5G1LA

A double mutant of dsbg engineered for denitrosylation
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
228
structure length
228
Chain Sequence
LPAPVKAIEKQGITIIKTFDAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNTLIEKEIYAPAGREMWQRMEQSHWLLDGKKDAPVIVYVFADPFCGPCKQFWQQARPWVDSGKVQLRTLLVGVIKPESPATAAAILASKDPAKTWQQYEASGGKLKLNVPANVSTEQMKVLSDNEKLMDDLGANVTPAIYYMSKENTLQQAVGLPDQKTLNIIMGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sulfur Denitrosylation by an Engineered Trx-Like Dsbg Enzyme Identifies Nucleophilic Cysteine Hydrogen Bonds as Key Functional Determinant.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords THIOL DISULFIDE INTERCHANGE PROTEIN DSBG
total genus 67
structure length 228
sequence length 228
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 5g1lA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5g1lA02
1AW9A 4G2EA 1JZDA 5CP1A 2LEGA 2WRTA 4KAEA 2V41A 5HFKA 5ELAA 3KMNA 4PXOA 1T7PB 13GSA 1ZYQB 4MMMA 1XCCA 4N10A 3ZYWA 1TDIA 2F51A 4CDOA 2CVKA 2O8VB 2FNOA 4V1Ap 1A0FA 3UVTA 2IMFA 3D4MA 1HNAA 1J9BA 2X99A 2OBIA 2ZUPA 2HZEA 1AXDA 2NBSA 1XVQA 1GWCA 1CQGA 4KSMA 2B3SA 3N5OA 4RQXA 1R4WA 3IK7A 3WGEA 2R5GA 3DXBA 4MJEA 1EEMA 2REMA 2HNLA 2R6KA 4IGJA 1Y25A 3FR9A 3TGZA 20GSA 2O85A 1XWAA 4TW5A 3E0UA 2GZYA 5LD0A 4TXVA 4XS6A 5AGYA 1XXUA 1OC9A 3EMXA 5C04A 2WGRA 3IV4A 4ULXA 2VCWA 3CMIA 3ME8A 1DE1A 5GAND 1THXA 4JR6A 1FB6A 3DGQA 3MNGA 1OC8A 1OC3A 4XS4B 1F3BA 4ZBAA 1V98A 1SL0B 2L6CA 1GULA 3D4TA 3HZ8A 2IFQB 2PMTA 2LNSA 1OKTA 4YQUA 2VOCA 3IRAA 1K0BA 1VF2A 1TI1A 2MZCA 4MH2A 2IPAA 1RW1A 2JSZA 2QC7A 2OBKA 1B4QA 3L4NA 2BMXA 4NXIA 5B6MA 4FYBA 3TOTA 1URMA 3M3MA 1GRXA 3HDCA 4BL7A 1WMJA 4GRFA 1PN9A 4WBJA 4HOJA 4ZL9A 1EV9A 4L5OA 3VFIA 2H71A 2XC2A 5IPHA 3I9V2 4GSTA 4I2UA 5COHA 2H1BA 2NDOA 1I9DA 4RQRA 2CZ2A 2DIZA 3CXGA 5DCGA 3QD9A 3DWVA 2A4VA 4IVFA 4KCEA 1AUCA 4WBRD 1MD3A 3BOAA 1SL1B 1OVNA 1WIKA 5A5KA 2GSQA 1F2EA 1TU8A 4K7IA 4LMWA 1MDIA 2B1LA 1Z3EA 3LSZA 16GSA 1GTBA 1UN2A 1PA3A 5F8BA 1ST9A 1GSUA 3ZVJD 1SK1A 3HZ4A 4OO5A 4V2NA 4GXZA 1PX7A 2LRNA 1NSWA 3TJGA 1W4VA 4HJMA 2L4CA 3HVSA 6GSWA 2ON5A 3ED3A 5E4WA 1RK4A 3US3A 4GSSA 4EDZA 2X8GA 4MLYA 1GLPA 3PR8A 4OMVA 2C0FA 1XFLA 2LRTA 4K9ZA 4TXOB 4TXOA 2JU5A 4N0ZA 3PH9A 3UVHA 5JWOB 3LORA 4V1Ag 3KTBA 3L78A 5LCZA 1ERVA 2O89A 4KNDA 2FWHA 5D9VA 4YH2A 5ECSA 3EU3A 1Z6NA 3IR4A 2FWEA 2KP1A 4J2FA 1J0FA 1TRWA 3GUSA 1XOBA 1A2JA 1E6BA 3GHAA 4IKHA 4EDYA 3HKRA 4ILFA 4GQCA 4NV2A 1ZGNA 4ECBA 1IYHA 1GNWA 1R7HA 5DBQA 4IHUA 1NM3A 2WS2A 5HFIA 3KEBA 4KW6A 2WB9A 3LYPA 2N5AA 3MDKA 5CRHA 1XIYA 4N11A 3M9JA 4WEYA 1NHOA 4D73B 4FIWA 5D8IA 2YPMA 1Z5YE 2RM6A 3FK8A 1M7TA 1N2AA 5IMCA 4GQFA 3VPQA 3D22A 4BVXA 1O81A 1U88A 3F63A 1GSEA 2PGTA 4EKZA 4BWSA 3G9BA 5J9CA 3GMFA 1BJXA 3H1NA 4ZB6A 4V2MA 1G7EA 1GSYA 2VLTA 5ECHB 3PGTA 4IN0A 4HZ4A 2YV9A 3ZFBA 1JZOA 4KCAA 2PWJA 5DVBA 4ML1A 2JACA 3TRPA 3DRNA 5ID2A 3FZ5A 4L0UA 4L5LA 1FVJA 1PMTA 4FYUA 3GTUA 3GTUB 3ZTLA 2H6YA 4JZQA 2H66A 2B5EA 4WF4A 2YWIA 4Q5RA 1GNEA 4Z7XA 4HJ2A 1A8LA 6GSVA 4ML6A 1K3OA 1B9XC 2HYXA 2IL3A 2YV7A 3ZIVA 1ABAA 1TRSA 1EP8A 1XWGA 2AV4A 5IO2A 3S9FA 1XPVA 4XIHA 3A5WA 4ECIA 3VWWA 5IOWA 3LYKA 4E8HA 3BCIA 1Z6MA 3WD6A 4AJ6A 3F3QA 4BA7A 3IPZA 1H75A 1PGTA 4PGTA 4YQMA 1PQNA 1PKZA 4AJ7A 5IMDA 3UIWA 3BJ5A 3MWHA 2LKUA 1M99A 5IO0A 5ECQB 1FG4A 3LQ7A 4XTSA 4LL1B 4MDCA 4QL9A 2OE3A 4N0VA 4MPFA 3TKQA 1XW6A 3TJBA 5ECNB 4GLTA 2VCTA 2M72A 3APSA 5ECIB 3A2VA 4OD7A 1X5EA 5J3RA 1YF1A 2C3TA 1TTZA 3UMAA 2YZHA 2CVDA 2IMDA 3RHCA 1XZOA 2KLXA 1XWCA 3QFAC 5EVOA 2B1KA 1OE8A 4MZWA 3I6AA 5J4UA 4K0NA 4DEJA 1JLVA 2RUFA 3L9UA 5LNKe 2OE1A 2I81A 2LJRA 5G5FA 1KEBA 2ES7A 3TCOA 1TXXA 3ISOA 4MABA 4KDYA 1K0AA 5H5RA 3QOUA 1YEPA 2LQOA 4OWYA 3J7Yk 4ZL8A 4TKYA 1A2LA 4PX1A 5EY6A 4NV5A 2A2SA 2RLIA 3J7Yb 2DIYA 3QMXA 2VUPA 3LFLA 1T4YA 2EIQA 2H6ZA 5D9TA 2L59A 3A2XA 2FUG2 3TUEA 1GP1A 1TOFA 1TI3A 2LS5A 5D93A 2YN1A 2MYGA 5EL8A 2VCXA 2L6DA 3NIVA 4MZCA 2L5LA 2GVPA 1B8XA 1QUWA 1A0RP 4ZXGA 4PNGA 5CYYA 2AHEA 3GL5A 2JL4A 2IWTA 3DVXA 3M8NA 3F4RA 2PVQA 3JCML 1XBSA 3VWXA 4YAPA 2GZPA 1GSSA 5EPFA 5F05A 1W89A 5ECLB 4NPBA 4AJ8A 2Z9SA 1OAZA 1V57A 1SKWB 4OCEA 1SENA 5J5NA 5IOXA 1ZCPA 3IDVA 4TN8A 3HA9A 4HUAA 2VCVA 3FR3A 4EF0A 5DQSA 1Q4JA 1M2AA 3ZLPA 2CA8A 4KX4A 4XHMA 3FRCA 1O8WA 1WRYA 2F8AA 4JR4A 1B4PA 2E7PA 2JZSA 1R26A 4QQ7A 5KN2A 1PL2A 5IPGA 1WE0A 3TRQA 5L71A 2K18A 4JBBA 1DBYA 1OKDA 4I97A 4I5QA 1ZOFA 1GTUA 1K3LA 1JHBA 3D6IA 2OADA 4TVEA 1AQWA 4ID0A 4MF7A 2JZTA 5D96A 3QPMA 4F03A 5A4UA 4BWQA 2L57A 2GLRA 1SL2B 4KGIA 3GSTA 3SBCA 4RI7A 2EIRA 5H5QA 1U6TA 1NW2A 5G5EA 1SYXA 1VF1A 1F37A 5D9WA 2M80A 5J41A 2X64A 3EYTA 2HRNA 2H8LA 5J9BA 2H70A 1XW9A 1IYIA 2E2MA 5G2ZA 2MMAA 5G30A 3I43A 2CX4A 4ZILA 2N5FA 3ZVJA 1XW5A 3QAWA 3QDNA 2VIMA 3KH9A 1MDKA 4KDUA 3GH6A 1X0RA 2VL9A 1EOHA 4MPGA 2VLVA 3FEUA 3ZITA 2XBQA 3G7YA 4AGSA 1GSDA 1TP9A 2MMZA 3U6VA 3HVXA 4L8EA 1R5PA 3WGXA 4HQSA 3H79A 3APQA 3FY7A 3LXZA 1H4OA 3CRUA 1OYJA 5HR0A 4MJCA 2C3QA 3IXRA 3ZRDA 2X8HA 2LNTA 2YZUA 2TRXA 1SJ6A 2K9FA 2IMIA 3RDWA 1DSBA 1TRUA 1G0TA 2DLXA 3F8UA 1BG5A 4K7NA 2BJXA 3LG6A 3DYRA 2P31A 1TW9A 3EURA 3KIJA 3GKKA 3CSHA 4HI7A 3W8SA 3HXSA 4ACSA 3LWAA 2V6KA 2NTOA 2YCDA 2P0GA 4Q5FA 1V9WA 3NZNA 2OJLA 5ECMB 4KA0A 1V40A 3KXOA 4WR5A 2AYTA 1RQMA 1QGVA 3GFKA 1TRVA 3QAVA 4WR4A 1U87A 1BQ7A 1HD2A 1WPIA 5ECOB 2IMKA 3TKSE 3VLNA 1O73A 2H1GA 4IP1A 1E2YA 1FOVA 3HVVA 2EIOA 3DKSA 4K6XA 3LXTA 3R2QA 1LBKA 3I69A 1YKCA 2IYJA 3FZAA 5DDLA 2H30A 2RUEA 1FW1A 4EE0A 2LRCA 5GZZB 2RIIA 2LSTA 4KDXA 4KSOA 2CAIA 2PVOC 3WGDA 2FWFA 1TKDB 3EWLA 1A24A 2FCHA 2H01A 5ELGA 5AIXA 3KP8A 2O7KA 2NPBA 3C1RA 5JWRB 3EMPA 7GSSA 1F6MC 5CAXA 4HU7A 2FA4A 4H86A 17GSA 5CRDA 4FH8A 3CTFA 3EVIA 3O76A 4PQIA 4NHZA 1T1VA 2FWGA 3M1GA 2HZFA 4F0BA 2QGVA 1JZRA 5GAPD 4PURA 2YJHA 3GH9A 2WJUA 2HFDA 1SD9A 3FHKA 5IQYA 2DJKA 3D21A 4K8MA 3CRTA 4ZIJA 1WJKA 1UVZA 1YJ6A 1V2AA 2C8UA 4PUFC 2F8FA 3IBHA 4N30A 2P5RA 2HZEB 2VL3A 1SKRB 3TOUA 3CSIA 3Q6OA 1BAYA 3GIXA 2VCQA 3FR6A 4Q5QA 3QAGA 3C73A 1K0OA 1GUMA 1X5DA 4LA1A 1YF0A 2HLSA 1QK8A 4ECCA 3QFBC 5IMFA 4IW9A 1AQXA 5A4VA 4TRXA 1PSQA 1J08A 1JFUA 5D9XA 4JRRA 1QFNA 3H93A 2C80A 3RAZA 4OFTA 3KTLA 2FY6A 3GX8A 4WKWA 4IQAA 2N5BA 1C72A 5CNWA 4LL4B 2I9HA 3L9SA 2LJKA 4MCUA 2P5QA 3UBLA 3UEMA 2R37A 4FYCA 5AN1A 1GH2A 2LQQA 2BTOT 4K2DA 1T4ZA 2HXKA 2AAWA 4YQVA 2I1UA 5KEJA 5DALB 3TDGA 4E8EA 2PBJA 1MTCA 2HRFA 2MMOA 3HYPA 1XWKA 3ZMLA 1M0UA 3TJKA 1KBNA 1THOA 3KCMA 3PINA 2MBTA 2GT5A 3F0IA 3HJOA 4LMVA 2IIYA 4GSNA 5DJMA 5GSTA 2H0HA 5G31A 2DJ0A 3GX0A 5HR3A 3HJPA 1ON4A 3C8EA 3D5JA 1GTAA 5CO3A 3RHBA 4MA9A 3GL3A 2B5YA 2DJ2A 4HDEA 4KB3A 1AC1A 4QL7A 3K8NA 3ZZXA 6GSUA 3APOA 4K7OA 1EOGA 3O3TA 3F9UA 1FO5A 2GDRA 4JU5A 2ALBA 1VRSD 2X8CA 1PX6A 6GSYA 3P8WA 2H1DA 3EC3A 2V6OA 1K3YA 2VL2C 4IJ3A 2GQLA 3KMOA 3P7XA 4OFNA 4V2LA 3OR5A 1ML6A 1YZXA 4HS1A 2DSAA 4MJAA 3MSZA 2V1MA 4D73A 2WCIA 3IHQA 2WFCA 1PL1A 1M9BA 1R5AA 2CVBA 4RI6A 2WZ9A 3FZ4A 4TR0A 1Z9HA 2AJQB 2R4VA 1ZMAA 4Q5NA 2O87A 1LJRA 5ECPB 3MAKA 5B7CA 1TK5B 4O7HA 4MH3A 2IMEA 1HNCA 1EV4A 4KE3A 1B48A 1JLWA 3FW2A 3BD2A 3IE3A 2KUCA 3ZFLA 1X5CA 5HFGA 2VO4A 3TJJA 5B6NA 4WXTA 3DIEA 2JADA 3LGCA 3DMLA 3TKSC 3O6TA 1ACVA 12GSA 4POBA 1KNGA 4IJIA 2YWMA 3TKRA 1QQ2A 1K0MA 2IJYA 4FO5A 5AISA 4CW9A 5INYA 1S3CA 1QMVA 4NWYA 2DJ3A 2HE3A 1M2BA 4F0CA 5FHIA 1X9MB 3KP9A 3EINA 2VM2A 5AIVA 2TRCP 4GTUA 1ERUA 3Q18A 2GQKA 5JCUA 2OKAA 2MBSA 4MF6A 3D0ZA 2H72A 1EGOA 5A4WA 3Q74A 3IAM2 1YEXA 1MEKA 4TR4A 4I6XA 2VCZA 2B7KA 2EC4A 2CT6A 2J23A 4XCSA 4RUVA 1O8XA 1SJZA 3HY2A 5FWGA 3HD5A 1YDKA 3LJRA 4O92A 2XPDA 2LUSA 1G6YA 1K0NA 1VF4A 4ZB9A 2VLUA 3GNJA 4F2IA 3WT2A 2GSRA 3NOFA 3F6DA 5JCWA 1Y6EA 2TIRA 1JZWA 1Z7RA 3ERFA 3RBTA 1HYUA 4HZ2A 1SJIA 2B6MA 5CRWA 1HQOA 4EUYA 4ZB8A 2VL2A 5B8BA 4XRDA 2GSTA 4AF2A 1YKAA 1GSQA 4POMA 4EO3A 1M2DA 2H6XA 3E9JB 1EP7A 3VURA 4JE1A 1BYEA 1EZKA 3UBKA 3BCKA 4POLA 2VM1A 3G7JA 2IFQA 5DCHA 3TKSA 1GUKA 4DSSA 1OE7A 2PUKC 1KTEA 1WWJA 4XS4A 11GSA 2C1YA 1I5GA 2K8SA 2CV4A 4J57E 1MD4A 3VK9A 3GSSA 2YWNA 1WP0A 1F3AA 2HT9A 2XBIA 4HQZA 2C0DA 1OC9B 1VGLA 5JCGA 1UC7A 1XOAA 1T8EB 2H0IA 3IC4A 3H4KA 2GSSA 4HU9A 5IM9A 5JWQB 4EL1A 3M9KA 3GKXA 3CSJA 4WETA 2KHPA 4HEA2 22GSA 3IOSA 1TJDA 5E59A 4P3YB 3HJMA 1TK0B 3P90A 1YY7A 1A23A 1GTIA 1MDJA 3UL3A 2L5OA 2V2GA 3G7IA 2ZNMA 1EWXA 5KN0A 2GT6A 4TR1A 2H19A 1ZZYA 4G10A 3ZMKA 5HR2A 3KGKA 4TR3A 1PRXA 2JZRA 2AB6A 3H8QA 5DAKB 3ZL5A 2JSYA 4KUNA 2OACA 4CHSA 3F6FA 2C0EA 3RPNA 4KH7A 5G1LA 4MJBA 4BPYA 2I4AA 3IK9A 4J56E 3RPPA 1A8YA 1ERWA 2IN3A 2B5XA 2QKEA 3P2AA 4GF0A 1SKSB 4MF5A 5B8AA 4PUAA 3DD3A 3FZ9A 2AUVA 3KZQA 1GSFA 4XS1A 1FVKA 3CTGA 2DBCA 4K0GA 1N8JA 1VF3A 3GKNA 2E0QA 1LU4A 5ECKB 3DEXA 1S3DA 2RM5A 4DVCA 3TKPA 2WDUA 3TRXA 2LTKA 3N9JA 2OE0A 3HCZA 4I8BA 1YQ1A 1DE2A 3UAPA 2FLSA 1Q98A 1G7OA 5GSSA 6GSXA 4L0WA 2K6VA 1T3BA 4TOPA 2ON7A 3VI7A 2WULA 2XPEA 3A2WA 6GSTA 3SWLA 2DMMA 3VPTA 2FGXA 2FD3A 4ECJA 3IA1A 2DJ1A 1SK0A 3WT1A 1U3IA 2C3NA 1ERTA 3GV1A 1SK2A 9GSSA 3ME7A 5DALA 1EEJA 3ZREA 2I3YA 4MZBA 2F3MA 4JEDA 2M46A 3A3TA 4WF5A 2IY2A 1ZL9A 4O32A 3ZIJA 4F9ZA 5DJLA 2GS3A 1O85A 2PERA 4OFMA 5C00A 2KP2A 2LV3A 2NVLA 2K8VA 1PD21 4ZBDA 1SD8A 1Z7PA 2F9SA 1A2MA 2L4QA 4I2TA 5G1KA 2E2GA 2FA8A 3Q19A 1FHEA 4OO4A 4TR1B 3C71A 2GZZA 3L0HA 1M9AA 2YJ7A 2VAFA 1U3AA 3FKFA 2H73A 5FT3A 4X1UA 2CX3A 3F3RA 2G0FA 4X43A 1O7UA 1X9SB 2MMNA 1DUGA 8GSSA 4ISDA 3E3EA 3WYWA 2QSIA 1TU7A 1V58A 4IQ1A 1UA5A 2H1AA 3VWVA 1NHYA 4IBPA 3BBYA 3V1WA 5ID2B 3CYNA 18GSA 3AY8A 1O6JA 3KJYA 2GQMA 2R2JA 4NHWA 4DSQA 3C1SA 4F82A 2OA7A 1TK8B 4PQHA 5HQPA 2LJAA 2C0GA 4NAXA 4G19A 1USBA 2CZ3A 1SYRA 5F0GA 1ZYEA 1GLQA 3GYKA 2PPTA 2YNXA 2YOIA 3IAS2 4LLRA 2FHEA 5IMVA 5ABRA 2V32A 3LEFA 1B9YC 2ZCTA 3UOMA 5F06A 5DAKA 3QCPA 3F4TA 3DVWA 4O5RA 3FYGA 4ZBBA 4X0XA 4YAVA 3GKMA 2YANA 3KH7A 14GSA 2DMLA 3UJ1A 4DSRA 4GWRA 5HR1A 5CREA 1PKWA 1T00A 3KD0A 1X9WB 2G2QA 1BEDA 3KM6A 5IIZA 1BX9A 3EU4A 5F07A 3C7MA 1ILOA 3U5RE 1K0DA 2B7JA 1GUHA 4POKA 2VD0A 4XRAA 3ERWA 3VWUA 3UARA 1WOUA 4NMUA 1HNBA 3TJFA 1XWBA 3CBUA 1FAAA 2H74A 10GSA 1S3AA 2A2RA 5DQYA 6GSSA 2PN8A 4IP6A 1AAZA 4MK3A 1SU9A 4DSSB 2H0GA 4IELA 2HI7A 1CQHA 19GSA 2YWOA 4EC0A 2PU9C 4PNFA 2CAQA 5ENUA 2VD1A 3GRXA 3GURA 1GL8A 3GN3A 4EXJA 5H5SA 3EE2A 3L9VA 1K0CA 2YP6A 4PQ1A 3F4SA 5KN3A 2C4JA 3VI5A 3M0FA 5CRGA 5IMAA 4MP4A 5D73A 2R3XA 3QR6A 3TB2A 2GTUA 2HSHA 4K1FA 4BVYA 2H75A 3GA4A 2XHFA 1AQVA 2HSYA 5IMZA 4ZL7A 1XVWA 2D2ZA 3W6GA 2J9HA 4EVMA 3HHVA 4GCIA 1QXHA 1EGRA 1F9MA 3ERGA 4IS0A 5KN1A 1AIUA 2GGTA 2DC5A 1FB0A 4G9HA 3W8JA 1G6WA 2KOKA 2CQ9A 2H76A 2DJJA 4OCFA 5ECRB
chains in the Genus database with same CATH superfamily
1AW9A 5D83A 4G2EA 1JZDA 4HKVB 5CP1A 2LEGA 3MPHA 4XBYA 2XEPA 2WRTA 4KAEA 2V41A 5HFKA 3X42A 5ELAA 3KMNA 1HYFA 1QJGA 4PXOA 1T7PB 13GSA 1ZYQB 4MMMA 1XCCA 4N10A 2W6JH 3ZYWA 1TDIA 2F51A 4CDOA 2CVKA 1K9M4 2O8VB 2FNOA 4V1Ap 1A0FA 3UVTA 2IMFA 3D4MA 1HNAA 4IIAA 1IVUA 1J9BA 2X99A 2OBIA 4A5PA 1NJI4 2ZUPA 4IPBA 1WQLB 2W2CA 1AXDA 2HZEA 2NBSA 5BIRA 1XVQA 1BRGA 2W56A 1GWCA 3CU3A 1CQGA 4KSMA 2B3SA 3RGAA 3N5OA 5AI1A 4RQXA 1R4WA 3IK7A 3WGEA 2R5GA 3CCL3 3DXBA 1SIHA 4MJEA 1JBRA 1EEMA 3LXUX 1VQ63 2REMA 2Z76A 1MWSA 2HNLA 3Q3FA 3FG4A 2R6KA 1RN1A 1GY5A 4IGJA 1TRPA 3KCHA 1Y25A 3FR9A 3TGZA 20GSA 2O85A 1XWAA 4TW5A 3E0UA 1BU4A 2QA2A 2GZYA 4CY6A 5LD0A 4TXVA 4XS6A 5AGYA 3MYTA 1XXUA 1OC9A 1Q42A 3EMXA 5C04A 2WGRA 3IV4A 4ULXA 2VCWA 3CMIA 4HM3B 3ME8A 1DE1A 5GAND 1THXA 5FGOA 4JR6A 1FB6A 3DGQA 1RGHA 3MNGA 2MF7A 1OC8A 1FUTA 5ELJA 1OC3A 2WO0A 4XS4B 1F3BA 3PCRA 1V98A 4ZBAA 1SL0B 2L6CA 1GULA 3D4TA 3HZ8A 2IFQB 2CFDA 3PXMA 1FUWA 1B2MA 2OOVA 4N6NB 2PMTA 1NWWA 1J2BA 2LNSA 1EUIC 1TTOA 1OKTA 4YQUA 2VOCA 3IRAA 4YKGA 2O3OA 1K0BA 3DXOA 1YNVX 1VF2A 1TI1A 2MZCA 3OW22 4MH2A 2IPAA 1IU7A 1RW1A 3CPOA 4EW5A 2JSZA 2QC7A 3URPA 1CQSA 2OBKA 1UUVB 1B4QA 3L4NA 2BMXA 4NXIA 5B6MA 4FYBA 3TOTA 3KSPA 3NBJA 1URMA 3M3MA 1GRXA 3HDCA 1YJ93 3PS8A 1VZZA 4BL7A 1OACA 2IMJA 1WMJA 4GRFA 1PN9A 2L4VA 4WBJA 1DMQA 4HOJA 4EXRA 4ZL9A 1EV9A 4L5OA 3VFIA 2H71A 2XC2A 5IPHA 3BNDA 2C11A 3I9V2 4GSTA 4MNNA 4I2UA 5COHA 2H1BA 2NDOA 1I9DA 3I553 4RQRA 2CZ2A 2DIZA 4K2XA 3CXGA 3DM8A 1STFI 3QD9A 5DCGA 3DWVA 2A4VA 4IVFA 1GOYA 4KCEA 1RCKA 2WOHA 3B7CA 1AUCA 4WBRD 1MD3A 3BOAA 1X1XA 1NDOB 1W7CA 1SL1B 3ZFZA 1OVNA 2F86B 1WIKA 2DKHA 5A5KA 2BMOB 1UGIA 2GSQA 4AKYA 1F2EA 1I2EA 1BSEA 3BB9A 4TX4A 1M904 2CIUA 3LTAA 1TU8A 4K7IA 4LMWA 1MDIA 2B1LA 3WODG 1Z3EA 3LSZA 5KOWA 3G713 16GSA 3FMWA 1GTBA 2BIRA 1UN2A 1PA3A 5F8BA 1ST9A 1GSUA 3ZVJD 1SK1A 3HZ4A 4OO5A 4V2NA 2YX9A 4GXZA 1PX7A 2LRNA 1NSWA 3TJGA 1BGSA 1W4VA 4HJMA 2L4CA 4HOHA 1D6YA 3WDGB 2W9PA 3HVSA 6GSWA 4HM2B 2ON5A 3ED3A 5E4WA 1RK4A 3US3A 4GSSA 1R4CA 4N3VA 2AAEA 6GSPA 4EDZA 2X8GA 4FMAA 4MLYA 1GLPA 3PR8A 4OMVA 2C0FA 1XFLA 1DYUA 2LRTA 4K9ZA 4TXOB 4TXOA 2JU5A 4N0ZA 1RN4A 3PH9A 3UVHA 5JWOB 3FH1A 4L8PA 3X41A 3KZTA 5BVBA 3LORA 4WHAA 1RHLA 4V1Ag 1AVLA 3KTBA 3L78A 5LCZA 1FGQA 1ERVA 2O89A 4KNDA 3GSPA 3DMCA 1ZYNA 1IYYA 2FWHA 2R0PA 5D9VA 3T0UA 3NQYA 4LGQA 4YH2A 2OOVC 3WR2A 5ECSA 3EU3A 1Z6NA 3IR4A 2FWEA 3WA3A 2KP1A 1YIT3 1DMMA 2OQEA 1VQN3 1CYVA 1W00A 4J2FA 1J0FA 3PGBA 1TRWA 3GUSA 1XOBA 3HIGA 1A2JA 1VQ43 1E6BA 3GHAA 4IKHA 1KWIA 1A2VA 4EDYA 3HKRA 4ILFA 4GQCA 1O7GB 1X1WA 1MGWA 4X2OA 4NV2A 1ZGNA 4ECBA 1B2SA 1IYHA 1GNWA 4BIRA 3J7Yd 3NV0A 1R7HA 4IHUA 5DBQA 2X4AA 1NM3A 2WS2A 5HFIA 3KEBA 4KW6A 2WB9A 3S28A 1T5YA 3LYPA 2N5AA 3WMDA 3MDKA 5CRHA 2P0XA 1XIYA 1RTUA 1I3IA 4N11A 1GD4A 2XR8B 3M9JA 1RLSA 4WEYA 1NHOA 4D73B 4FIWA 5D8IA 3EJVA 2YPMA 3AGNA 4CCVA 1Z5YE 2RM6A 1W4NA 1PU4A 1YIJ3 3FK8A 1M7TA 3MG2A 1N2AA 3MIXA 5IMCA 4GQFA 3VPQA 3LTDA 3ZG5A 2GBXB 3D22A 4BVXA 4KT3B 4Z2RA 1PY3A 3S67A 1O81A 1N9EA 1U88A 3F63A 1GSEA 4R1KA 1JB2A 4GB5A 2PGTA 2R0GA 1UDII 4EKZA 4BWSA 2W0QA 3G9BA 1RKYA 3SOYA 5J9CA 2FGTA 3GMFA 1BJXA 1B21A 1RN7A 4MEIA 3H1NA 4ZB6A 4V2MA 1G7EA 1GSYA 4KFEA 1JNQA 2VLTA 5KOXA 5ECHB 3PGTA 3G4S3 3N9HA 1NU3A 4IN0A 4HZ4A 2YV9A 3ZFBA 3FGYA 1JZOA 4KCAA 2PWJA 5DVBA 4ML1A 3QK9A 1DVDA 2JACA 3TRPA 3DRNA 2LYXA 5ID2A 3FZ5A 4L0UA 2BU4A 2IA7A 4L5LA 1FVJA 1PMTA 4FYUA 3GTUA 3GTUB 3ZTLA 2H6YA 1ZS7A 4JZQA 2H66A 1S723 1TIJA 2C10A 2B5EA 1NB3I 4WF4A 2YWIA 4Q5RA 1GNEA 4Z7XA 4HJ2A 1A8LA 1N5PA 3LZAA 3Q1CA 6GSVA 4ML6A 4BTXA 1ZO2A 1K3OA 4AKZA 1I8VA 1B9XC 2HYXA 2IL3A 2YV7A 4JF8A 1NB5I 3EF8A 3ZIVA 1ABAA 3EN8A 1TRSA 1EP8A 1QVF2 1XWGA 2AV4A 5IO2A 3S9FA 1DVCA 1XPVA 2AADA 1AR0A 4XIHA 1GMPA 4BU4A 2JQ5A 3A5WA 4ECIA 1Q7HA 3VWWA 1ULIB 3PYJA 5IOWA 3LYKA 4E8HA 3BCIA 1X1YA 1B27A 1Z6MA 3WD6A 2E2TA 4AJ6A 3F3QA 4BA7A 3IPZA 1H75A 1PGTA 4PGTA 4YQMA 4HZBB 2XRXB 1PQNA 1PKZA 3V98A 3OWSA 4AJ7A 5IMDA 3UIWA 3BJ5A 3D5IA 2LKUA 3MWHA 1M99A 1IK3A 3KE7A 5IO0A 5ECQB 5GSPA 5M19A 1FG4A 3LQ7A 4XTSA 4LL1B 4MDCA 2GSPA 4QL9A 2OE3A 4N0VA 4MPFA 3TKQA 1XW6A 1RSNA 3TJBA 3EHCA 4HM1B 5ECNB 3MKIA 2KF6A 1K734 4XB5A 2VCTA 4GLTA 2M72A 3APSA 4BTYA 5ECIB 3LTCA 2GBWB 2F98A 3A2VA 3G6E3 3K5TA 4OD7A 1TUHA 1MWRA 3CMA3 1X5EA 3CC43 5J3RA 3CCE3 1YF1A 2C3TA 1RRHA 1TTZA 1LQMB 2XGLA 3UMAA 2YZHA 4LYLB 2CVDA 2IMDA 3RHCA 3SXXA 4BIKA 1XZOA 2KLXA 1XWCA 3D5GA 2RCDA 1B2ZA 4R4KA 1I2GA 2F99A 3QFAC 5EVOA 2B1KA 1OE8A 4MZWA 3I6AA 5J4UA 3GZRA 4K0NA 4DEJA 1JLVA 2RUFA 3L9UA 5LNKe 2OE1A 2I81A 3EX9A 2W9QA 2LJRA 1I70A 2R0CA 5G5FA 1KEBA 2ES7A 1Q814 5KN0A 3TCOA 2STDA 3NBRA 1VQP3 1TXXA 3ISOA 4MABA 1R4YA 4KDYA 1IQYA 4RNYA 5IG5A 1K0AA 5H5RA 3QOUA 1Q9EA 4KF9A 1SIIA 5IG3A 5IERA 1YEPA 1BNJA 2LQOA 4OWYA 3J7Yk 4ZL8A 4TKYA 1A2LA 3JUQA 4PX1A 5EY6A 1GD3A 3CCJ3 3VGNA 4NV5A 2HMJB 1D6ZA 2A2SA 2RLIA 3J7Yb 2DIYA 2Z6BA 3QMXA 3BNCA 2VUPA 3LFLA 3DGLA 1T4YA 2EIQA 2H6ZA 5D9TA 2L59A 3NM7A 1BNSA 4HSCX 3A2XA 2RGQA 1VQQA 2FUG2 3TUEA 1GP1A 1TOFA 1TI3A 4XM4A 2LS5A 5D93A 5M18A 2YN1A 2MYGA 5EL8A 3BIRA 4EYCA 2VCXA 5IG4A 1IQ8A 2L6DA 3NIVA 3FLJA 2L5LA 4MZCA 2GVPA 1B8XA 1QUWA 1A0RP 4ZXGA 4PNGA 5CYYA 4KFFA 3ECFA 2AHEA 2JL4A 2IWTA 3GL5A 3DVXA 2KAAA 3M8NA 3F4RA 2CFGA 3F7XA 5IENA 2Y74A 8CHOA 2PVQA 1RRLA 3JCML 1XBSA 3IJEB 3VWXA 3QRDA 4YAPA 2GZPA 1GSSA 1KSIA 5EPFA 5F05A 3F9SA 3R3EA 5FW5A 1O7MB 5KP4A 1W89A 5ECLB 4NPBA 4AJ8A 1WMPA 4HM7B 2HRKA 4Z2UA 1OF5A 1AVKA 2Z9SA 1WMOA 1OAZA 2XF3A 1PFPA 1V57A 1SKWB 2HMMB 1BNRA 4N6MA 3A5IA 4OCEA 3PZWA 1SENA 1F8NA 5J5NA 1BRSA 5IOXA 3ER7A 1UI7A 1ZCPA 3IDVA 1U8CB 1M3IA 4TN8A 3HA9A 4ZM8A 4HUAA 3M8CA 6RNTA 2VCVA 3FR3A 4EF0A 5DQSA 1S5AA 1Q4JA 1M2AA 3ZLPA 2CA8A 4KX4A 4XHMA 5D82A 3FRCA 3DY5A 4MMZB 3UNLA 1O8WA 1WRYA 2F8AA 1W6CA 3SVAA 4JR4A 1B4PA 2UX0A 2E7PA 1B3SA 1N9JA 2Q07A 4HM0B 4PTSA 1JN5B 4HVNA 2JZSA 5I97A 1R26A 4QQ7A 5KN2A 1O7PB 1PL2A 5IPGA 3WOFB 1WE0A 2CX0A 3TRQA 5L71A 2K18A 4WYKA 4JBBA 1DBYA 2KRTA 1OKDA 4I97A 4I5QA 1DMNA 1ZOFA 1GTUA 4HM4B 1K3LA 1JHBA 3D6IA 2OADA 4TVEA 1AQWA 4ID0A 1DE3A 4MF7A 2JZTA 5D96A 2ZA4A 5EVHA 1W01A 3QPMA 3EC9A 4F03A 3HOHA 1SPUA 5A4UA 3DZLA 4BWQA 2L57A 1RJOA 1E3VA 2GLRA 1SL2B 4RNZA 4KGIA 2R41A 3RDEA 1B2XA 3I563 3GSTA 3SBCA 3DH2A 4RI7A 2EIRA 1U6TA 5H5QA 1NW2A 1SYXA 1W02A 5G5EA 1VF1A 1F37A 3T8NA 1JKGA 5D9WA 4KVHA 3CXC2 4K61A 2M80A 5J41A 2X64A 3EYTA 2HRNA 2H8LA 1QALA 5J9BA 3H3HA 2H70A 3K63A 1XW9A 2RNTA 1IYIA 2E2MA 1QAKA 2L1SA 2F5WA 5G2ZA 2MMAA 5G30A 3I43A 3IMAB 3X3ZA 2CG1A 2CX4A 4ZILA 2N5FA 1LOXA 3ZVJA 1G96A 1XW5A 5EQLA 3QAWA 3QDNA 2VIMA 3KH9A 1MDKA 2PNCA 4KDUA 3JUPA 3GH6A 1X0RA 2VL9A 1EOHA 3EBTA 1G02A 2XH9A 4MPGA 2P0MA 2VLVA 3DUKA 3FEUA 3S29A 3KSED 3ZITA 2XBQA 1BVIA 3FSDA 1B2UA 4J8TA 3G7YA 1EQKA 5KP3A 3WA2X 1OGXA 3T8UA 4AGSA 1GSDA 4HZ9B 2R4IA 1TP9A 2MMZA 3U6VA 3HVXA 4L8EA 1R5PA 1FGTA 3WGXA 4HQSA 2KF5A 3H79A 3APQA 3FY7A 3LXZA 3DGMA 1H4OA 4XDWA 2BNGA 1OYJA 3CRUA 5HR0A 1OGZA 4MJCA 2C3QA 3IXRA 3ZRDA 3D9RA 4EV2A 2X8HA 5A0OB 2LNTA 2YZUA 2TRXA 1SJ6A 2BO9B 3CC23 2K9FA 5IF6A 3AGOA 2W04A 1BANA 2IMIA 4CDLA 3RDWA 1DSBA 4N6UA 1VQO3 1TRUA 1BSBA 1YGWA 1EKMA 1G0TA 2DLXA 3F8UA 1BG5A 4K7NA 2BJXA 1ZX2A 5DRVA 3LG6A 3DYRA 5CF1A 1GSPA 1TW9A 2P31A 2V1LA 3EURA 3KIJA 3GKKA 3CSHA 4HI7A 1YJN3 2CFLA 3W8SA 4FCMA 5AIFA 3HXSA 2KCDA 5AYRB 4ACSA 3LWAA 2V6KA 1RGGA 2NTOA 2YCDA 2P0GA 4Q5FA 1V9WA 3NZNA 1PN0A 3ZG0A 2OJLA 3GRDA 1GOUA 5ECMB 4KA0A 1V40A 1JBSA 3KXOA 4WR5A 2A15A 2AYTA 1RQMA 1QGVA 3GFKA 1TRVA 3QAVA 1OF5B 1A90A 4WR4A 1U87A 1GY6A 1BQ7A 4LEHA 1HD2A 1WPIA 5ECOB 2IMKA 3TKSE 1O73A 3VLNA 1YI23 2H1GA 2ZL8A 3A5EA 4IP1A 1E2YA 7GSPA 1FOVA 3HVVA 3D79A 2XFSA 4JRFA 2ZHXB 2EIOA 3DKSA 3IHGA 1RGFA 3UL6A 3LXTA 4K6XA 5BRTA 3R2QA 4MJDA 4XBXA 3EPTA 1JRQA 1LBKA 3I69A 1YKCA 2IYJA 3FZAA 5DDLA 1JB5A 2H30A 2RUEA 1FW1A 4EE0A 2LRCA 5GZZB 1XG8A 3HIIA 2RIIA 1A2PA 1RGLA 2LSTA 3G8ZA 4KDXA 4KSOA 2CAIA 1X1UA 2PVOC 3WGDA 2FWFA 1TKDB 2WGQA 3EWLA 1A24A 3NX0A 1BOXA 1Q824 4J5KA 2FCHA 1VQ73 2H01A 3VF1A 5ELGA 5AIXA 1TFOA 3KP8A 2O7KA 2NPBA 3C1RA 1OHPA 1I0XA 5JWRB 3EMPA 2M7OA 3EN1B 3FZWA 7GSSA 1F6MC 5CAXA 4HU7A 2FA4A 4H86A 2GEXA 17GSA 3VSYA 4FH8A 3CTFA 3EVIA 3O76A 5CRDA 3KIIA 3F8XA 1LOYA 2ZDJA 3AHWA 4PQIA 1GS3A 2CHCA 4NHZA 3X3XA 2GU3A 1T1VA 2FWGA 3M1GA 2HZFA 1IV7A 4F0BA 1UCLA 2QGVA 1K28A 1TU5A 1JZRA 5GAPD 2QA1A 4PURA 3JVCA 2YJHA 1YJW3 2Z77A 5ELUA 3GH9A 2WJUA 2HFDA 3LMLA 1SD9A 2QA43 3FHKA 5IQYA 2DJKA 3D21A 3FF2A 4K8MA 1T2HA 4O5UA 4FCZA 3CRTA 4ZIJA 2HOHA 1WJKA 1UVZA 1YJ6A 1V2AA 2C8UA 9RNTA 3RNTA 2ML6A 1Y4KA 4PUFC 2SARA 2F8FA 3FG1A 3IBHA 4N30A 2P5RA 1FYSA 2HZEB 2VL3A 3GWRA 1SJWA 1SKRB 3MWZA 3TOUA 4BVXB 3CSIA 3Q6OA 4CJNA 3LTBA 1BAYA 3GIXA 5LC7A 2VCQA 3FR6A 4J5GA 1YHQ3 4Q5QA 3QAGA 3C73A 1K0OA 1GUMA 1X5DA 3HVNA 3OWYA 4LA1A 1YF0A 2HLSA 1QK8A 4ECCA 3QFBC 4YKFA 3HX8A 5IMFA 4IW9A 1AQXA 5A4VA 4TRXA 2YFJB 1PSQA 1J08A 2BT3A 1JFUA 1JKGB 5D9XA 5JBSA 2D1WA 4JRRA 2HMLB 1QFNA 3H93A 1Q40B 2C80A 4RNTA 3RAZA 3D4AA 4OFTA 3KTLA 2FY6A 3GX8A 4WKWA 3NHXA 4IQAA 2N5BA 1C72A 5CNWA 1CEWI 4G0KA 4FCJA 4LL4B 4GL6A 3SX1A 2RSXA 2I9HA 1ULJB 3L9SA 2LJKA 2WOFA 4G0LA 1BSCA 4MCUA 5EEOA 2P5QA 1A67A 3UBLA 1M1K4 3UEMA 4EIPA 2R37A 2P05A 1GH2A 4O3VA 2LQQA 2BTOT 4FYCA 5AN1A 3Q2PA 2K0MA 4K2DA 2E2VA 1T4ZA 2HXKA 1PYLA 2AAWA 4YQVA 2B1XB 2I1UA 5KEJA 4R9KA 1UI8A 1MWUA 5DALB 3TDGA 1M9GA 2GEYA 4E8EA 2PBJA 1MTCA 2HRFA 2MMOA 3HYPA 3K7CA 1XWKA 3ZMLA 1M0UA 3TJKA 1KBNA 1THOA 3B4OA 3KCMA 3D3LA 3PINA 2MBTA 4RBNA 3HI7A 5KP1A 5AIIA 2GT5A 1T2IA 3F0IA 3HJOA 2D42A 4LMVA 4HJLB 3K0ZA 1K41A 3B4PA 2IIYA 4GSNA 5DJMA 5GSTA 2H0HA 3BLZA 1BSAA 3GZXB 5G31A 2DJ0A 4K1UA 3GX0A 4NHFA 5HR3A 3HJPA 1ON4A 1RGKA 3C8EA 1FOHA 3D5JA 2LQVA 2CFKA 1GTAA 5CO3A 3RHBA 1N5HA 4MA9A 1Q7Y4 4N6OB 3GL3A 2B5YA 1N8QA 2DJ2A 4HDEA 4KB3A 3EE1A 1AC1A 4QWTA 1K8A4 4QL7A 3HK4A 1UUWB 3K8NA 3ZZXA 6GSUA 3OX9A 5BXQA 1M3JA 1VQ93 3APOA 5RNTA 4K7OA 1EOGA 2YFIB 3O3TA 3F9UA 4X4JA 1FO5A 1VQL3 3FCSB 2GDRA 4JU5A 1W6YA 2ALBA 1LXEA 1VRSD 1YGEA 2X8CA 1PX6A 1VQM3 6GSYA 5BU4A 3LYGA 3P8WA 3CCM3 5JPUA 2H1DA 3EC3A 2V6OA 1FGOA 1K3YA 2VL2C 2W03A 2BMQB 1AV4A 4IJ3A 5STDA 2GQLA 3KMOA 3P7XA 4OFNA 4LSOA 4V2LA 3OR5A 1ML6A 1YZXA 4HS1A 4XDVA 2DSAA 4MJAA 3MSZA 2CKFB 4H3UA 2V1MA 4D73A 2WCIA 3IHQA 2WFCA 1PL1A 1OHSA 1M9BA 1R5AA 2CVBA 4RI6A 2WZ9A 2CK3H 3F14A 3FZ4A 1FA3A 1E3RA 4TR0A 3UB1A 1Z9HA 2AJQB 2R4VA 1ZMAA 4Q5NA 2O87A 1LJRA 5ECPB 3MAKA 5B7CA 4WFOA 1TK5B 5AEWB 4O7HA 2F56A 1AY7A 4MH3A 2IMEA 1W5ZA 1HNCA 1ASKA 1OHOA 3U1WA 1EV4A 4KE3A 1HU9A 3LOYA 1B48A 1JLWA 3FW2A 2HRAA 3BD2A 3IE3A 3BU4A 2KUCA 3ZFLA 1X5CA 1LNIA 3NUVA 5HFGA 2VO4A 3TJJA 5B6NA 4WXTA 1HKXA 3DIEA 4ICYA 2JADA 1PFOA 3LGCA 3FF0A 3DMLA 3TKSC 3O6TA 1ACVA 12GSA 2OTL3 4POBA 2KF4A 1KNGA 4IJIA 4K5SA 1KC84 2YWMA 3TKRA 1QQ2A 3KN4A 1BRJA 1K0MA 4K5RA 1ZGXA 1IT7A 2IJYA 4FO5A 1US1A 5AISA 3LT8A 4CW9A 4L7KA 5INYA 2IUJA 1S3CA 1QMVA 4NWYA 2DJ3A 5LC6A 1Q864 2HE3A 8RNTA 2W56B 4HBRA 1WMNA 2XFTA 3KFQC 4L8OA 7RNTA 1M2BA 4F0CA 5FHIA 1X9MB 3G0KA 1VQK3 3EINA 3UL5A 3KP9A 3PPUA 2VM2A 3MHEA 5AIVA 2TRCP 1FGMA 4LMIA 3STDA 4BTWA 4GTUA 2WGOA 4Z2TA 1ERUA 1UGHI 3Q18A 2GQKA 4OVMA 5JCUA 1TFKA 2OKAA 2MBSA 5M1AA 4MF6A 1GMQA 3D0ZA 2H72A 1BAOA 1EGOA 5A4WA 3Q74A 1LNHA 3IAM2 4DKIA 1YEXA 1MEKA 4TR4A 4I6XA 2VCZA 2B7KA 2HMNB 2EC4A 2CT6A 2J23A 4BL3A 4XCSA 4RUVA 1O8XA 1ZYPA 1RGAA 1SJZA 3HY2A 5FWGA 3NBBA 3HZPA 7STDA 3SEDA 2OTJ3 1YDKA 3HD5A 3LJRA 4O92A 2JDIH 3OV4A 2XPDA 2LUSA 2CFWA 1G6YA 1K0NA 1VF4A 4ZB9A 5CLKA 3GAXA 2VLUA 2O9UX 3GNJA 5G2GA 1JB4A 3WT2A 4F2IA 1LOVA 1Q40A 2GSRA 3CCV3 3NOFA 2SBLA 3F6DA 5JCWA 1Y6EA 1IVXA 1QAFA 2TIRA 1JZWA 1Z7RA 2QIYA 3ERFA 3JUOA 3MG3A 5DREA 1HYUA 3RBTA 1BRNL 1SJIA 4HZ2A 4BL7B 2B6MA 5CRWA 1BNFA 1HQOA 1OH0A 1V74A 5CF2A 4O02B 3A76A 1I0VA 4ZB8A 5IW9A 4EUYA 4FQUA 2VL2A 5B8BA 4XRDA 2GSTA 4AF2A 3N54B 1SQWA 1YKAA 1GSQA 4POMA 4EO3A 4I4KA 1M2DA 2H6XA 3E9JB 1EP7A 3VURA 4JE1A 1BYEA 1EZKA 1RMSA 3X40A 3UBKA 3BCKA 3I0YA 4POLA 1IQXA 2VM1A 3G7JA 3BNEA 2KF3A 2IFQA 5DCHA 3TKSA 1GUKA 4DSSA 1OE7A 2PUKC 1MNLA 4EV5A 1KTEA 1WWJA 4XS4A 11GSA 2C1YA 1I5GA 2K8SA 2CV4A 4J57E 1MD4A 3K9MC 3VK9A 4HAAA 1BSDA 3GSSA 2YWNA 1YVBI 1WP0A 2HMOB 1F3AA 2B24B 1FGRA 2HT9A 2XBIA 4HQZA 4WWUC 2C0DA 2C4BA 3FKAA 3JUMA 1AQZA 1OC9B 1VGLA 2DKIA 3AMOB 5JCGA 2CC3A 1UC7A 1XOAA 1T8EB 2H0IA 3IC4A 3H4KA 2GSSA 4HU9A 5IM9A 3OXAA 5JWQB 4EL1A 3M9KA 1D6UA 3MSOA 3CSJA 3GKXA 4WETA 2KHPA 4HEA2 22GSA 1VQ83 3IOSA 1TJDA 5E59A 1BIRA 4P3YB 4U13A 3HJMA 1TK0B 3P90A 1YY7A 3Q90A 1RGEA 1A23A 1LQGC 1EA2A 1OCVA 2I9WA 4Q53A 1GTIA 1QMAA 1MDJA 1L5GB 3EBYA 3B8LA 3UL3A 2L5OA 2V2GA 2CG0A 3G7IA 2ZNMA 1ROAA 1IV9A 2P09A 3EQQB 2HMKB 2F5MA 6STDA 1EWXA 1OUNA 1WTHA 3NV0B 2GT6A 4G0IA 2H19A 1ZZYA 4G10A 4TR1A 5HR2A 3KGKA 3ZMKA 4TR3A 5CXOA 4USSA 1PRXA 4G1MB 1JV2B 4K1VA 4N6LA 2JZRA 2AB6A 3H8QA 5DAKB 3ZL5A 1O7NB 2Z7AA 2UUGC 2JSYA 1C7HA 3AHSA 2OACA 4KUNA 4CHSA 3G16A 3F6FA 2C0EA 3RPNA 4KH7A 3PCSA 5G1LA 1FW7A 4MJBA 4BPYA 2I4AA 3IK9A 4J56E 2RFRA 3RPPA 1A8YA 1ERWA 2IN3A 2B5XA 2QKEA 3P2AA 4GF0A 1U5OA 1SKSB 3S27A 4MF5A 3NQZA 4NREA 5B8AA 4STDA 4PUAA 2IUKA 3SLUA 1JBTA 1MGRA 3DD3A 3FZ9A 3CME3 2AUVA 4FMDA 1BUQA 3KZQA 5D81A 1GSFA 4XS1A 4EIQA 1TRQA 1FVKA 3MG1A 3CTGA 2DBCA 4K0GA 1N8JA 1JJ22 2A4HA 1WNHA 5AIHA 1C54A 1VF3A 3GKNA 2E0QA 1LU4A 5ECKB 3DEXA 1S3DA 2RM5A 4DVCA 1UCJA 3TKPA 2WDUA 3TRXA 5JPPA 2LTKA 3N9JA 1RDSA 2OE0A 2CW9A 4BVYB 3HCZA 1Z1SA 1YQ1A 4I8BA 3UAPA 1DE2A 1IVWA 2FLSA 2GU1A 3LW9A 1Q98A 4IT7A 4FMCA 1G7OA 5GSSA 6GSXA 4L0WA 2K6VA 1W6GA 1T3BA 4TOPA 2ON7A 3VI7A 2WULA 2XPEA 1DETA 3A2WA 6GSTA 3SWLA 4FMBA 4CY8A 1YVSA 2DMMA 4O8SA 3CPW2 2Y73A 4LZIA 3VPTA 1EG9B 2FGXA 2FD3A 4ECJA 3IA1A 2DJ1A 1SK0A 4HM8B 3WT1A 1U3IA 3CCQ3 4ORLA 2C3NA 2E2UA 4K90B 4RZMA 2MC8A 5HOHA 1ERTA 4XBTA 3GV1A 1SK2A 4H61A 9GSSA 4CPKA 3ME7A 2GXFA 5DALA 2OWPA 1EEJA 3ZREA 2I3YA 4MZBA 2F3MA 2K3DA 4JEDA 2M46A 3A3TA 4WF5A 1W2B2 2IY2A 1ZL9A 2BMRB 1I3FA 2HSMA 4O32A 3CCR3 2OQEC 1KQS2 3ZIJA 4F9ZA 5DJLA 2GS3A 1O85A 2PERA 4OFMA 1VQ53 3GZYB 5C00A 2KP2A 2LV3A 2NVLA 1W2ZA 1IDPA 2K8VA 1PD21 4ZBDA 1SD8A 1Z7PA 2F9SA 1A2MA 2L4QA 3CCU3 1GYBA 4I2TA 5G1KA 3S5CA 1LRAA 3DGYA 3E99A 4O2HA 2K54A 1BRIA 2E2GA 2FA8A 3Q19A 1MOLA 1FHEA 4OO4A 5AIGA 3V92A 4TR1B 1UUGB 1ISKA 3C71A 3LT9A 2GZZA 3L0HA 1M9AA 2YJ7A 4J9AA 4MMXB 5IG0A 4KFDA 2VAFA 1U3AA 1GOVA 2J8XB 4MMYB 3FKFA 2H73A 5FT3A 4X1UA 3CQFA 2CX3A 3F3RA 2G0FA 4X43A 1O7UA 2P38A 1X9SB 4HYZA 2MMNA 1BUJA 5CK6A 1DUGA 4EC6A 8GSSA 4ISDA 3E3EA 3WYWA 1BRKA 1O7HB 2QSIA 1TU7A 1KD14 1V58A 4IQ1A 1UA5A 2H1AA 3VWVA 1NHYA 2QEX3 1BNEA 4IBPA 3BBYA 3V1WA 3LH4A 3CYNA 5ID2B 18GSA 3AY8A 1O6JA 3KJYA 1ROVA 3AMOA 2GQMA 1S3RA 2X49A 4PEJA 2QGUA 2R2JA 1I2FA 4NHWA 4HM6B 4DSQA 3C1SA 4F82A 3DGOA 4WYKB 5AYSC 1MWTA 2OA7A 1TK8B 4PQHA 1NO3A 5HQPA 1A2KA 2LJAA 2KXGA 2C0GA 4NAXA 4G19A 1E97A 1USBA 2CZ3A 1IVVA 1SYRA 5F0GA 3FG3A 3V99A 1JN5A 1ZYEA 1N8R4 1GLQA 3GYKA 3CNMA 3H51A 4WP5A 1GMRA 3SOAA 2PPTA 2YNXA 4R9LA 1GY7A 2YOIA 3IAS2 5AEUB 4LLRA 2FHEA 2A2PA 2XSHB 5IMVA 5ABRA 2V32A 1CYUA 3F7SA 3LEFA 1B9YC 2ZCTA 3EB8A 3UOMA 1BNGA 1RCLA 4GSPA 5F06A 4R80A 1IT8A 3O8YA 1HZ1A 5DAKA 3QCPA 1FUSA 3F4TA 3DVWA 2F4YA 4O5RA 3FYGA 5IEOA 4ZBBA 4X0XA 4YAVA 3GKMA 2YANA 1UW1A 3KH7A 1RGCA 14GSA 2DMLA 3CNXA 3OWUA 3UJ1A 3NM2A 4DSRA 3RGRA 4O5QA 4GWRA 5HR1A 5CREA 1PKWA 4X2HA 1O7WB 2CWUA 3MYDA 1T00A 1STDA 3KD0A 4KZ1A 2G2QA 1BEDA 1X9WB 3KM6A 5IIZA 1BX9A 3IC8A 3CD63 2UZ8A 3EU4A 5F07A 3C7MA 3F40A 1ILOA 3U5RE 1K0DA 2B7JA 3L0RA 2CWVA 3X3YA 1RNTA 1GUHA 4POKA 3WOEB 2VD0A 4XRAA 3CC73 3ERWA 3VWUA 1FZUA 3UARA 2UGIA 4GHOA 4AEQA 1QVG2 2CH9A 1LOWA 1WOUA 4NMUA 2RBIA 1BRHA 1HNBA 3TJFA 1XWBA 3CBUA 4EBGA 1B20A 1FAAA 4N6TA 4FR9A 2H74A 3ALAA 10GSA 1S3AA 2PZVA 2A2RA 5DQYA 6GSSA 3ROBA 2PN8A 4IP6A 1AAZA 4MK3A 1SU9A 4DSSB 4OK0A 2H0GA 4IELA 1UCKA 2HI7A 2XSOB 1CQHA 19GSA 2YWOA 4EC0A 2PU9C 1OPYA 2OCTA 3F8HA 4PNFA 2FNQA 2BHMA 3N8BA 2CAQA 1UCIA 3DGNA 3NXJA 1LVNA 5ENUA 5BMUA 4HM5B 2VD1A 3GRXA 4BL2A 3GURA 3SYUA 1GL8A 5IEPA 3JUNA 3GN3A 4EXJA 5H5SA 3EE2A 3L9VA 3GZBA 1K0CA 2YP6A 4PQ1A 1M1XB 3F4SA 5KN3A 2C4JA 3UJMA 3VI5A 3M0FA 5CRGA 5IMAA 4MP4A 1NNVA 5D73A 5TGNA 3CCS3 2R3XA 3QR6A 3TB2A 2GTUA 2HSHA 4K1FA 4BVYA 2CWTA 3IPTA 2H75A 3GA4A 1CH0A 1BNIA 2FXTA 2XHFA 3U97A 1AQVA 2HSYA 4N6V0 5IMZA 4OUQA 4ZL7A 1XVWA 2D2ZA 3W6GA 2J9HA 4EVMA 3WHOA 3BNBA 3HHVA 4GCIA 1QXHA 1EGRA 1TP6A 1F9MA 3ERGA 4IS0A 5KN1A 1AIUA 2GGTA 1RNBA 2ML5A 2DC5A 2XGNA 1FB0A 5HGRA 3KKGA 4G9HA 3W8JA 1G6WA 2KOKA 1SARA 2CQ9A 2YFLB 2INXA 2H76A 2DJJA 4OCFA 2CX1A 5ECRB
chains in the Genus database with same CATH topology
1AW9A 4G2EA 1JZDA 5CP1A 2LEGA 2WRTA 4KAEA 2V41A 5HFKA 5ELAA 3KMNA 4PXOA 1T7PB 13GSA 1ZYQB 4MMMA 1XCCA 4N10A 3ZYWA 1TDIA 2F51A 4CDOA 2CVKA 2O8VB 2FNOA 4V1Ap 1A0FA 3UVTA 2IMFA 3D4MA 1HNAA 1J9BA 2X99A 2OBIA 4A5PA 2ZUPA 2HZEA 1AXDA 2NBSA 1XVQA 1GWCA 1CQGA 4KSMA 2B3SA 3N5OA 4RQXA 1R4WA 3IK7A 3WGEA 2R5GA 3DXBA 4MJEA 1EEMA 2REMA 2HNLA 2R6KA 4IGJA 1Y25A 3FR9A 3TGZA 20GSA 2O85A 1XWAA 4TW5A 3E0UA 2QA2A 2GZYA 4CY6A 5LD0A 4TXVA 4XS6A 5AGYA 1XXUA 1OC9A 3EMXA 5C04A 2WGRA 3IV4A 4ULXA 2VCWA 3CMIA 3ME8A 1DE1A 5GAND 1THXA 4JR6A 1FB6A 3DGQA 3MNGA 1OC8A 1OC3A 4XS4B 1F3BA 4ZBAA 1V98A 1SL0B 2L6CA 1GULA 3D4TA 3HZ8A 2IFQB 2PMTA 2LNSA 1OKTA 4YQUA 2VOCA 3IRAA 4YKGA 1K0BA 1VF2A 1TI1A 2MZCA 4MH2A 2IPAA 1RW1A 2JSZA 2QC7A 2OBKA 1B4QA 3L4NA 2BMXA 4NXIA 5B6MA 4FYBA 3TOTA 1URMA 3M3MA 1GRXA 3HDCA 4BL7A 1WMJA 4GRFA 1PN9A 4WBJA 4HOJA 4ZL9A 1EV9A 4L5OA 3VFIA 2H71A 2XC2A 5IPHA 3I9V2 4GSTA 4MNNA 4I2UA 5COHA 2H1BA 2NDOA 1I9DA 4RQRA 2CZ2A 2DIZA 4K2XA 3CXGA 5DCGA 3QD9A 3DWVA 2A4VA 4IVFA 4KCEA 1AUCA 4WBRD 1MD3A 3BOAA 1SL1B 1OVNA 1WIKA 2DKHA 5A5KA 2GSQA 1F2EA 1TU8A 4K7IA 4LMWA 1MDIA 2B1LA 1Z3EA 3LSZA 5KOWA 16GSA 3FMWA 1GTBA 1UN2A 1PA3A 5F8BA 1ST9A 1GSUA 3ZVJD 1SK1A 3HZ4A 4OO5A 4V2NA 4GXZA 1PX7A 2LRNA 1NSWA 3TJGA 1W4VA 4HJMA 2L4CA 3HVSA 6GSWA 2ON5A 3ED3A 5E4WA 1RK4A 3US3A 4GSSA 4EDZA 2X8GA 4MLYA 1GLPA 3PR8A 4OMVA 2C0FA 1XFLA 2LRTA 4K9ZA 4TXOB 4TXOA 2JU5A 4N0ZA 3PH9A 3UVHA 5JWOB 3LORA 4V1Ag 3KTBA 3L78A 5LCZA 1ERVA 2O89A 4KNDA 2R0PA 1ZYNA 2FWHA 5D9VA 4YH2A 5ECSA 3EU3A 1Z6NA 3IR4A 2FWEA 2KP1A 4J2FA 1J0FA 1TRWA 3GUSA 1XOBA 1A2JA 1E6BA 3GHAA 4IKHA 4EDYA 3HKRA 4ILFA 4GQCA 4NV2A 1ZGNA 4ECBA 1IYHA 1GNWA 1R7HA 5DBQA 4IHUA 2X4AA 1NM3A 2WS2A 5HFIA 3KEBA 4KW6A 2WB9A 3LYPA 2N5AA 3MDKA 5CRHA 1XIYA 4N11A 3M9JA 4WEYA 1NHOA 4D73B 4FIWA 5D8IA 2YPMA 1Z5YE 2RM6A 3FK8A 1M7TA 1N2AA 3MIXA 5IMCA 4GQFA 3VPQA 3D22A 4BVXA 4Z2RA 1O81A 1U88A 3F63A 1GSEA 2PGTA 2R0GA 4EKZA 4BWSA 3G9BA 5J9CA 3GMFA 1BJXA 3H1NA 4ZB6A 4V2MA 1G7EA 1GSYA 2VLTA 5KOXA 5ECHB 3PGTA 4IN0A 4HZ4A 2YV9A 3ZFBA 1JZOA 4KCAA 2PWJA 5DVBA 4ML1A 2JACA 3TRPA 3DRNA 5ID2A 3FZ5A 4L0UA 4L5LA 1FVJA 1PMTA 4FYUA 3GTUA 3GTUB 3ZTLA 2H6YA 4JZQA 2H66A 2B5EA 4WF4A 2YWIA 4Q5RA 1GNEA 4Z7XA 4HJ2A 1A8LA 6GSVA 4ML6A 1K3OA 1B9XC 2HYXA 2IL3A 2YV7A 3ZIVA 1ABAA 1TRSA 1EP8A 1XWGA 2AV4A 5IO2A 3S9FA 1XPVA 4XIHA 3A5WA 4ECIA 3VWWA 5IOWA 3LYKA 4E8HA 3BCIA 1Z6MA 3WD6A 4AJ6A 3F3QA 4BA7A 3IPZA 1H75A 1PGTA 4PGTA 4YQMA 1PQNA 1PKZA 4AJ7A 5IMDA 3UIWA 3BJ5A 3MWHA 2LKUA 1M99A 5IO0A 5ECQB 1FG4A 3LQ7A 4XTSA 4LL1B 4MDCA 4QL9A 2OE3A 4N0VA 4MPFA 3TKQA 1XW6A 3TJBA 5ECNB 4GLTA 2VCTA 2M72A 3APSA 5ECIB 3A2VA 4OD7A 1X5EA 5J3RA 1YF1A 2C3TA 1TTZA 3UMAA 2YZHA 2CVDA 2IMDA 3RHCA 1XZOA 2KLXA 1XWCA 3QFAC 5EVOA 2B1KA 1OE8A 4MZWA 3I6AA 5J4UA 4K0NA 4DEJA 1JLVA 2RUFA 3L9UA 5LNKe 2OE1A 2I81A 2LJRA 2R0CA 5G5FA 1KEBA 2ES7A 3TCOA 1TXXA 3ISOA 4MABA 4KDYA 1K0AA 5H5RA 3QOUA 4KF9A 1YEPA 2LQOA 4OWYA 3J7Yk 4ZL8A 4TKYA 1A2LA 4PX1A 5EY6A 4NV5A 2A2SA 2RLIA 3J7Yb 2DIYA 3QMXA 2VUPA 3LFLA 1T4YA 2EIQA 2H6ZA 5D9TA 2L59A 3A2XA 2FUG2 3TUEA 1GP1A 1TOFA 1TI3A 2LS5A 5D93A 2YN1A 2MYGA 5EL8A 2VCXA 2L6DA 3NIVA 4MZCA 2L5LA 2GVPA 1B8XA 1QUWA 1A0RP 4ZXGA 4PNGA 5CYYA 2AHEA 3GL5A 2JL4A 2IWTA 3DVXA 3M8NA 3F4RA 2PVQA 3JCML 1XBSA 3VWXA 4YAPA 2GZPA 1GSSA 5EPFA 5F05A 3R3EA 1W89A 5ECLB 4NPBA 4AJ8A 2HRKA 4Z2UA 2Z9SA 1OAZA 1V57A 1SKWB 3A5IA 4OCEA 1SENA 5J5NA 5IOXA 1ZCPA 3IDVA 4TN8A 3HA9A 4HUAA 2VCVA 3FR3A 4EF0A 5DQSA 1Q4JA 1M2AA 3ZLPA 2CA8A 4KX4A 4XHMA 3FRCA 1O8WA 1WRYA 2F8AA 4JR4A 1B4PA 2E7PA 4PTSA 2JZSA 1R26A 4QQ7A 5KN2A 1PL2A 5IPGA 1WE0A 3TRQA 5L71A 2K18A 4JBBA 1DBYA 1OKDA 4I97A 4I5QA 1ZOFA 1GTUA 1K3LA 1JHBA 3D6IA 2OADA 4TVEA 1AQWA 4ID0A 4MF7A 2JZTA 5D96A 3QPMA 4F03A 5A4UA 4BWQA 2L57A 2GLRA 1SL2B 4KGIA 3GSTA 3SBCA 4RI7A 2EIRA 5H5QA 1U6TA 1NW2A 5G5EA 1SYXA 1VF1A 1F37A 5D9WA 2M80A 5J41A 2X64A 3EYTA 2HRNA 2H8LA 5J9BA 2H70A 1XW9A 1IYIA 2E2MA 5G2ZA 5G30A 2MMAA 3I43A 2CX4A 4ZILA 2N5FA 3ZVJA 1XW5A 3QAWA 3QDNA 2VIMA 3KH9A 1MDKA 4KDUA 3GH6A 1X0RA 2VL9A 1EOHA 4MPGA 2VLVA 3FEUA 3ZITA 2XBQA 3G7YA 4AGSA 1GSDA 1TP9A 2MMZA 3U6VA 3HVXA 4L8EA 1R5PA 3WGXA 4HQSA 3H79A 3APQA 3FY7A 3LXZA 1H4OA 3CRUA 1OYJA 5HR0A 4MJCA 2C3QA 3IXRA 3ZRDA 2X8HA 2LNTA 2YZUA 2TRXA 1SJ6A 2K9FA 2IMIA 3RDWA 1DSBA 1TRUA 1G0TA 2DLXA 3F8UA 1BG5A 4K7NA 2BJXA 3LG6A 3DYRA 2P31A 1TW9A 3EURA 3KIJA 3GKKA 3CSHA 4HI7A 3W8SA 3HXSA 4ACSA 3LWAA 2V6KA 2NTOA 2YCDA 2P0GA 4Q5FA 1V9WA 3NZNA 1PN0A 2OJLA 5ECMB 4KA0A 1V40A 3KXOA 4WR5A 2AYTA 1RQMA 1QGVA 3GFKA 1TRVA 3QAVA 4WR4A 1U87A 1BQ7A 1HD2A 1WPIA 5ECOB 2IMKA 3TKSE 1O73A 3VLNA 2H1GA 4IP1A 1E2YA 1FOVA 3HVVA 3IHGA 2EIOA 5BRTA 3DKSA 4K6XA 3LXTA 3R2QA 3EPTA 1LBKA 3I69A 1YKCA 2IYJA 3FZAA 5DDLA 2H30A 2RUEA 1FW1A 4EE0A 2LRCA 5GZZB 2RIIA 2LSTA 4KDXA 4KSOA 2CAIA 2PVOC 3WGDA 2FWFA 1TKDB 3EWLA 1A24A 2FCHA 2H01A 5ELGA 5AIXA 3KP8A 2O7KA 2NPBA 3C1RA 5JWRB 3EMPA 7GSSA 1F6MC 5CAXA 4HU7A 2FA4A 4H86A 17GSA 5CRDA 4FH8A 3CTFA 3EVIA 3O76A 4PQIA 4NHZA 1T1VA 2FWGA 3M1GA 2HZFA 4F0BA 2QGVA 1JZRA 5GAPD 2QA1A 4PURA 2YJHA 3GH9A 2WJUA 2HFDA 1SD9A 3FHKA 5IQYA 2DJKA 3D21A 4K8MA 4O5UA 3CRTA 4ZIJA 1WJKA 1UVZA 1YJ6A 1V2AA 2C8UA 4PUFC 2F8FA 3IBHA 4N30A 2P5RA 2HZEB 2VL3A 1SKRB 3TOUA 4BVXB 3CSIA 3Q6OA 1BAYA 3GIXA 2VCQA 3FR6A 4Q5QA 3QAGA 3C73A 1K0OA 1GUMA 1X5DA 4LA1A 1YF0A 2HLSA 1QK8A 4ECCA 3QFBC 4YKFA 5IMFA 4IW9A 1AQXA 5A4VA 4TRXA 1PSQA 1J08A 1JFUA 5D9XA 4JRRA 1QFNA 3H93A 2C80A 3RAZA 4OFTA 3KTLA 2FY6A 3GX8A 4WKWA 4IQAA 2N5BA 1C72A 5CNWA 4G0KA 4LL4B 2I9HA 3L9SA 2LJKA 4G0LA 4MCUA 2P5QA 3UBLA 3UEMA 4EIPA 2R37A 4FYCA 5AN1A 1GH2A 2LQQA 2BTOT 4K2DA 1T4ZA 2HXKA 2AAWA 4YQVA 2I1UA 5KEJA 5DALB 3TDGA 4E8EA 2PBJA 1MTCA 2HRFA 2MMOA 3HYPA 1XWKA 3ZMLA 1M0UA 3TJKA 1KBNA 1THOA 3KCMA 3PINA 2MBTA 2GT5A 3F0IA 3HJOA 4LMVA 2IIYA 4GSNA 5DJMA 5GSTA 2H0HA 5G31A 2DJ0A 3GX0A 5HR3A 3HJPA 1ON4A 3C8EA 1FOHA 3D5JA 1GTAA 5CO3A 3RHBA 4MA9A 3GL3A 2B5YA 2DJ2A 4HDEA 4KB3A 1AC1A 4QL7A 3K8NA 3ZZXA 6GSUA 3APOA 4K7OA 1EOGA 3O3TA 3F9UA 4X4JA 1FO5A 2GDRA 4JU5A 2ALBA 1VRSD 2X8CA 1PX6A 6GSYA 3P8WA 2H1DA 3EC3A 2V6OA 1K3YA 2VL2C 4IJ3A 2GQLA 3KMOA 3P7XA 4OFNA 4V2LA 3OR5A 1ML6A 1YZXA 4HS1A 2DSAA 4MJAA 3MSZA 2V1MA 4D73A 2WCIA 3IHQA 2WFCA 1PL1A 1M9BA 1R5AA 2CVBA 4RI6A 2WZ9A 3FZ4A 4TR0A 1Z9HA 2AJQB 2R4VA 1ZMAA 4Q5NA 2O87A 1LJRA 5ECPB 3MAKA 5B7CA 1TK5B 4O7HA 4MH3A 2IMEA 1HNCA 1EV4A 4KE3A 1B48A 1JLWA 3FW2A 2HRAA 3BD2A 3IE3A 2KUCA 3ZFLA 1X5CA 5HFGA 2VO4A 3TJJA 5B6NA 4WXTA 3DIEA 4ICYA 2JADA 3LGCA 3DMLA 3TKSC 3O6TA 1ACVA 12GSA 4POBA 1KNGA 4IJIA 4K5SA 2YWMA 3TKRA 1QQ2A 1K0MA 4K5RA 2IJYA 4FO5A 5AISA 4CW9A 5INYA 1S3CA 1QMVA 4NWYA 2DJ3A 2HE3A 1M2BA 4F0CA 5FHIA 1X9MB 3KP9A 3EINA 3PPUA 2VM2A 5AIVA 2TRCP 4GTUA 4Z2TA 1ERUA 3Q18A 2GQKA 5JCUA 2OKAA 2MBSA 4MF6A 3D0ZA 2H72A 1EGOA 5A4WA 3Q74A 3IAM2 1YEXA 1MEKA 4TR4A 4I6XA 2VCZA 2B7KA 2EC4A 2CT6A 2J23A 4XCSA 4RUVA 1ZYPA 1O8XA 1SJZA 3HY2A 5FWGA 3HD5A 1YDKA 3LJRA 4O92A 2XPDA 2LUSA 1G6YA 1K0NA 1VF4A 4ZB9A 2VLUA 3GNJA 4F2IA 3WT2A 2GSRA 3NOFA 3F6DA 5JCWA 1Y6EA 2TIRA 1JZWA 1Z7RA 3ERFA 3RBTA 1HYUA 4HZ2A 1SJIA 4BL7B 2B6MA 5CRWA 1HQOA 4EUYA 4ZB8A 4FQUA 2VL2A 5B8BA 4XRDA 2GSTA 4AF2A 1YKAA 1GSQA 4POMA 4EO3A 1M2DA 2H6XA 3E9JB 1EP7A 3VURA 4JE1A 1BYEA 1EZKA 3UBKA 3BCKA 4POLA 2VM1A 3G7JA 2IFQA 5DCHA 3TKSA 1GUKA 4DSSA 1OE7A 2PUKC 1KTEA 1WWJA 4XS4A 11GSA 2C1YA 1I5GA 2K8SA 2CV4A 4J57E 1MD4A 3VK9A 3GSSA 2YWNA 1WP0A 1F3AA 2HT9A 2XBIA 4HQZA 2C0DA 1OC9B 1VGLA 2DKIA 5JCGA 1UC7A 1XOAA 1T8EB 2H0IA 3IC4A 3H4KA 2GSSA 4HU9A 5IM9A 5JWQB 4EL1A 3M9KA 3GKXA 3CSJA 4WETA 2KHPA 4HEA2 22GSA 3IOSA 1TJDA 5E59A 4P3YB 3HJMA 1TK0B 3P90A 1YY7A 1A23A 1GTIA 1MDJA 3UL3A 2L5OA 2V2GA 3G7IA 2ZNMA 1EWXA 4G0IA 5KN0A 2GT6A 4TR1A 2H19A 1ZZYA 4G10A 3ZMKA 5HR2A 3KGKA 4TR3A 4USSA 1PRXA 2JZRA 2AB6A 3H8QA 5DAKB 3ZL5A 2JSYA 4KUNA 2OACA 4CHSA 3F6FA 2C0EA 3RPNA 4KH7A 5G1LA 4MJBA 4BPYA 2I4AA 3IK9A 4J56E 3RPPA 1A8YA 1ERWA 2IN3A 2B5XA 2QKEA 3P2AA 4GF0A 1SKSB 4MF5A 5B8AA 4PUAA 3DD3A 3FZ9A 2AUVA 3KZQA 1GSFA 4XS1A 4EIQA 1FVKA 3CTGA 2DBCA 4K0GA 1N8JA 2A4HA 1VF3A 3GKNA 2E0QA 1LU4A 5ECKB 3DEXA 1S3DA 2RM5A 4DVCA 3TKPA 2WDUA 3TRXA 2LTKA 3N9JA 2OE0A 4BVYB 3HCZA 4I8BA 1YQ1A 1DE2A 3UAPA 2FLSA 3LW9A 1Q98A 1G7OA 5GSSA 6GSXA 4L0WA 2K6VA 1T3BA 4TOPA 2ON7A 3VI7A 2WULA 2XPEA 3A2WA 6GSTA 3SWLA 4CY8A 2DMMA 3VPTA 2FGXA 2FD3A 4ECJA 3IA1A 2DJ1A 1SK0A 3WT1A 1U3IA 2C3NA 1ERTA 3GV1A 1SK2A 9GSSA 3ME7A 5DALA 1EEJA 3ZREA 2I3YA 4MZBA 2F3MA 4JEDA 2M46A 3A3TA 4WF5A 2IY2A 1ZL9A 2HSMA 4O32A 3ZIJA 4F9ZA 5DJLA 2GS3A 1O85A 2PERA 4OFMA 5C00A 2KP2A 2LV3A 2NVLA 2K8VA 1PD21 4ZBDA 1SD8A 1Z7PA 2F9SA 1A2MA 2L4QA 4I2TA 5G1KA 2E2GA 2FA8A 3Q19A 1FHEA 4OO4A 4TR1B 3C71A 2GZZA 3L0HA 1M9AA 2YJ7A 2VAFA 1U3AA 3FKFA 2H73A 5FT3A 4X1UA 2CX3A 3F3RA 2G0FA 4X43A 1O7UA 1X9SB 2MMNA 1DUGA 8GSSA 4ISDA 3E3EA 3WYWA 2QSIA 1TU7A 1V58A 4IQ1A 1UA5A 2H1AA 3VWVA 1NHYA 4IBPA 3BBYA 3V1WA 5ID2B 3CYNA 18GSA 3AY8A 1O6JA 3KJYA 2GQMA 2X49A 2R2JA 4NHWA 4DSQA 3C1SA 4F82A 2OA7A 1TK8B 4PQHA 5HQPA 2LJAA 2C0GA 4NAXA 4G19A 1USBA 2CZ3A 1SYRA 5F0GA 1ZYEA 1GLQA 3GYKA 2PPTA 2YNXA 2YOIA 3IAS2 4LLRA 2FHEA 2A2PA 5IMVA 5ABRA 2V32A 3LEFA 1B9YC 2ZCTA 3UOMA 5F06A 5DAKA 3QCPA 3F4TA 3DVWA 4O5RA 3FYGA 4ZBBA 4X0XA 4YAVA 3GKMA 2YANA 3KH7A 14GSA 2DMLA 3UJ1A 4DSRA 4O5QA 4GWRA 5HR1A 5CREA 1PKWA 3MYDA 1T00A 3KD0A 1X9WB 2G2QA 1BEDA 3KM6A 5IIZA 1BX9A 3IC8A 2UZ8A 3EU4A 5F07A 3C7MA 1ILOA 3U5RE 1K0DA 2B7JA 1GUHA 4POKA 2VD0A 4XRAA 3ERWA 3VWUA 3UARA 1WOUA 4NMUA 1HNBA 3TJFA 1XWBA 3CBUA 1FAAA 2H74A 10GSA 1S3AA 2A2RA 5DQYA 6GSSA 2PN8A 4IP6A 1AAZA 4MK3A 1SU9A 4DSSB 2H0GA 4IELA 2HI7A 1CQHA 19GSA 2YWOA 4EC0A 2PU9C 4PNFA 2CAQA 5ENUA 5BMUA 2VD1A 3GRXA 3GURA 1GL8A 3GN3A 4EXJA 5H5SA 3EE2A 3L9VA 1K0CA 2YP6A 4PQ1A 3F4SA 5KN3A 2C4JA 3VI5A 3M0FA 5CRGA 5IMAA 4MP4A 5D73A 2R3XA 3QR6A 3TB2A 2GTUA 2HSHA 4K1FA 4BVYA 2H75A 3GA4A 2XHFA 1AQVA 2HSYA 5IMZA 4ZL7A 1XVWA 2D2ZA 3W6GA 2J9HA 4EVMA 3HHVA 4GCIA 1QXHA 1EGRA 1F9MA 3ERGA 4IS0A 5KN1A 1AIUA 2GGTA 2DC5A 1FB0A 4G9HA 3W8JA 1G6WA 2KOKA 2CQ9A 2H76A 2DJJA 4OCFA 5ECRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AW9 A;  4G2E A;  1JZD A;  5CP1 A;  2LEG A;  2WRT A;  4KAE A;  2V41 A;  5HFK A;  5ELA A;  3KMN A;  4PXO A;  1T7P B;  13GS A;  1ZYQ B;  4MMM A;  1XCC A;  4N10 A;  3ZYW A;  1TDI A;  2F51 A;  4CDO A;  2CVK A;  2O8V B;  2FNO A;  4V1A p;  1A0F A;  3UVT A;  2IMF A;  3D4M A;  1HNA A;  1J9B A;  2X99 A;  2OBI A;  2ZUP A;  2HZE A;  1AXD A;  2NBS A;  1XVQ A;  1GWC A;  1CQG A;  4KSM A;  2B3S A;  3N5O A;  4RQX A;  1R4W A;  3IK7 A;  3WGE A;  2R5G A;  3DXB A;  4MJE A;  1EEM A;  2REM A;  2HNL A;  2R6K A;  4IGJ A;  1Y25 A;  3FR9 A;  3TGZ A;  20GS A;  2O85 A;  1XWA A;  4TW5 A;  3E0U A;  2GZY A;  5LD0 A;  4TXV A;  4XS6 A;  5AGY A;  1XXU A;  1OC9 A;  3EMX A;  5C04 A;  2WGR A;  3IV4 A;  4ULX A;  2VCW A;  3CMI A;  3ME8 A;  1DE1 A;  5GAN D;  1THX A;  4JR6 A;  1FB6 A;  3DGQ A;  3MNG A;  1OC8 A;  1OC3 A;  4XS4 B;  1F3B A;  4ZBA A;  1V98 A;  1SL0 B;  2L6C A;  1GUL A;  3D4T A;  3HZ8 A;  2IFQ B;  2PMT A;  2LNS A;  1OKT A;  4YQU A;  2VOC A;  3IRA A;  1K0B A;  1VF2 A;  1TI1 A;  2MZC A;  4MH2 A;  2IPA A;  1RW1 A;  2JSZ A;  2QC7 A;  2OBK A;  1B4Q A;  3L4N A;  2BMX A;  4NXI A;  5B6M A;  4FYB A;  3TOT A;  1URM A;  3M3M A;  1GRX A;  3HDC A;  4BL7 A;  1WMJ A;  4GRF A;  1PN9 A;  4WBJ A;  4HOJ A;  4ZL9 A;  1EV9 A;  4L5O A;  3VFI A;  2H71 A;  2XC2 A;  5IPH A;  3I9V 2;  4GST A;  4I2U A;  5COH A;  2H1B A;  2NDO A;  1I9D A;  4RQR A;  2CZ2 A;  2DIZ A;  3CXG A;  5DCG A;  3QD9 A;  3DWV A;  2A4V A;  4IVF A;  4KCE A;  1AUC A;  4WBR D;  1MD3 A;  3BOA A;  1SL1 B;  1OVN A;  1WIK A;  5A5K A;  2GSQ A;  1F2E A;  1TU8 A;  4K7I A;  4LMW A;  1MDI A;  2B1L A;  1Z3E A;  3LSZ A;  16GS A;  1GTB A;  1UN2 A;  1PA3 A;  5F8B A;  1ST9 A;  1GSU A;  3ZVJ D;  1SK1 A;  3HZ4 A;  4OO5 A;  4V2N A;  4GXZ A;  1PX7 A;  2LRN A;  1NSW A;  3TJG A;  1W4V A;  4HJM A;  2L4C A;  3HVS A;  6GSW A;  2ON5 A;  3ED3 A;  5E4W A;  1RK4 A;  3US3 A;  4GSS A;  4EDZ A;  2X8G A;  4MLY A;  1GLP A;  3PR8 A;  4OMV A;  2C0F A;  1XFL A;  2LRT A;  4K9Z A;  4TXO B;  4TXO A;  2JU5 A;  4N0Z A;  3PH9 A;  3UVH A;  5JWO B;  3LOR A;  4V1A g;  3KTB A;  3L78 A;  5LCZ A;  1ERV A;  2O89 A;  4KND A;  2FWH A;  5D9V A;  4YH2 A;  5ECS A;  3EU3 A;  1Z6N A;  3IR4 A;  2FWE A;  2KP1 A;  4J2F A;  1J0F A;  1TRW A;  3GUS A;  1XOB A;  1A2J A;  1E6B A;  3GHA A;  4IKH A;  4EDY A;  3HKR A;  4ILF A;  4GQC A;  4NV2 A;  1ZGN A;  4ECB A;  1IYH A;  1GNW A;  1R7H A;  5DBQ A;  4IHU A;  1NM3 A;  2WS2 A;  5HFI A;  3KEB A;  4KW6 A;  2WB9 A;  3LYP A;  2N5A A;  3MDK A;  5CRH A;  1XIY A;  4N11 A;  3M9J A;  4WEY A;  1NHO A;  4D73 B;  4FIW A;  5D8I A;  2YPM A;  1Z5Y E;  2RM6 A;  3FK8 A;  1M7T A;  1N2A A;  5IMC A;  4GQF A;  3VPQ A;  3D22 A;  4BVX A;  1O81 A;  1U88 A;  3F63 A;  1GSE A;  2PGT A;  4EKZ A;  4BWS A;  3G9B A;  5J9C A;  3GMF A;  1BJX A;  3H1N A;  4ZB6 A;  4V2M A;  1G7E A;  1GSY A;  2VLT A;  5ECH B;  3PGT A;  4IN0 A;  4HZ4 A;  2YV9 A;  3ZFB A;  1JZO A;  4KCA A;  2PWJ A;  5DVB A;  4ML1 A;  2JAC A;  3TRP A;  3DRN A;  5ID2 A;  3FZ5 A;  4L0U A;  4L5L A;  1FVJ A;  1PMT A;  4FYU A;  3GTU A;  3GTU B;  3ZTL A;  2H6Y A;  4JZQ A;  2H66 A;  2B5E A;  4WF4 A;  2YWI A;  4Q5R A;  1GNE A;  4Z7X A;  4HJ2 A;  1A8L A;  6GSV A;  4ML6 A;  1K3O A;  1B9X C;  2HYX A;  2IL3 A;  2YV7 A;  3ZIV A;  1ABA A;  1TRS A;  1EP8 A;  1XWG A;  2AV4 A;  5IO2 A;  3S9F A;  1XPV A;  4XIH A;  3A5W A;  4ECI A;  3VWW A;  5IOW A;  3LYK A;  4E8H A;  3BCI A;  1Z6M A;  3WD6 A;  4AJ6 A;  3F3Q A;  4BA7 A;  3IPZ A;  1H75 A;  1PGT A;  4PGT A;  4YQM A;  1PQN A;  1PKZ A;  4AJ7 A;  5IMD A;  3UIW A;  3BJ5 A;  3MWH A;  2LKU A;  1M99 A;  5IO0 A;  5ECQ B;  1FG4 A;  3LQ7 A;  4XTS A;  4LL1 B;  4MDC A;  4QL9 A;  2OE3 A;  4N0V A;  4MPF A;  3TKQ A;  1XW6 A;  3TJB A;  5ECN B;  4GLT A;  2VCT A;  2M72 A;  3APS A;  5ECI B;  3A2V A;  4OD7 A;  1X5E A;  5J3R A;  1YF1 A;  2C3T A;  1TTZ A;  3UMA A;  2YZH A;  2CVD A;  2IMD A;  3RHC A;  1XZO A;  2KLX A;  1XWC A;  3QFA C;  5EVO A;  2B1K A;  1OE8 A;  4MZW A;  3I6A A;  5J4U A;  4K0N A;  4DEJ A;  1JLV A;  2RUF A;  3L9U A;  5LNK e;  2OE1 A;  2I81 A;  2LJR A;  5G5F A;  1KEB A;  2ES7 A;  3TCO A;  1TXX A;  3ISO A;  4MAB A;  4KDY A;  1K0A A;  5H5R A;  3QOU A;  1YEP A;  2LQO A;  4OWY A;  3J7Y k;  4ZL8 A;  4TKY A;  1A2L A;  4PX1 A;  5EY6 A;  4NV5 A;  2A2S A;  2RLI A;  3J7Y b;  2DIY A;  3QMX A;  2VUP A;  3LFL A;  1T4Y A;  2EIQ A;  2H6Z A;  5D9T A;  2L59 A;  3A2X A;  2FUG 2;  3TUE A;  1GP1 A;  1TOF A;  1TI3 A;  2LS5 A;  5D93 A;  2YN1 A;  2MYG A;  5EL8 A;  2VCX A;  2L6D A;  3NIV A;  4MZC A;  2L5L A;  2GVP A;  1B8X A;  1QUW A;  1A0R P;  4ZXG A;  4PNG A;  5CYY A;  2AHE A;  3GL5 A;  2JL4 A;  2IWT A;  3DVX A;  3M8N A;  3F4R A;  2PVQ A;  3JCM L;  1XBS A;  3VWX A;  4YAP A;  2GZP A;  1GSS A;  5EPF A;  5F05 A;  1W89 A;  5ECL B;  4NPB A;  4AJ8 A;  2Z9S A;  1OAZ A;  1V57 A;  1SKW B;  4OCE A;  1SEN A;  5J5N A;  5IOX A;  1ZCP A;  3IDV A;  4TN8 A;  3HA9 A;  4HUA A;  2VCV A;  3FR3 A;  4EF0 A;  5DQS A;  1Q4J A;  1M2A A;  3ZLP A;  2CA8 A;  4KX4 A;  4XHM A;  3FRC A;  1O8W A;  1WRY A;  2F8A A;  4JR4 A;  1B4P A;  2E7P A;  2JZS A;  1R26 A;  4QQ7 A;  5KN2 A;  1PL2 A;  5IPG A;  1WE0 A;  3TRQ A;  5L71 A;  2K18 A;  4JBB A;  1DBY A;  1OKD A;  4I97 A;  4I5Q A;  1ZOF A;  1GTU A;  1K3L A;  1JHB A;  3D6I A;  2OAD A;  4TVE A;  1AQW A;  4ID0 A;  4MF7 A;  2JZT A;  5D96 A;  3QPM A;  4F03 A;  5A4U A;  4BWQ A;  2L57 A;  2GLR A;  1SL2 B;  4KGI A;  3GST A;  3SBC A;  4RI7 A;  2EIR A;  5H5Q A;  1U6T A;  1NW2 A;  5G5E A;  1SYX A;  1VF1 A;  1F37 A;  5D9W A;  2M80 A;  5J41 A;  2X64 A;  3EYT A;  2HRN A;  2H8L A;  5J9B A;  2H70 A;  1XW9 A;  1IYI A;  2E2M A;  5G2Z A;  2MMA A;  5G30 A;  3I43 A;  2CX4 A;  4ZIL A;  2N5F A;  3ZVJ A;  1XW5 A;  3QAW A;  3QDN A;  2VIM A;  3KH9 A;  1MDK A;  4KDU A;  3GH6 A;  1X0R A;  2VL9 A;  1EOH A;  4MPG A;  2VLV A;  3FEU A;  3ZIT A;  2XBQ A;  3G7Y A;  4AGS A;  1GSD A;  1TP9 A;  2MMZ A;  3U6V A;  3HVX A;  4L8E A;  1R5P A;  3WGX A;  4HQS A;  3H79 A;  3APQ A;  3FY7 A;  3LXZ A;  1H4O A;  3CRU A;  1OYJ A;  5HR0 A;  4MJC A;  2C3Q A;  3IXR A;  3ZRD A;  2X8H A;  2LNT A;  2YZU A;  2TRX A;  1SJ6 A;  2K9F A;  2IMI A;  3RDW A;  1DSB A;  1TRU A;  1G0T A;  2DLX A;  3F8U A;  1BG5 A;  4K7N A;  2BJX A;  3LG6 A;  3DYR A;  2P31 A;  1TW9 A;  3EUR A;  3KIJ A;  3GKK A;  3CSH A;  4HI7 A;  3W8S A;  3HXS A;  4ACS A;  3LWA A;  2V6K A;  2NTO A;  2YCD A;  2P0G A;  4Q5F A;  1V9W A;  3NZN A;  2OJL A;  5ECM B;  4KA0 A;  1V40 A;  3KXO A;  4WR5 A;  2AYT A;  1RQM A;  1QGV A;  3GFK A;  1TRV A;  3QAV A;  4WR4 A;  1U87 A;  1BQ7 A;  1HD2 A;  1WPI A;  5ECO B;  2IMK A;  3TKS E;  3VLN A;  1O73 A;  2H1G A;  4IP1 A;  1E2Y A;  1FOV A;  3HVV A;  2EIO A;  3DKS A;  4K6X A;  3LXT A;  3R2Q A;  1LBK A;  3I69 A;  1YKC A;  2IYJ A;  3FZA A;  5DDL A;  2H30 A;  2RUE A;  1FW1 A;  4EE0 A;  2LRC A;  5GZZ B;  2RII A;  2LST A;  4KDX A;  4KSO A;  2CAI A;  2PVO C;  3WGD A;  2FWF A;  1TKD B;  3EWL A;  1A24 A;  2FCH A;  2H01 A;  5ELG A;  5AIX A;  3KP8 A;  2O7K A;  2NPB A;  3C1R A;  5JWR B;  3EMP A;  7GSS A;  1F6M C;  5CAX A;  4HU7 A;  2FA4 A;  4H86 A;  17GS A;  5CRD A;  4FH8 A;  3CTF A;  3EVI A;  3O76 A;  4PQI A;  4NHZ A;  1T1V A;  2FWG A;  3M1G A;  2HZF A;  4F0B A;  2QGV A;  1JZR A;  5GAP D;  4PUR A;  2YJH A;  3GH9 A;  2WJU A;  2HFD A;  1SD9 A;  3FHK A;  5IQY A;  2DJK A;  3D21 A;  4K8M A;  3CRT A;  4ZIJ A;  1WJK A;  1UVZ A;  1YJ6 A;  1V2A A;  2C8U A;  4PUF C;  2F8F A;  3IBH A;  4N30 A;  2P5R A;  2HZE B;  2VL3 A;  1SKR B;  3TOU A;  3CSI A;  3Q6O A;  1BAY A;  3GIX A;  2VCQ A;  3FR6 A;  4Q5Q A;  3QAG A;  3C73 A;  1K0O A;  1GUM A;  1X5D A;  4LA1 A;  1YF0 A;  2HLS A;  1QK8 A;  4ECC A;  3QFB C;  5IMF A;  4IW9 A;  1AQX A;  5A4V A;  4TRX A;  1PSQ A;  1J08 A;  1JFU A;  5D9X A;  4JRR A;  1QFN A;  3H93 A;  2C80 A;  3RAZ A;  4OFT A;  3KTL A;  2FY6 A;  3GX8 A;  4WKW A;  4IQA A;  2N5B A;  1C72 A;  5CNW A;  4LL4 B;  2I9H A;  3L9S A;  2LJK A;  4MCU A;  2P5Q A;  3UBL A;  3UEM A;  2R37 A;  4FYC A;  5AN1 A;  1GH2 A;  2LQQ A;  2BTO T;  4K2D A;  1T4Z A;  2HXK A;  2AAW A;  4YQV A;  2I1U A;  5KEJ A;  5DAL B;  3TDG A;  4E8E A;  2PBJ A;  1MTC A;  2HRF A;  2MMO A;  3HYP A;  1XWK A;  3ZML A;  1M0U A;  3TJK A;  1KBN A;  1THO A;  3KCM A;  3PIN A;  2MBT A;  2GT5 A;  3F0I A;  3HJO A;  4LMV A;  2IIY A;  4GSN A;  5DJM A;  5GST A;  2H0H A;  5G31 A;  2DJ0 A;  3GX0 A;  5HR3 A;  3HJP A;  1ON4 A;  3C8E A;  3D5J A;  1GTA A;  5CO3 A;  3RHB A;  4MA9 A;  3GL3 A;  2B5Y A;  2DJ2 A;  4HDE A;  4KB3 A;  1AC1 A;  4QL7 A;  3K8N A;  3ZZX A;  6GSU A;  3APO A;  4K7O A;  1EOG A;  3O3T A;  3F9U A;  1FO5 A;  2GDR A;  4JU5 A;  2ALB A;  1VRS D;  2X8C A;  1PX6 A;  6GSY A;  3P8W A;  2H1D A;  3EC3 A;  2V6O A;  1K3Y A;  2VL2 C;  4IJ3 A;  2GQL A;  3KMO A;  3P7X A;  4OFN A;  4V2L A;  3OR5 A;  1ML6 A;  1YZX A;  4HS1 A;  2DSA A;  4MJA A;  3MSZ A;  2V1M A;  4D73 A;  2WCI A;  3IHQ A;  2WFC A;  1PL1 A;  1M9B A;  1R5A A;  2CVB A;  4RI6 A;  2WZ9 A;  3FZ4 A;  4TR0 A;  1Z9H A;  2AJQ B;  2R4V A;  1ZMA A;  4Q5N A;  2O87 A;  1LJR A;  5ECP B;  3MAK A;  5B7C A;  1TK5 B;  4O7H A;  4MH3 A;  2IME A;  1HNC A;  1EV4 A;  4KE3 A;  1B48 A;  1JLW A;  3FW2 A;  3BD2 A;  3IE3 A;  2KUC A;  3ZFL A;  1X5C A;  5HFG A;  2VO4 A;  3TJJ A;  5B6N A;  4WXT A;  3DIE A;  2JAD A;  3LGC A;  3DML A;  3TKS C;  3O6T A;  1ACV A;  12GS A;  4POB A;  1KNG A;  4IJI A;  2YWM A;  3TKR A;  1QQ2 A;  1K0M A;  2IJY A;  4FO5 A;  5AIS A;  4CW9 A;  5INY A;  1S3C A;  1QMV A;  4NWY A;  2DJ3 A;  2HE3 A;  1M2B A;  4F0C A;  5FHI A;  1X9M B;  3KP9 A;  3EIN A;  2VM2 A;  5AIV A;  2TRC P;  4GTU A;  1ERU A;  3Q18 A;  2GQK A;  5JCU A;  2OKA A;  2MBS A;  4MF6 A;  3D0Z A;  2H72 A;  1EGO A;  5A4W A;  3Q74 A;  3IAM 2;  1YEX A;  1MEK A;  4TR4 A;  4I6X A;  2VCZ A;  2B7K A;  2EC4 A;  2CT6 A;  2J23 A;  4XCS A;  4RUV A;  1O8X A;  1SJZ A;  3HY2 A;  5FWG A;  3HD5 A;  1YDK A;  3LJR A;  4O92 A;  2XPD A;  2LUS A;  1G6Y A;  1K0N A;  1VF4 A;  4ZB9 A;  2VLU A;  3GNJ A;  4F2I A;  3WT2 A;  2GSR A;  3NOF A;  3F6D A;  5JCW A;  1Y6E A;  2TIR A;  1JZW A;  1Z7R A;  3ERF A;  3RBT A;  1HYU A;  4HZ2 A;  1SJI A;  2B6M A;  5CRW A;  1HQO A;  4EUY A;  4ZB8 A;  2VL2 A;  5B8B A;  4XRD A;  2GST A;  4AF2 A;  1YKA A;  1GSQ A;  4POM A;  4EO3 A;  1M2D A;  2H6X A;  3E9J B;  1EP7 A;  3VUR A;  4JE1 A;  1BYE A;  1EZK A;  3UBK A;  3BCK A;  4POL A;  2VM1 A;  3G7J A;  2IFQ A;  5DCH A;  3TKS A;  1GUK A;  4DSS A;  1OE7 A;  2PUK C;  1KTE A;  1WWJ A;  4XS4 A;  11GS A;  2C1Y A;  1I5G A;  2K8S A;  2CV4 A;  4J57 E;  1MD4 A;  3VK9 A;  3GSS A;  2YWN A;  1WP0 A;  1F3A A;  2HT9 A;  2XBI A;  4HQZ A;  2C0D A;  1OC9 B;  1VGL A;  5JCG A;  1UC7 A;  1XOA A;  1T8E B;  2H0I A;  3IC4 A;  3H4K A;  2GSS A;  4HU9 A;  5IM9 A;  5JWQ B;  4EL1 A;  3M9K A;  3GKX A;  3CSJ A;  4WET A;  2KHP A;  4HEA 2;  22GS A;  3IOS A;  1TJD A;  5E59 A;  4P3Y B;  3HJM A;  1TK0 B;  3P90 A;  1YY7 A;  1A23 A;  1GTI A;  1MDJ A;  3UL3 A;  2L5O A;  2V2G A;  3G7I A;  2ZNM A;  1EWX A;  5KN0 A;  2GT6 A;  4TR1 A;  2H19 A;  1ZZY A;  4G10 A;  3ZMK A;  5HR2 A;  3KGK A;  4TR3 A;  1PRX A;  2JZR A;  2AB6 A;  3H8Q A;  5DAK B;  3ZL5 A;  2JSY A;  4KUN A;  2OAC A;  4CHS A;  3F6F A;  2C0E A;  3RPN A;  4KH7 A;  5G1L A;  4MJB A;  4BPY A;  2I4A A;  3IK9 A;  4J56 E;  3RPP A;  1A8Y A;  1ERW A;  2IN3 A;  2B5X A;  2QKE A;  3P2A A;  4GF0 A;  1SKS B;  4MF5 A;  5B8A A;  4PUA A;  3DD3 A;  3FZ9 A;  2AUV A;  3KZQ A;  1GSF A;  4XS1 A;  1FVK A;  3CTG A;  2DBC A;  4K0G A;  1N8J A;  1VF3 A;  3GKN A;  2E0Q A;  1LU4 A;  5ECK B;  3DEX A;  1S3D A;  2RM5 A;  4DVC A;  3TKP A;  2WDU A;  3TRX A;  2LTK A;  3N9J A;  2OE0 A;  3HCZ A;  4I8B A;  1YQ1 A;  1DE2 A;  3UAP A;  2FLS A;  1Q98 A;  1G7O A;  5GSS A;  6GSX A;  4L0W A;  2K6V A;  1T3B A;  4TOP A;  2ON7 A;  3VI7 A;  2WUL A;  2XPE A;  3A2W A;  6GST A;  3SWL A;  2DMM A;  3VPT A;  2FGX A;  2FD3 A;  4ECJ A;  3IA1 A;  2DJ1 A;  1SK0 A;  3WT1 A;  1U3I A;  2C3N A;  1ERT A;  3GV1 A;  1SK2 A;  9GSS A;  3ME7 A;  5DAL A;  1EEJ A;  3ZRE A;  2I3Y A;  4MZB A;  2F3M A;  4JED A;  2M46 A;  3A3T A;  4WF5 A;  2IY2 A;  1ZL9 A;  4O32 A;  3ZIJ A;  4F9Z A;  5DJL A;  2GS3 A;  1O85 A;  2PER A;  4OFM A;  5C00 A;  2KP2 A;  2LV3 A;  2NVL A;  2K8V A;  1PD2 1;  4ZBD A;  1SD8 A;  1Z7P A;  2F9S A;  1A2M A;  2L4Q A;  4I2T A;  5G1K A;  2E2G A;  2FA8 A;  3Q19 A;  1FHE A;  4OO4 A;  4TR1 B;  3C71 A;  2GZZ A;  3L0H A;  1M9A A;  2YJ7 A;  2VAF A;  1U3A A;  3FKF A;  2H73 A;  5FT3 A;  4X1U A;  2CX3 A;  3F3R A;  2G0F A;  4X43 A;  1O7U A;  1X9S B;  2MMN A;  1DUG A;  8GSS A;  4ISD A;  3E3E A;  3WYW A;  2QSI A;  1TU7 A;  1V58 A;  4IQ1 A;  1UA5 A;  2H1A A;  3VWV A;  1NHY A;  4IBP A;  3BBY A;  3V1W A;  5ID2 B;  3CYN A;  18GS A;  3AY8 A;  1O6J A;  3KJY A;  2GQM A;  2R2J A;  4NHW A;  4DSQ A;  3C1S A;  4F82 A;  2OA7 A;  1TK8 B;  4PQH A;  5HQP A;  2LJA A;  2C0G A;  4NAX A;  4G19 A;  1USB A;  2CZ3 A;  1SYR A;  5F0G A;  1ZYE A;  1GLQ A;  3GYK A;  2PPT A;  2YNX A;  2YOI A;  3IAS 2;  4LLR A;  2FHE A;  5IMV A;  5ABR A;  2V32 A;  3LEF A;  1B9Y C;  2ZCT A;  3UOM A;  5F06 A;  5DAK A;  3QCP A;  3F4T A;  3DVW A;  4O5R A;  3FYG A;  4ZBB A;  4X0X A;  4YAV A;  3GKM A;  2YAN A;  3KH7 A;  14GS A;  2DML A;  3UJ1 A;  4DSR A;  4GWR A;  5HR1 A;  5CRE A;  1PKW A;  1T00 A;  3KD0 A;  1X9W B;  2G2Q A;  1BED A;  3KM6 A;  5IIZ A;  1BX9 A;  3EU4 A;  5F07 A;  3C7M A;  1ILO A;  3U5R E;  1K0D A;  2B7J A;  1GUH A;  4POK A;  2VD0 A;  4XRA A;  3ERW A;  3VWU A;  3UAR A;  1WOU A;  4NMU A;  1HNB A;  3TJF A;  1XWB A;  3CBU A;  1FAA A;  2H74 A;  10GS A;  1S3A A;  2A2R A;  5DQY A;  6GSS A;  2PN8 A;  4IP6 A;  1AAZ A;  4MK3 A;  1SU9 A;  4DSS B;  2H0G A;  4IEL A;  2HI7 A;  1CQH A;  19GS A;  2YWO A;  4EC0 A;  2PU9 C;  4PNF A;  2CAQ A;  5ENU A;  2VD1 A;  3GRX A;  3GUR A;  1GL8 A;  3GN3 A;  4EXJ A;  5H5S A;  3EE2 A;  3L9V A;  1K0C A;  2YP6 A;  4PQ1 A;  3F4S A;  5KN3 A;  2C4J A;  3VI5 A;  3M0F A;  5CRG A;  5IMA A;  4MP4 A;  5D73 A;  2R3X A;  3QR6 A;  3TB2 A;  2GTU A;  2HSH A;  4K1F A;  4BVY A;  2H75 A;  3GA4 A;  2XHF A;  1AQV A;  2HSY A;  5IMZ A;  4ZL7 A;  1XVW A;  2D2Z A;  3W6G A;  2J9H A;  4EVM A;  3HHV A;  4GCI A;  1QXH A;  1EGR A;  1F9M A;  3ERG A;  4IS0 A;  5KN1 A;  1AIU A;  2GGT A;  2DC5 A;  1FB0 A;  4G9H A;  3W8J A;  1G6W A;  2KOK A;  2CQ9 A;  2H76 A;  2DJJ A;  4OCF A;  5ECR B; 
#chains in the Genus database with same CATH topology
 1AW9 A;  5D83 A;  4G2E A;  1JZD A;  4HKV B;  5CP1 A;  2LEG A;  3MPH A;  4XBY A;  2XEP A;  2WRT A;  4KAE A;  2V41 A;  5HFK A;  3X42 A;  5ELA A;  3KMN A;  1HYF A;  1QJG A;  4PXO A;  1T7P B;  13GS A;  1ZYQ B;  4MMM A;  1XCC A;  4N10 A;  2W6J H;  3ZYW A;  1TDI A;  2F51 A;  4CDO A;  2CVK A;  1K9M 4;  2O8V B;  2FNO A;  4V1A p;  1A0F A;  3UVT A;  2IMF A;  3D4M A;  1HNA A;  4IIA A;  1IVU A;  1J9B A;  2X99 A;  2OBI A;  4A5P A;  1NJI 4;  2ZUP A;  4IPB A;  1WQL B;  2W2C A;  1AXD A;  2HZE A;  2NBS A;  5BIR A;  1XVQ A;  1BRG A;  2W56 A;  1GWC A;  3CU3 A;  1CQG A;  4KSM A;  2B3S A;  3RGA A;  3N5O A;  5AI1 A;  4RQX A;  1R4W A;  3IK7 A;  3WGE A;  2R5G A;  3CCL 3;  3DXB A;  1SIH A;  4MJE A;  1JBR A;  1EEM A;  3LXU X;  1VQ6 3;  2REM A;  2Z76 A;  1MWS A;  2HNL A;  3Q3F A;  3FG4 A;  2R6K A;  1RN1 A;  1GY5 A;  4IGJ A;  1TRP A;  3KCH A;  1Y25 A;  3FR9 A;  3TGZ A;  20GS A;  2O85 A;  1XWA A;  4TW5 A;  3E0U A;  1BU4 A;  2QA2 A;  2GZY A;  4CY6 A;  5LD0 A;  4TXV A;  4XS6 A;  5AGY A;  3MYT A;  1XXU A;  1OC9 A;  1Q42 A;  3EMX A;  5C04 A;  2WGR A;  3IV4 A;  4ULX A;  2VCW A;  3CMI A;  4HM3 B;  3ME8 A;  1DE1 A;  5GAN D;  1THX A;  5FGO A;  4JR6 A;  1FB6 A;  3DGQ A;  1RGH A;  3MNG A;  2MF7 A;  1OC8 A;  1FUT A;  5ELJ A;  1OC3 A;  2WO0 A;  4XS4 B;  1F3B A;  3PCR A;  1V98 A;  4ZBA A;  1SL0 B;  2L6C A;  1GUL A;  3D4T A;  3HZ8 A;  2IFQ B;  2CFD A;  3PXM A;  1FUW A;  1B2M A;  2OOV A;  4N6N B;  2PMT A;  1NWW A;  1J2B A;  2LNS A;  1EUI C;  1TTO A;  1OKT A;  4YQU A;  2VOC A;  3IRA A;  4YKG A;  2O3O A;  1K0B A;  3DXO A;  1YNV X;  1VF2 A;  1TI1 A;  2MZC A;  3OW2 2;  4MH2 A;  2IPA A;  1IU7 A;  1RW1 A;  3CPO A;  4EW5 A;  2JSZ A;  2QC7 A;  3URP A;  1CQS A;  2OBK A;  1UUV B;  1B4Q A;  3L4N A;  2BMX A;  4NXI A;  5B6M A;  4FYB A;  3TOT A;  3KSP A;  3NBJ A;  1URM A;  3M3M A;  1GRX A;  3HDC A;  1YJ9 3;  3PS8 A;  1VZZ A;  4BL7 A;  1OAC A;  2IMJ A;  1WMJ A;  4GRF A;  1PN9 A;  2L4V A;  4WBJ A;  1DMQ A;  4HOJ A;  4EXR A;  4ZL9 A;  1EV9 A;  4L5O A;  3VFI A;  2H71 A;  2XC2 A;  5IPH A;  3BND A;  2C11 A;  3I9V 2;  4GST A;  4MNN A;  4I2U A;  5COH A;  2H1B A;  2NDO A;  1I9D A;  3I55 3;  4RQR A;  2CZ2 A;  2DIZ A;  4K2X A;  3CXG A;  3DM8 A;  1STF I;  3QD9 A;  5DCG A;  3DWV A;  2A4V A;  4IVF A;  1GOY A;  4KCE A;  1RCK A;  2WOH A;  3B7C A;  1AUC A;  4WBR D;  1MD3 A;  3BOA A;  1X1X A;  1NDO B;  1W7C A;  1SL1 B;  3ZFZ A;  1OVN A;  2F86 B;  1WIK A;  2DKH A;  5A5K A;  2BMO B;  1UGI A;  2GSQ A;  4AKY A;  1F2E A;  1I2E A;  1BSE A;  3BB9 A;  4TX4 A;  1M90 4;  2CIU A;  3LTA A;  1TU8 A;  4K7I A;  4LMW A;  1MDI A;  2B1L A;  3WOD G;  1Z3E A;  3LSZ A;  5KOW A;  3G71 3;  16GS A;  3FMW A;  1GTB A;  2BIR A;  1UN2 A;  1PA3 A;  5F8B A;  1ST9 A;  1GSU A;  3ZVJ D;  1SK1 A;  3HZ4 A;  4OO5 A;  4V2N A;  2YX9 A;  4GXZ A;  1PX7 A;  2LRN A;  1NSW A;  3TJG A;  1BGS A;  1W4V A;  4HJM A;  2L4C A;  4HOH A;  1D6Y A;  3WDG B;  2W9P A;  3HVS A;  6GSW A;  4HM2 B;  2ON5 A;  3ED3 A;  5E4W A;  1RK4 A;  3US3 A;  4GSS A;  1R4C A;  4N3V A;  2AAE A;  6GSP A;  4EDZ A;  2X8G A;  4FMA A;  4MLY A;  1GLP A;  3PR8 A;  4OMV A;  2C0F A;  1XFL A;  1DYU A;  2LRT A;  4K9Z A;  4TXO B;  4TXO A;  2JU5 A;  4N0Z A;  1RN4 A;  3PH9 A;  3UVH A;  5JWO B;  3FH1 A;  4L8P A;  3X41 A;  3KZT A;  5BVB A;  3LOR A;  4WHA A;  1RHL A;  4V1A g;  1AVL A;  3KTB A;  3L78 A;  5LCZ A;  1FGQ A;  1ERV A;  2O89 A;  4KND A;  3GSP A;  3DMC A;  1ZYN A;  1IYY A;  2FWH A;  2R0P A;  5D9V A;  3T0U A;  3NQY A;  4LGQ A;  4YH2 A;  2OOV C;  3WR2 A;  5ECS A;  3EU3 A;  1Z6N A;  3IR4 A;  2FWE A;  3WA3 A;  2KP1 A;  1YIT 3;  1DMM A;  2OQE A;  1VQN 3;  1CYV A;  1W00 A;  4J2F A;  1J0F A;  3PGB A;  1TRW A;  3GUS A;  1XOB A;  3HIG A;  1A2J A;  1VQ4 3;  1E6B A;  3GHA A;  4IKH A;  1KWI A;  1A2V A;  4EDY A;  3HKR A;  4ILF A;  4GQC A;  1O7G B;  1X1W A;  1MGW A;  4X2O A;  4NV2 A;  1ZGN A;  4ECB A;  1B2S A;  1IYH A;  1GNW A;  4BIR A;  3J7Y d;  3NV0 A;  1R7H A;  4IHU A;  5DBQ A;  2X4A A;  1NM3 A;  2WS2 A;  5HFI A;  3KEB A;  4KW6 A;  2WB9 A;  3S28 A;  1T5Y A;  3LYP A;  2N5A A;  3WMD A;  3MDK A;  5CRH A;  2P0X A;  1XIY A;  1RTU A;  1I3I A;  4N11 A;  1GD4 A;  2XR8 B;  3M9J A;  1RLS A;  4WEY A;  1NHO A;  4D73 B;  4FIW A;  5D8I A;  3EJV A;  2YPM A;  3AGN A;  4CCV A;  1Z5Y E;  2RM6 A;  1W4N A;  1PU4 A;  1YIJ 3;  3FK8 A;  1M7T A;  3MG2 A;  1N2A A;  3MIX A;  5IMC A;  4GQF A;  3VPQ A;  3LTD A;  3ZG5 A;  2GBX B;  3D22 A;  4BVX A;  4KT3 B;  4Z2R A;  1PY3 A;  3S67 A;  1O81 A;  1N9E A;  1U88 A;  3F63 A;  1GSE A;  4R1K A;  1JB2 A;  4GB5 A;  2PGT A;  2R0G A;  1UDI I;  4EKZ A;  4BWS A;  2W0Q A;  3G9B A;  1RKY A;  3SOY A;  5J9C A;  2FGT A;  3GMF A;  1BJX A;  1B21 A;  1RN7 A;  4MEI A;  3H1N A;  4ZB6 A;  4V2M A;  1G7E A;  1GSY A;  4KFE A;  1JNQ A;  2VLT A;  5KOX A;  5ECH B;  3PGT A;  3G4S 3;  3N9H A;  1NU3 A;  4IN0 A;  4HZ4 A;  2YV9 A;  3ZFB A;  3FGY A;  1JZO A;  4KCA A;  2PWJ A;  5DVB A;  4ML1 A;  3QK9 A;  1DVD A;  2JAC A;  3TRP A;  3DRN A;  2LYX A;  5ID2 A;  3FZ5 A;  4L0U A;  2BU4 A;  2IA7 A;  4L5L A;  1FVJ A;  1PMT A;  4FYU A;  3GTU A;  3GTU B;  3ZTL A;  2H6Y A;  1ZS7 A;  4JZQ A;  2H66 A;  1S72 3;  1TIJ A;  2C10 A;  2B5E A;  1NB3 I;  4WF4 A;  2YWI A;  4Q5R A;  1GNE A;  4Z7X A;  4HJ2 A;  1A8L A;  1N5P A;  3LZA A;  3Q1C A;  6GSV A;  4ML6 A;  4BTX A;  1ZO2 A;  1K3O A;  4AKZ A;  1I8V A;  1B9X C;  2HYX A;  2IL3 A;  2YV7 A;  4JF8 A;  1NB5 I;  3EF8 A;  3ZIV A;  1ABA A;  3EN8 A;  1TRS A;  1EP8 A;  1QVF 2;  1XWG A;  2AV4 A;  5IO2 A;  3S9F A;  1DVC A;  1XPV A;  2AAD A;  1AR0 A;  4XIH A;  1GMP A;  4BU4 A;  2JQ5 A;  3A5W A;  4ECI A;  1Q7H A;  3VWW A;  1ULI B;  3PYJ A;  5IOW A;  3LYK A;  4E8H A;  3BCI A;  1X1Y A;  1B27 A;  1Z6M A;  3WD6 A;  2E2T A;  4AJ6 A;  3F3Q A;  4BA7 A;  3IPZ A;  1H75 A;  1PGT A;  4PGT A;  4YQM A;  4HZB B;  2XRX B;  1PQN A;  1PKZ A;  3V98 A;  3OWS A;  4AJ7 A;  5IMD A;  3UIW A;  3BJ5 A;  3D5I A;  2LKU A;  3MWH A;  1M99 A;  1IK3 A;  3KE7 A;  5IO0 A;  5ECQ B;  5GSP A;  5M19 A;  1FG4 A;  3LQ7 A;  4XTS A;  4LL1 B;  4MDC A;  2GSP A;  4QL9 A;  2OE3 A;  4N0V A;  4MPF A;  3TKQ A;  1XW6 A;  1RSN A;  3TJB A;  3EHC A;  4HM1 B;  5ECN B;  3MKI A;  2KF6 A;  1K73 4;  4XB5 A;  2VCT A;  4GLT A;  2M72 A;  3APS A;  4BTY A;  5ECI B;  3LTC A;  2GBW B;  2F98 A;  3A2V A;  3G6E 3;  3K5T A;  4OD7 A;  1TUH A;  1MWR A;  3CMA 3;  1X5E A;  3CC4 3;  5J3R A;  3CCE 3;  1YF1 A;  2C3T A;  1RRH A;  1TTZ A;  1LQM B;  2XGL A;  3UMA A;  2YZH A;  4LYL B;  2CVD A;  2IMD A;  3RHC A;  3SXX A;  4BIK A;  1XZO A;  2KLX A;  1XWC A;  3D5G A;  2RCD A;  1B2Z A;  4R4K A;  1I2G A;  2F99 A;  3QFA C;  5EVO A;  2B1K A;  1OE8 A;  4MZW A;  3I6A A;  5J4U A;  3GZR A;  4K0N A;  4DEJ A;  1JLV A;  2RUF A;  3L9U A;  5LNK e;  2OE1 A;  2I81 A;  3EX9 A;  2W9Q A;  2LJR A;  1I70 A;  2R0C A;  5G5F A;  1KEB A;  2ES7 A;  1Q81 4;  5KN0 A;  3TCO A;  2STD A;  3NBR A;  1VQP 3;  1TXX A;  3ISO A;  4MAB A;  1R4Y A;  4KDY A;  1IQY A;  4RNY A;  5IG5 A;  1K0A A;  5H5R A;  3QOU A;  1Q9E A;  4KF9 A;  1SII A;  5IG3 A;  5IER A;  1YEP A;  1BNJ A;  2LQO A;  4OWY A;  3J7Y k;  4ZL8 A;  4TKY A;  1A2L A;  3JUQ A;  4PX1 A;  5EY6 A;  1GD3 A;  3CCJ 3;  3VGN A;  4NV5 A;  2HMJ B;  1D6Z A;  2A2S A;  2RLI A;  3J7Y b;  2DIY A;  2Z6B A;  3QMX A;  3BNC A;  2VUP A;  3LFL A;  3DGL A;  1T4Y A;  2EIQ A;  2H6Z A;  5D9T A;  2L59 A;  3NM7 A;  1BNS A;  4HSC X;  3A2X A;  2RGQ A;  1VQQ A;  2FUG 2;  3TUE A;  1GP1 A;  1TOF A;  1TI3 A;  4XM4 A;  2LS5 A;  5D93 A;  5M18 A;  2YN1 A;  2MYG A;  5EL8 A;  3BIR A;  4EYC A;  2VCX A;  5IG4 A;  1IQ8 A;  2L6D A;  3NIV A;  3FLJ A;  2L5L A;  4MZC A;  2GVP A;  1B8X A;  1QUW A;  1A0R P;  4ZXG A;  4PNG A;  5CYY A;  4KFF A;  3ECF A;  2AHE A;  2JL4 A;  2IWT A;  3GL5 A;  3DVX A;  2KAA A;  3M8N A;  3F4R A;  2CFG A;  3F7X A;  5IEN A;  2Y74 A;  8CHO A;  2PVQ A;  1RRL A;  3JCM L;  1XBS A;  3IJE B;  3VWX A;  3QRD A;  4YAP A;  2GZP A;  1GSS A;  1KSI A;  5EPF A;  5F05 A;  3F9S A;  3R3E A;  5FW5 A;  1O7M B;  5KP4 A;  1W89 A;  5ECL B;  4NPB A;  4AJ8 A;  1WMP A;  4HM7 B;  2HRK A;  4Z2U A;  1OF5 A;  1AVK A;  2Z9S A;  1WMO A;  1OAZ A;  2XF3 A;  1PFP A;  1V57 A;  1SKW B;  2HMM B;  1BNR A;  4N6M A;  3A5I A;  4OCE A;  3PZW A;  1SEN A;  1F8N A;  5J5N A;  1BRS A;  5IOX A;  3ER7 A;  1UI7 A;  1ZCP A;  3IDV A;  1U8C B;  1M3I A;  4TN8 A;  3HA9 A;  4ZM8 A;  4HUA A;  3M8C A;  6RNT A;  2VCV A;  3FR3 A;  4EF0 A;  5DQS A;  1S5A A;  1Q4J A;  1M2A A;  3ZLP A;  2CA8 A;  4KX4 A;  4XHM A;  5D82 A;  3FRC A;  3DY5 A;  4MMZ B;  3UNL A;  1O8W A;  1WRY A;  2F8A A;  1W6C A;  3SVA A;  4JR4 A;  1B4P A;  2UX0 A;  2E7P A;  1B3S A;  1N9J A;  2Q07 A;  4HM0 B;  4PTS A;  1JN5 B;  4HVN A;  2JZS A;  5I97 A;  1R26 A;  4QQ7 A;  5KN2 A;  1O7P B;  1PL2 A;  5IPG A;  3WOF B;  1WE0 A;  2CX0 A;  3TRQ A;  5L71 A;  2K18 A;  4WYK A;  4JBB A;  1DBY A;  2KRT A;  1OKD A;  4I97 A;  4I5Q A;  1DMN A;  1ZOF A;  1GTU A;  4HM4 B;  1K3L A;  1JHB A;  3D6I A;  2OAD A;  4TVE A;  1AQW A;  4ID0 A;  1DE3 A;  4MF7 A;  2JZT A;  5D96 A;  2ZA4 A;  5EVH A;  1W01 A;  3QPM A;  3EC9 A;  4F03 A;  3HOH A;  1SPU A;  5A4U A;  3DZL A;  4BWQ A;  2L57 A;  1RJO A;  1E3V A;  2GLR A;  1SL2 B;  4RNZ A;  4KGI A;  2R41 A;  3RDE A;  1B2X A;  3I56 3;  3GST A;  3SBC A;  3DH2 A;  4RI7 A;  2EIR A;  1U6T A;  5H5Q A;  1NW2 A;  1SYX A;  1W02 A;  5G5E A;  1VF1 A;  1F37 A;  3T8N A;  1JKG A;  5D9W A;  4KVH A;  3CXC 2;  4K61 A;  2M80 A;  5J41 A;  2X64 A;  3EYT A;  2HRN A;  2H8L A;  1QAL A;  5J9B A;  3H3H A;  2H70 A;  3K63 A;  1XW9 A;  2RNT A;  1IYI A;  2E2M A;  1QAK A;  2L1S A;  2F5W A;  5G2Z A;  2MMA A;  5G30 A;  3I43 A;  3IMA B;  3X3Z A;  2CG1 A;  2CX4 A;  4ZIL A;  2N5F A;  1LOX A;  3ZVJ A;  1G96 A;  1XW5 A;  5EQL A;  3QAW A;  3QDN A;  2VIM A;  3KH9 A;  1MDK A;  2PNC A;  4KDU A;  3JUP A;  3GH6 A;  1X0R A;  2VL9 A;  1EOH A;  3EBT A;  1G02 A;  2XH9 A;  4MPG A;  2P0M A;  2VLV A;  3DUK A;  3FEU A;  3S29 A;  3KSE D;  3ZIT A;  2XBQ A;  1BVI A;  3FSD A;  1B2U A;  4J8T A;  3G7Y A;  1EQK A;  5KP3 A;  3WA2 X;  1OGX A;  3T8U A;  4AGS A;  1GSD A;  4HZ9 B;  2R4I A;  1TP9 A;  2MMZ A;  3U6V A;  3HVX A;  4L8E A;  1R5P A;  1FGT A;  3WGX A;  4HQS A;  2KF5 A;  3H79 A;  3APQ A;  3FY7 A;  3LXZ A;  3DGM A;  1H4O A;  4XDW A;  2BNG A;  1OYJ A;  3CRU A;  5HR0 A;  1OGZ A;  4MJC A;  2C3Q A;  3IXR A;  3ZRD A;  3D9R A;  4EV2 A;  2X8H A;  5A0O B;  2LNT A;  2YZU A;  2TRX A;  1SJ6 A;  2BO9 B;  3CC2 3;  2K9F A;  5IF6 A;  3AGO A;  2W04 A;  1BAN A;  2IMI A;  4CDL A;  3RDW A;  1DSB A;  4N6U A;  1VQO 3;  1TRU A;  1BSB A;  1YGW A;  1EKM A;  1G0T A;  2DLX A;  3F8U A;  1BG5 A;  4K7N A;  2BJX A;  1ZX2 A;  5DRV A;  3LG6 A;  3DYR A;  5CF1 A;  1GSP A;  1TW9 A;  2P31 A;  2V1L A;  3EUR A;  3KIJ A;  3GKK A;  3CSH A;  4HI7 A;  1YJN 3;  2CFL A;  3W8S A;  4FCM A;  5AIF A;  3HXS A;  2KCD A;  5AYR B;  4ACS A;  3LWA A;  2V6K A;  1RGG A;  2NTO A;  2YCD A;  2P0G A;  4Q5F A;  1V9W A;  3NZN A;  1PN0 A;  3ZG0 A;  2OJL A;  3GRD A;  1GOU A;  5ECM B;  4KA0 A;  1V40 A;  1JBS A;  3KXO A;  4WR5 A;  2A15 A;  2AYT A;  1RQM A;  1QGV A;  3GFK A;  1TRV A;  3QAV A;  1OF5 B;  1A90 A;  4WR4 A;  1U87 A;  1GY6 A;  1BQ7 A;  4LEH A;  1HD2 A;  1WPI A;  5ECO B;  2IMK A;  3TKS E;  1O73 A;  3VLN A;  1YI2 3;  2H1G A;  2ZL8 A;  3A5E A;  4IP1 A;  1E2Y A;  7GSP A;  1FOV A;  3HVV A;  3D79 A;  2XFS A;  4JRF A;  2ZHX B;  2EIO A;  3DKS A;  3IHG A;  1RGF A;  3UL6 A;  3LXT A;  4K6X A;  5BRT A;  3R2Q A;  4MJD A;  4XBX A;  3EPT A;  1JRQ A;  1LBK A;  3I69 A;  1YKC A;  2IYJ A;  3FZA A;  5DDL A;  1JB5 A;  2H30 A;  2RUE A;  1FW1 A;  4EE0 A;  2LRC A;  5GZZ B;  1XG8 A;  3HII A;  2RII A;  1A2P A;  1RGL A;  2LST A;  3G8Z A;  4KDX A;  4KSO A;  2CAI A;  1X1U A;  2PVO C;  3WGD A;  2FWF A;  1TKD B;  2WGQ A;  3EWL A;  1A24 A;  3NX0 A;  1BOX A;  1Q82 4;  4J5K A;  2FCH A;  1VQ7 3;  2H01 A;  3VF1 A;  5ELG A;  5AIX A;  1TFO A;  3KP8 A;  2O7K A;  2NPB A;  3C1R A;  1OHP A;  1I0X A;  5JWR B;  3EMP A;  2M7O A;  3EN1 B;  3FZW A;  7GSS A;  1F6M C;  5CAX A;  4HU7 A;  2FA4 A;  4H86 A;  2GEX A;  17GS A;  3VSY A;  4FH8 A;  3CTF A;  3EVI A;  3O76 A;  5CRD A;  3KII A;  3F8X A;  1LOY A;  2ZDJ A;  3AHW A;  4PQI A;  1GS3 A;  2CHC A;  4NHZ A;  3X3X A;  2GU3 A;  1T1V A;  2FWG A;  3M1G A;  2HZF A;  1IV7 A;  4F0B A;  1UCL A;  2QGV A;  1K28 A;  1TU5 A;  1JZR A;  5GAP D;  2QA1 A;  4PUR A;  3JVC A;  2YJH A;  1YJW 3;  2Z77 A;  5ELU A;  3GH9 A;  2WJU A;  2HFD A;  3LML A;  1SD9 A;  2QA4 3;  3FHK A;  5IQY A;  2DJK A;  3D21 A;  3FF2 A;  4K8M A;  1T2H A;  4O5U A;  4FCZ A;  3CRT A;  4ZIJ A;  2HOH A;  1WJK A;  1UVZ A;  1YJ6 A;  1V2A A;  2C8U A;  9RNT A;  3RNT A;  2ML6 A;  1Y4K A;  4PUF C;  2SAR A;  2F8F A;  3FG1 A;  3IBH A;  4N30 A;  2P5R A;  1FYS A;  2HZE B;  2VL3 A;  3GWR A;  1SJW A;  1SKR B;  3MWZ A;  3TOU A;  4BVX B;  3CSI A;  3Q6O A;  4CJN A;  3LTB A;  1BAY A;  3GIX A;  5LC7 A;  2VCQ A;  3FR6 A;  4J5G A;  1YHQ 3;  4Q5Q A;  3QAG A;  3C73 A;  1K0O A;  1GUM A;  1X5D A;  3HVN A;  3OWY A;  4LA1 A;  1YF0 A;  2HLS A;  1QK8 A;  4ECC A;  3QFB C;  4YKF A;  3HX8 A;  5IMF A;  4IW9 A;  1AQX A;  5A4V A;  4TRX A;  2YFJ B;  1PSQ A;  1J08 A;  2BT3 A;  1JFU A;  1JKG B;  5D9X A;  5JBS A;  2D1W A;  4JRR A;  2HML B;  1QFN A;  3H93 A;  1Q40 B;  2C80 A;  4RNT A;  3RAZ A;  3D4A A;  4OFT A;  3KTL A;  2FY6 A;  3GX8 A;  4WKW A;  3NHX A;  4IQA A;  2N5B A;  1C72 A;  5CNW A;  1CEW I;  4G0K A;  4FCJ A;  4LL4 B;  4GL6 A;  3SX1 A;  2RSX A;  2I9H A;  1ULJ B;  3L9S A;  2LJK A;  2WOF A;  4G0L A;  1BSC A;  4MCU A;  5EEO A;  2P5Q A;  1A67 A;  3UBL A;  1M1K 4;  3UEM A;  4EIP A;  2R37 A;  2P05 A;  1GH2 A;  4O3V A;  2LQQ A;  2BTO T;  4FYC A;  5AN1 A;  3Q2P A;  2K0M A;  4K2D A;  2E2V A;  1T4Z A;  2HXK A;  1PYL A;  2AAW A;  4YQV A;  2B1X B;  2I1U A;  5KEJ A;  4R9K A;  1UI8 A;  1MWU A;  5DAL B;  3TDG A;  1M9G A;  2GEY A;  4E8E A;  2PBJ A;  1MTC A;  2HRF A;  2MMO A;  3HYP A;  3K7C A;  1XWK A;  3ZML A;  1M0U A;  3TJK A;  1KBN A;  1THO A;  3B4O A;  3KCM A;  3D3L A;  3PIN A;  2MBT A;  4RBN A;  3HI7 A;  5KP1 A;  5AII A;  2GT5 A;  1T2I A;  3F0I A;  3HJO A;  2D42 A;  4LMV A;  4HJL B;  3K0Z A;  1K41 A;  3B4P A;  2IIY A;  4GSN A;  5DJM A;  5GST A;  2H0H A;  3BLZ A;  1BSA A;  3GZX B;  5G31 A;  2DJ0 A;  4K1U A;  3GX0 A;  4NHF A;  5HR3 A;  3HJP A;  1ON4 A;  1RGK A;  3C8E A;  1FOH A;  3D5J A;  2LQV A;  2CFK A;  1GTA A;  5CO3 A;  3RHB A;  1N5H A;  4MA9 A;  1Q7Y 4;  4N6O B;  3GL3 A;  2B5Y A;  1N8Q A;  2DJ2 A;  4HDE A;  4KB3 A;  3EE1 A;  1AC1 A;  4QWT A;  1K8A 4;  4QL7 A;  3HK4 A;  1UUW B;  3K8N A;  3ZZX A;  6GSU A;  3OX9 A;  5BXQ A;  1M3J A;  1VQ9 3;  3APO A;  5RNT A;  4K7O A;  1EOG A;  2YFI B;  3O3T A;  3F9U A;  4X4J A;  1FO5 A;  1VQL 3;  3FCS B;  2GDR A;  4JU5 A;  1W6Y A;  2ALB A;  1LXE A;  1VRS D;  1YGE A;  2X8C A;  1PX6 A;  1VQM 3;  6GSY A;  5BU4 A;  3LYG A;  3P8W A;  3CCM 3;  5JPU A;  2H1D A;  3EC3 A;  2V6O A;  1FGO A;  1K3Y A;  2VL2 C;  2W03 A;  2BMQ B;  1AV4 A;  4IJ3 A;  5STD A;  2GQL A;  3KMO A;  3P7X A;  4OFN A;  4LSO A;  4V2L A;  3OR5 A;  1ML6 A;  1YZX A;  4HS1 A;  4XDV A;  2DSA A;  4MJA A;  3MSZ A;  2CKF B;  4H3U A;  2V1M A;  4D73 A;  2WCI A;  3IHQ A;  2WFC A;  1PL1 A;  1OHS A;  1M9B A;  1R5A A;  2CVB A;  4RI6 A;  2WZ9 A;  2CK3 H;  3F14 A;  3FZ4 A;  1FA3 A;  1E3R A;  4TR0 A;  3UB1 A;  1Z9H A;  2AJQ B;  2R4V A;  1ZMA A;  4Q5N A;  2O87 A;  1LJR A;  5ECP B;  3MAK A;  5B7C A;  4WFO A;  1TK5 B;  5AEW B;  4O7H A;  2F56 A;  1AY7 A;  4MH3 A;  2IME A;  1W5Z A;  1HNC A;  1ASK A;  1OHO A;  3U1W A;  1EV4 A;  4KE3 A;  1HU9 A;  3LOY A;  1B48 A;  1JLW A;  3FW2 A;  2HRA A;  3BD2 A;  3IE3 A;  3BU4 A;  2KUC A;  3ZFL A;  1X5C A;  1LNI A;  3NUV A;  5HFG A;  2VO4 A;  3TJJ A;  5B6N A;  4WXT A;  1HKX A;  3DIE A;  4ICY A;  2JAD A;  1PFO A;  3LGC A;  3FF0 A;  3DML A;  3TKS C;  3O6T A;  1ACV A;  12GS A;  2OTL 3;  4POB A;  2KF4 A;  1KNG A;  4IJI A;  4K5S A;  1KC8 4;  2YWM A;  3TKR A;  1QQ2 A;  3KN4 A;  1BRJ A;  1K0M A;  4K5R A;  1ZGX A;  1IT7 A;  2IJY A;  4FO5 A;  1US1 A;  5AIS A;  3LT8 A;  4CW9 A;  4L7K A;  5INY A;  2IUJ A;  1S3C A;  1QMV A;  4NWY A;  2DJ3 A;  5LC6 A;  1Q86 4;  2HE3 A;  8RNT A;  2W56 B;  4HBR A;  1WMN A;  2XFT A;  3KFQ C;  4L8O A;  7RNT A;  1M2B A;  4F0C A;  5FHI A;  1X9M B;  3G0K A;  1VQK 3;  3EIN A;  3UL5 A;  3KP9 A;  3PPU A;  2VM2 A;  3MHE A;  5AIV A;  2TRC P;  1FGM A;  4LMI A;  3STD A;  4BTW A;  4GTU A;  2WGO A;  4Z2T A;  1ERU A;  1UGH I;  3Q18 A;  2GQK A;  4OVM A;  5JCU A;  1TFK A;  2OKA A;  2MBS A;  5M1A A;  4MF6 A;  1GMQ A;  3D0Z A;  2H72 A;  1BAO A;  1EGO A;  5A4W A;  3Q74 A;  1LNH A;  3IAM 2;  4DKI A;  1YEX A;  1MEK A;  4TR4 A;  4I6X A;  2VCZ A;  2B7K A;  2HMN B;  2EC4 A;  2CT6 A;  2J23 A;  4BL3 A;  4XCS A;  4RUV A;  1O8X A;  1ZYP A;  1RGA A;  1SJZ A;  3HY2 A;  5FWG A;  3NBB A;  3HZP A;  7STD A;  3SED A;  2OTJ 3;  1YDK A;  3HD5 A;  3LJR A;  4O92 A;  2JDI H;  3OV4 A;  2XPD A;  2LUS A;  2CFW A;  1G6Y A;  1K0N A;  1VF4 A;  4ZB9 A;  5CLK A;  3GAX A;  2VLU A;  2O9U X;  3GNJ A;  5G2G A;  1JB4 A;  3WT2 A;  4F2I A;  1LOV A;  1Q40 A;  2GSR A;  3CCV 3;  3NOF A;  2SBL A;  3F6D A;  5JCW A;  1Y6E A;  1IVX A;  1QAF A;  2TIR A;  1JZW A;  1Z7R A;  2QIY A;  3ERF A;  3JUO A;  3MG3 A;  5DRE A;  1HYU A;  3RBT A;  1BRN L;  1SJI A;  4HZ2 A;  4BL7 B;  2B6M A;  5CRW A;  1BNF A;  1HQO A;  1OH0 A;  1V74 A;  5CF2 A;  4O02 B;  3A76 A;  1I0V A;  4ZB8 A;  5IW9 A;  4EUY A;  4FQU A;  2VL2 A;  5B8B A;  4XRD A;  2GST A;  4AF2 A;  3N54 B;  1SQW A;  1YKA A;  1GSQ A;  4POM A;  4EO3 A;  4I4K A;  1M2D A;  2H6X A;  3E9J B;  1EP7 A;  3VUR A;  4JE1 A;  1BYE A;  1EZK A;  1RMS A;  3X40 A;  3UBK A;  3BCK A;  3I0Y A;  4POL A;  1IQX A;  2VM1 A;  3G7J A;  3BNE A;  2KF3 A;  2IFQ A;  5DCH A;  3TKS A;  1GUK A;  4DSS A;  1OE7 A;  2PUK C;  1MNL A;  4EV5 A;  1KTE A;  1WWJ A;  4XS4 A;  11GS A;  2C1Y A;  1I5G A;  2K8S A;  2CV4 A;  4J57 E;  1MD4 A;  3K9M C;  3VK9 A;  4HAA A;  1BSD A;  3GSS A;  2YWN A;  1YVB I;  1WP0 A;  2HMO B;  1F3A A;  2B24 B;  1FGR A;  2HT9 A;  2XBI A;  4HQZ A;  4WWU C;  2C0D A;  2C4B A;  3FKA A;  3JUM A;  1AQZ A;  1OC9 B;  1VGL A;  2DKI A;  3AMO B;  5JCG A;  2CC3 A;  1UC7 A;  1XOA A;  1T8E B;  2H0I A;  3IC4 A;  3H4K A;  2GSS A;  4HU9 A;  5IM9 A;  3OXA A;  5JWQ B;  4EL1 A;  3M9K A;  1D6U A;  3MSO A;  3CSJ A;  3GKX A;  4WET A;  2KHP A;  4HEA 2;  22GS A;  1VQ8 3;  3IOS A;  1TJD A;  5E59 A;  1BIR A;  4P3Y B;  4U13 A;  3HJM A;  1TK0 B;  3P90 A;  1YY7 A;  3Q90 A;  1RGE A;  1A23 A;  1LQG C;  1EA2 A;  1OCV A;  2I9W A;  4Q53 A;  1GTI A;  1QMA A;  1MDJ A;  1L5G B;  3EBY A;  3B8L A;  3UL3 A;  2L5O A;  2V2G A;  2CG0 A;  3G7I A;  2ZNM A;  1ROA A;  1IV9 A;  2P09 A;  3EQQ B;  2HMK B;  2F5M A;  6STD A;  1EWX A;  1OUN A;  1WTH A;  3NV0 B;  2GT6 A;  4G0I A;  2H19 A;  1ZZY A;  4G10 A;  4TR1 A;  5HR2 A;  3KGK A;  3ZMK A;  4TR3 A;  5CXO A;  4USS A;  1PRX A;  4G1M B;  1JV2 B;  4K1V A;  4N6L A;  2JZR A;  2AB6 A;  3H8Q A;  5DAK B;  3ZL5 A;  1O7N B;  2Z7A A;  2UUG C;  2JSY A;  1C7H A;  3AHS A;  2OAC A;  4KUN A;  4CHS A;  3G16 A;  3F6F A;  2C0E A;  3RPN A;  4KH7 A;  3PCS A;  5G1L A;  1FW7 A;  4MJB A;  4BPY A;  2I4A A;  3IK9 A;  4J56 E;  2RFR A;  3RPP A;  1A8Y A;  1ERW A;  2IN3 A;  2B5X A;  2QKE A;  3P2A A;  4GF0 A;  1U5O A;  1SKS B;  3S27 A;  4MF5 A;  3NQZ A;  4NRE A;  5B8A A;  4STD A;  4PUA A;  2IUK A;  3SLU A;  1JBT A;  1MGR A;  3DD3 A;  3FZ9 A;  3CME 3;  2AUV A;  4FMD A;  1BUQ A;  3KZQ A;  5D81 A;  1GSF A;  4XS1 A;  4EIQ A;  1TRQ A;  1FVK A;  3MG1 A;  3CTG A;  2DBC A;  4K0G A;  1N8J A;  1JJ2 2;  2A4H A;  1WNH A;  5AIH A;  1C54 A;  1VF3 A;  3GKN A;  2E0Q A;  1LU4 A;  5ECK B;  3DEX A;  1S3D A;  2RM5 A;  4DVC A;  1UCJ A;  3TKP A;  2WDU A;  3TRX A;  5JPP A;  2LTK A;  3N9J A;  1RDS A;  2OE0 A;  2CW9 A;  4BVY B;  3HCZ A;  1Z1S A;  1YQ1 A;  4I8B A;  3UAP A;  1DE2 A;  1IVW A;  2FLS A;  2GU1 A;  3LW9 A;  1Q98 A;  4IT7 A;  4FMC A;  1G7O A;  5GSS A;  6GSX A;  4L0W A;  2K6V A;  1W6G A;  1T3B A;  4TOP A;  2ON7 A;  3VI7 A;  2WUL A;  2XPE A;  1DET A;  3A2W A;  6GST A;  3SWL A;  4FMB A;  4CY8 A;  1YVS A;  2DMM A;  4O8S A;  3CPW 2;  2Y73 A;  4LZI A;  3VPT A;  1EG9 B;  2FGX A;  2FD3 A;  4ECJ A;  3IA1 A;  2DJ1 A;  1SK0 A;  4HM8 B;  3WT1 A;  1U3I A;  3CCQ 3;  4ORL A;  2C3N A;  2E2U A;  4K90 B;  4RZM A;  2MC8 A;  5HOH A;  1ERT A;  4XBT A;  3GV1 A;  1SK2 A;  4H61 A;  9GSS A;  4CPK A;  3ME7 A;  2GXF A;  5DAL A;  2OWP A;  1EEJ A;  3ZRE A;  2I3Y A;  4MZB A;  2F3M A;  2K3D A;  4JED A;  2M46 A;  3A3T A;  4WF5 A;  1W2B 2;  2IY2 A;  1ZL9 A;  2BMR B;  1I3F A;  2HSM A;  4O32 A;  3CCR 3;  2OQE C;  1KQS 2;  3ZIJ A;  4F9Z A;  5DJL A;  2GS3 A;  1O85 A;  2PER A;  4OFM A;  1VQ5 3;  3GZY B;  5C00 A;  2KP2 A;  2LV3 A;  2NVL A;  1W2Z A;  1IDP A;  2K8V A;  1PD2 1;  4ZBD A;  1SD8 A;  1Z7P A;  2F9S A;  1A2M A;  2L4Q A;  3CCU 3;  1GYB A;  4I2T A;  5G1K A;  3S5C A;  1LRA A;  3DGY A;  3E99 A;  4O2H A;  2K54 A;  1BRI A;  2E2G A;  2FA8 A;  3Q19 A;  1MOL A;  1FHE A;  4OO4 A;  5AIG A;  3V92 A;  4TR1 B;  1UUG B;  1ISK A;  3C71 A;  3LT9 A;  2GZZ A;  3L0H A;  1M9A A;  2YJ7 A;  4J9A A;  4MMX B;  5IG0 A;  4KFD A;  2VAF A;  1U3A A;  1GOV A;  2J8X B;  4MMY B;  3FKF A;  2H73 A;  5FT3 A;  4X1U A;  3CQF A;  2CX3 A;  3F3R A;  2G0F A;  4X43 A;  1O7U A;  2P38 A;  1X9S B;  4HYZ A;  2MMN A;  1BUJ A;  5CK6 A;  1DUG A;  4EC6 A;  8GSS A;  4ISD A;  3E3E A;  3WYW A;  1BRK A;  1O7H B;  2QSI A;  1TU7 A;  1KD1 4;  1V58 A;  4IQ1 A;  1UA5 A;  2H1A A;  3VWV A;  1NHY A;  2QEX 3;  1BNE A;  4IBP A;  3BBY A;  3V1W A;  3LH4 A;  3CYN A;  5ID2 B;  18GS A;  3AY8 A;  1O6J A;  3KJY A;  1ROV A;  3AMO A;  2GQM A;  1S3R A;  2X49 A;  4PEJ A;  2QGU A;  2R2J A;  1I2F A;  4NHW A;  4HM6 B;  4DSQ A;  3C1S A;  4F82 A;  3DGO A;  4WYK B;  5AYS C;  1MWT A;  2OA7 A;  1TK8 B;  4PQH A;  1NO3 A;  5HQP A;  1A2K A;  2LJA A;  2KXG A;  2C0G A;  4NAX A;  4G19 A;  1E97 A;  1USB A;  2CZ3 A;  1IVV A;  1SYR A;  5F0G A;  3FG3 A;  3V99 A;  1JN5 A;  1ZYE A;  1N8R 4;  1GLQ A;  3GYK A;  3CNM A;  3H51 A;  4WP5 A;  1GMR A;  3SOA A;  2PPT A;  2YNX A;  4R9L A;  1GY7 A;  2YOI A;  3IAS 2;  5AEU B;  4LLR A;  2FHE A;  2A2P A;  2XSH B;  5IMV A;  5ABR A;  2V32 A;  1CYU A;  3F7S A;  3LEF A;  1B9Y C;  2ZCT A;  3EB8 A;  3UOM A;  1BNG A;  1RCL A;  4GSP A;  5F06 A;  4R80 A;  1IT8 A;  3O8Y A;  1HZ1 A;  5DAK A;  3QCP A;  1FUS A;  3F4T A;  3DVW A;  2F4Y A;  4O5R A;  3FYG A;  5IEO A;  4ZBB A;  4X0X A;  4YAV A;  3GKM A;  2YAN A;  1UW1 A;  3KH7 A;  1RGC A;  14GS A;  2DML A;  3CNX A;  3OWU A;  3UJ1 A;  3NM2 A;  4DSR A;  3RGR A;  4O5Q A;  4GWR A;  5HR1 A;  5CRE A;  1PKW A;  4X2H A;  1O7W B;  2CWU A;  3MYD A;  1T00 A;  1STD A;  3KD0 A;  4KZ1 A;  2G2Q A;  1BED A;  1X9W B;  3KM6 A;  5IIZ A;  1BX9 A;  3IC8 A;  3CD6 3;  2UZ8 A;  3EU4 A;  5F07 A;  3C7M A;  3F40 A;  1ILO A;  3U5R E;  1K0D A;  2B7J A;  3L0R A;  2CWV A;  3X3Y A;  1RNT A;  1GUH A;  4POK A;  3WOE B;  2VD0 A;  4XRA A;  3CC7 3;  3ERW A;  3VWU A;  1FZU A;  3UAR A;  2UGI A;  4GHO A;  4AEQ A;  1QVG 2;  2CH9 A;  1LOW A;  1WOU A;  4NMU A;  2RBI A;  1BRH A;  1HNB A;  3TJF A;  1XWB A;  3CBU A;  4EBG A;  1B20 A;  1FAA A;  4N6T A;  4FR9 A;  2H74 A;  3ALA A;  10GS A;  1S3A A;  2PZV A;  2A2R A;  5DQY A;  6GSS A;  3ROB A;  2PN8 A;  4IP6 A;  1AAZ A;  4MK3 A;  1SU9 A;  4DSS B;  4OK0 A;  2H0G A;  4IEL A;  1UCK A;  2HI7 A;  2XSO B;  1CQH A;  19GS A;  2YWO A;  4EC0 A;  2PU9 C;  1OPY A;  2OCT A;  3F8H A;  4PNF A;  2FNQ A;  2BHM A;  3N8B A;  2CAQ A;  1UCI A;  3DGN A;  3NXJ A;  1LVN A;  5ENU A;  5BMU A;  4HM5 B;  2VD1 A;  3GRX A;  4BL2 A;  3GUR A;  3SYU A;  1GL8 A;  5IEP A;  3JUN A;  3GN3 A;  4EXJ A;  5H5S A;  3EE2 A;  3L9V A;  3GZB A;  1K0C A;  2YP6 A;  4PQ1 A;  1M1X B;  3F4S A;  5KN3 A;  2C4J A;  3UJM A;  3VI5 A;  3M0F A;  5CRG A;  5IMA A;  4MP4 A;  1NNV A;  5D73 A;  5TGN A;  3CCS 3;  2R3X A;  3QR6 A;  3TB2 A;  2GTU A;  2HSH A;  4K1F A;  4BVY A;  2CWT A;  3IPT A;  2H75 A;  3GA4 A;  1CH0 A;  1BNI A;  2FXT A;  2XHF A;  3U97 A;  1AQV A;  2HSY A;  4N6V 0;  5IMZ A;  4OUQ A;  4ZL7 A;  1XVW A;  2D2Z A;  3W6G A;  2J9H A;  4EVM A;  3WHO A;  3BNB A;  3HHV A;  4GCI A;  1QXH A;  1EGR A;  1TP6 A;  1F9M A;  3ERG A;  4IS0 A;  5KN1 A;  1AIU A;  2GGT A;  1RNB A;  2ML5 A;  2DC5 A;  2XGN A;  1FB0 A;  5HGR A;  3KKG A;  4G9H A;  3W8J A;  1G6W A;  2KOK A;  1SAR A;  2CQ9 A;  2YFL B;  2INX A;  2H76 A;  2DJJ A;  4OCF A;  2CX1 A;  5ECR B; 
#chains in the Genus database with same CATH homology
 1AW9 A;  4G2E A;  1JZD A;  5CP1 A;  2LEG A;  2WRT A;  4KAE A;  2V41 A;  5HFK A;  5ELA A;  3KMN A;  4PXO A;  1T7P B;  13GS A;  1ZYQ B;  4MMM A;  1XCC A;  4N10 A;  3ZYW A;  1TDI A;  2F51 A;  4CDO A;  2CVK A;  2O8V B;  2FNO A;  4V1A p;  1A0F A;  3UVT A;  2IMF A;  3D4M A;  1HNA A;  1J9B A;  2X99 A;  2OBI A;  4A5P A;  2ZUP A;  2HZE A;  1AXD A;  2NBS A;  1XVQ A;  1GWC A;  1CQG A;  4KSM A;  2B3S A;  3N5O A;  4RQX A;  1R4W A;  3IK7 A;  3WGE A;  2R5G A;  3DXB A;  4MJE A;  1EEM A;  2REM A;  2HNL A;  2R6K A;  4IGJ A;  1Y25 A;  3FR9 A;  3TGZ A;  20GS A;  2O85 A;  1XWA A;  4TW5 A;  3E0U A;  2QA2 A;  2GZY A;  4CY6 A;  5LD0 A;  4TXV A;  4XS6 A;  5AGY A;  1XXU A;  1OC9 A;  3EMX A;  5C04 A;  2WGR A;  3IV4 A;  4ULX A;  2VCW A;  3CMI A;  3ME8 A;  1DE1 A;  5GAN D;  1THX A;  4JR6 A;  1FB6 A;  3DGQ A;  3MNG A;  1OC8 A;  1OC3 A;  4XS4 B;  1F3B A;  4ZBA A;  1V98 A;  1SL0 B;  2L6C A;  1GUL A;  3D4T A;  3HZ8 A;  2IFQ B;  2PMT A;  2LNS A;  1OKT A;  4YQU A;  2VOC A;  3IRA A;  4YKG A;  1K0B A;  1VF2 A;  1TI1 A;  2MZC A;  4MH2 A;  2IPA A;  1RW1 A;  2JSZ A;  2QC7 A;  2OBK A;  1B4Q A;  3L4N A;  2BMX A;  4NXI A;  5B6M A;  4FYB A;  3TOT A;  1URM A;  3M3M A;  1GRX A;  3HDC A;  4BL7 A;  1WMJ A;  4GRF A;  1PN9 A;  4WBJ A;  4HOJ A;  4ZL9 A;  1EV9 A;  4L5O A;  3VFI A;  2H71 A;  2XC2 A;  5IPH A;  3I9V 2;  4GST A;  4MNN A;  4I2U A;  5COH A;  2H1B A;  2NDO A;  1I9D A;  4RQR A;  2CZ2 A;  2DIZ A;  4K2X A;  3CXG A;  5DCG A;  3QD9 A;  3DWV A;  2A4V A;  4IVF A;  4KCE A;  1AUC A;  4WBR D;  1MD3 A;  3BOA A;  1SL1 B;  1OVN A;  1WIK A;  2DKH A;  5A5K A;  2GSQ A;  1F2E A;  1TU8 A;  4K7I A;  4LMW A;  1MDI A;  2B1L A;  1Z3E A;  3LSZ A;  5KOW A;  16GS A;  3FMW A;  1GTB A;  1UN2 A;  1PA3 A;  5F8B A;  1ST9 A;  1GSU A;  3ZVJ D;  1SK1 A;  3HZ4 A;  4OO5 A;  4V2N A;  4GXZ A;  1PX7 A;  2LRN A;  1NSW A;  3TJG A;  1W4V A;  4HJM A;  2L4C A;  3HVS A;  6GSW A;  2ON5 A;  3ED3 A;  5E4W A;  1RK4 A;  3US3 A;  4GSS A;  4EDZ A;  2X8G A;  4MLY A;  1GLP A;  3PR8 A;  4OMV A;  2C0F A;  1XFL A;  2LRT A;  4K9Z A;  4TXO B;  4TXO A;  2JU5 A;  4N0Z A;  3PH9 A;  3UVH A;  5JWO B;  3LOR A;  4V1A g;  3KTB A;  3L78 A;  5LCZ A;  1ERV A;  2O89 A;  4KND A;  2R0P A;  1ZYN A;  2FWH A;  5D9V A;  4YH2 A;  5ECS A;  3EU3 A;  1Z6N A;  3IR4 A;  2FWE A;  2KP1 A;  4J2F A;  1J0F A;  1TRW A;  3GUS A;  1XOB A;  1A2J A;  1E6B A;  3GHA A;  4IKH A;  4EDY A;  3HKR A;  4ILF A;  4GQC A;  4NV2 A;  1ZGN A;  4ECB A;  1IYH A;  1GNW A;  1R7H A;  5DBQ A;  4IHU A;  2X4A A;  1NM3 A;  2WS2 A;  5HFI A;  3KEB A;  4KW6 A;  2WB9 A;  3LYP A;  2N5A A;  3MDK A;  5CRH A;  1XIY A;  4N11 A;  3M9J A;  4WEY A;  1NHO A;  4D73 B;  4FIW A;  5D8I A;  2YPM A;  1Z5Y E;  2RM6 A;  3FK8 A;  1M7T A;  1N2A A;  3MIX A;  5IMC A;  4GQF A;  3VPQ A;  3D22 A;  4BVX A;  4Z2R A;  1O81 A;  1U88 A;  3F63 A;  1GSE A;  2PGT A;  2R0G A;  4EKZ A;  4BWS A;  3G9B A;  5J9C A;  3GMF A;  1BJX A;  3H1N A;  4ZB6 A;  4V2M A;  1G7E A;  1GSY A;  2VLT A;  5KOX A;  5ECH B;  3PGT A;  4IN0 A;  4HZ4 A;  2YV9 A;  3ZFB A;  1JZO A;  4KCA A;  2PWJ A;  5DVB A;  4ML1 A;  2JAC A;  3TRP A;  3DRN A;  5ID2 A;  3FZ5 A;  4L0U A;  4L5L A;  1FVJ A;  1PMT A;  4FYU A;  3GTU A;  3GTU B;  3ZTL A;  2H6Y A;  4JZQ A;  2H66 A;  2B5E A;  4WF4 A;  2YWI A;  4Q5R A;  1GNE A;  4Z7X A;  4HJ2 A;  1A8L A;  6GSV A;  4ML6 A;  1K3O A;  1B9X C;  2HYX A;  2IL3 A;  2YV7 A;  3ZIV A;  1ABA A;  1TRS A;  1EP8 A;  1XWG A;  2AV4 A;  5IO2 A;  3S9F A;  1XPV A;  4XIH A;  3A5W A;  4ECI A;  3VWW A;  5IOW A;  3LYK A;  4E8H A;  3BCI A;  1Z6M A;  3WD6 A;  4AJ6 A;  3F3Q A;  4BA7 A;  3IPZ A;  1H75 A;  1PGT A;  4PGT A;  4YQM A;  1PQN A;  1PKZ A;  4AJ7 A;  5IMD A;  3UIW A;  3BJ5 A;  3MWH A;  2LKU A;  1M99 A;  5IO0 A;  5ECQ B;  1FG4 A;  3LQ7 A;  4XTS A;  4LL1 B;  4MDC A;  4QL9 A;  2OE3 A;  4N0V A;  4MPF A;  3TKQ A;  1XW6 A;  3TJB A;  5ECN B;  4GLT A;  2VCT A;  2M72 A;  3APS A;  5ECI B;  3A2V A;  4OD7 A;  1X5E A;  5J3R A;  1YF1 A;  2C3T A;  1TTZ A;  3UMA A;  2YZH A;  2CVD A;  2IMD A;  3RHC A;  1XZO A;  2KLX A;  1XWC A;  3QFA C;  5EVO A;  2B1K A;  1OE8 A;  4MZW A;  3I6A A;  5J4U A;  4K0N A;  4DEJ A;  1JLV A;  2RUF A;  3L9U A;  5LNK e;  2OE1 A;  2I81 A;  2LJR A;  2R0C A;  5G5F A;  1KEB A;  2ES7 A;  3TCO A;  1TXX A;  3ISO A;  4MAB A;  4KDY A;  1K0A A;  5H5R A;  3QOU A;  4KF9 A;  1YEP A;  2LQO A;  4OWY A;  3J7Y k;  4ZL8 A;  4TKY A;  1A2L A;  4PX1 A;  5EY6 A;  4NV5 A;  2A2S A;  2RLI A;  3J7Y b;  2DIY A;  3QMX A;  2VUP A;  3LFL A;  1T4Y A;  2EIQ A;  2H6Z A;  5D9T A;  2L59 A;  3A2X A;  2FUG 2;  3TUE A;  1GP1 A;  1TOF A;  1TI3 A;  2LS5 A;  5D93 A;  2YN1 A;  2MYG A;  5EL8 A;  2VCX A;  2L6D A;  3NIV A;  4MZC A;  2L5L A;  2GVP A;  1B8X A;  1QUW A;  1A0R P;  4ZXG A;  4PNG A;  5CYY A;  2AHE A;  3GL5 A;  2JL4 A;  2IWT A;  3DVX A;  3M8N A;  3F4R A;  2PVQ A;  3JCM L;  1XBS A;  3VWX A;  4YAP A;  2GZP A;  1GSS A;  5EPF A;  5F05 A;  3R3E A;  1W89 A;  5ECL B;  4NPB A;  4AJ8 A;  2HRK A;  4Z2U A;  2Z9S A;  1OAZ A;  1V57 A;  1SKW B;  3A5I A;  4OCE A;  1SEN A;  5J5N A;  5IOX A;  1ZCP A;  3IDV A;  4TN8 A;  3HA9 A;  4HUA A;  2VCV A;  3FR3 A;  4EF0 A;  5DQS A;  1Q4J A;  1M2A A;  3ZLP A;  2CA8 A;  4KX4 A;  4XHM A;  3FRC A;  1O8W A;  1WRY A;  2F8A A;  4JR4 A;  1B4P A;  2E7P A;  4PTS A;  2JZS A;  1R26 A;  4QQ7 A;  5KN2 A;  1PL2 A;  5IPG A;  1WE0 A;  3TRQ A;  5L71 A;  2K18 A;  4JBB A;  1DBY A;  1OKD A;  4I97 A;  4I5Q A;  1ZOF A;  1GTU A;  1K3L A;  1JHB A;  3D6I A;  2OAD A;  4TVE A;  1AQW A;  4ID0 A;  4MF7 A;  2JZT A;  5D96 A;  3QPM A;  4F03 A;  5A4U A;  4BWQ A;  2L57 A;  2GLR A;  1SL2 B;  4KGI A;  3GST A;  3SBC A;  4RI7 A;  2EIR A;  5H5Q A;  1U6T A;  1NW2 A;  5G5E A;  1SYX A;  1VF1 A;  1F37 A;  5D9W A;  2M80 A;  5J41 A;  2X64 A;  3EYT A;  2HRN A;  2H8L A;  5J9B A;  2H70 A;  1XW9 A;  1IYI A;  2E2M A;  5G2Z A;  5G30 A;  2MMA A;  3I43 A;  2CX4 A;  4ZIL A;  2N5F A;  3ZVJ A;  1XW5 A;  3QAW A;  3QDN A;  2VIM A;  3KH9 A;  1MDK A;  4KDU A;  3GH6 A;  1X0R A;  2VL9 A;  1EOH A;  4MPG A;  2VLV A;  3FEU A;  3ZIT A;  2XBQ A;  3G7Y A;  4AGS A;  1GSD A;  1TP9 A;  2MMZ A;  3U6V A;  3HVX A;  4L8E A;  1R5P A;  3WGX A;  4HQS A;  3H79 A;  3APQ A;  3FY7 A;  3LXZ A;  1H4O A;  3CRU A;  1OYJ A;  5HR0 A;  4MJC A;  2C3Q A;  3IXR A;  3ZRD A;  2X8H A;  2LNT A;  2YZU A;  2TRX A;  1SJ6 A;  2K9F A;  2IMI A;  3RDW A;  1DSB A;  1TRU A;  1G0T A;  2DLX A;  3F8U A;  1BG5 A;  4K7N A;  2BJX A;  3LG6 A;  3DYR A;  2P31 A;  1TW9 A;  3EUR A;  3KIJ A;  3GKK A;  3CSH A;  4HI7 A;  3W8S A;  3HXS A;  4ACS A;  3LWA A;  2V6K A;  2NTO A;  2YCD A;  2P0G A;  4Q5F A;  1V9W A;  3NZN A;  1PN0 A;  2OJL A;  5ECM B;  4KA0 A;  1V40 A;  3KXO A;  4WR5 A;  2AYT A;  1RQM A;  1QGV A;  3GFK A;  1TRV A;  3QAV A;  4WR4 A;  1U87 A;  1BQ7 A;  1HD2 A;  1WPI A;  5ECO B;  2IMK A;  3TKS E;  1O73 A;  3VLN A;  2H1G A;  4IP1 A;  1E2Y A;  1FOV A;  3HVV A;  3IHG A;  2EIO A;  5BRT A;  3DKS A;  4K6X A;  3LXT A;  3R2Q A;  3EPT A;  1LBK A;  3I69 A;  1YKC A;  2IYJ A;  3FZA A;  5DDL A;  2H30 A;  2RUE A;  1FW1 A;  4EE0 A;  2LRC A;  5GZZ B;  2RII A;  2LST A;  4KDX A;  4KSO A;  2CAI A;  2PVO C;  3WGD A;  2FWF A;  1TKD B;  3EWL A;  1A24 A;  2FCH A;  2H01 A;  5ELG A;  5AIX A;  3KP8 A;  2O7K A;  2NPB A;  3C1R A;  5JWR B;  3EMP A;  7GSS A;  1F6M C;  5CAX A;  4HU7 A;  2FA4 A;  4H86 A;  17GS A;  5CRD A;  4FH8 A;  3CTF A;  3EVI A;  3O76 A;  4PQI A;  4NHZ A;  1T1V A;  2FWG A;  3M1G A;  2HZF A;  4F0B A;  2QGV A;  1JZR A;  5GAP D;  2QA1 A;  4PUR A;  2YJH A;  3GH9 A;  2WJU A;  2HFD A;  1SD9 A;  3FHK A;  5IQY A;  2DJK A;  3D21 A;  4K8M A;  4O5U A;  3CRT A;  4ZIJ A;  1WJK A;  1UVZ A;  1YJ6 A;  1V2A A;  2C8U A;  4PUF C;  2F8F A;  3IBH A;  4N30 A;  2P5R A;  2HZE B;  2VL3 A;  1SKR B;  3TOU A;  4BVX B;  3CSI A;  3Q6O A;  1BAY A;  3GIX A;  2VCQ A;  3FR6 A;  4Q5Q A;  3QAG A;  3C73 A;  1K0O A;  1GUM A;  1X5D A;  4LA1 A;  1YF0 A;  2HLS A;  1QK8 A;  4ECC A;  3QFB C;  4YKF A;  5IMF A;  4IW9 A;  1AQX A;  5A4V A;  4TRX A;  1PSQ A;  1J08 A;  1JFU A;  5D9X A;  4JRR A;  1QFN A;  3H93 A;  2C80 A;  3RAZ A;  4OFT A;  3KTL A;  2FY6 A;  3GX8 A;  4WKW A;  4IQA A;  2N5B A;  1C72 A;  5CNW A;  4G0K A;  4LL4 B;  2I9H A;  3L9S A;  2LJK A;  4G0L A;  4MCU A;  2P5Q A;  3UBL A;  3UEM A;  4EIP A;  2R37 A;  4FYC A;  5AN1 A;  1GH2 A;  2LQQ A;  2BTO T;  4K2D A;  1T4Z A;  2HXK A;  2AAW A;  4YQV A;  2I1U A;  5KEJ A;  5DAL B;  3TDG A;  4E8E A;  2PBJ A;  1MTC A;  2HRF A;  2MMO A;  3HYP A;  1XWK A;  3ZML A;  1M0U A;  3TJK A;  1KBN A;  1THO A;  3KCM A;  3PIN A;  2MBT A;  2GT5 A;  3F0I A;  3HJO A;  4LMV A;  2IIY A;  4GSN A;  5DJM A;  5GST A;  2H0H A;  5G31 A;  2DJ0 A;  3GX0 A;  5HR3 A;  3HJP A;  1ON4 A;  3C8E A;  1FOH A;  3D5J A;  1GTA A;  5CO3 A;  3RHB A;  4MA9 A;  3GL3 A;  2B5Y A;  2DJ2 A;  4HDE A;  4KB3 A;  1AC1 A;  4QL7 A;  3K8N A;  3ZZX A;  6GSU A;  3APO A;  4K7O A;  1EOG A;  3O3T A;  3F9U A;  4X4J A;  1FO5 A;  2GDR A;  4JU5 A;  2ALB A;  1VRS D;  2X8C A;  1PX6 A;  6GSY A;  3P8W A;  2H1D A;  3EC3 A;  2V6O A;  1K3Y A;  2VL2 C;  4IJ3 A;  2GQL A;  3KMO A;  3P7X A;  4OFN A;  4V2L A;  3OR5 A;  1ML6 A;  1YZX A;  4HS1 A;  2DSA A;  4MJA A;  3MSZ A;  2V1M A;  4D73 A;  2WCI A;  3IHQ A;  2WFC A;  1PL1 A;  1M9B A;  1R5A A;  2CVB A;  4RI6 A;  2WZ9 A;  3FZ4 A;  4TR0 A;  1Z9H A;  2AJQ B;  2R4V A;  1ZMA A;  4Q5N A;  2O87 A;  1LJR A;  5ECP B;  3MAK A;  5B7C A;  1TK5 B;  4O7H A;  4MH3 A;  2IME A;  1HNC A;  1EV4 A;  4KE3 A;  1B48 A;  1JLW A;  3FW2 A;  2HRA A;  3BD2 A;  3IE3 A;  2KUC A;  3ZFL A;  1X5C A;  5HFG A;  2VO4 A;  3TJJ A;  5B6N A;  4WXT A;  3DIE A;  4ICY A;  2JAD A;  3LGC A;  3DML A;  3TKS C;  3O6T A;  1ACV A;  12GS A;  4POB A;  1KNG A;  4IJI A;  4K5S A;  2YWM A;  3TKR A;  1QQ2 A;  1K0M A;  4K5R A;  2IJY A;  4FO5 A;  5AIS A;  4CW9 A;  5INY A;  1S3C A;  1QMV A;  4NWY A;  2DJ3 A;  2HE3 A;  1M2B A;  4F0C A;  5FHI A;  1X9M B;  3KP9 A;  3EIN A;  3PPU A;  2VM2 A;  5AIV A;  2TRC P;  4GTU A;  4Z2T A;  1ERU A;  3Q18 A;  2GQK A;  5JCU A;  2OKA A;  2MBS A;  4MF6 A;  3D0Z A;  2H72 A;  1EGO A;  5A4W A;  3Q74 A;  3IAM 2;  1YEX A;  1MEK A;  4TR4 A;  4I6X A;  2VCZ A;  2B7K A;  2EC4 A;  2CT6 A;  2J23 A;  4XCS A;  4RUV A;  1ZYP A;  1O8X A;  1SJZ A;  3HY2 A;  5FWG A;  3HD5 A;  1YDK A;  3LJR A;  4O92 A;  2XPD A;  2LUS A;  1G6Y A;  1K0N A;  1VF4 A;  4ZB9 A;  2VLU A;  3GNJ A;  4F2I A;  3WT2 A;  2GSR A;  3NOF A;  3F6D A;  5JCW A;  1Y6E A;  2TIR A;  1JZW A;  1Z7R A;  3ERF A;  3RBT A;  1HYU A;  4HZ2 A;  1SJI A;  4BL7 B;  2B6M A;  5CRW A;  1HQO A;  4EUY A;  4ZB8 A;  4FQU A;  2VL2 A;  5B8B A;  4XRD A;  2GST A;  4AF2 A;  1YKA A;  1GSQ A;  4POM A;  4EO3 A;  1M2D A;  2H6X A;  3E9J B;  1EP7 A;  3VUR A;  4JE1 A;  1BYE A;  1EZK A;  3UBK A;  3BCK A;  4POL A;  2VM1 A;  3G7J A;  2IFQ A;  5DCH A;  3TKS A;  1GUK A;  4DSS A;  1OE7 A;  2PUK C;  1KTE A;  1WWJ A;  4XS4 A;  11GS A;  2C1Y A;  1I5G A;  2K8S A;  2CV4 A;  4J57 E;  1MD4 A;  3VK9 A;  3GSS A;  2YWN A;  1WP0 A;  1F3A A;  2HT9 A;  2XBI A;  4HQZ A;  2C0D A;  1OC9 B;  1VGL A;  2DKI A;  5JCG A;  1UC7 A;  1XOA A;  1T8E B;  2H0I A;  3IC4 A;  3H4K A;  2GSS A;  4HU9 A;  5IM9 A;  5JWQ B;  4EL1 A;  3M9K A;  3GKX A;  3CSJ A;  4WET A;  2KHP A;  4HEA 2;  22GS A;  3IOS A;  1TJD A;  5E59 A;  4P3Y B;  3HJM A;  1TK0 B;  3P90 A;  1YY7 A;  1A23 A;  1GTI A;  1MDJ A;  3UL3 A;  2L5O A;  2V2G A;  3G7I A;  2ZNM A;  1EWX A;  4G0I A;  5KN0 A;  2GT6 A;  4TR1 A;  2H19 A;  1ZZY A;  4G10 A;  3ZMK A;  5HR2 A;  3KGK A;  4TR3 A;  4USS A;  1PRX A;  2JZR A;  2AB6 A;  3H8Q A;  5DAK B;  3ZL5 A;  2JSY A;  4KUN A;  2OAC A;  4CHS A;  3F6F A;  2C0E A;  3RPN A;  4KH7 A;  5G1L A;  4MJB A;  4BPY A;  2I4A A;  3IK9 A;  4J56 E;  3RPP A;  1A8Y A;  1ERW A;  2IN3 A;  2B5X A;  2QKE A;  3P2A A;  4GF0 A;  1SKS B;  4MF5 A;  5B8A A;  4PUA A;  3DD3 A;  3FZ9 A;  2AUV A;  3KZQ A;  1GSF A;  4XS1 A;  4EIQ A;  1FVK A;  3CTG A;  2DBC A;  4K0G A;  1N8J A;  2A4H A;  1VF3 A;  3GKN A;  2E0Q A;  1LU4 A;  5ECK B;  3DEX A;  1S3D A;  2RM5 A;  4DVC A;  3TKP A;  2WDU A;  3TRX A;  2LTK A;  3N9J A;  2OE0 A;  4BVY B;  3HCZ A;  4I8B A;  1YQ1 A;  1DE2 A;  3UAP A;  2FLS A;  3LW9 A;  1Q98 A;  1G7O A;  5GSS A;  6GSX A;  4L0W A;  2K6V A;  1T3B A;  4TOP A;  2ON7 A;  3VI7 A;  2WUL A;  2XPE A;  3A2W A;  6GST A;  3SWL A;  4CY8 A;  2DMM A;  3VPT A;  2FGX A;  2FD3 A;  4ECJ A;  3IA1 A;  2DJ1 A;  1SK0 A;  3WT1 A;  1U3I A;  2C3N A;  1ERT A;  3GV1 A;  1SK2 A;  9GSS A;  3ME7 A;  5DAL A;  1EEJ A;  3ZRE A;  2I3Y A;  4MZB A;  2F3M A;  4JED A;  2M46 A;  3A3T A;  4WF5 A;  2IY2 A;  1ZL9 A;  2HSM A;  4O32 A;  3ZIJ A;  4F9Z A;  5DJL A;  2GS3 A;  1O85 A;  2PER A;  4OFM A;  5C00 A;  2KP2 A;  2LV3 A;  2NVL A;  2K8V A;  1PD2 1;  4ZBD A;  1SD8 A;  1Z7P A;  2F9S A;  1A2M A;  2L4Q A;  4I2T A;  5G1K A;  2E2G A;  2FA8 A;  3Q19 A;  1FHE A;  4OO4 A;  4TR1 B;  3C71 A;  2GZZ A;  3L0H A;  1M9A A;  2YJ7 A;  2VAF A;  1U3A A;  3FKF A;  2H73 A;  5FT3 A;  4X1U A;  2CX3 A;  3F3R A;  2G0F A;  4X43 A;  1O7U A;  1X9S B;  2MMN A;  1DUG A;  8GSS A;  4ISD A;  3E3E A;  3WYW A;  2QSI A;  1TU7 A;  1V58 A;  4IQ1 A;  1UA5 A;  2H1A A;  3VWV A;  1NHY A;  4IBP A;  3BBY A;  3V1W A;  5ID2 B;  3CYN A;  18GS A;  3AY8 A;  1O6J A;  3KJY A;  2GQM A;  2X49 A;  2R2J A;  4NHW A;  4DSQ A;  3C1S A;  4F82 A;  2OA7 A;  1TK8 B;  4PQH A;  5HQP A;  2LJA A;  2C0G A;  4NAX A;  4G19 A;  1USB A;  2CZ3 A;  1SYR A;  5F0G A;  1ZYE A;  1GLQ A;  3GYK A;  2PPT A;  2YNX A;  2YOI A;  3IAS 2;  4LLR A;  2FHE A;  2A2P A;  5IMV A;  5ABR A;  2V32 A;  3LEF A;  1B9Y C;  2ZCT A;  3UOM A;  5F06 A;  5DAK A;  3QCP A;  3F4T A;  3DVW A;  4O5R A;  3FYG A;  4ZBB A;  4X0X A;  4YAV A;  3GKM A;  2YAN A;  3KH7 A;  14GS A;  2DML A;  3UJ1 A;  4DSR A;  4O5Q A;  4GWR A;  5HR1 A;  5CRE A;  1PKW A;  3MYD A;  1T00 A;  3KD0 A;  1X9W B;  2G2Q A;  1BED A;  3KM6 A;  5IIZ A;  1BX9 A;  3IC8 A;  2UZ8 A;  3EU4 A;  5F07 A;  3C7M A;  1ILO A;  3U5R E;  1K0D A;  2B7J A;  1GUH A;  4POK A;  2VD0 A;  4XRA A;  3ERW A;  3VWU A;  3UAR A;  1WOU A;  4NMU A;  1HNB A;  3TJF A;  1XWB A;  3CBU A;  1FAA A;  2H74 A;  10GS A;  1S3A A;  2A2R A;  5DQY A;  6GSS A;  2PN8 A;  4IP6 A;  1AAZ A;  4MK3 A;  1SU9 A;  4DSS B;  2H0G A;  4IEL A;  2HI7 A;  1CQH A;  19GS A;  2YWO A;  4EC0 A;  2PU9 C;  4PNF A;  2CAQ A;  5ENU A;  5BMU A;  2VD1 A;  3GRX A;  3GUR A;  1GL8 A;  3GN3 A;  4EXJ A;  5H5S A;  3EE2 A;  3L9V A;  1K0C A;  2YP6 A;  4PQ1 A;  3F4S A;  5KN3 A;  2C4J A;  3VI5 A;  3M0F A;  5CRG A;  5IMA A;  4MP4 A;  5D73 A;  2R3X A;  3QR6 A;  3TB2 A;  2GTU A;  2HSH A;  4K1F A;  4BVY A;  2H75 A;  3GA4 A;  2XHF A;  1AQV A;  2HSY A;  5IMZ A;  4ZL7 A;  1XVW A;  2D2Z A;  3W6G A;  2J9H A;  4EVM A;  3HHV A;  4GCI A;  1QXH A;  1EGR A;  1F9M A;  3ERG A;  4IS0 A;  5KN1 A;  1AIU A;  2GGT A;  2DC5 A;  1FB0 A;  4G9H A;  3W8J A;  1G6W A;  2KOK A;  2CQ9 A;  2H76 A;  2DJJ A;  4OCF A;  5ECR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...