 2LEGA 3DGQA 1U87A 4V1Ag 4D73A 3QD9A 1GSSA 5G1KA 2LNTA 1EOHA 2GLRA 2YP6A 1TXXA 3M3MA 4EUYA 4Q5QA 4WF5A 1GUHA 4MZWA 2VLUA 3GV1A 1YEXA 3HHVA 2H1GA 4G10A 3LXTA 2LSTA 1OKDA 4Z2RA 1UA5A 2JU5A 5ECQB 4GWRA 3GSSA 2H75A 4ZB9A 1VF1A 2GQMA 1YKAA 4F0CA 3KCMA 3CXGA 2C0EA 2FUG2 5DAKA 6GSSA 1GNWA 4XS6A 3J7Yk 2H30A 1QUWA 3RHCA 1EP7A 4MNNA 4IJIA 4KAEA 3GHAA 4IGJA 1YDKA 2F8FA 5D9TA 3US3A 5B8AA 3A5IA 2NPBA 2I4AA 1J08A 5HR2A 3F0IA 2LRNA 4EDYA 2IFQA 1TKDB 1K0NA 2L6CA 4ZILA 1IYIA 2B7JA 2ZNMA 3RPNA 1S3CA 3APOA 2XBIA 1QFNA 1SENA 1TK0B 3IHQA 3ZFBA 4L8EA 5ECKB 4NMUA 4IELA 2NBSA 2F3MA 2X99A 4RQRA 12GSA 2M80A 4K2DA 4K7OA 5BMUA 5DALB 1XCCA 3EMPA 1MTCA 2C0DA 4I8BA 4IQAA 4BL7B 1R4WA 2A2SA 2DJ2A 2H76A 1UVZA 2WULA 4Q5NA 5A4UA 1TU7A 3IPZA 4Q5FA 4EKZA 1GSEA 2B5EA 4POLA 2DJKA 2CVKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OE1 A;  5DDL A;  2R3X A;  2JAD A;  1A0R P;  1ZOF A;  3MDK A;  4K8M A;  3UAR A;  4HS1 A;  3ZVJ D;  4I6X A;  4JZQ A;  3P7X A;  5GZZ B;  4E8E A;  4TXO A;  1OYJ A;  1FOV A;  5HFK A;  1HNA A;  3KH7 A;  1X9S B;  4WKW A;  4ECC A;  3ED3 A;  4GXZ A;  3L4N A;  1ZYQ B;  1E2Y A;  2ON5 A;  2AHE A;  1S3D A;  3HDC A;  3H1N A;  2B5Y A;  2B1K A;  1B4Q A;  3F4T A;  4NHZ A;  4HZ2 A;  1GTB A;  1M99 A;  4HOJ A;  3VI7 A;  3O76 A;  4OMV A;  3M9J A;  2TRX A;  3F9U A;  2J23 A;  4J57 E;  3QFB C;  4MAB A;  2AYT A;  5DCH A;  4F0B A;  2ZCT A;  1BJX A;  3EUR A;  5FHI A;  1SJZ A;  2VLT A;  4X43 A;  4NPB A;  3OR5 A;  1O8W A;  1VGL A;  3F63 A;  1HNC A;  2TIR A;  4EL1 A;  1ON4 A;  4MJB A;  2VIM A;  3L9V A;  1TK5 B;  1XBS A;  4MJE A;  2EIQ A;  1UC7 A;  2VCZ A;  4JR4 A;  1A8L A;  4JE1 A;  2HLS A;  3IA1 A;  1ACV A;  1MD4 A;  2IY2 A;  2L5L A;  4HUA A;  5G1L A;  2HNL A;  3ZLP A;  4N30 A;  1H75 A;  17GS A;  1PX6 A;  3UIW A;  1F2E A;  2K18 A;  2LUS A;  1ZMA A;  2MMZ A;  4IJ3 A;  3U6V A;  3GKM A;  1NSW A;  4TXO B;  4KUN A;  2N5B A;  3G9B A;  1ZYE A;  1X9M B;  1SD9 A;  3BOA A;  2MBS A;  4ZL9 A;  3N5O A;  1LU4 A;  1SK0 A;  2I1U A;  2EIO A;  1TU8 A;  4XTS A;  1V57 A;  4JU5 A;  4GST A;  4TW5 A;  2G0F A;  3L9U A;  1O7U A;  2PVO C;  5B6N A;  2L57 A;  3EU3 A;  5ECI B;  5KN0 A;  2FY6 A;  3TJG A;  1MEK A;  1B9X C;  5G5F A;  4DEJ A;  1SKR B;  3C73 A;  5A4V A;  2P5R A;  4J56 E;  7GSS A;  1B9Y C;  1G0T A;  1AQW A;  2KP1 A;  5A5K A;  2IMK A;  4KW6 A;  4MH3 A;  2HYX A;  1SL2 B;  1U3A A;  4MJA A;  1GLQ A;  5IMA A;  5ID2 B;  2ALB A;  3EVI A;  2GSS A;  2GSQ A;  1JZO A;  3M9K A;  2GZP A;  1YEP A;  1F37 A;  2F8A A;  2V6K A;  3JCM L;  4XCS A;  5H5R A;  5JWO B;  3NIV A;  4WET A;  3VFI A;  4CHS A;  5GAP D;  3G7J A;  3LXZ A;  2YWM A;  4IKH A;  2H19 A;  4K6X A;  1PGT A;  5IQY A;  4OO5 A;  5D8I A;  2AV4 A;  3IOS A;  4YAV A;  3GFK A;  4PQH A;  3DEX A;  1QQ2 A;  4MF6 A;  3RAZ A;  4ILF A;  2H6Y A;  2K6V A;  4FYB A;  5JCW A;  5G30 A;  2OJL A;  1QGV A;  2LRT A;  4IBP A;  2CQ9 A;  4KGI A;  1M0U A;  1URM A;  2V2G A;  2WJU A;  1QMV A;  3EMX A;  4MDC A;  2PGT A;  1OC9 B;  2IJY A;  2MMN A;  3HJM A;  5CRD A;  2FWH A;  2VD1 A;  4RI7 A;  4X1U A;  1GSF A;  4IQ1 A;  1K0O A;  3NOF A;  2QSI A;  3IK7 A;  2DIY A;  1ERU A;  2ON7 A;  3PIN A;  3TUE A;  2H01 A;  4KA0 A;  1X0R A;  1YF1 A;  3M1G A;  3D0Z A;  1FVJ A;  5IMV A;  4XHM A;  4LL4 B;  3D5J A;  2H73 A;  1HNB A;  3UMA A;  4BVX A;  3EYT A;  1SKW B;  1WWJ A;  3RBT A;  1GTU A;  4I5Q A;  5H5S A;  2YWO A;  5B7C A;  3EWL A;  3RDW A;  1TW9 A;  3CTG A;  4KX4 A;  4G2E A;  1SU9 A;  3LJR A;  2K8S A;  2CZ3 A;  1JLW A;  4HZ4 A;  1PQN A;  4I97 A;  5G2Z A;  4BVY A;  5JWQ B;  2R2J A;  4OD7 A;  2BJX A;  2PU9 C;  2ES7 A;  4ML1 A;  2K9F A;  4XS1 A;  4ZXG A;  2FWE A;  1CQH A;  3W6G A;  1OE7 A;  3WT1 A;  4O32 A;  1IYH A;  2AAW A;  3FEU A;  3J7Y b;  2YOI A;  5IIZ A;  5L71 A;  5AIX A;  3UOM A;  3WGD A;  5CRE A;  2E2M A;  4TN8 A;  2HZE A;  2HSH A;  3VPQ A;  4MF7 A;  3KD0 A;  1OC8 A;  2B6M A;  4WR4 A;  1PL1 A;  1ABA A;  4TR4 A;  2R6K A;  4BPY A;  2AUV A;  5IMC A;  2Z9S A;  5F8B A;  2C1Y A;  2FA8 A;  1W89 A;  1VRS D;  1B8X A;  5KN2 A;  1HD2 A;  1XWG A;  2RUF A;  1XWC A;  4HU9 A;  2YJ7 A;  2R4V A;  4MPF A;  3M8N A;  3ZMK A;  2PMT A;  2BTO T;  1PSQ A;  2K8V A;  3ZYW A;  1JZR A;  4GCI A;  3IBH A;  3DYR A;  1ERW A;  2GS3 A;  3TGZ A;  4KND A;  3IAM 2;  5F0G A;  1DE2 A;  2IPA A;  4LMV A;  2H0H A;  3BCI A;  4N0Z A;  4GRF A;  1PKZ A;  4EXJ A;  4HQS A;  1PN9 A;  4GSN A;  3IDV A;  1F9M A;  1ZL9 A;  3DVX A;  2JZT A;  4EDZ A;  2MMA A;  5ELA A;  4TR1 B;  4KE3 A;  5COH A;  5DQY A;  4I2U A;  2OE0 A;  1N8J A;  1TDI A;  5ECH B;  2HE3 A;  2CAQ A;  1K0M A;  3CSH A;  2HI7 A;  3E9J B;  4PQ1 A;  3EU4 A;  1XXU A;  4XIH A;  2VD0 A;  1OVN A;  1G6Y A;  2FCH A;  1ST9 A;  1DSB A;  3QMX A;  5GST A;  4QL9 A;  3ZRE A;  1V98 A;  3C71 A;  1Z5Y E;  3P2A A;  4ECI A;  2C4J A;  4LLR A;  2X8H A;  5ECS A;  4KH7 A;  4O5R A;  1K0A A;  3TJF A;  3IC4 A;  3ME8 A;  2XC2 A;  4GTU A;  4XRA A;  2H8L A;  3LSZ A;  1XZO A;  3V1W A;  4JBB A;  2DLX A;  4AJ7 A;  1YQ1 A;  2L59 A;  2OE3 A;  1G6W A;  1GNE A;  2PER A;  1X5E A;  5JCU A;  3LYK A;  4CW9 A;  1SYR A;  1OKT A;  5D73 A;  4OFT A;  4EO3 A;  5CNW A;  6GSW A;  5CAX A;  4NWY A;  5E59 A;  3FR6 A;  2XHF A;  3CRT A;  1CQG A;  1GTA A;  4RQX A;  5D96 A;  3CYN A;  1PD2 1;  3FHK A;  5EPF A;  4PX1 A;  2FNO A;  5EY6 A;  3M0F A;  3GKN A;  2YN1 A;  2C0F A;  1M7T A;  3EE2 A;  2HT9 A;  4F03 A;  3DML A;  1THO A;  3ERF A;  3WGE A;  4NV5 A;  2G2Q A;  1USB A;  5JWR B;  16GS A;  4Q5R A;  4PUA A;  4EC0 A;  4K7N A;  3ZIV A;  4DSQ A;  4DVC A;  3LG6 A;  2CV4 A;  4ZL8 A;  1BQ7 A;  5B6M A;  1FB0 A;  3MAK A;  3WYW A;  3O3T A;  5ENU A;  4N11 A;  2GZZ A;  3WT2 A;  3P8W A;  1TP9 A;  5LCZ A;  3KZQ A;  3VK9 A;  4ZIJ A;  1X5C A;  5FWG A;  2O85 A;  4L0W A;  4GF0 A;  5GSS A;  3QAV A;  1GUM A;  1VF2 A;  2GQK A;  4TRX A;  3TKS E;  2GQL A;  2L5O A;  2KLX A;  2QC7 A;  4HU7 A;  1J9B A;  2F9S A;  3TOT A;  4MF5 A;  4KSM A;  3O6T A;  1VF4 A;  3H8Q A;  1UN2 A;  1NHY A;  4BWQ A;  1S3A A;  3I69 A;  3GL5 A;  4ML6 A;  4ZBA A;  1TOF A;  3L0H A;  1H4O A;  3CTF A;  1AW9 A;  3QCP A;  1GRX A;  3GYK A;  2IWT A;  2DJ1 A;  2RUE A;  4POM A;  3A2V A;  3N9J A;  4RI6 A;  3LWA A;  5AN1 A;  2VL3 A;  4WBR D;  1T7P B;  2OA7 A;  3A2X A;  1VF3 A;  2GTU A;  3FKF A;  2LJK A;  3ZTL A;  1O6J A;  3D22 A;  3Q74 A;  4K0N A;  2XBQ A;  5ECL B;  3KM6 A;  5HR0 A;  2KOK A;  6GSY A;  4TR3 A;  1ERV A;  3TRP A;  5LD0 A;  2IFQ B;  3VWW A;  4ID0 A;  3I6A A;  2IMD A;  5ECP B;  3GTU B;  5DVB A;  1FHE A;  3BD2 A;  3QAG A;  1XPV A;  2JSZ A;  2H70 A;  4GLT A;  2DSA A;  4KB3 A;  5AGY A;  2V32 A;  2O8V B;  2PN8 A;  1I9D A;  2VM2 A;  5J3R A;  1SK1 A;  1KTE A;  2X64 A;  1T8E B;  1Z7P A;  4H86 A;  3FYG A;  2GDR A;  1GSU A;  2E0Q A;  2IIY A;  5INY A;  5IMF A;  2HRN A;  2LQQ A;  3KMO A;  2RII A;  2FHE A;  5CRH A;  1YF0 A;  1FO5 A;  1V2A A;  1RK4 A;  4O7H A;  2OKA A;  2LNS A;  4XS4 B;  4JED A;  2GST A;  2VAF A;  3FR9 A;  2YCD A;  4POK A;  4K1F A;  3QR6 A;  1PX7 A;  1NW2 A;  5HFI A;  5KEJ A;  1XVW A;  4PGT A;  3DWV A;  4MP4 A;  3UVH A;  4OFM A;  1B48 A;  6GSV A;  1TI1 A;  2GGT A;  1EGO A;  2WFC A;  2X8C A;  2E7P A;  3EIN A;  1XWK A;  3R2Q A;  3DRN A;  4WEY A;  3DXB A;  2B7K A;  1EEJ A;  1ZCP A;  4GQC A;  2CZ2 A;  2CX4 A;  1O8X A;  4OCE A;  4MMM A;  3PR8 A;  2KUC A;  1WRY A;  2A4V A;  2IMI A;  3TJB A;  5DBQ A;  1SJ6 A;  3G7Y A;  5ELG A;  2YWN A;  1GL8 A;  3WD6 A;  4IS0 A;  5DJL A;  4PNF A;  1BG5 A;  1WP0 A;  3MWH A;  1MD3 A;  4AJ8 A;  2O87 A;  3HYP A;  2VCT A;  1GLP A;  3KMN A;  5G31 A;  3S9F A;  3BJ5 A;  1QXH A;  2IME A;  1HYU A;  4GSS A;  1XWA A;  3VPT A;  3PGT A;  1PA3 A;  1EEM A;  2AB6 A;  4F82 A;  4DSS A;  4MLY A;  2WRT A;  4DSS B;  5B8B A;  3IR4 A;  3FK8 A;  1K0C A;  19GS A;  3GKK A;  4YAP A;  5KN1 A;  2V41 A;  5IO2 A;  2HZE B;  4NAX A;  1THX A;  3GIX A;  3Q18 A;  2JSY A;  3NZN A;  1ERT A;  1J0F A;  1O73 A;  1FG4 A;  3HA9 A;  1M9B A;  2RM5 A;  1JHB A;  1PRX A;  1I5G A;  3HVX A;  1XOA A;  2FWF A;  4EF0 A;  3P90 A;  3QAW A;  5DAK B;  3HZ4 A;  2FWG A;  2DBC A;  1AQX A;  2H1D A;  3WGX A;  3GKX A;  4G9H A;  2LJA A;  1TTZ A;  4MPG A;  2R5G A;  1QK8 A;  2QKE A;  3SBC A;  3ZIT A;  3GNJ A;  1K0D A;  2H6X A;  3GRX A;  1ZGN A;  1F6M C;  3IRA A;  4ULX A;  2E2G A;  5AIV A;  2KHP A;  3FZA A;  3GUR A;  2DIZ A;  1PMT A;  2X8G A;  1XFL A;  4ZBB A;  3LOR A;  2YV7 A;  1F3B A;  2IN3 A;  3TKS C;  1XW6 A;  2I9H A;  2CT6 A;  3CSJ A;  4IW9 A;  3UEM A;  9GSS A;  1FVK A;  4EVM A;  1YJ6 A;  2H71 A;  2PUK C;  4BWS A;  3UBK A;  3UVT A;  2MZC A;  5J9C A;  2WB9 A;  2MYG A;  1SK2 A;  4ECJ A;  2EC4 A;  5ECR B;  2VO4 A;  3FRC A;  3A5W A;  3D4M A;  5J4U A;  1E6B A;  1SL1 B;  2DJ3 A;  3KTL A;  5J5N A;  2P0G A;  2HZF A;  2CX3 A;  3HKR A;  3D4T A;  1F3A A;  1BAY A;  18GS A;  4K0G A;  1FAA A;  1K3Y A;  2BMX A;  3I9V 2;  3HZ8 A;  1KNG A;  2LJR A;  1A24 A;  4LMW A;  4ZL7 A;  2CA8 A;  4I2T A;  3TRQ A;  5IPH A;  2MMO A;  3BBY A;  10GS A;  1XOB A;  3IV4 A;  4MZC A;  1JFU A;  3QPM A;  1R5A A;  4K7I A;  2RLI A;  4MH2 A;  4WF4 A;  5ABR A;  1N2A A;  2NDO A;  5GAN D;  1XIY A;  5F07 A;  2RM6 A;  2FD3 A;  2LRC A;  2TRC P;  3KEB A;  3HJO A;  2YNX A;  4KCA A;  1M2A A;  4FH8 A;  4HDE A;  5ID2 A;  4V2L A;  1FW1 A;  3DKS A;  4L5O A;  3FW2 A;  2LKU A;  3TJJ A;  2JAC A;  1BED A;  4IVF A;  3F4R A;  2GT6 A;  3ZRD A;  2N5A A;  3RHB A;  3RPP A;  2VCV A;  4PUR A;  3KP9 A;  2WS2 A;  3U5R E;  3QFA C;  3KTB A;  1GUK A;  4N0V A;  2YWI A;  3K8N A;  2VL9 A;  2L6D A;  3SWL A;  3VLN A;  1A0F A;  3F3Q A;  1XW9 A;  2CVB A;  3KGK A;  1M2B A;  2B3S A;  4LA1 A;  2HSY A;  3L9S A;  3H79 A;  3HXS A;  2VCQ A;  4ACS A;  1K0B A;  3CBU A;  3ZFL A;  2PVQ A;  2VUP A;  1OAZ A;  2WCI A;  4CDO A;  2DML A;  3ME7 A;  1DBY A;  2LTK A;  1TJD A;  1YKC A;  4OFN A;  3TOU A;  3ZVJ A;  2ZUP A;  4D73 B;  4XS4 A;  3DD3 A;  3H4K A;  2KP2 A;  5KN3 A;  5IPG A;  3HCZ A;  2VCX A;  4TOP A;  2I81 A;  3G7I A;  5F06 A;  5IO0 A;  4FO5 A;  3TKQ A;  3LGC A;  3FZ5 A;  2MBT A;  4OO4 A;  2M72 A;  3F6F A;  3LFL A;  1AQV A;  1G7E A;  20GS A;  3Q6O A;  3PH9 A;  1U3I A;  4BL7 A;  1WOU A;  3LYP A;  1Z6M A;  1AIU A;  4OWY A;  1AAZ A;  3ZML A;  1KEB A;  1Z7R A;  1NM3 A;  3BCK A;  1WJK A;  1M2D A;  1HQO A;  2GVP A;  4Z7X A;  3MNG A;  2LV3 A;  3W8S A;  1X9W B;  2DJJ A;  3TJK A;  5D9W A;  4NXI A;  4RUV A;  4KDU A;  4ISD A;  2H66 A;  3UL3 A;  2P31 A;  2VCW A;  1V9W A;  2L4Q A;  3VWV A;  3W8J A;  1TRV A;  4TR0 A;  3ERG A;  4K9Z A;  4YQM A;  1LBK A;  4IHU A;  1KBN A;  2H0G A;  2YJH A;  3VWX A;  1SJI A;  2CAI A;  3UAP A;  11GS A;  4FIW A;  4POB A;  5CYY A;  5J9B A;  3GX0 A;  4GQF A;  3DIE A;  1Y6E A;  4MK3 A;  2CVD A;  3TDG A;  2IYJ A;  4J2F A;  2EIR A;  3HY2 A;  4YQV A;  3D21 A;  4TVE A;  5HR1 A;  2J9H A;  5G5E A;  3GA4 A;  4MJC A;  1AXD A;  1JZD A;  1GUL A;  3CSI A;  5IMZ A;  2AJQ B;  1XVQ A;  4ECB A;  6GSX A;  3GH9 A;  2DMM A;  5D9V A;  3MSZ A;  2H6Z A;  1Z9H A;  1OC9 A;  4TXV A;  2JL4 A;  3C8E A;  4AGS A;  1X5D A;  2HFD A;  3IE3 A;  4FYU A;  1U88 A;  3ISO A;  3KXO A;  3HD5 A;  1WIK A;  1MDK A;  1EV4 A;  2PPT A;  4DSR A;  2N5F A;  1A8Y A;  13GS A;  1O81 A;  1T1V A;  1A2J A;  3TCO A;  1EGR A;  2VL2 C;  2YZH A;  1NHO A;  3KJY A;  3TKS A;  4KDY A;  2V1M A;  3ZL5 A;  3ZIJ A;  4AF2 A;  1SL0 B;  3APQ A;  5DCG A;  4G19 A;  2C0G A;  1TRW A;  3UJ1 A;  3HJP A;  1WMJ A;  2B5X A;  6GST A;  1WPI A;  4JRR A;  2OAD A;  2H72 A;  2NTO A;  4P3Y B;  3GMF A;  1LJR A;  1TRS A;  4TKY A;  3F3R A;  2C80 A;  2H1B A;  5DAL A;  4WR5 A;  3ZZX A;  1MDJ A;  4YH2 A;  2LQO A;  3GUS A;  1JLV A;  2I3Y A;  4XRD A;  2HRF A;  3H93 A;  1B4P A;  1ML6 A;  2O7K A;  1A2M A;  3D6I A;  4NHW A;  5C04 A;  5IOX A;  3A2W A;  1Z6N A;  5D93 A;  1GSY A;  1GH2 A;  5CRG A;  3FZ4 A;  2V6O A;  4QQ7 A;  1DUG A;  1SKS B;  3UBL A;  1GSQ A;  2WDU A;  1R26 A;  4OCF A;  4NV2 A;  4V1A p;  1U6T A;  8GSS A;  3KP8 A;  3KH9 A;  4WBJ A;  1JZW A;  2GSR A;  4YQU A;  2NVL A;  5HFG A;  4HI7 A;  1OE8 A;  2F51 A;  3QOU A;  2VOC A;  3E3E A;  1V58 A;  2OBI A;  1EZK A;  2YPM A;  2XPE A;  1GSD A;  4HEA 2;  2JZR A;  3ERW A;  2IMF A;  3TRX A;  4PNG A;  3E0U A;  4PUF C;  3CMI A;  1GTI A;  6GSU A;  3C1R A;  2FGX A;  1AC1 A;  2H74 A;  5CP1 A;  4JR6 A;  2H0I A;  2FA4 A;  5FT3 A;  5LNK e;  3C1S A;  4L5L A;  2VLV A;  5HQP A;  1XWB A;  1AUC A;  1YY7 A;  4MA9 A;  2R37 A;  4IP1 A;  1ILO A;  3VWU A;  1EV9 A;  1RQM A;  1FB6 A;  5C00 A;  3TKP A;  2GT5 A;  5AIS A;  3C7M A;  1PL2 A;  2YV9 A;  2C3N A;  1EOG A;  5A4W A;  4LL1 B;  2C8U A;  3A3T A;  2QGV A;  4TR1 A;  4E8H A;  1GWC A;  3APS A;  1A2L A;  5IM9 A;  1XW5 A;  5DQS A;  2FLS A;  14GS A;  4N10 A;  1K3L A;  5ECM B;  3FY7 A;  2IL3 A;  2REM A;  4QL7 A;  2P5Q A;  3HVS A;  5ECN B;  1Z3E A;  5JCG A;  5IMD A;  2OBK A;  2A2R A;  5F05 A;  3GTU A;  3EC3 A;  1SD8 A;  2XPD A;  2DJ0 A;  1TK8 B;  4KCE A;  1EWX A;  4BA7 A;  3TB2 A;  3F8U A;  3Q19 A;  3QDN A;  1K3O A;  1EP8 A;  4PXO A;  3IAS 2;  22GS A;  4HJ2 A;  4X0X A;  1A23 A;  4V2N A;  3HVV A;  1DE1 A;  1PKW A;  2PWJ A;  1V40 A;  3VUR A;  4AJ6 A;  5E4W A;  5CRW A;  1WE0 A;  2LS5 A;  1R5P A;  4HQZ A;  2JZS A;  1GP1 A;  4WXT A;  2D2Z A;  5IOW A;  5H5Q A;  1O85 A;  5HR3 A;  3GL3 A;  1ZZY A;  1TRU A;  4HJM A;  4PQI A;  4ZB6 A;  3IXR A;  1G7O A;  4ZBD A;  3I43 A;  3F4S A;  3LQ7 A;  1OC3 A;  2VL2 A;  4IP6 A;  4V2M A;  1YZX A;  5EVO A;  3GST A;  4EE0 A;  4O92 A;  1Q4J A;  1W4V A;  2O89 A;  3GH6 A;  2H1A A;  1BX9 A;  3FR3 A;  1BYE A;  2VM1 A;  4MCU A;  2OAC A;  1RW1 A;  3KIJ A;  5D9X A;  1C72 A;  1R7H A;  2B1L A;  4IN0 A;  3GX8 A;  3AY8 A;  4KSO A;  2HXK A;  5EL8 A;  2PBJ A;  5CO3 A;  2DC5 A;  3CRU A;  2C3Q A;  2C3T A;  3TKR A;  4FYC A;  1TI3 A;  1T3B A;  1Y25 A;  1MDI A;  4KDX A;  3FZ9 A;  4ZB8 A;  5J41 A;  2WZ9 A;  3F6D A;  3VI5 A;  2WGR A;  4L0U A;  2YZU A;  5ECO B;  1T00 A;  2YAN A;  1M9A A;  3LEF A;  3DVW A;  3GN3 A;  4F9Z A;  2GZY A;  1Q98 A;  1T4Y A;  4MZB A;  3L78 A;  2M46 A;  1T4Z A;  5DJM A;  4F2I A;  1SYX A;  3IK9 A;  2L4C A;  2LEG A;  3DGQ A;  1U87 A;  4V1A g;  4D73 A;  3QD9 A;  1GSS A;  5G1K A;  2LNT A;  1EOH A;  2GLR A;  2YP6 A;  1TXX A;  3M3M A;  4EUY A;  4Q5Q A;  4WF5 A;  1GUH A;  4MZW A;  2VLU A;  3GV1 A;  1YEX A;  3HHV A;  2H1G A;  4G10 A;  3LXT A;  2LST A;  1OKD A;  1UA5 A;  2JU5 A;  5ECQ B;  4GWR A;  3GSS A;  2H75 A;  4ZB9 A;  1VF1 A;  2GQM A;  1YKA A;  4F0C A;  3KCM A;  3CXG A;  2C0E A;  2FUG 2;  5DAK A;  6GSS A;  1GNW A;  4XS6 A;  3J7Y k;  2H30 A;  1QUW A;  3RHC A;  1EP7 A;  4IJI A;  4KAE A;  3GHA A;  4IGJ A;  1YDK A;  2F8F A;  5D9T A;  3US3 A;  5B8A A;  2NPB A;  2I4A A;  1J08 A;  5HR2 A;  3F0I A;  2LRN A;  4EDY A;  2IFQ A;  1TKD B;  1K0N A;  2L6C A;  4ZIL A;  1IYI A;  2B7J A;  2ZNM A;  3RPN A;  1S3C A;  3APO A;  2XBI A;  1QFN A;  1SEN A;  1TK0 B;  3IHQ A;  3ZFB A;  4L8E A;  5ECK B;  4NMU A;  4IEL A;  2NBS A;  2F3M A;  2X99 A;  4RQR A;  12GS A;  2M80 A;  4K2D A;  4K7O A;  5DAL B;  1XCC A;  3EMP A;  1MTC A;  2C0D A;  4I8B A;  4IQA A;  1R4W A;  2A2S A;  2DJ2 A;  2H76 A;  1UVZ A;  2WUL A;  4Q5N A;  5A4U A;  1TU7 A;  3IPZ A;  4Q5F A;  4EKZ A;  1GSE A;  2B5E A;  4POL A;  2DJK A;  2CVK A; 
#chains in the Genus database with same CATH topology
 4K90 B;  2JQ5 A;  1FA3 A;  2OE1 A;  5DDL A;  2R3X A;  2JAD A;  3E99 A;  1A0R P;  1ZOF A;  3T8U A;  3MDK A;  1ZO2 A;  4K8M A;  3UAR A;  1Q7Y 4;  3EPT A;  4HS1 A;  3ZVJ D;  1UGH I;  4I6X A;  5AIG A;  4JZQ A;  4H3U A;  3P7X A;  3NQZ A;  2CWU A;  1FUS A;  5GZZ B;  1SJW A;  4E8E A;  4TXO A;  1OYJ A;  2CFD A;  1FOV A;  5HFK A;  3JUQ A;  1HNA A;  1A2K A;  3KH7 A;  1X9S B;  3N9H A;  4WKW A;  4ECC A;  3ED3 A;  1BVI A;  4GXZ A;  3L4N A;  1M3J A;  1UCJ A;  1ZYQ B;  1GOV A;  1E2Y A;  2ON5 A;  9RNT A;  1K28 A;  1MWT A;  2AHE A;  1S3D A;  3HDC A;  3H1N A;  2B5Y A;  2B1K A;  3NV0 A;  4Z2U A;  1B4Q A;  3PGB A;  1BUJ A;  2F86 B;  3F4T A;  2GXF A;  4HZ2 A;  4NHZ A;  5TGN A;  1GTB A;  1M99 A;  4HOJ A;  3CXC 2;  3VI7 A;  3IHG A;  4XBT A;  1W5Z A;  3Q1C A;  3M9J A;  3O76 A;  4OMV A;  1EKM A;  2TRX A;  3F9U A;  1IVU A;  2J23 A;  4G0K A;  4IT7 A;  4J57 E;  3QFB C;  4MAB A;  3EX9 A;  2AYT A;  2UX0 A;  1BSE A;  1RGC A;  5DCH A;  4ICY A;  2ZCT A;  4F0B A;  1BJX A;  3CD6 3;  2BIR A;  4BTW A;  3EUR A;  5FHI A;  1UUG B;  3CC4 3;  1SJZ A;  2VLT A;  4X43 A;  4NPB A;  3OR5 A;  2XSH B;  1KQS 2;  2RGQ A;  1O8W A;  1VGL A;  3F63 A;  1HNC A;  5AI1 A;  2TIR A;  1CEW I;  3SED A;  4EL1 A;  1ON4 A;  4MMZ B;  4MJB A;  2VIM A;  3L9V A;  1TK5 B;  1KD1 4;  1XBS A;  4MJE A;  2EIQ A;  1UC7 A;  2VCZ A;  4O5Q A;  1GMR A;  3RGA A;  4JR4 A;  2P09 A;  1A8L A;  4JE1 A;  1ULJ B;  3X3X A;  2HLS A;  3OX9 A;  3IA1 A;  1ACV A;  1MD4 A;  5AIH A;  1VQP 3;  4L8P A;  2IY2 A;  2L5L A;  4HUA A;  1QAF A;  5G1L A;  2HNL A;  1DMQ A;  3ZLP A;  1IVX A;  4N30 A;  4HAA A;  1H75 A;  17GS A;  1PX6 A;  3UIW A;  1F2E A;  2K18 A;  2LUS A;  4IPB A;  1ZMA A;  2MMZ A;  4IJ3 A;  3U6V A;  3GKM A;  1NSW A;  2W56 B;  4TXO B;  4KUN A;  2N5B A;  3G9B A;  3X40 A;  1JRQ A;  1ZYE A;  3WR2 A;  1X9M B;  4HM0 B;  1SD9 A;  3BOA A;  2MBS A;  4ZL9 A;  3DGM A;  3N5O A;  1LU4 A;  1SK0 A;  3AHW A;  2I1U A;  2EIO A;  3EQQ B;  1ZS7 A;  1TU8 A;  4XTS A;  1V57 A;  4JU5 A;  3S5C A;  1JN5 B;  4GST A;  4XBX A;  3OW2 2;  1MOL A;  4LMI A;  4TW5 A;  2C4B A;  2G0F A;  3L9U A;  1O7U A;  4HKV B;  2PVO C;  4AKY A;  5B6N A;  2L57 A;  3NM2 A;  3EU3 A;  5ECI B;  5KN0 A;  2FY6 A;  1MEK A;  1B9X C;  3TJG A;  5G5F A;  4DEJ A;  1RJO A;  1SKR B;  4RNZ A;  3C73 A;  5A4V A;  2P5R A;  4J56 E;  2ML5 A;  2RCD A;  1B9Y C;  1G0T A;  1AQW A;  2KP1 A;  7GSS A;  5M18 A;  3JUO A;  5A5K A;  2IMK A;  1OPY A;  4KW6 A;  4MH3 A;  1LQM B;  3LW9 A;  2HYX A;  4HM6 B;  1SL2 B;  1U3A A;  1RGG A;  3UB1 A;  1WQL B;  4MMX B;  4MJA A;  1GLQ A;  5IMA A;  1W01 A;  5ID2 B;  2ALB A;  3MKI A;  3EVI A;  2GSS A;  2GSQ A;  1JZO A;  3WDG B;  3M9K A;  4EC6 A;  2GZP A;  1YEP A;  2XRX B;  3K5T A;  4Z2T A;  1F37 A;  2F8A A;  2V6K A;  3JCM L;  3WOE B;  2X49 A;  2X4A A;  4XCS A;  4FMC A;  2GBX B;  5H5R A;  1BRH A;  5JWO B;  3NIV A;  4WET A;  3VFI A;  1A67 A;  4CHS A;  1NB3 I;  5GAP D;  3G7J A;  2GEY A;  3LXZ A;  2YWM A;  2A15 A;  4IKH A;  2R0G A;  2H19 A;  3CCQ 3;  4K6X A;  1EUI C;  1PGT A;  5IQY A;  4OO5 A;  5D8I A;  2AV4 A;  3F7S A;  3FH1 A;  3IOS A;  1JB2 A;  4YAV A;  3GFK A;  5BU4 A;  4PQH A;  3DEX A;  1QQ2 A;  4MF6 A;  3RAZ A;  1RCL A;  4ILF A;  2H6Y A;  2K6V A;  4FYB A;  5JCW A;  5G30 A;  1MWU A;  1NO3 A;  2OJL A;  3I55 3;  1Q40 B;  1QGV A;  2LRT A;  4IBP A;  1IQ8 A;  1LOW A;  2CQ9 A;  2ML6 A;  1NDO B;  4KGI A;  1BNS A;  1Z1S A;  1M0U A;  1URM A;  2V2G A;  2WJU A;  1OHS A;  1QMV A;  3EMX A;  4MDC A;  2PGT A;  3V92 A;  3PS8 A;  1OC9 B;  4GHO A;  2IJY A;  4EBG A;  2MMN A;  3HJM A;  3PXM A;  5CRD A;  2FWH A;  2VD1 A;  4RI7 A;  4X1U A;  1GSF A;  1RGK A;  4IQ1 A;  1K0O A;  3NOF A;  2QSI A;  3IK7 A;  2DIY A;  1ERU A;  4AEQ A;  3OWY A;  2ON7 A;  1OAC A;  3PIN A;  3TUE A;  4USS A;  2H01 A;  4KA0 A;  1X0R A;  2CFW A;  3BNE A;  1DET A;  2W9P A;  1YF1 A;  3M1G A;  3D0Z A;  1FVJ A;  3LOY A;  4XHM A;  5IMV A;  4LL4 B;  3D5J A;  1STF I;  2H73 A;  1HNB A;  4FMD A;  4WYK A;  1BSC A;  3UMA A;  4BVX B;  4WYK B;  4BVX A;  1VQN 3;  2GEX A;  4I4K A;  3OWS A;  1BAO A;  3EYT A;  1SKW B;  2HMM B;  1BSB A;  1WWJ A;  2HML B;  4STD A;  3RBT A;  2P0M A;  1VQM 3;  1GTU A;  1UUV B;  1RLS A;  3QK9 A;  4I5Q A;  1GMP A;  3UJM A;  5H5S A;  3PCR A;  4N6O B;  2YWO A;  1B3S A;  5B7C A;  3URP A;  3EWL A;  1B2X A;  3RDW A;  1IT7 A;  1TW9 A;  3CTG A;  4KX4 A;  4FCJ A;  3MYD A;  4XM4 A;  1SU9 A;  3LJR A;  4G2E A;  2K8S A;  4J5K A;  2CWV A;  3X3Z A;  2CZ3 A;  1JLW A;  1GY6 A;  4HZ4 A;  1PQN A;  4I97 A;  1NJI 4;  2YFL B;  3LH4 A;  5G2Z A;  4CCV A;  1BSD A;  1BUQ A;  4BVY A;  5JWQ B;  1FOH A;  2R2J A;  4OD7 A;  3SXX A;  5LC6 A;  2BJX A;  1GOU A;  2PU9 C;  1B20 A;  4XDV A;  3HVN A;  2ES7 A;  4ML1 A;  2K9F A;  4XS1 A;  4ZXG A;  3NBJ A;  2FWE A;  1AVL A;  1I3F A;  1CQH A;  3W6G A;  4FCM A;  3KSP A;  3F40 A;  1OE7 A;  3WT1 A;  4O32 A;  1IYH A;  2AAW A;  3LTB A;  4HM4 B;  3FEU A;  3J7Y b;  2YOI A;  5IIZ A;  5L71 A;  5AIX A;  3UOM A;  3WGD A;  5CRE A;  4R4K A;  1IT8 A;  2E2M A;  4TN8 A;  3B4P A;  2HZE A;  2HSH A;  3CPW 2;  1TP6 A;  3CNM A;  4MF7 A;  3VPQ A;  3KD0 A;  3DY5 A;  1OC8 A;  1X1W A;  1M9G A;  2B6M A;  4ZM8 A;  4WR4 A;  1PL1 A;  1ABA A;  4TR4 A;  4WP5 A;  1O7H B;  4R9L A;  3H3H A;  2CC3 A;  2AAE A;  3WOD G;  1VQL 3;  1K73 4;  1C7H A;  2R6K A;  1JNQ A;  4BPY A;  2Z76 A;  2AUV A;  1UGI A;  5IMC A;  3J7Y d;  4BL2 A;  2Z9S A;  3D4A A;  4L7K A;  5F8B A;  2C1Y A;  2FA8 A;  1X1X A;  1JBR A;  1W89 A;  1VRS D;  1B8X A;  5KN2 A;  3MG2 A;  1HD2 A;  2ZDJ A;  3GZB A;  1XWG A;  4KZ1 A;  4BTX A;  1W2Z A;  4O5U A;  2RUF A;  1XWC A;  4HU9 A;  1JN5 A;  2YJ7 A;  1JBS A;  2R4V A;  4MPF A;  2CK3 H;  3M8N A;  1E3R A;  1VQ5 3;  3ZMK A;  3SOA A;  2FXT A;  5A0O B;  3X42 A;  2PMT A;  2YFI B;  1G96 A;  2BTO T;  4X4J A;  1PSQ A;  1JJ2 2;  4R1K A;  2K8V A;  2KAA A;  3ZYW A;  1ZX2 A;  1OHO A;  1JZR A;  4GCI A;  3IBH A;  3CPO A;  3UL5 A;  3DYR A;  1ERW A;  1RMS A;  2GS3 A;  3TGZ A;  4KND A;  7GSP A;  3IAM 2;  5F0G A;  3GZX B;  1DE2 A;  2IPA A;  2HMK B;  4LMV A;  2H0H A;  2IA7 A;  3BCI A;  4N0Z A;  4GRF A;  1PKZ A;  4EXJ A;  4HQS A;  3HX8 A;  1PN9 A;  4GSN A;  3IDV A;  4N6U A;  1F9M A;  3FMW A;  1ZL9 A;  1Q42 A;  4EV2 A;  3DVX A;  2JZT A;  4EDZ A;  1CQS A;  1BRI A;  2MMA A;  1TFO A;  2R0C A;  5ELA A;  3MG1 A;  4TR1 B;  4CY8 A;  4KE3 A;  4G0L A;  2LYX A;  5COH A;  5DQY A;  3ECF A;  4I2U A;  4NHF A;  2OE0 A;  1N8J A;  1TDI A;  5ECH B;  1PY3 A;  3ZG0 A;  2HE3 A;  2CAQ A;  1K0M A;  3CSH A;  2HI7 A;  3E9J B;  3ZFZ A;  4PQ1 A;  2OCT A;  3EU4 A;  1XXU A;  3KCH A;  3K63 A;  2B1X B;  4XIH A;  4BVY B;  2K0M A;  2VD0 A;  1OVN A;  1G6Y A;  2FCH A;  5HGR A;  1B21 A;  1ST9 A;  3BNC A;  4N6V 0;  1DSB A;  3QMX A;  5GST A;  4QL9 A;  3ZRE A;  1V98 A;  3C71 A;  1Z5Y E;  1WTH A;  3P2A A;  3PZW A;  4ECI A;  2C4J A;  4LLR A;  1AVK A;  1NB5 I;  2X8H A;  2HMJ B;  4K5S A;  5ECS A;  1O7N B;  4KH7 A;  4O5R A;  1K0A A;  3BND A;  3TJF A;  3IC4 A;  3ME8 A;  5AYS C;  2XC2 A;  4LYL B;  4GTU A;  1IVW A;  4XRA A;  2H8L A;  3LSZ A;  1KSI A;  1XZO A;  3V1W A;  4JBB A;  2DLX A;  4AJ7 A;  2XR8 B;  4R9K A;  1YQ1 A;  2L59 A;  1S72 3;  1QAL A;  1JBT A;  1BOX A;  4PTS A;  2F98 A;  2OE3 A;  1G6W A;  1GNE A;  1UCK A;  2PER A;  1X5E A;  1IU7 A;  5JCU A;  3LYK A;  4CW9 A;  1O7G B;  4LEH A;  4EXR A;  1SYR A;  1OKT A;  5D73 A;  4OFT A;  3RNT A;  4EO3 A;  5CNW A;  6GSW A;  5CAX A;  3AGN A;  5FGO A;  4NWY A;  5E59 A;  3FR6 A;  3FF0 A;  2XHF A;  3CRT A;  5BRT A;  1CQG A;  1GTA A;  4RQX A;  2PNC A;  5D96 A;  3CYN A;  2XSO B;  1PD2 1;  3FHK A;  5EPF A;  2Y73 A;  4PX1 A;  2FNO A;  3FG4 A;  1QMA A;  5EY6 A;  1ROV A;  3M0F A;  1QVF 2;  3WA3 A;  3GKN A;  2YN1 A;  2C0F A;  1M7T A;  4A5P A;  3EN1 B;  3EE2 A;  2HT9 A;  5BIR A;  4F03 A;  1RNB A;  1LOX A;  1GSP A;  3H51 A;  1LVN A;  4RZM A;  2WOF A;  4WWU C;  3DML A;  1THO A;  3ERF A;  4BIK A;  3WGE A;  4NV5 A;  2G2Q A;  1USB A;  5JWR B;  16GS A;  4Q5R A;  2CHC A;  4PUA A;  1SIH A;  1Q82 4;  1JB4 A;  3N8B A;  4EC0 A;  4K7N A;  1W6G A;  5ELU A;  3ZIV A;  4DSQ A;  4DVC A;  3LG6 A;  2CV4 A;  4ZL8 A;  1BQ7 A;  5B6M A;  1FB0 A;  3MAK A;  3WYW A;  3O3T A;  1ROA A;  4FCZ A;  5ENU A;  4N11 A;  1UW1 A;  1VQ8 3;  2GZZ A;  3WT2 A;  3P8W A;  1TP9 A;  5LCZ A;  3KZQ A;  3VK9 A;  2R41 A;  4ZIJ A;  1X5C A;  5FWG A;  2CX0 A;  2O85 A;  4L0W A;  4GF0 A;  5GSS A;  1RN1 A;  1GUM A;  3QAV A;  3CCR 3;  3OV4 A;  8RNT A;  1S5A A;  3T0U A;  5RNT A;  1VF2 A;  2GQK A;  3ZG5 A;  1RRL A;  4TRX A;  3TKS E;  1BNE A;  5CF2 A;  2GQL A;  3CC7 3;  2L5O A;  1HYF A;  2KLX A;  4HOH A;  2QC7 A;  4HU7 A;  1VQ4 3;  2BT3 A;  1J9B A;  1C54 A;  4K2X A;  1OUN A;  2F9S A;  4HSC X;  3TOT A;  4MF5 A;  4KSM A;  1LNH A;  2WGQ A;  1QJG A;  3O6T A;  1VF4 A;  2MF7 A;  1W2B 2;  3H8Q A;  1UN2 A;  2Z6B A;  1NHY A;  1LOV A;  1OCV A;  4BWQ A;  1S3A A;  4CJN A;  1EA2 A;  3I69 A;  2DKH A;  3GL5 A;  4LZI A;  2STD A;  2W0Q A;  5IEN A;  4ML6 A;  4ZBA A;  1TOF A;  2FGT A;  3CQF A;  1H4O A;  3L0H A;  4ORL A;  3CTF A;  1AW9 A;  1RRH A;  3QCP A;  1GRX A;  3GYK A;  1OH0 A;  2IWT A;  1I2F A;  2F5W A;  2DJ1 A;  1U8C B;  2RUE A;  4POM A;  1YJ9 3;  1WNH A;  3A2V A;  3N9J A;  4RI6 A;  3LWA A;  2CKF B;  2L1S A;  1I2E A;  5AN1 A;  3X3Y A;  2VL3 A;  3STD A;  4WBR D;  1T7P B;  2OA7 A;  3D9R A;  3A2X A;  1VF3 A;  2GTU A;  4O2H A;  4HYZ A;  2LJK A;  4O02 B;  3FKF A;  3ZTL A;  1M90 4;  1O6J A;  3D22 A;  3Q74 A;  4K0N A;  4N6M A;  2GU1 A;  2XBQ A;  3FCS B;  2C11 A;  5ECL B;  3EE1 A;  3KM6 A;  5IEP A;  5HR0 A;  2KOK A;  1RCK A;  6GSY A;  3JUM A;  4TR3 A;  1ERV A;  3TRP A;  5LD0 A;  2IFQ B;  3G71 3;  5GSP A;  3UNL A;  3DMC A;  3LZA A;  3VWW A;  4ID0 A;  3I6A A;  3MIX A;  3LT9 A;  2IMD A;  4EIQ A;  4BTY A;  5ECP B;  1OGZ A;  3GTU B;  2SBL A;  5DVB A;  1DE3 A;  1FHE A;  3BD2 A;  3QAG A;  3IPT A;  3HOH A;  1XPV A;  4XDW A;  2H70 A;  2JSZ A;  2XGL A;  4GLT A;  2DSA A;  4KB3 A;  3G16 A;  5AGY A;  4FQU A;  1UCI A;  5DRE A;  2V32 A;  2W56 A;  2SAR A;  1US1 A;  2O8V B;  4OK0 A;  1I9D A;  1QAK A;  2PN8 A;  2VM2 A;  5J3R A;  1BRG A;  3DH2 A;  1SK1 A;  4GB5 A;  4FR9 A;  1KTE A;  2L4V A;  2X64 A;  1Z7P A;  1T8E B;  4H86 A;  4MJD A;  3WOF B;  3FYG A;  2GDR A;  1Q7H A;  3AHS A;  2QEX 3;  1GSU A;  3CCL 3;  2CG1 A;  1TFK A;  2E0Q A;  2IIY A;  5INY A;  2P0X A;  5BVB A;  5IMF A;  2P05 A;  1BRN L;  3PPU A;  2HRN A;  4HM8 B;  2LQQ A;  2D1W A;  2P38 A;  4HM2 B;  3KMO A;  4OUQ A;  1Q81 4;  2RII A;  2F56 A;  2FHE A;  5CRH A;  1YF0 A;  1FO5 A;  1V2A A;  1RK4 A;  5D82 A;  1E97 A;  1Q86 4;  4O7H A;  2OKA A;  2LNS A;  4XS4 B;  4JED A;  2GST A;  1I0V A;  2VAF A;  3JUN A;  3MSO A;  3FR9 A;  2YCD A;  4POK A;  4K1F A;  3DM8 A;  3QR6 A;  1IQX A;  1PX7 A;  1NW2 A;  5HFI A;  1LRA A;  2MC8 A;  4AKZ A;  5KEJ A;  1XVW A;  1N5H A;  4PGT A;  3DWV A;  3NX0 A;  4N6T A;  3S67 A;  4MP4 A;  3GWR A;  3WA2 X;  3UVH A;  4OFM A;  3QRD A;  1B48 A;  6GSV A;  1MGR A;  1TI1 A;  2GGT A;  1EGO A;  2WFC A;  2X8C A;  2E7P A;  1ASK A;  1DMM A;  3EIN A;  1XWK A;  1JKG B;  3B7C A;  3DRN A;  3R2Q A;  4WEY A;  4HM1 B;  3DXB A;  2B7K A;  1YGW A;  1ZCP A;  1EEJ A;  1FYS A;  2F99 A;  4GQC A;  5CK6 A;  2CZ2 A;  2CX4 A;  1O8X A;  5D83 A;  1ZGX A;  4OCE A;  4MMM A;  3PR8 A;  2KUC A;  1WRY A;  2A4V A;  2IMI A;  3TJB A;  3MHE A;  5DBQ A;  1TIJ A;  1RN7 A;  1S3R A;  1SJ6 A;  1RGH A;  3G7Y A;  5ELG A;  2YWN A;  1A2V A;  1GL8 A;  3CMA 3;  3WD6 A;  3LML A;  4IS0 A;  5DJL A;  4PNF A;  1BG5 A;  3EHC A;  1WP0 A;  3MWH A;  1MD3 A;  4AJ8 A;  1D6U A;  2E2V A;  1O7P B;  2O87 A;  3HYP A;  2VCT A;  1GLP A;  1IV7 A;  3KMN A;  5G31 A;  3S9F A;  3BJ5 A;  1QXH A;  1W02 A;  1GS3 A;  3BIR A;  1HYU A;  1XWA A;  2IME A;  3PGT A;  4GSS A;  3VPT A;  1PA3 A;  1EEM A;  2AB6 A;  4F82 A;  4DSS A;  1PYL A;  4MLY A;  3K7C A;  2WRT A;  4DKI A;  4DSS B;  5B8B A;  3IR4 A;  3FK8 A;  3K9M C;  3HIG A;  1K0C A;  3A5E A;  19GS A;  3GKK A;  4YAP A;  2CFG A;  5KN1 A;  2V41 A;  5IO2 A;  3CU3 A;  2HZE B;  4NAX A;  4N3V A;  5JBS A;  1THX A;  3GIX A;  3Q18 A;  3VGN A;  2JSY A;  1BAN A;  1D6Y A;  5HOH A;  3NZN A;  3B8L A;  1ERT A;  3AMO A;  1J0F A;  5KP4 A;  4BU4 A;  1O73 A;  3EBY A;  2CFK A;  1FG4 A;  3HA9 A;  1M9B A;  1AQZ A;  1DYU A;  5ELJ A;  2RM5 A;  1JHB A;  5JPU A;  1PRX A;  2KXG A;  1I5G A;  2E2U A;  3HVX A;  1XOA A;  2FWF A;  1T2I A;  4EF0 A;  3P90 A;  3HZP A;  3QAW A;  5DAK B;  3F9S A;  1MGW A;  1W7C A;  2CG0 A;  2RNT A;  1CYV A;  3HZ4 A;  2FWG A;  2DBC A;  1AQX A;  2H1D A;  3WGX A;  3GKX A;  4G9H A;  2LJA A;  1TTZ A;  3GZR A;  4MPG A;  2R5G A;  1QK8 A;  6STD A;  3KE7 A;  2QKE A;  1T5Y A;  1SQW A;  1YNV X;  3SBC A;  3ZIT A;  3GNJ A;  1K0D A;  2H6X A;  3GRX A;  1GD4 A;  1ZGN A;  2KF6 A;  3EJV A;  3EC9 A;  1F6M C;  4EYC A;  1M3I A;  7STD A;  2O9U X;  3IRA A;  4ULX A;  3BLZ A;  2XEP A;  3R3E A;  2E2G A;  3CCJ 3;  5AIV A;  2KHP A;  2B24 B;  4EW5 A;  1W4N A;  7RNT A;  3FZA A;  3GUR A;  2DIZ A;  1PMT A;  2X8G A;  1XFL A;  4ZBB A;  1BNG A;  3LOR A;  3F7X A;  2YV7 A;  1F3B A;  2IN3 A;  1BU4 A;  3TKS C;  5IER A;  1XW6 A;  2OTL 3;  3FG1 A;  2XFT A;  2I9H A;  1B27 A;  2CT6 A;  3CSJ A;  4IW9 A;  3UEM A;  9GSS A;  3EN8 A;  2W9Q A;  3OXA A;  3NV0 B;  1FVK A;  3S29 A;  3KSE D;  4EVM A;  4GL6 A;  1YJ6 A;  2H71 A;  4KT3 B;  2PUK C;  4BWS A;  1TU5 A;  3UBK A;  3UVT A;  4J9A A;  2MZC A;  4YKF A;  1JB5 A;  5J9C A;  5CXO A;  5CLK A;  2WB9 A;  2MYG A;  2QA1 A;  1SK2 A;  3OWU A;  1IVV A;  2Z77 A;  2BU4 A;  4O8S A;  4ECJ A;  2EC4 A;  1STD A;  5ECR B;  2VO4 A;  3FRC A;  4IIA A;  2UGI A;  1ISK A;  3AMO B;  3A5W A;  3D4M A;  5J4U A;  1E6B A;  1SL1 B;  2DJ3 A;  3KTL A;  5J5N A;  1FUW A;  2P0G A;  2HZF A;  3CME 3;  2CX3 A;  5I97 A;  3HKR A;  3D4T A;  1XG8 A;  1F3A A;  1BAY A;  5IG4 A;  18GS A;  4K0G A;  1FAA A;  3LYG A;  1K3Y A;  2BMX A;  3I9V 2;  1B2S A;  4HJL B;  3HZ8 A;  1KNG A;  2LJR A;  3GAX A;  1A24 A;  5JPP A;  4LMW A;  4ZL7 A;  2CA8 A;  1NWW A;  1DMN A;  4I2T A;  1UDI I;  3TRQ A;  5IPH A;  4HM3 B;  2W6J H;  2MMO A;  3BBY A;  10GS A;  1XOB A;  3U97 A;  3PYJ A;  3IV4 A;  1W00 A;  4MZC A;  1JFU A;  2V1L A;  3QPM A;  2I9W A;  1R5A A;  3CC2 3;  1TRQ A;  4K7I A;  2RLI A;  4MH2 A;  4WF4 A;  3KII A;  5ABR A;  1N2A A;  2NDO A;  5GAN D;  4HBR A;  1XIY A;  5F07 A;  3EF8 A;  1BRS A;  2RM6 A;  4LGQ A;  2FD3 A;  2LRC A;  2TRC P;  3KEB A;  1BNJ A;  3HJO A;  2YNX A;  4KCA A;  1GY5 A;  4LSO A;  1I3I A;  4FMA A;  1M2A A;  5M1A A;  4FH8 A;  4HDE A;  3HI7 A;  5ID2 A;  4V2L A;  1FW1 A;  1RKY A;  3DKS A;  4L5O A;  4K61 A;  3FW2 A;  3CCM 3;  5EVH A;  2LKU A;  2ZHX B;  3TJJ A;  2JAC A;  1BED A;  4IVF A;  3F4R A;  2GT6 A;  3ZRD A;  2N5A A;  1TRP A;  3RHB A;  3RPP A;  2VCV A;  4PUR A;  3KP9 A;  1BNR A;  3N54 B;  2WS2 A;  3U5R E;  1FGT A;  3QFA C;  3D5G A;  3KTB A;  1GUK A;  4G0I A;  4N0V A;  3SX1 A;  2KF4 A;  5IW9 A;  2YWI A;  3K8N A;  2VL9 A;  2L6D A;  3SWL A;  3VLN A;  1A0F A;  1I2G A;  3F3Q A;  1XW9 A;  2CVB A;  1K41 A;  3KGK A;  1M2B A;  2CX1 A;  1RGF A;  2B3S A;  4LA1 A;  3SVA A;  2HSY A;  1PFO A;  3L9S A;  4N6N B;  3CCV 3;  1YVB I;  1K9M 4;  1JKG A;  3H79 A;  2QA2 A;  4JF8 A;  2BMO B;  1VQ6 3;  4TX4 A;  3HXS A;  5KOX A;  2VCQ A;  4ACS A;  6RNT A;  1K0B A;  3RDE A;  3MYT A;  3LTA A;  3M8C A;  3CBU A;  3ZFL A;  2PVQ A;  2VUP A;  1BRK A;  1N8Q A;  1OAZ A;  2WCI A;  4JRF A;  2A4H A;  4CDO A;  2DML A;  1RGL A;  1YIJ 3;  3ME7 A;  1RHL A;  1DBY A;  5EEO A;  1BSA A;  2LTK A;  1TJD A;  1YKC A;  1MWR A;  1IV9 A;  4OFN A;  3TOU A;  3VF1 A;  4KVH A;  5AIF A;  2RSX A;  3ZVJ A;  4HZB B;  1I70 A;  1HKX A;  3NHX A;  2ZUP A;  4D73 B;  4XS4 A;  1F8N A;  2KRT A;  3DD3 A;  3H4K A;  5IG5 A;  2KP2 A;  1PU4 A;  5KN3 A;  2CWT A;  5IG3 A;  5IPG A;  3HCZ A;  1BNI A;  2VCX A;  4TOP A;  2I81 A;  3G7I A;  5F06 A;  2IUK A;  1O7W B;  5IO0 A;  4FO5 A;  5STD A;  3TKQ A;  3LGC A;  2J8X B;  1T2H A;  3FG3 A;  3FZ5 A;  2MBT A;  4N6L A;  4OO4 A;  3DUK A;  2M72 A;  3F6F A;  3LFL A;  1AQV A;  1G7E A;  2PZV A;  3D5I A;  4X2O A;  3O8Y A;  20GS A;  3Q6O A;  3NBR A;  3PH9 A;  3CCE 3;  3NBB A;  1U3I A;  1DVC A;  4R80 A;  4BL7 A;  4FMB A;  3DGY A;  1SAR A;  1WOU A;  1EQK A;  3LYP A;  1Z6M A;  2XFS A;  2GU3 A;  1AIU A;  4OWY A;  1AAZ A;  3ZML A;  1KEB A;  3SYU A;  1Z7R A;  2HMO B;  1NM3 A;  3S27 A;  3BCK A;  1WJK A;  3K0Z A;  1AR0 A;  1I8V A;  1M2D A;  1HQO A;  2GVP A;  3LTC A;  1N5P A;  4Z7X A;  2HRK A;  3MNG A;  2LV3 A;  3W8S A;  1X9W B;  2DJJ A;  1B2Z A;  3TJK A;  1HZ1 A;  5D9W A;  2RBI A;  4NXI A;  4RUV A;  3FF2 A;  3FZW A;  4KDU A;  4ISD A;  4U13 A;  2H66 A;  2JDI H;  3UL3 A;  2P31 A;  2VCW A;  3G6E 3;  3G8Z A;  1V9W A;  2L4Q A;  4YKG A;  4KFF A;  1FGM A;  5IF6 A;  3VWV A;  3W8J A;  1TRV A;  3NQY A;  4TR0 A;  3ERG A;  1JV2 B;  1UI8 A;  4K9Z A;  1QVG 2;  4YQM A;  1LBK A;  3Q3F A;  4IHU A;  1KBN A;  2H0G A;  2YJH A;  3VWX A;  1SJI A;  3WHO A;  2CAI A;  3UAP A;  1BNF A;  11GS A;  4FIW A;  2XF3 A;  3I0Y A;  4POB A;  1PFP A;  3KZT A;  5CYY A;  5J9B A;  2FNQ A;  2OTJ 3;  3FKA A;  4PEJ A;  3GX0 A;  3FLJ A;  1IDP A;  2AAD A;  4GQF A;  3DIE A;  2K3D A;  1Y6E A;  1U5O A;  4EIP A;  4MK3 A;  2CVD A;  3TDG A;  4RNT A;  5AEU B;  2IYJ A;  4J2F A;  2EIR A;  3HY2 A;  4YQV A;  3D21 A;  4TVE A;  5HR1 A;  2OQE C;  1IK3 A;  2J9H A;  5G5E A;  3GA4 A;  1ULI B;  3ER7 A;  4MJC A;  1AXD A;  2F5M A;  1JZD A;  1A2P A;  1GUL A;  3CSI A;  5IMZ A;  3DXO A;  1NNV A;  2AJQ B;  2HMN B;  1YVS A;  4CDL A;  1UI7 A;  1XVQ A;  4ECB A;  6GSX A;  3GH9 A;  1Y4K A;  1TTO A;  2DMM A;  5D9V A;  5FW5 A;  3MSZ A;  4BL3 A;  2H6Z A;  1Z9H A;  1OC9 A;  4TXV A;  2JL4 A;  3C8E A;  3GRD A;  3EB8 A;  4AGS A;  3B4O A;  1X5D A;  2HFD A;  3IE3 A;  4FYU A;  1U88 A;  3ISO A;  3KXO A;  3HD5 A;  1WIK A;  1MDK A;  1EV4 A;  2PPT A;  4DSR A;  1RGA A;  2N5F A;  1A8Y A;  3CCU 3;  13GS A;  1O81 A;  1T1V A;  1A2J A;  2INX A;  2CIU A;  3TCO A;  1EGR A;  5BXQ A;  2VL2 C;  2YZH A;  5IG0 A;  1UCL A;  4KFD A;  1NHO A;  3KJY A;  1RNT A;  3TKS A;  4KDY A;  2V1M A;  3NXJ A;  1YJN 3;  2QA4 3;  3ZL5 A;  5D81 A;  3ZIJ A;  1ZYN A;  4AF2 A;  1SL0 B;  3APQ A;  3DGO A;  1VQK 3;  4EV5 A;  5DCG A;  5KP3 A;  4OVM A;  4G19 A;  2C0G A;  1TRW A;  3UJ1 A;  3DZL A;  3HJP A;  1WMJ A;  2B5X A;  6GST A;  1WPI A;  4JRR A;  1RTU A;  2QGU A;  2OAD A;  2H72 A;  3CCS 3;  2NTO A;  4P3Y B;  3GMF A;  1LJR A;  4K1U A;  1TRS A;  4TKY A;  3MPH A;  3F3R A;  2C80 A;  2H1B A;  5DAL A;  2RFR A;  4WR5 A;  3ZZX A;  1MDJ A;  4YH2 A;  2LQO A;  3GUS A;  2HRA A;  1JLV A;  2I3Y A;  4XRD A;  2Q07 A;  4X2H A;  2HRF A;  3H93 A;  1W6Y A;  1B4P A;  1ML6 A;  2O7K A;  1A2M A;  3D6I A;  4NHW A;  2BO9 B;  5C04 A;  5IOX A;  3A2W A;  1Z6N A;  5D93 A;  1GSY A;  1GH2 A;  2KF3 A;  5CRG A;  3FZ4 A;  2V6O A;  4QQ7 A;  1DUG A;  1SKS B;  3UBL A;  3KN4 A;  2DKI A;  1TUH A;  1GSQ A;  2WDU A;  3MG3 A;  1RN4 A;  1R26 A;  4OCF A;  4NV2 A;  4V1A p;  1U6T A;  8GSS A;  3KP8 A;  3KH9 A;  4WBJ A;  3NUV A;  1JZW A;  2GSR A;  4YQU A;  1GMQ A;  4QWT A;  2NVL A;  5HFG A;  4HI7 A;  1M1K 4;  1OE8 A;  3ALA A;  3V98 A;  4KF9 A;  3I56 3;  2F51 A;  3QOU A;  2VOC A;  3E3E A;  1V58 A;  3HK4 A;  2UZ8 A;  5M19 A;  2OBI A;  1EZK A;  2YPM A;  2XPE A;  1GSD A;  4HEA 2;  2JZR A;  3ERW A;  2IMF A;  3TRX A;  4PNG A;  3HII A;  1IQY A;  3E0U A;  4PUF C;  4O3V A;  3CMI A;  1GTI A;  3JUP A;  6GSU A;  3C1R A;  2FGX A;  4J8T A;  1AC1 A;  1YGE A;  2H74 A;  1SII A;  1MWS A;  1N9E A;  2CH9 A;  1RGE A;  5CP1 A;  1WMN A;  1W6C A;  2H0I A;  1YHQ 3;  2FA4 A;  4JR6 A;  5FT3 A;  1IYY A;  5LNK e;  3C1S A;  4L5L A;  1CYU A;  3FGY A;  2VLV A;  5HQP A;  4Q53 A;  1XWB A;  1AUC A;  5KOW A;  1YY7 A;  3RGR A;  4MA9 A;  4BIR A;  2R37 A;  3GSP A;  4IP1 A;  1ILO A;  3VWU A;  1EV9 A;  1RQM A;  1X1Y A;  1FB6 A;  5C00 A;  3D3L A;  3TKP A;  2GT5 A;  4CPK A;  5AIS A;  2LQV A;  3C7M A;  2GBW B;  1PL2 A;  2YV9 A;  2C3N A;  1D6Z A;  1V74 A;  1EOG A;  5A4W A;  2BMR B;  4LL1 B;  2C8U A;  3A3T A;  2QGV A;  4TR1 A;  6GSP A;  4E8H A;  1R4Y A;  1GWC A;  3APS A;  3UL6 A;  1A2L A;  5IM9 A;  4RNY A;  1KWI A;  1XW5 A;  5DQS A;  2FLS A;  14GS A;  4N10 A;  2BMQ B;  1K3L A;  5ECM B;  3FY7 A;  2Y74 A;  2IL3 A;  2IMJ A;  1FGQ A;  2REM A;  4QL7 A;  2P5Q A;  3HVS A;  3IMA B;  1VQO 3;  5ECN B;  1Z3E A;  3G4S 3;  5JCG A;  5IMD A;  1B2M A;  3D79 A;  5IEO A;  2OBK A;  3MWZ A;  2CW9 A;  1RSN A;  2D42 A;  3F8H A;  2A2R A;  5F05 A;  3GTU A;  5LC7 A;  1O7M B;  3EC3 A;  4WHA A;  1BRJ A;  1SD8 A;  2E2T A;  2XPD A;  2R0P A;  2DJ0 A;  1TK8 B;  2OQE A;  4L8O A;  2W03 A;  4K5R A;  4KCE A;  1EWX A;  4BA7 A;  3KKG A;  1AY7 A;  3TB2 A;  3F8U A;  4J5G A;  3Q19 A;  1VQ9 3;  5AII A;  1E3V A;  3QDN A;  1K3O A;  1EP8 A;  1OF5 B;  4PXO A;  3IAS 2;  22GS A;  4HJ2 A;  4X0X A;  1A23 A;  4V2N A;  3HVV A;  1DE1 A;  5CF1 A;  1PKW A;  3F8X A;  2PWJ A;  1V40 A;  3VUR A;  4AJ6 A;  2OWP A;  4CY6 A;  2WGO A;  2A2P A;  5E4W A;  1G02 A;  3LXU X;  5CRW A;  1WE0 A;  2LS5 A;  1R5P A;  1M1X B;  4HQZ A;  1N8R 4;  2JZS A;  3Q90 A;  3FSD A;  1GP1 A;  1EG9 B;  3F14 A;  4WXT A;  4HVN A;  2D2Z A;  1N9J A;  4GSP A;  5IOW A;  5H5Q A;  1O85 A;  1CH0 A;  5HR3 A;  3GL3 A;  1ZZY A;  1TRU A;  4HJM A;  4PQI A;  4ZB6 A;  2C10 A;  3IXR A;  1G7O A;  4ZBD A;  1X1U A;  3I43 A;  3GZY B;  3F4S A;  3LQ7 A;  1OC3 A;  2VL2 A;  4IP6 A;  4V2M A;  1YZX A;  5EVO A;  3GST A;  4EE0 A;  4O92 A;  4KFE A;  1Q4J A;  1W4V A;  4H61 A;  1PN0 A;  2O89 A;  1J2B A;  3GH6 A;  8CHO A;  1ZYP A;  1L5G B;  2OOV A;  2H1A A;  1BX9 A;  3FR3 A;  5KP1 A;  3DGN A;  1BYE A;  2VM1 A;  4MCU A;  2OAC A;  2K54 A;  1RW1 A;  2ZA4 A;  3KIJ A;  5D9X A;  1GY7 A;  1C72 A;  1R7H A;  3SLU A;  1YIT 3;  2B1L A;  1R4C A;  4IN0 A;  3GX8 A;  3BU4 A;  3AY8 A;  4KSO A;  3LTD A;  2WO0 A;  4XB5 A;  2HXK A;  5EL8 A;  2PBJ A;  2DC5 A;  5CO3 A;  3CRU A;  2C3Q A;  2C3T A;  3TKR A;  1MNL A;  4FYC A;  1TI3 A;  1T3B A;  1Y25 A;  3NM7 A;  1MDI A;  4MMY B;  2HSM A;  3FZ9 A;  4KDX A;  4ZB8 A;  5J41 A;  1VQQ A;  2WZ9 A;  3U1W A;  2YFJ B;  3F6D A;  3VI5 A;  1KC8 4;  2WGR A;  1OGX A;  4L0U A;  2YZU A;  5ECO B;  1T00 A;  2YAN A;  1M9A A;  1DVD A;  3LEF A;  5G2G A;  1BIR A;  3DVW A;  3GN3 A;  2O3O A;  4F9Z A;  2GZY A;  3IC8 A;  1OHP A;  1Q98 A;  3KFQ C;  1T4Y A;  1RDS A;  3BNB A;  1OF5 A;  4MZB A;  3L78 A;  5DRV A;  2XGN A;  3CNX A;  3ROB A;  2M46 A;  1T4Z A;  5DJM A;  4F2I A;  1SYX A;  3IK9 A;  1WMP A;  3AGO A;  1NU3 A;  2L4C A;  2W04 A;  2LEG A;  3DGQ A;  1LOY A;  1GYB A;  1U87 A;  4K1V A;  4V1A g;  4D73 A;  4NRE A;  2XH9 A;  4XBY A;  3QD9 A;  5AYR B;  1GSS A;  5G1K A;  2LNT A;  1EOH A;  2GLR A;  2YP6 A;  3BB9 A;  1TXX A;  3M3M A;  4EUY A;  4WFO A;  3S28 A;  1Q9E A;  4Q5Q A;  4WF5 A;  1GUH A;  4MZW A;  2VLU A;  3GV1 A;  1LXE A;  1UUW B;  1YEX A;  2QIY A;  3HHV A;  2OOV C;  2H1G A;  4G10 A;  1GD3 A;  3LXT A;  2LST A;  3X41 A;  1OKD A;  4Z2R A;  1UA5 A;  1B2U A;  1WMO A;  2JU5 A;  3VSY A;  5ECQ B;  2IUJ A;  4GWR A;  3GSS A;  3IJE B;  2H75 A;  2W2C A;  4ZB9 A;  2KCD A;  1VF1 A;  2GQM A;  3JVC A;  2Z7A A;  1YKA A;  4F0C A;  2UUG C;  3KCM A;  3CXG A;  5AEW B;  2C0E A;  2FUG 2;  2ZL8 A;  4HM5 B;  2M7O A;  5DAK A;  6GSS A;  1FUT A;  1GNW A;  4XS6 A;  3J7Y k;  3G0K A;  2H30 A;  1QUW A;  3V99 A;  4HM7 B;  3RHC A;  1EP7 A;  2WOH A;  4MNN A;  4RBN A;  4IJI A;  3LT8 A;  4KAE A;  1GOY A;  3PCS A;  3GHA A;  1BGS A;  4IGJ A;  1YDK A;  2F8F A;  5D9T A;  2R4I A;  3T8N A;  2KF5 A;  3US3 A;  5B8A A;  3A5I A;  1K8A 4;  2NPB A;  4G1M B;  2I4A A;  1J08 A;  2BHM A;  5HR2 A;  3F0I A;  2LRN A;  4EDY A;  1FGO A;  2IFQ A;  3A76 A;  1TKD B;  2YX9 A;  1K0N A;  1LQG C;  1YI2 3;  3EBT A;  2BNG A;  1A90 A;  3SOY A;  1VZZ A;  2L6C A;  2CFL A;  4ZIL A;  1IYI A;  2B7J A;  2ZNM A;  3RPN A;  1FZU A;  1S3C A;  3DGL A;  3APO A;  2XBI A;  1QFN A;  1SEN A;  1TK0 B;  3Q2P A;  1SPU A;  3WMD A;  3IHQ A;  3ZFB A;  4L8E A;  5ECK B;  2HOH A;  2F4Y A;  1Q40 A;  4NMU A;  4IEL A;  2NBS A;  2F3M A;  2X99 A;  4RQR A;  12GS A;  2M80 A;  4K2D A;  1AV4 A;  4K7O A;  5BMU A;  5DAL B;  1XCC A;  1I0X A;  3EMP A;  1HU9 A;  1MTC A;  2C0D A;  4I8B A;  4IQA A;  4BL7 B;  5EQL A;  1LNI A;  1R4W A;  2A2S A;  1FGR A;  2DJ2 A;  2H76 A;  4HZ9 B;  1FW7 A;  1UVZ A;  3L0R A;  4MEI A;  1VQ7 3;  2WUL A;  4Q5N A;  1YJW 3;  5A4U A;  1TU7 A;  3IPZ A;  4Q5F A;  4EKZ A;  1GSE A;  2B5E A;  4POL A;  2DJK A;  2GSP A;  2CVK A; 
#chains in the Genus database with same CATH homology
 2OE1 A;  5DDL A;  2R3X A;  2JAD A;  1A0R P;  1ZOF A;  3MDK A;  4K8M A;  3UAR A;  3EPT A;  4HS1 A;  3ZVJ D;  4I6X A;  4JZQ A;  3P7X A;  5GZZ B;  4E8E A;  4TXO A;  1OYJ A;  1FOV A;  5HFK A;  1HNA A;  3KH7 A;  1X9S B;  4WKW A;  4ECC A;  3ED3 A;  4GXZ A;  3L4N A;  1ZYQ B;  1E2Y A;  2ON5 A;  2AHE A;  1S3D A;  3HDC A;  3H1N A;  2B5Y A;  2B1K A;  4Z2U A;  1B4Q A;  3F4T A;  4NHZ A;  4HZ2 A;  1GTB A;  1M99 A;  4HOJ A;  3VI7 A;  3IHG A;  3O76 A;  4OMV A;  3M9J A;  2TRX A;  3F9U A;  2J23 A;  4G0K A;  4J57 E;  3QFB C;  4MAB A;  2AYT A;  5DCH A;  4ICY A;  2ZCT A;  4F0B A;  1BJX A;  3EUR A;  5FHI A;  1SJZ A;  2VLT A;  4X43 A;  4NPB A;  3OR5 A;  1O8W A;  1VGL A;  3F63 A;  1HNC A;  2TIR A;  4EL1 A;  1ON4 A;  4MJB A;  2VIM A;  3L9V A;  1TK5 B;  1XBS A;  4MJE A;  2EIQ A;  1UC7 A;  2VCZ A;  4O5Q A;  4JR4 A;  1A8L A;  4JE1 A;  2HLS A;  3IA1 A;  1ACV A;  1MD4 A;  2IY2 A;  2L5L A;  4HUA A;  5G1L A;  2HNL A;  3ZLP A;  4N30 A;  1H75 A;  17GS A;  1PX6 A;  3UIW A;  1F2E A;  2K18 A;  2LUS A;  1ZMA A;  2MMZ A;  4IJ3 A;  3U6V A;  3GKM A;  1NSW A;  4TXO B;  4KUN A;  2N5B A;  3G9B A;  1ZYE A;  1X9M B;  1SD9 A;  3BOA A;  2MBS A;  4ZL9 A;  3N5O A;  1LU4 A;  1SK0 A;  2I1U A;  2EIO A;  1TU8 A;  4XTS A;  1V57 A;  4JU5 A;  4GST A;  4TW5 A;  2G0F A;  3L9U A;  1O7U A;  2PVO C;  5B6N A;  2L57 A;  3EU3 A;  5ECI B;  5KN0 A;  2FY6 A;  3TJG A;  1MEK A;  1B9X C;  5G5F A;  4DEJ A;  1SKR B;  3C73 A;  5A4V A;  2P5R A;  4J56 E;  7GSS A;  1B9Y C;  1G0T A;  1AQW A;  2KP1 A;  5A5K A;  2IMK A;  4KW6 A;  4MH3 A;  3LW9 A;  2HYX A;  1SL2 B;  1U3A A;  4MJA A;  1GLQ A;  5IMA A;  5ID2 B;  2ALB A;  3EVI A;  2GSS A;  2GSQ A;  1JZO A;  3M9K A;  2GZP A;  1YEP A;  4Z2T A;  1F37 A;  2F8A A;  2V6K A;  3JCM L;  2X49 A;  2X4A A;  4XCS A;  5H5R A;  5JWO B;  3NIV A;  4WET A;  3VFI A;  4CHS A;  5GAP D;  3G7J A;  3LXZ A;  2YWM A;  4IKH A;  2R0G A;  2H19 A;  4K6X A;  1PGT A;  5IQY A;  4OO5 A;  5D8I A;  2AV4 A;  3IOS A;  4YAV A;  3GFK A;  4PQH A;  3DEX A;  1QQ2 A;  4MF6 A;  3RAZ A;  4ILF A;  2H6Y A;  2K6V A;  4FYB A;  5JCW A;  5G30 A;  2OJL A;  1QGV A;  2LRT A;  4IBP A;  2CQ9 A;  4KGI A;  1M0U A;  1URM A;  2V2G A;  2WJU A;  1QMV A;  3EMX A;  4MDC A;  2PGT A;  1OC9 B;  2IJY A;  2MMN A;  3HJM A;  5CRD A;  2FWH A;  2VD1 A;  4RI7 A;  4X1U A;  1GSF A;  4IQ1 A;  1K0O A;  3NOF A;  2QSI A;  3IK7 A;  2DIY A;  1ERU A;  2ON7 A;  3PIN A;  3TUE A;  4USS A;  2H01 A;  4KA0 A;  1X0R A;  1YF1 A;  3M1G A;  3D0Z A;  1FVJ A;  5IMV A;  4XHM A;  4LL4 B;  3D5J A;  2H73 A;  1HNB A;  4BVX B;  3UMA A;  4BVX A;  3EYT A;  1SKW B;  1WWJ A;  3RBT A;  1GTU A;  4I5Q A;  5H5S A;  2YWO A;  5B7C A;  3EWL A;  3RDW A;  1TW9 A;  3CTG A;  4KX4 A;  3MYD A;  4G2E A;  1SU9 A;  3LJR A;  2K8S A;  2CZ3 A;  1JLW A;  4HZ4 A;  1PQN A;  4I97 A;  5G2Z A;  4BVY A;  5JWQ B;  1FOH A;  2R2J A;  4OD7 A;  2BJX A;  2PU9 C;  2ES7 A;  4ML1 A;  2K9F A;  4XS1 A;  4ZXG A;  2FWE A;  1CQH A;  3W6G A;  1OE7 A;  3WT1 A;  4O32 A;  1IYH A;  2AAW A;  3FEU A;  3J7Y b;  2YOI A;  5IIZ A;  5L71 A;  5AIX A;  3UOM A;  3WGD A;  5CRE A;  2E2M A;  4TN8 A;  2HZE A;  2HSH A;  3VPQ A;  4MF7 A;  3KD0 A;  1OC8 A;  2B6M A;  4WR4 A;  1PL1 A;  1ABA A;  4TR4 A;  2R6K A;  4BPY A;  2AUV A;  5IMC A;  2Z9S A;  5F8B A;  2C1Y A;  2FA8 A;  1W89 A;  1VRS D;  1B8X A;  5KN2 A;  1HD2 A;  1XWG A;  4O5U A;  2RUF A;  1XWC A;  4HU9 A;  2YJ7 A;  2R4V A;  4MPF A;  3M8N A;  3ZMK A;  2PMT A;  2BTO T;  4X4J A;  1PSQ A;  2K8V A;  3ZYW A;  1JZR A;  4GCI A;  3IBH A;  3DYR A;  1ERW A;  2GS3 A;  3TGZ A;  4KND A;  3IAM 2;  5F0G A;  1DE2 A;  2IPA A;  4LMV A;  2H0H A;  3BCI A;  4N0Z A;  4GRF A;  1PKZ A;  4EXJ A;  4HQS A;  1PN9 A;  4GSN A;  3IDV A;  3FMW A;  1F9M A;  1ZL9 A;  3DVX A;  2JZT A;  4EDZ A;  2MMA A;  2R0C A;  5ELA A;  4TR1 B;  4CY8 A;  4KE3 A;  4G0L A;  5COH A;  5DQY A;  4I2U A;  2OE0 A;  1N8J A;  1TDI A;  5ECH B;  2HE3 A;  2CAQ A;  1K0M A;  3CSH A;  2HI7 A;  3E9J B;  4PQ1 A;  3EU4 A;  1XXU A;  4XIH A;  4BVY B;  2VD0 A;  1OVN A;  1G6Y A;  2FCH A;  1ST9 A;  1DSB A;  3QMX A;  5GST A;  4QL9 A;  3ZRE A;  1V98 A;  3C71 A;  1Z5Y E;  3P2A A;  4ECI A;  2C4J A;  4LLR A;  2X8H A;  4K5S A;  5ECS A;  4KH7 A;  4O5R A;  1K0A A;  3TJF A;  3IC4 A;  3ME8 A;  2XC2 A;  4GTU A;  4XRA A;  2H8L A;  3LSZ A;  1XZO A;  3V1W A;  4JBB A;  2DLX A;  4AJ7 A;  1YQ1 A;  2L59 A;  4PTS A;  2OE3 A;  1G6W A;  1GNE A;  2PER A;  1X5E A;  5JCU A;  3LYK A;  4CW9 A;  1SYR A;  1OKT A;  5D73 A;  4OFT A;  4EO3 A;  5CNW A;  6GSW A;  5CAX A;  4NWY A;  5E59 A;  3FR6 A;  2XHF A;  3CRT A;  5BRT A;  1CQG A;  1GTA A;  4RQX A;  5D96 A;  3CYN A;  1PD2 1;  3FHK A;  5EPF A;  4PX1 A;  2FNO A;  5EY6 A;  3M0F A;  3GKN A;  2YN1 A;  2C0F A;  1M7T A;  4A5P A;  3EE2 A;  2HT9 A;  4F03 A;  3DML A;  1THO A;  3ERF A;  3WGE A;  4NV5 A;  2G2Q A;  1USB A;  5JWR B;  16GS A;  4Q5R A;  4PUA A;  4EC0 A;  4K7N A;  3ZIV A;  4DSQ A;  4DVC A;  3LG6 A;  2CV4 A;  4ZL8 A;  1BQ7 A;  5B6M A;  1FB0 A;  3MAK A;  3WYW A;  3O3T A;  5ENU A;  4N11 A;  2GZZ A;  3WT2 A;  3P8W A;  1TP9 A;  5LCZ A;  3KZQ A;  3VK9 A;  4ZIJ A;  1X5C A;  5FWG A;  2O85 A;  4L0W A;  4GF0 A;  5GSS A;  3QAV A;  1GUM A;  1VF2 A;  2GQK A;  4TRX A;  3TKS E;  2GQL A;  2L5O A;  2KLX A;  2QC7 A;  4HU7 A;  1J9B A;  4K2X A;  2F9S A;  3TOT A;  4MF5 A;  4KSM A;  3O6T A;  1VF4 A;  3H8Q A;  1UN2 A;  1NHY A;  4BWQ A;  1S3A A;  3I69 A;  2DKH A;  3GL5 A;  4ML6 A;  4ZBA A;  1TOF A;  3L0H A;  1H4O A;  3CTF A;  1AW9 A;  3QCP A;  1GRX A;  3GYK A;  2IWT A;  2DJ1 A;  2RUE A;  4POM A;  3A2V A;  3N9J A;  4RI6 A;  3LWA A;  5AN1 A;  2VL3 A;  4WBR D;  1T7P B;  2OA7 A;  3A2X A;  1VF3 A;  2GTU A;  3FKF A;  2LJK A;  3ZTL A;  1O6J A;  3D22 A;  3Q74 A;  4K0N A;  2XBQ A;  5ECL B;  3KM6 A;  5HR0 A;  2KOK A;  6GSY A;  4TR3 A;  1ERV A;  3TRP A;  5LD0 A;  2IFQ B;  3VWW A;  4ID0 A;  3I6A A;  3MIX A;  2IMD A;  4EIQ A;  5ECP B;  3GTU B;  5DVB A;  1FHE A;  3BD2 A;  3QAG A;  1XPV A;  2JSZ A;  2H70 A;  4GLT A;  2DSA A;  4KB3 A;  5AGY A;  4FQU A;  2V32 A;  2O8V B;  2PN8 A;  1I9D A;  2VM2 A;  5J3R A;  1SK1 A;  1KTE A;  2X64 A;  1T8E B;  1Z7P A;  4H86 A;  3FYG A;  2GDR A;  1GSU A;  2E0Q A;  2IIY A;  5INY A;  5IMF A;  3PPU A;  2HRN A;  2LQQ A;  3KMO A;  2RII A;  2FHE A;  5CRH A;  1YF0 A;  1FO5 A;  1V2A A;  1RK4 A;  4O7H A;  2OKA A;  2LNS A;  4XS4 B;  4JED A;  2GST A;  2VAF A;  3FR9 A;  2YCD A;  4POK A;  4K1F A;  3QR6 A;  1PX7 A;  1NW2 A;  5HFI A;  5KEJ A;  1XVW A;  4PGT A;  3DWV A;  4MP4 A;  3UVH A;  4OFM A;  1B48 A;  6GSV A;  1TI1 A;  2GGT A;  1EGO A;  2WFC A;  2X8C A;  2E7P A;  3EIN A;  1XWK A;  3R2Q A;  3DRN A;  4WEY A;  3DXB A;  2B7K A;  1EEJ A;  1ZCP A;  4GQC A;  2CZ2 A;  2CX4 A;  1O8X A;  4OCE A;  4MMM A;  3PR8 A;  2KUC A;  1WRY A;  2A4V A;  2IMI A;  3TJB A;  5DBQ A;  1SJ6 A;  3G7Y A;  5ELG A;  2YWN A;  1GL8 A;  3WD6 A;  4IS0 A;  5DJL A;  4PNF A;  1BG5 A;  1WP0 A;  3MWH A;  1MD3 A;  4AJ8 A;  2O87 A;  3HYP A;  2VCT A;  1GLP A;  3KMN A;  5G31 A;  3S9F A;  3BJ5 A;  1QXH A;  2IME A;  1HYU A;  4GSS A;  1XWA A;  3VPT A;  3PGT A;  1PA3 A;  1EEM A;  2AB6 A;  4F82 A;  4DSS A;  4MLY A;  2WRT A;  4DSS B;  5B8B A;  3IR4 A;  3FK8 A;  1K0C A;  19GS A;  3GKK A;  4YAP A;  5KN1 A;  2V41 A;  5IO2 A;  2HZE B;  4NAX A;  1THX A;  3GIX A;  3Q18 A;  2JSY A;  3NZN A;  1ERT A;  1J0F A;  1O73 A;  1FG4 A;  3HA9 A;  1M9B A;  2RM5 A;  1JHB A;  1PRX A;  1I5G A;  3HVX A;  1XOA A;  2FWF A;  4EF0 A;  3P90 A;  3QAW A;  5DAK B;  3HZ4 A;  2FWG A;  2DBC A;  1AQX A;  2H1D A;  3WGX A;  3GKX A;  4G9H A;  2LJA A;  1TTZ A;  4MPG A;  2R5G A;  1QK8 A;  2QKE A;  3SBC A;  3ZIT A;  3GNJ A;  1K0D A;  2H6X A;  3GRX A;  1ZGN A;  1F6M C;  3IRA A;  4ULX A;  3R3E A;  2E2G A;  5AIV A;  2KHP A;  3FZA A;  3GUR A;  2DIZ A;  1PMT A;  2X8G A;  1XFL A;  4ZBB A;  3LOR A;  2YV7 A;  1F3B A;  2IN3 A;  3TKS C;  1XW6 A;  2I9H A;  2CT6 A;  3CSJ A;  4IW9 A;  3UEM A;  9GSS A;  1FVK A;  4EVM A;  1YJ6 A;  2H71 A;  2PUK C;  4BWS A;  3UBK A;  3UVT A;  2MZC A;  4YKF A;  5J9C A;  2WB9 A;  2MYG A;  2QA1 A;  1SK2 A;  4ECJ A;  2EC4 A;  5ECR B;  2VO4 A;  3FRC A;  3A5W A;  3D4M A;  5J4U A;  1E6B A;  1SL1 B;  2DJ3 A;  3KTL A;  5J5N A;  2P0G A;  2HZF A;  2CX3 A;  3HKR A;  3D4T A;  1F3A A;  1BAY A;  18GS A;  4K0G A;  1FAA A;  1K3Y A;  2BMX A;  3I9V 2;  3HZ8 A;  1KNG A;  2LJR A;  1A24 A;  4LMW A;  4ZL7 A;  2CA8 A;  4I2T A;  3TRQ A;  5IPH A;  2MMO A;  3BBY A;  10GS A;  1XOB A;  3IV4 A;  4MZC A;  1JFU A;  3QPM A;  1R5A A;  4K7I A;  2RLI A;  4MH2 A;  4WF4 A;  5ABR A;  1N2A A;  2NDO A;  5GAN D;  1XIY A;  5F07 A;  2RM6 A;  2FD3 A;  2LRC A;  2TRC P;  3KEB A;  3HJO A;  2YNX A;  4KCA A;  1M2A A;  4FH8 A;  4HDE A;  5ID2 A;  4V2L A;  1FW1 A;  3DKS A;  4L5O A;  3FW2 A;  2LKU A;  3TJJ A;  2JAC A;  1BED A;  4IVF A;  3F4R A;  2GT6 A;  3ZRD A;  2N5A A;  3RHB A;  3RPP A;  2VCV A;  4PUR A;  3KP9 A;  2WS2 A;  3U5R E;  3QFA C;  3KTB A;  1GUK A;  4G0I A;  4N0V A;  2YWI A;  3K8N A;  2VL9 A;  2L6D A;  3SWL A;  3VLN A;  1A0F A;  3F3Q A;  1XW9 A;  2CVB A;  3KGK A;  1M2B A;  2B3S A;  4LA1 A;  2HSY A;  3L9S A;  3H79 A;  2QA2 A;  3HXS A;  5KOX A;  2VCQ A;  4ACS A;  1K0B A;  3CBU A;  3ZFL A;  2PVQ A;  2VUP A;  1OAZ A;  2WCI A;  2A4H A;  4CDO A;  2DML A;  3ME7 A;  1DBY A;  2LTK A;  1TJD A;  1YKC A;  4OFN A;  3TOU A;  3ZVJ A;  2ZUP A;  4D73 B;  4XS4 A;  3DD3 A;  3H4K A;  2KP2 A;  5KN3 A;  5IPG A;  3HCZ A;  2VCX A;  4TOP A;  2I81 A;  3G7I A;  5F06 A;  5IO0 A;  4FO5 A;  3TKQ A;  3LGC A;  3FZ5 A;  2MBT A;  4OO4 A;  2M72 A;  3F6F A;  3LFL A;  1AQV A;  1G7E A;  20GS A;  3Q6O A;  3PH9 A;  1U3I A;  4BL7 A;  1WOU A;  3LYP A;  1Z6M A;  1AIU A;  4OWY A;  1AAZ A;  3ZML A;  1KEB A;  1Z7R A;  1NM3 A;  3BCK A;  1WJK A;  1M2D A;  1HQO A;  2GVP A;  4Z7X A;  2HRK A;  3MNG A;  2LV3 A;  3W8S A;  1X9W B;  2DJJ A;  3TJK A;  5D9W A;  4NXI A;  4RUV A;  4KDU A;  4ISD A;  3UL3 A;  2H66 A;  2P31 A;  2VCW A;  1V9W A;  2L4Q A;  4YKG A;  3VWV A;  3W8J A;  1TRV A;  4TR0 A;  3ERG A;  4K9Z A;  4YQM A;  1LBK A;  4IHU A;  1KBN A;  2H0G A;  2YJH A;  3VWX A;  1SJI A;  2CAI A;  3UAP A;  11GS A;  4FIW A;  4POB A;  5CYY A;  5J9B A;  3GX0 A;  4GQF A;  3DIE A;  1Y6E A;  4EIP A;  4MK3 A;  2CVD A;  3TDG A;  2IYJ A;  4J2F A;  2EIR A;  3HY2 A;  4YQV A;  3D21 A;  4TVE A;  5HR1 A;  2J9H A;  5G5E A;  3GA4 A;  4MJC A;  1AXD A;  1JZD A;  1GUL A;  3CSI A;  5IMZ A;  2AJQ B;  1XVQ A;  4ECB A;  6GSX A;  3GH9 A;  2DMM A;  5D9V A;  3MSZ A;  2H6Z A;  1Z9H A;  1OC9 A;  4TXV A;  2JL4 A;  3C8E A;  4AGS A;  1X5D A;  2HFD A;  3IE3 A;  4FYU A;  1U88 A;  3ISO A;  3KXO A;  3HD5 A;  1WIK A;  1MDK A;  1EV4 A;  2PPT A;  4DSR A;  2N5F A;  1A8Y A;  13GS A;  1O81 A;  1T1V A;  1A2J A;  3TCO A;  1EGR A;  2VL2 C;  2YZH A;  1NHO A;  3KJY A;  3TKS A;  4KDY A;  2V1M A;  3ZL5 A;  3ZIJ A;  1ZYN A;  4AF2 A;  1SL0 B;  3APQ A;  5DCG A;  4G19 A;  2C0G A;  1TRW A;  3UJ1 A;  3HJP A;  1WMJ A;  2B5X A;  6GST A;  1WPI A;  4JRR A;  2OAD A;  2H72 A;  2NTO A;  4P3Y B;  3GMF A;  1LJR A;  1TRS A;  4TKY A;  3F3R A;  2C80 A;  2H1B A;  5DAL A;  4WR5 A;  3ZZX A;  1MDJ A;  4YH2 A;  2LQO A;  3GUS A;  2HRA A;  1JLV A;  2I3Y A;  4XRD A;  2HRF A;  3H93 A;  1B4P A;  1ML6 A;  2O7K A;  1A2M A;  3D6I A;  4NHW A;  5C04 A;  5IOX A;  3A2W A;  1Z6N A;  5D93 A;  1GSY A;  1GH2 A;  5CRG A;  3FZ4 A;  2V6O A;  4QQ7 A;  1DUG A;  1SKS B;  3UBL A;  2DKI A;  1GSQ A;  2WDU A;  1R26 A;  4OCF A;  4NV2 A;  4V1A p;  1U6T A;  8GSS A;  3KP8 A;  3KH9 A;  4WBJ A;  1JZW A;  2GSR A;  4YQU A;  2NVL A;  5HFG A;  4HI7 A;  1OE8 A;  4KF9 A;  2F51 A;  3QOU A;  2VOC A;  3E3E A;  1V58 A;  2UZ8 A;  2OBI A;  1EZK A;  2YPM A;  2XPE A;  1GSD A;  4HEA 2;  2JZR A;  3ERW A;  2IMF A;  3TRX A;  4PNG A;  3E0U A;  4PUF C;  3CMI A;  1GTI A;  6GSU A;  3C1R A;  2FGX A;  1AC1 A;  2H74 A;  5CP1 A;  4JR6 A;  2H0I A;  2FA4 A;  5FT3 A;  5LNK e;  3C1S A;  4L5L A;  2VLV A;  5HQP A;  1XWB A;  5KOW A;  1AUC A;  1YY7 A;  4MA9 A;  2R37 A;  4IP1 A;  1ILO A;  3VWU A;  1EV9 A;  1RQM A;  1FB6 A;  5C00 A;  3TKP A;  2GT5 A;  5AIS A;  3C7M A;  1PL2 A;  2YV9 A;  2C3N A;  1EOG A;  5A4W A;  4LL1 B;  2C8U A;  3A3T A;  2QGV A;  4TR1 A;  4E8H A;  1GWC A;  3APS A;  1A2L A;  5IM9 A;  1XW5 A;  5DQS A;  2FLS A;  14GS A;  4N10 A;  1K3L A;  5ECM B;  3FY7 A;  2IL3 A;  2REM A;  4QL7 A;  2P5Q A;  3HVS A;  5ECN B;  1Z3E A;  5JCG A;  5IMD A;  2OBK A;  2A2R A;  5F05 A;  3GTU A;  3EC3 A;  1SD8 A;  2XPD A;  2R0P A;  2DJ0 A;  1TK8 B;  4K5R A;  4KCE A;  1EWX A;  4BA7 A;  3TB2 A;  3F8U A;  3Q19 A;  3QDN A;  1K3O A;  1EP8 A;  4PXO A;  3IAS 2;  22GS A;  4HJ2 A;  4X0X A;  1A23 A;  4V2N A;  3HVV A;  1DE1 A;  1PKW A;  2PWJ A;  1V40 A;  3VUR A;  4AJ6 A;  4CY6 A;  2A2P A;  5E4W A;  5CRW A;  1WE0 A;  2LS5 A;  1R5P A;  4HQZ A;  2JZS A;  1GP1 A;  4WXT A;  2D2Z A;  5IOW A;  5H5Q A;  1O85 A;  5HR3 A;  3GL3 A;  1ZZY A;  1TRU A;  4HJM A;  4PQI A;  4ZB6 A;  3IXR A;  1G7O A;  4ZBD A;  3I43 A;  3F4S A;  3LQ7 A;  1OC3 A;  2VL2 A;  4IP6 A;  4V2M A;  1YZX A;  5EVO A;  3GST A;  4EE0 A;  4O92 A;  1Q4J A;  1W4V A;  1PN0 A;  2O89 A;  3GH6 A;  1ZYP A;  2H1A A;  1BX9 A;  3FR3 A;  1BYE A;  2VM1 A;  4MCU A;  2OAC A;  1RW1 A;  3KIJ A;  5D9X A;  1C72 A;  1R7H A;  2B1L A;  4IN0 A;  3GX8 A;  3AY8 A;  4KSO A;  2HXK A;  5EL8 A;  2PBJ A;  5CO3 A;  2DC5 A;  3CRU A;  2C3Q A;  2C3T A;  3TKR A;  4FYC A;  1TI3 A;  1T3B A;  1Y25 A;  1MDI A;  2HSM A;  3FZ9 A;  4KDX A;  4ZB8 A;  5J41 A;  2WZ9 A;  3F6D A;  3VI5 A;  2WGR A;  4L0U A;  2YZU A;  5ECO B;  1T00 A;  2YAN A;  1M9A A;  3LEF A;  3DVW A;  3GN3 A;  4F9Z A;  2GZY A;  3IC8 A;  1Q98 A;  1T4Y A;  4MZB A;  3L78 A;  2M46 A;  1T4Z A;  5DJM A;  4F2I A;  1SYX A;  3IK9 A;  2L4C A;  2LEG A;  3DGQ A;  1U87 A;  4V1A g;  4D73 A;  3QD9 A;  1GSS A;  5G1K A;  2LNT A;  1EOH A;  2GLR A;  2YP6 A;  1TXX A;  3M3M A;  4EUY A;  4Q5Q A;  4WF5 A;  1GUH A;  4MZW A;  2VLU A;  3GV1 A;  1YEX A;  3HHV A;  2H1G A;  4G10 A;  3LXT A;  2LST A;  1OKD A;  4Z2R A;  1UA5 A;  2JU5 A;  5ECQ B;  4GWR A;  3GSS A;  2H75 A;  4ZB9 A;  1VF1 A;  2GQM A;  1YKA A;  4F0C A;  3KCM A;  3CXG A;  2C0E A;  2FUG 2;  5DAK A;  6GSS A;  1GNW A;  4XS6 A;  3J7Y k;  2H30 A;  1QUW A;  3RHC A;  1EP7 A;  4MNN A;  4IJI A;  4KAE A;  3GHA A;  4IGJ A;  1YDK A;  2F8F A;  5D9T A;  3US3 A;  5B8A A;  3A5I A;  2NPB A;  2I4A A;  1J08 A;  5HR2 A;  3F0I A;  2LRN A;  4EDY A;  2IFQ A;  1TKD B;  1K0N A;  2L6C A;  4ZIL A;  1IYI A;  2B7J A;  2ZNM A;  3RPN A;  1S3C A;  3APO A;  2XBI A;  1QFN A;  1SEN A;  1TK0 B;  3IHQ A;  3ZFB A;  4L8E A;  5ECK B;  4NMU A;  4IEL A;  2NBS A;  2F3M A;  2X99 A;  4RQR A;  12GS A;  2M80 A;  4K2D A;  4K7O A;  5BMU A;  5DAL B;  1XCC A;  3EMP A;  1MTC A;  2C0D A;  4I8B A;  4IQA A;  4BL7 B;  1R4W A;  2A2S A;  2DJ2 A;  2H76 A;  1UVZ A;  2WUL A;  4Q5N A;  5A4U A;  1TU7 A;  3IPZ A;  4Q5F A;  4EKZ A;  1GSE A;  2B5E A;  4POL A;  2DJK A;  2CVK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...