5G1LA

A double mutant of dsbg engineered for denitrosylation
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
228
structure length
228
Chain Sequence
LPAPVKAIEKQGITIIKTFDAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNTLIEKEIYAPAGREMWQRMEQSHWLLDGKKDAPVIVYVFADPFCGPCKQFWQQARPWVDSGKVQLRTLLVGVIKPESPATAAAILASKDPAKTWQQYEASGGKLKLNVPANVSTEQMKVLSDNEKLMDDLGANVTPAIYYMSKENTLQQAVGLPDQKTLNIIMGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOL DISULFIDE INTERCHANGE PROTEIN DSBG
publication title Sulfur Denitrosylation by an Engineered Trx-Like Dsbg Enzyme Identifies Nucleophilic Cysteine Hydrogen Bonds as Key Functional Determinant.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 67
structure length 228
sequence length 228
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 5g1lA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5g1lA02
5J3RA 3HVVA 1KEBA 2XHFA 1K0AA 3D4MA 3MSZA 3TUEA 3HY2A 2PUKC 5D73A 2FGXA 1U87A 2L5LA 5G31A 1EGRA 1XOAA 2H76A 2LNTA 1XCCA 3WYWA 2VCQA 4XS4A 4DSRA 3ED3A 1ZYQB 1M9AA 4G10A 4TN8A 3KXOA 5F07A 2C0GA 4KA0A 1A2JA 1SK0A 2RLIA 2CA8A 2YV9A 1EWXA 2LKUA 1O85A 1EZKA 3TKQA 3ZZXA 1XW9A 2GZZA 2B3SA 2TRXA 3LSZA 3BCIA 1UVZA 2YNXA 5ECLB 1OC9B 2DIYA 4YQVA 1TOFA 6GSUA 1TK5B 4KX4A 3ERGA 1N8JA 2FLSA 3VWUA 2NDOA 2HXKA 2CAIA 2E2MA 1XWAA 4HJ2A 1XWCA 3IA1A 1TRWA 5H5SA 2H6XA 1XOBA 3F3RA 3S9FA 1QFNA 2B1LA 3D0ZA 2VD1A 19GSA 4HU9A 3L78A 4MF7A 1K0BA 2H72A 3LEFA 3GSSA 4EO3A 3D6IA 1RQMA 5G5EA 1WJKA 2VLUA 4E8EA 1LBKA 3VI5A 1M2DA 1XWBA 1Z6NA 1WRYA 1V2AA 3A2XA 3C7MA 3EURA 1F37A 4BPYA 2IIYA 1DUGA 4IQ1A 4ML1A 2H8LA 3UARA 3M0FA 1S3DA 3KTLA 4EE0A 2DLXA 3UVHA 1R5AA 2XPDA 3TGZA 3WGXA 1ML6A 3H8QA 4K8MA 1JZOA 1JHBA 1V40A 1X0RA 2L6CA 2DIZA 5J4UA 5DCGA 2DMMA 2NVLA 2HYXA 2O89A 5G30A 4I2TA 2GS3A 1XIYA 5AN1A 3Q18A 5EVOA 4NPBA 3KP8A 2H1GA 4JR4A 4PGTA 3QD9A 1OC3A 1M99A 3GTUB 4YAVA 1VF1A 1AAZA 3WD6A 2EIRA 2E7PA 1NHYA 2VOCA 2BJXA 1MTCA 4PNGA 4K1FA 6GSWA 3MDKA 2R37A 3KIJA 2HT9A 2RM5A 3TJFA 4MZCA 2YWMA 2PWJA 3DXBA 3QFAC 1GTBA 2AAWA 2WZ9A 4PURA 3CSHA 2N5BA 5DAKA 1A0RP 1SK1A 4F2IA 3GFKA 2H0GA 4G2EA 2GQLA 1X9SB 3LXTA 1SYRA 2M72A 1B48A 3GL5A 3ZL5A 3D22A 3CRTA 5ENUA 2YWNA 3APSA 1MEKA 2HZEB 3GYKA 5ECKB 1U88A 2YJ7A 2FY6A 1V57A 3KP9A 1PMTA 2IFQA 2MMAA 1OAZA 1YZXA 4MF6A 4PX1A 1BQ7A 2B1KA 2RUEA 5ECHB 2O87A 5DALA 4GLTA 2D2ZA 1MDJA 3GV1A 3ZVJD 1J08A 1HQOA 1SL0B 5FT3A 1EEJA 1GRXA 4KB3A 1FO5A 5HQPA 3HD5A 5G2ZA 4TR3A 2H71A 2VUPA 3GRXA 3CTFA 2VLVA 3IAM2 4XS4B 1YKAA 2WGRA 4L5LA 5FWGA 3MWHA 3LYPA 1TI3A 4K0GA 1ZL9A 3QAWA 16GSA 3L9VA 4XCSA 1H75A 4YAPA 5IO2A 4GXZA 3LORA 3RAZA 1EOHA 3EU3A 3MNGA 3RDWA 3PGTA 4WBJA 2A2RA 2YJHA 4V1Ap 5H5RA 1F6MC 4ECJA 1SYXA 2WJUA 4TR4A 2H0HA 2ES7A 3JCML 3A5WA 2ALBA 3GKXA 2YV7A 1V98A 4KSMA 3M9KA 4I8BA 3PR8A 2B7KA 3EMXA 2EIOA 5IMDA 2X8GA 2YPMA 1OC9A 1T1VA 1SKSB 1PGTA 3DEXA 4J56E 3NOFA 2H19A 3CRUA 1MD3A 4ECIA 5IIZA 1B4PA 4GSNA 1GSQA 3IXRA 4D73B 1AIUA 1UA5A 4EKZA 3KTBA 2DJ1A 4DSQA 3US3A 1E2YA 3F8UA 1A8YA 4TR1B 5H5QA 1C72A 3CXGA 2B5EA 4RQRA 3DIEA 4MDCA 1G6WA 2C4JA 3ZYWA 2MMOA 2V41A 2VL2A 2GT5A 5IO0A 2DJ3A 3SWLA 2JZRA 3NIVA 4EC0A 4I97A 2I4AA 2GVPA 1WOUA 5ECNB 5LD0A 1XWKA 1I5GA 3LWAA 2X99A 4LMVA 2VIMA 1ZYEA 4KUNA 2QC7A 4XRDA 3GH9A 1QK8A 2GQKA 3MAKA 2JZTA 3TRPA 1X9WB 2R4VA 1A24A 1XVWA 2J9HA 4GF0A 3VWXA 4EVMA 5DCHA 1O81A 2GQMA 2WCIA 2FA4A 5GAND 3QDNA 4EF0A 3RHBA 5KN3A 1UN2A 2KUCA 2MMZA 1OC8A 5A4VA 4WF5A 2OKAA 4MZBA 3BD2A 1GSDA 3L9UA 4DEJA 3EU4A 1VGLA 4JRRA 3APQA 1T4ZA 2YP6A 3F6FA 2ON7A 2CQ9A 1KNGA 2XBIA 5IMFA 1FG4A 3F4RA 2LTKA 3ZFBA 1TKDB 2J23A 4Z7XA 3J7Yb 3GTUA 1IYIA 1HYUA 4WKWA 3KMOA 4JE1A 2ZCTA 1PN9A 1EGOA 4WBRD 4IN0A 4PQIA 2IPAA 2K6VA 2XC2A 1YJ6A 2C0EA 5D9VA 4LL4B 3IR4A 1K3YA 2L59A 3VI7A 2XPEA 5EY6A 1K3OA 1TRVA 1PD21 2G0FA 5DALB 3GN3A 4JBBA 5EPFA 2KP2A 3M1GA 4EDYA 5LCZA 2K9FA 3HVXA 5J5NA 1J0FA 4NHWA 1X9MB 5CRDA 1M9BA 1GSEA 3GH6A 3QCPA 3C71A 3FY7A 2HE3A 3CSIA 2O85A 3C1RA 2HI7A 4IW9A 2CZ2A 3GKKA 3QOUA 4GSTA 2L4QA 4EDZA 2CX3A 4AGSA 1K0CA 2KP1A 2VAFA 4ZB8A 1AQWA 2KOKA 4OMVA 4ZB6A 4O92A 1YF1A 3TKSC 5AISA 5A4WA 5EL8A 3DWVA 3CSJA 4RI6A 4IP1A 4FIWA 3O3TA 4HZ2A 2VL3A 2VL9A 2NBSA 3FK8A 4HS1A 5E4WA 1USBA 3VLNA 1AW9A 4KDUA 5HFGA 1VF2A 3TKPA 3H4KA 4MH2A 3ZFLA 3CMIA 4K7NA 1DBYA 17GSA 5CNWA 3Q74A 2B7JA 4POLA 2GDRA 5AIXA 4TOPA 2B5YA 1WPIA 1TJDA 3UEMA 1F3AA 1NHOA 4Q5FA 5IMVA 3GSTA 4OCFA 2HSYA 5IPHA 1TU8A 3HXSA 1OYJA 3ZMKA 3R2QA 1U3AA 1BG5A 5J9BA 2H74A 1JZRA 3F4TA 2V2GA 1G7EA 3GX0A 2P5RA 2LQQA 2E2GA 3VFIA 3F4SA 3PINA 3KGKA 4K6XA 3UL3A 3P7XA 1W4VA 4AJ8A 3G7IA 1B4QA 4ZBDA 2LS5A 1ERTA 4E8HA 3DVWA 2C3TA 3KM6A 4MP4A 1FB0A 3F6DA 4O32A 4D73A 1YQ1A 2GZYA 4DSSB 2C80A 1QQ2A 3DGQA 4JU5A 2P31A 2FWFA 3EMPA 3LYKA 1O6JA 4TR1A 4ZILA 1YDKA 3UBLA 1ACVA 1WIKA 2H1DA 5HR3A 5JCGA 2LJAA 3FW2A 4ZBAA 5KN0A 3TKSE 3F63A 3GA4A 3HCZA 2L57A 1GSUA 2LRCA 2M46A 1PX6A 5HR0A 5G5FA 5B6NA 2L5OA 3GHAA 1JZWA 2PBJA 4V1Ag 4O5RA 1PKWA 4MMMA 2HZFA 3QAGA 4WR5A 12GSA 4L8EA 4N10A 5G1LA 1FVKA 2FWEA 4POBA 1SU9A 1J9BA 5ECIB 1X5CA 3J7Yk 3ME7A 1GTUA 4OFMA 3HHVA 4JR6A 4FYUA 4OFTA 1WE0A 2CT6A 1T7PB 3TOTA 2ZUPA 2H6YA 2LRNA 2C8UA 2LRTA 5A4UA 4V2LA 2RM6A 3E9JB 5IM9A 4XTSA 4N11A 3RHCA 2JACA 4EUYA 2LV3A 2YWOA 2DJ0A 5HFIA 6GSSA 5FHIA 1OVNA 2K8SA 5DJMA 3FR3A 2HRNA 2KLXA 2IJYA 4ML6A 2K18A 5E59A 4K0NA 4ILFA 1THXA 2YWIA 4KGIA 3TJGA 1URMA 3FZ4A 1GSYA 1GSFA 2YANA 4ZL8A 3FRCA 1EP7A 1A23A 3D21A 2YZHA 1M2BA 2R3XA 4RUVA 5CYYA 4KSOA 7GSSA 3GNJA 2MZCA 3QAVA 4BA7A 1GUMA 3A3TA 4DVCA 4F82A 2FHEA 2CVDA 3GL3A 2O7KA 5GSTA 1BX9A 1O73A 4ZIJA 4IP6A 4X1UA 2JZSA 3G7JA 4KDXA 1O7UA 1XVQA 5D8IA 4X0XA 4NXIA 2YN1A 2BMXA 3ZTLA 3P90A 1TU7A 2CAQA 4YH2A 4GQCA 5ECPB 3CTGA 1A8LA 5J9CA 3TRQA 4XHMA 1SJZA 4HDEA 2H30A 4K9ZA 2DMLA 3VURA 3QMXA 3I9V2 2C3NA 3TKRA 5ECOB 1XZOA 1KTEA 3IK9A 3I43A 3DKSA 3PH9A 4ID0A 4MH3A 4TXVA 3U5RE 4PUFC 3N5OA 1GTIA 2HSHA 1R26A 3NZNA 1FOVA 2N5AA 5GAPD 1GNWA 2OA7A 3M8NA 2AV4A 4TVEA 4MPFA 5HR1A 3M3MA 4XS6A 5D96A 1GLQA 3HYPA 4CHSA 3DYRA 2NPBA 1TI1A 1UC7A 3GUSA 3ZRDA 2AHEA 6GSYA 1OKTA 5JCUA 1A2MA 2LJKA 3SBCA 4WETA 2IYJA 1SL2B 3BCKA 6GSXA 4OO5A 2A4VA 1B9YC 2V6KA 2GSRA 2DSAA 2OBIA 5ABRA 4ACSA 4IQAA 1YEXA 4LA1A 4G19A 1ZZYA 3FZAA 1HNBA 2LUSA 1R5PA 2GT6A 1ERVA 5GSSA 3HJMA 1TRUA 3GX8A 5F06A 2V32A 2G2QA 2VCZA 3EINA 5DQYA 1Y6EA 1Z9HA 4IELA 2KHPA 4BVYA 1K3LA 2OACA 3KJYA 2VM2A 4ECBA 1KBNA 1JFUA 2C0DA 1V9WA 1SK2A 1QXHA 4OD7A 4DSSA 4KCAA 1K0NA 3E0UA 2X8HA 4HUAA 2GZPA 5G1KA 2V1MA 1DE1A 3RPNA 2LEGA 1YY7A 5CREA 4MA9A 2OE0A 2REMA 1BAYA 3DMLA 3VPTA 2HNLA 4CW9A 5JWOB 1MDKA 2H1AA 2PU9C 3O6TA 2CZ3A 1H4OA 2N5FA 3WGDA 4GWRA 4TW5A 4MPGA 4MLYA 3KEBA 4TKYA 1DSBA 2I3YA 2GGTA 3ERWA 2QSIA 2VCTA 4EL1A 1THOA 2P5QA 3ZIJA 3ZITA 1FB6A 3L4NA 4J57E 1EEMA 3FEUA 1WMJA 1U3IA 3ZMLA 2FA8A 3CYNA 2K8VA 1OKDA 3KZQA 4I6XA 1RK4A 2PVQA 3KCMA 2NTOA 2ZNMA 4HQSA 1FHEA 1GSSA 2VCVA 3DVXA 4G9HA 4AJ6A 5ELAA 1YF0A 4HEA2 3HZ4A 2C3QA 4IKHA 3UOMA 2IMIA 1HD2A 4HZ4A 1TK0B 2H70A 3LXZA 4PQ1A 1MD4A 1S3CA 2GSTA 1HNAA 5JWRB 3LFLA 1PX7A 2F8AA 4KAEA 3LG6A 3IRAA 1S3AA 4BL7A 4Q5RA 4I5QA 4POMA 2TRCP 1SJ6A 1PL1A 3EVIA 2JADA 3LQ7A 2PVOC 3F9UA 3ZIVA 4MABA 4H86A 1M2AA 2VCXA 8GSSA 1B9XC 3FZ9A 5JCWA 1O8XA 4NMUA 3A2VA 4OCEA 3EWLA 9GSSA 3W6GA 1QMVA 3FHKA 3D4TA 1XW5A 4TR0A 1WP0A 1N2AA 2X64A 1T4YA 3WT2A 3TOUA 2DJJA 3RBTA 3GKNA 2OADA 1PQNA 1TXXA 3G7YA 5DQSA 2C0FA 3ZVJA 4PUAA 4KNDA 5ID2A 4F0BA 4RQXA 1W89A 2H1BA 3D5JA 3IC4A 3K8NA 5ELGA 4NHZA 3VWWA 4FYBA 3IE3A 2H66A 2GSQA 1EV9A 4NV2A 4K2DA 4MJEA 2VO4A 3IHQA 6GSVA 4OFNA 2QKEA 4MF5A 2JU5A 5KN2A 3KH7A 4V2NA 1SD8A 1YKCA 2LJRA 3VWVA 1BYEA 3KD0A 2LQOA 3FR9A 5CRWA 2PERA 2FWHA 2H75A 4WR4A 2DBCA 1BEDA 2C1YA 4IGJA 3W8JA 2VD0A 4LLRA 4HOJA 3BJ5A 5DJLA 13GSA 4LL1B 2ON5A 4TRXA 5IQYA 2XBQA 2B5XA 3HZ8A 2AB6A 4GSSA 2CV4A 4YQMA 2H73A 4IJ3A 3TDGA 4ISDA 5IPGA 1G0TA 4WXTA 3IDVA 1SKWB 2M80A 3C73A 2PN8A 4YQUA 3OR5A 5B8BA 4QQ7A 4OWYA 1EP8A 3QR6A 4ULXA 2R2JA 2EC4A 4HI7A 4X43A 3F3QA 2JSZA 3FYGA 4POKA 3VPQA 2DC5A 1VF4A 2FNOA 1VF3A 2WDUA 3Q19A 2FUG2 4GCIA 3TKSA 1SJIA 3GKMA 1ZCPA 2L6DA 1FAAA 2PGTA 3C8EA 1Z6MA 4N0VA 3ISOA 1HNCA 5IOWA 2IY2A 5F05A 4IBPA 1TP9A 2LSTA 2VCWA 3H79A 3IOSA 5HR2A 2MBTA 1TK8B 1XBSA 5J41A 3IPZA 4MJAA 3TJKA 3GMFA 4MCUA 4K7IA 3LJRA 2H01A 1GP1A 5IOXA 1ON4A 1YEPA 1XFLA 4PXOA 4FO5A 1O8WA 3CBUA 1V58A 4MJCA 4LMWA 2WFCA 5D9XA 3TRXA 1CQGA 3V1WA 4BWQA 1Z5YE 2JSYA 3H1NA 2AUVA 3W8SA 1FW1A 2GLRA 1Q98A 4PNFA 1A2LA 3WT1A 4KW6A 4JZQA 3EE2A 2IMEA 1SD9A 2R5GA 1X5EA 2CX4A 3GURA 5ECQB 2H0IA 5JWQB 5AGYA 2DJKA 3APOA 2RUFA 3C1SA 1X5DA 4HJMA 3TB2A 1PA3A 4WF4A 3ERFA 1GNEA 1ZGNA 2EIQA 1TDIA 4Q5QA 4K7OA 2OE1A 1ABAA 4ZL7A 4NAXA 1DE2A 4PQHA 3A2WA 3TJBA 3BOAA 3H93A 3ZLPA 2WULA 2YCDA 1B8XA 1EOGA 22GSA 4F03A 3BBYA 4CDOA 4N0ZA 1R7HA 2VLTA 4F0CA 1AC1A 4MK3A 10GSA 1IYHA 3ME8A 4TXOB 1I9DA 2IMDA 4KCEA 4L0WA 1SL1B 4IJIA 5KN1A 3L9SA 4GQFA 5A5KA 4F9ZA 5LNKe 1F2EA 5ID2B 5CAXA 1GL8A 3O76A 4GRFA 4L0UA 2I81A 1GH2A 1R4WA 5CRHA 1F3BA 5ECRB 5IMZA 5INYA 2VL2C 5IMAA 3HDCA 3UJ1A 2F3MA 3P2AA 2QGVA 3FZ5A 5IMCA 4L5OA 4HQZA 1A0FA 1PL2A 3IK7A 1XPVA 3P8WA 2E0QA 2PPTA 2IN3A 3FKFA 2R6KA 1AQXA 1MDIA 4AF2A 1RW1A 2X8CA 1PKZA 4KDYA 1M0UA 3WGEA 1AXDA 2FCHA 2I1UA 5B8AA 3I6AA 1Y25A 2HFDA 2FWGA 1QGVA 1Q4JA 2CVKA 3UIWA 1SKRB 6GSTA 5DVBA 2BTOT 5D93A 2L4CA 5HFKA 3RPPA 1VRSD 3KH9A 4KH7A 4IHUA 1T00A 5D9TA 1TRSA 2IMKA 4O7HA 4JEDA 1NW2A 3FR6A 2P0GA 1PRXA 4OO4A 1WWJA 5ECMB 5C04A 2HRFA 2I9HA 2WS2A 1FVJA 2OJLA 2O8VB 3IBHA 3TCOA 2VM1A 2DJ2A 3E3EA 1XXUA 1EV4A 1GLPA 4IVFA 1U6TA 3N9JA 4EXJA 1GUKA 3EYTA 5F0GA 2F9SA 1T3BA 1ILOA 1ZMAA 1K0MA 2OE3A 3LGCA 1JLVA 3F0IA 1E6BA 4ZL9A 3UAPA 2Z9SA 1LJRA 1Z3EA 1AQVA 3M9JA 2OBKA 1GULA 11GSA 5B6MA 5KEJA 1QUWA 3HJOA 2FD3A 4HU7A 3IV4A 1CQHA 3UBKA 5D9WA 1NSWA 2A2SA 3TJJA 18GSA 4QL7A 1GTAA 1AUCA 1TW9A 4XIHA 1NM3A 4NV5A 3UVTA 5DDLA 2TIRA 3HJPA 3QPMA 4IS0A 3I69A 3G9BA 4QL9A 2AJQB 4P3YB 3UMAA 1XWGA 20GSA 4FH8A 2WB9A 14GSA 3HKRA 4GTUA 5CO3A 1K0DA 1G6YA 1ZOFA 3HA9A 1JZDA 5GZZB 1Z7PA 4Q5NA 2IMFA 2GTUA 2GSSA 5COHA 5C00A 3U6VA 1G7OA 1ERWA 1SENA 2V6OA 3KMNA 2MYGA 1M7TA 1BJXA 1K0OA 5CP1A 1GWCA 2JL4A 2CVBA 2MBSA 1ST9A 1ERUA 2IL3A 1OE7A 3Q6OA 1OE8A 1XW6A 4J2FA 2H6ZA 4MZWA 2IWTA 4WEYA 5DAKB 4BWSA 4FYCA 5ECSA 2LNSA 3AY8A 5L71A 3L0HA 5AIVA 2WRTA 3DD3A 3HVSA 2YZUA 2PMTA 5DBQA 4AJ7A 2HLSA 4BVXA 2B6MA 2RIIA 2IFQB 1LU4A 4V2MA 1PSQA 2YOIA 4ZXGA 1GUHA 2MMNA 5B7CA 4MJBA 3GIXA 4NWYA 3ZREA 4XRAA 1JLWA 4I2UA 1T8EB 5F8BA 3IAS2 1F9MA 3QFBC 4KE3A 3VK9A 2F51A 3DRNA 4XS1A 4RI7A 2AYTA 4N30A 4TXOA 2HZEA 1Z7RA 4ZBBA 4ZB9A 4ECCA 2F8FA 5CRGA 3EC3A 1TTZA
chains in the Genus database with same CATH superfamily
5J3RA 3HVVA 1KEBA 2XHFA 1MGWA 1K0AA 3D4MA 2CWUA 3MSZA 3TUEA 3HY2A 2PUKC 5D73A 2FGXA 1U87A 2L5LA 5G31A 2IMJA 1EGRA 1XOAA 2H76A 2Y74A 2LNTA 4IPBA 5JPUA 1XCCA 3WYWA 2VCQA 2ZHXB 4XS4A 4DSRA 2HMLB 3CCU3 3ED3A 1STDA 1TU5A 1ZYQB 1M9AA 4G10A 4TN8A 3KXOA 5F07A 2C0GA 4KA0A 4HM8B 1UGIA 5FGOA 1A2JA 1SK0A 3K63A 3JUNA 1YIT3 2RLIA 2B24B 1FA3A 2CA8A 2YV9A 2CFWA 2Z77A 1O7MB 1EWXA 2UZ8A 1D6YA 2LKUA 1O85A 1SIHA 1EZKA 3TKQA 3ZZXA 4HVNA 1XW9A 2GZZA 2B3SA 2TRXA 5BRTA 3LSZA 2W2CA 3BCIA 1MWTA 3OWSA 1UVZA 2YNXA 1CH0A 5ECLB 1OC9B 5EQLA 2DIYA 4YQVA 2UUGC 1Q824 1TOFA 6GSUA 1QALA 2OOVA 1TK5B 4KX4A 1Q814 3ERGA 1N8JA 2FLSA 3VWUA 1BSDA 3PPUA 2NDOA 2HXKA 3KCHA 2CAIA 2E2MA 1XWAA 4HJ2A 4R9KA 2GBWB 2R4IA 1JN5B 1XWCA 1BNSA 3IA1A 1TRWA 5H5SA 2H6XA 1XOBA 2W6JH 3F3RA 3S9FA 1QFNA 2B1LA 3D0ZA 2BNGA 4OUQA 2VD1A 2XF3A 8RNTA 19GSA 5CF1A 4HU9A 3L78A 4MF7A 1RGAA 1K0BA 2H72A 5BVBA 3LEFA 3BNBA 1RKYA 3GSSA 1VQQA 3EC9A 4OK0A 4EO3A 3D6IA 1LRAA 1RQMA 3MYDA 1BRKA 3STDA 5G5EA 1D6UA 1WJKA 3S29A 2VLUA 4E8EA 1EKMA 1LBKA 3VI5A 1M2DA 1XWBA 1Z6NA 2UGIA 1WRYA 1V2AA 3A2XA 3A76A 2K54A 3C7MA 3EURA 3HX8A 1F37A 4BPYA 2IIYA 1DUGA 3JVCA 2CG1A 4IQ1A 3BNCA 1E97A 3GRDA 1RGLA 2F56A 4ML1A 2H8LA 3UARA 3M0FA 1S3DA 3KTLA 4EE0A 2DLXA 3UNLA 3UVHA 3VSYA 1R5AA 2XPDA 3TGZA 3WGXA 1ML6A 3CXC2 3H8QA 4K8MA 1JZOA 1JHBA 1V40A 1X0RA 3FZWA 2L6CA 3B4OA 3PZWA 2DIZA 1YGWA 1RN4A 1VQM3 4Z2RA 5J4UA 2CKFB 5DCGA 1RCLA 2W0QA 4J8TA 4I4KA 2DMMA 2QA2A 3KN4A 2NVLA 4KZ1A 2HYXA 2KF4A 3PS8A 2O89A 1F8NA 5G30A 4I2TA 2GS3A 3DY5A 3OX9A 1XIYA 5AN1A 3Q18A 5EVOA 4H61A 4NPBA 3KP8A 1W5ZA 2H1GA 4JR4A 1X1XA 4PGTA 3QD9A 1OC3A 1M99A 3GTUB 1Q42A 1FGQA 2CX1A 4YAVA 1VF1A 1AAZA 3WD6A 2EIRA 2E7PA 4LZIA 1NHYA 2VOCA 4HSCX 2BJXA 1MTCA 4K90B 4PNGA 2D42A 5DRVA 4K1FA 6GSWA 5M1AA 3MDKA 2R37A 3KIJA 4JF8A 2HT9A 3X41A 1LNIA 2RM5A 3TJFA 4MZCA 4LMIA 3ZG5A 2YWMA 2PWJA 3AMOB 3CCV3 3DXBA 3QFAC 1GTBA 4KFFA 2AAWA 2WZ9A 3LT8A 4PURA 3CSHA 2N5BA 2O3OA 5DAKA 1A0RP 1AR0A 1SK1A 4F2IA 5CF2A 3GFKA 2H0GA 4G2EA 2GQLA 1X9SB 1WQLB 5GSPA 3LXTA 2CFKA 1SYRA 2M72A 1GY7A 1B48A 2HRAA 3GL5A 3ZL5A 3D22A 3CRTA 5ENUA 1RGEA 1UDII 5TGNA 1GOVA 2YWNA 3APSA 1MEKA 3CC23 4RNTA 2HZEB 3GYKA 5ECKB 1U88A 3EPTA 3LXUX 2YJ7A 2WOFA 2FY6A 3HZPA 1LVNA 1V57A 3KP9A 1PMTA 2IFQA 2MMAA 1OAZA 1YZXA 1Q7HA 1OPYA 1IYYA 4MF6A 4PX1A 1C54A 1BQ7A 2B1KA 2RUEA 5ECHB 4KT3B 2O87A 5DALA 1ZS7A 1YGEA 1OGXA 1A67A 4GLTA 2D2ZA 1MDJA 3GV1A 3ZVJD 1J08A 1HQOA 3FKAA 2Z7AA 1SL0B 5FT3A 4PTSA 1EEJA 3MYTA 1GRXA 4EYCA 4KB3A 1FO5A 5HQPA 1BANA 3HD5A 5G2ZA 4TR3A 2H71A 2VUPA 1WTHA 3GRXA 3CTFA 2VLVA 3IAM2 4XS4B 3KFQC 1YKAA 2WGRA 4L5LA 3E99A 5FWGA 3MWHA 1I8VA 1YJN3 3LYPA 1TI3A 4K0GA 1HZ1A 1WMNA 1ZL9A 2IUKA 3F9SA 1MWRA 2UX0A 3QAWA 16GSA 3UJMA 3WDGB 2CFLA 3L9VA 3G8ZA 4XCSA 1PY3A 4HM1B 1ROAA 1H75A 4YAPA 1RN7A 3V99A 5IO2A 4GXZA 3LORA 3RAZA 1EOHA 3EU3A 3MNGA 3RDWA 3PGTA 4WBJA 3WOFB 2A2RA 2YJHA 4K1UA 4V1Ap 2J8XB 2FGTA 5H5RA 1F6MC 4FR9A 4ECJA 1SYXA 4LEHA 2WJUA 2HMNB 6GSPA 4TR4A 2H0HA 2ES7A 4OVMA 3ALAA 3JCML 2AAEA 3MG2A 3A5WA 2ALBA 1VQL3 2BO9B 3GKXA 1W7CA 2YV7A 1V98A 4KSMA 3M9KA 4I8BA 3PR8A 1BNGA 3SVAA 2B7KA 3EMXA 2EIOA 5IMDA 1MWSA 2X8GA 4WYKA 2YPMA 1OC9A 1T1VA 1SKSB 1PGTA 3DEXA 1UCJA 1FGRA 1RTUA 3EN8A 1OH0A 2K3DA 4J56E 4ORLA 1NDOB 2H19A 3NOFA 3CRUA 1IQYA 1MD3A 4ECIA 1JN5A 5IIZA 1B4PA 4GSNA 1GSQA 2LQVA 3IXRA 4D73B 1AIUA 1IK3A 3LOYA 3WODG 1E3RA 1UA5A 4EKZA 3KTBA 2DJ1A 4L8PA 2WGOA 1FZUA 4DSQA 1K41A 3US3A 1Q40B 1E2YA 3F8UA 1A8YA 4QWTA 4BL2A 2GSPA 2OQEC 4TR1B 1YJW3 5H5QA 1C72A 3CXGA 4HZ9B 2B5EA 2A2PA 4LGQA 1SPUA 4RQRA 1ULJB 3DIEA 2C4BA 3KKGA 1G6WA 4MDCA 2C4JA 3ZYWA 2MMOA 2V41A 2VL2A 2ZDJA 2RSXA 1JBSA 2GT5A 2W9PA 1E3VA 5IO0A 3Q2PA 4HBRA 2DJ3A 3BIRA 1BUJA 3SWLA 2JZRA 3NIVA 4EC0A 4I97A 3HVNA 2I4AA 2GVPA 1WOUA 2XEPA 5ECNB 1G96A 3LH4A 5LD0A 1XWKA 1I5GA 3LWAA 2X99A 4LMVA 2VIMA 1ZYEA 4KUNA 2QC7A 2LYXA 1GYBA 4XRDA 3GH9A 1BSCA 5HOHA 1QK8A 2GQKA 3MAKA 2JZTA 3TRPA 3WA3A 1X9WB 5AIGA 1A2VA 3GSPA 2R4VA 1A24A 3D79A 1XVWA 1K734 2J9HA 4XBTA 4GF0A 5AIIA 3VWXA 1RMSA 4EVMA 4U13A 5DCHA 1HU9A 1O81A 4K5RA 2GQMA 4XDVA 2WCIA 3DMCA 1W2B2 2FA4A 5GAND 2HMKB 3QDNA 4LYLB 1K9M4 4EF0A 3RHBA 5KN3A 4IT7A 1UN2A 3D3LA 2KUCA 2MMZA 2HMOB 1OC8A 5A4VA 4WF5A 2OKAA 4MZBA 3BD2A 1GSDA 4IIAA 3L9UA 2RBIA 4DEJA 3EU4A 4HYZA 1VGLA 4JRRA 3NXJA 2XGLA 3APQA 3K5TA 1T4ZA 2R0CA 2YP6A 3F6FA 2ON7A 1MWUA 2CQ9A 3LMLA 1KNGA 2XBIA 5IMFA 3DGYA 1K28A 2YFLB 1BRSA 1FG4A 3F4RA 3EE1A 3NBBA 3MWZA 1L5GB 5IG3A 2LTKA 1B2MA 3ZFBA 1BNEA 2BMQB 1TKDB 1IQ8A 2PNCA 2J23A 4H3UA 4Z7XA 3J7Yb 3GTUA 1IT8A 1CYVA 1IYIA 1STFI 1HYUA 4L8OA 4WKWA 3KMOA 4K61A 4JE1A 2ZCTA 1J2BA 1PN9A 1EGOA 1I0XA 4WBRD 4IN0A 3RNTA 3KSPA 1BAOA 4PQIA 2IPAA 3U1WA 1DMNA 2K6VA 2XC2A 4HM7B 4BTWA 1YJ6A 2C0EA 5D9VA 4LL4B 1FOHA 3IR4A 1M9GA 3AMOA 1K3YA 1W00A 2QIYA 2L59A 3VI7A 2XPEA 5EY6A 1K3OA 3CME3 3FF0A 3I563 1TRVA 1PD21 1YI23 4G1MB 3Q1CA 5BMUA 2G0FA 5DALB 2R0GA 3GN3A 1BRGA 4JBBA 5EPFA 3A5IA 1Q864 2KP2A 3M1GA 4EDYA 5LCZA 1FUSA 1O7PB 2K9FA 3HVXA 5J5NA 1J0FA 4NHWA 3CCL3 1QVF2 1X9MB 1JB2A 5CRDA 1M9BA 1GSEA 3GH6A 3QCPA 3C71A 3FY7A 2HE3A 3CSIA 2O85A 3C1RA 2HI7A 4IW9A 2CZ2A 2FNQA 3GKKA 3QOUA 3M8CA 5CK6A 4GSTA 2L4QA 4EDZA 3H3HA 2CX3A 3K9MC 1RN1A 1K0CA 4AGSA 1NB5I 2KP1A 3G4S3 2WOHA 2VAFA 1EQKA 3RDEA 2FXTA 4X2OA 4ZB8A 1AQWA 2KOKA 3ECFA 1QJGA 4OMVA 4ZB6A 4O92A 2E2VA 1YF1A 3TKSC 1AV4A 5AISA 3N9HA 5A4WA 3WOEB 5EL8A 3DWVA 3NUVA 4X4JA 3NV0B 1VQ93 4LSOA 3CSJA 4RI6A 4IP1A 4FIWA 3O3TA 4HZ2A 4WHAA 2VL3A 2VL9A 1WMPA 3CCR3 2NBSA 3FK8A 4HS1A 2P0XA 5E4WA 1USBA 1S5AA 3VLNA 3BU4A 1AW9A 4KDUA 5HFGA 3CQFA 1VF2A 4N6MA 1CYUA 3TKPA 1B3SA 3H4KA 1OHOA 4NHFA 4MH2A 1JNQA 3ZFLA 4CDLA 2OTL3 3CMIA 2XH9A 1OHSA 1VQP3 1DMMA 4K7NA 1DBYA 17GSA 3T8NA 5CNWA 3Q74A 2B7JA 1ZYNA 4POLA 2P38A 2GDRA 4TOPA 3GWRA 5AIXA 1NU3A 2B5YA 1WPIA 4WYKB 5IEPA 1TJDA 3UEMA 3MIXA 1F3AA 3BB9A 1NHOA 4Q5FA 5IMVA 3GSTA 4OCFA 3CPW2 2HSYA 1BNIA 5IPHA 1I3FA 1UCIA 1TU8A 3HXSA 1OYJA 2OWPA 4YKGA 3CCE3 1RDSA 3ZMKA 3R2QA 5KOXA 6RNTA 2IA7A 1JKGA 1MGRA 5LC6A 1U3AA 1BG5A 4O5UA 2H74A 5J9BA 1ISKA 1JZRA 3F4TA 2V2GA 1G7EA 1RHLA 4DKIA 3GX0A 2P5RA 3CMA3 2QA43 2LQQA 2E2GA 2HRKA 3VFIA 3F4SA 1VQ83 3KGKA 3PINA 4K6XA 3P7XA 3UL3A 4GSPA 1W4VA 4AJ8A 3B4PA 3BNEA 3OW22 5STDA 3G7IA 1B4QA 4ZBDA 3UL6A 2LS5A 2STDA 1ERTA 1VQ73 4BIKA 4E8HA 5IEOA 3DVWA 1GOUA 2C3TA 3KM6A 1LOYA 4MP4A 1FGMA 3S28A 2KXGA 1FB0A 4AKZA 3F6DA 4O32A 4D73A 4O5QA 3IPTA 1YQ1A 2GZYA 4DSSB 1QAFA 2C80A 2L4VA 5AYRB 1QQ2A 3DGQA 4JU5A 1Q40A 2P31A 2FWFA 3EMPA 1A90A 3LYKA 1YHQ3 1O6JA 4TR1A 4ZILA 3DUKA 4CY8A 2D1WA 3FCSB 1YDKA 3UBLA 3EHCA 1ACVA 1WIKA 2H1DA 4MJDA 5HR3A 5JCGA 2LJAA 1FGOA 3FW2A 4ZBAA 1RGCA 5KN0A 3F7XA 3TKSE 3F63A 3LTCA 2KF5A 1W01A 3GA4A 1FW7A 3HCZA 1IVWA 1GSUA 2L57A 2LRCA 2M46A 1PX6A 5HR0A 5G5FA 4NREA 5B6NA 1N8R4 2OCTA 2L5OA 4G0IA 2BMOB 3GHAA 1JZWA 2PBJA 1WNHA 3G713 4V1Ag 3DGOA 1YJ93 4O5RA 1PKWA 4MMMA 3MG1A 2HZFA 3QAGA 4RZMA 1R4YA 4WR5A 1G02A 1BIRA 12GSA 1GY6A 1IU7A 4L8EA 4N10A 1UI7A 1S723 3DGMA 5G1LA 1FVKA 2FWEA 1IVUA 1SU9A 1FGTA 4POBA 1J9BA 5ECIB 1LQMB 1X5CA 3J7Yk 3ME7A 2XSOB 3NQZA 4KVHA 1GTUA 4OFMA 1I2FA 3HHVA 4JR6A 1KD14 4FYUA 4OFTA 1B2UA 1U8CB 1WE0A 2CT6A 2HOHA 5AEUB 1T7PB 3TOTA 2ZUPA 2XR8B 1EG9B 2H6YA 2LRNA 2C8UA 2LRTA 5A4UA 1BVIA 4V2LA 2CWTA 1I2GA 2RM6A 3E9JB 3EBTA 5IM9A 2W56B 4XTSA 3CCM3 4N11A 3RHCA 2JACA 4EUYA 2LV3A 3VF1A 1N9JA 4N3VA 3CD63 2YWOA 2DJ0A 5HFIA 4HAAA 1ZGXA 4GB5A 6GSSA 3AHWA 5FHIA 1OVNA 2K8SA 5DJMA 3FR3A 1OUNA 3LYGA 2HRNA 6STDA 2KLXA 2IJYA 4ML6A 2K18A 5E59A 1RRHA 2F4YA 2C11A 4K0NA 4ILFA 1THXA 4AKYA 2YWIA 4KGIA 3TJGA 1NJI4 1URMA 1N8QA 3FZ4A 1GSYA 3NX0A 4BL7B 1SQWA 4J5KA 1GSFA 4EW5A 3FSDA 2YANA 3DM8A 4ZL8A 1JJ22 1W6CA 3FRCA 3WHOA 1ROVA 3CNXA 1EP7A 3HIIA 1A23A 3D21A 2YZHA 1M2BA 2R3XA 4RUVA 3F8HA 4HM0B 5CYYA 4KSOA 1OGZA 3CPOA 2ML6A 7GSSA 3GNJA 2MZCA 3QAVA 4BA7A 1GUMA 3NM2A 3A3TA 4DVCA 1NO3A 4F82A 3I0YA 2FHEA 2CVDA 3GL3A 3S67A 2O7KA 5GSTA 1RCKA 1BX9A 1O73A 2A4HA 9RNTA 1OF5B 3T0UA 4ZIJA 4IP6A 4X1UA 1XG8A 2JZSA 3G7JA 5IF6A 3SYUA 4KDXA 1O7UA 1XVQA 5D8IA 4X0XA 1AVKA 4NXIA 3LZAA 2YN1A 5IG0A 2BMXA 3ZTLA 3P90A 1TU7A 2CAQA 4YH2A 1KSIA 4GQCA 5ECPB 4O02B 3GZXB 3CTGA 1A8LA 1Y4KA 5EVHA 5J9CA 3TRQA 4XHMA 1SJZA 4HDEA 2H30A 2CFGA 4R4KA 2DMLA 4K9ZA 3VURA 3QMXA 3SX1A 3H51A 3I9V2 3I553 2C3NA 3TKRA 3EB8A 3MHEA 3NQYA 4Q53A 7GSPA 1A2KA 5ECOB 4ICYA 1XZOA 4YKFA 1KTEA 3IK9A 4CY6A 3I43A 2WO0A 1AY7A 3DH2A 2P05A 3DKSA 4CJNA 3PH9A 4ID0A 4MH3A 1DYUA 4TXVA 3U5RE 4N6LA 3NV0A 2P0MA 4PUFC 4MMYB 2CWVA 1W2ZA 2WGQA 4N6UA 3N5OA 1PN0A 4TX4A 1GTIA 2HSHA 1R26A 3IJEB 3NZNA 1FOVA 1KQS2 2CHCA 2N5AA 5GAPD 1GNWA 2OA7A 3M8NA 3LTDA 2AV4A 1QVG2 4KF9A 1UGHI 4TVEA 4MPFA 5HR1A 3M3MA 3OWUA 1GMPA 1FUTA 4XS6A 5AIFA 5D96A 4RNYA 1GLQA 3HYPA 1T2HA 1ASKA 3DYRA 4CHSA 4HZBB 2NPBA 1JKGB 1TI1A 1UC7A 1IVXA 4HM4B 3EF8A 3GUSA 3ZRDA 2YFIB 2AHEA 6GSYA 1OKTA 5CXOA 1BUQA 2KAAA 5JCUA 1A2MA 1PYLA 2LJKA 1PFOA 3SBCA 4WETA 4RNZA 1IDPA 2IYJA 1SL2B 2Q07A 1N9EA 3SLUA 3BCKA 6GSXA 4OO5A 2QEX3 2A4VA 1B9YC 4X2HA 2V6KA 2GSRA 2DSAA 2OBIA 3FH1A 4FCJA 3LTBA 1BOXA 5ABRA 2GU1A 4ACSA 4GL6A 4IQAA 1QMAA 1YEXA 4LA1A 4G19A 1ZZYA 4Z2TA 3FZAA 1HNBA 1JB4A 2LUSA 1R5PA 2GT6A 1ERVA 5GSSA 1QAKA 3GZRA 1O7HB 1W02A 3HJMA 4EC6A 1VQN3 1TRUA 3GX8A 5F06A 1RNBA 2V32A 2G2QA 2VCZA 3EINA 2CIUA 5DQYA 3NHXA 1Y6EA 1GOYA 1Z9HA 1M1K4 3URPA 5JPPA 4IELA 2XGNA 2KHPA 4BVYA 1K3LA 2OACA 3KJYA 2VM2A 4ECBA 3X3XA 1BGSA 5D83A 1IT7A 1JFUA 1KBNA 2C0DA 1V9WA 1SK2A 1LNHA 4XBYA 5KP3A 4STDA 1QXHA 3R3EA 4OD7A 4DSSA 4KCAA 1K0NA 3E0UA 1N5HA 2X8HA 4HUAA 3HIGA 1B21A 2GZPA 5G1KA 5A0OB 2V1MA 1RJOA 1DE1A 5JBSA 2SARA 4AEQA 3RPNA 1DVDA 3V92A 2KF6A 3EJVA 2LEGA 1YY7A 5CREA 4MA9A 2OE0A 4HJLB 1X1UA 2REMA 1O7NB 1BAYA 3DMLA 3VPTA 4FCMA 2HNLA 2KF3A 4EIQA 4CW9A 5JWOB 1MDKA 2H1AA 2PU9C 3O6TA 5BU4A 1BNRA 2CZ3A 4FCZA 1IV9A 1LOXA 1H4OA 3F8XA 1BNFA 3HOHA 2N5FA 3WGDA 4GWRA 4TW5A 4MPGA 4MLYA 3KEBA 4N6TA 4TKYA 1ZYPA 1DSBA 2HSMA 2I3YA 4O3VA 2GGTA 2BT3A 3ERWA 1NB3I 1RNTA 2QSIA 5HGRA 2VCTA 4EL1A 3U97A 1THOA 2P5QA 3ZIJA 3ZITA 3CCJ3 4FMAA 1B2ZA 1FB6A 3L4NA 1EEMA 4J57E 3FEUA 7STDA 1WMJA 1U3IA 3ZMLA 2FA8A 3CYNA 2K8VA 2HMJB 1OKDA 3KZQA 4I6XA 1RK4A 2PVQA 3KCMA 2NTOA 2ZNMA 4HQSA 1FHEA 1GSSA 1B2XA 1UI8A 3DXOA 2VCVA 2ML5A 3F14A 3DVXA 4G9HA 1JBRA 4AJ6A 3MKIA 4N6NB 5ELAA 1TFKA 1YF0A 4HEA2 2SBLA 3HZ4A 2C3QA 1YIJ3 4IKHA 2O9UX 1X1WA 3UOMA 2W56A 3X3YA 3BNDA 4HKVB 2IMIA 1HD2A 1NNVA 1R4CA 4HZ4A 1TK0B 1I70A 2H70A 3LXZA 4PQ1A 1GD4A 1MD4A 3GZYB 1S3CA 1HNAA 2GSTA 5JWRB 3LFLA 5EEOA 1PX7A 5KP4A 2B1XB 1T2IA 2F8AA 2OQEA 4KAEA 3LG6A 1Q7Y4 1AQZA 4HM5B 2W04A 4HM6B 2OOVC 4BU4A 3IRAA 1S3AA 4N6OB 4BL7A 4Q5RA 1M3JA 4I5QA 2MF7A 4XB5A 2TRCP 4POMA 1SJ6A 1PL1A 3EVIA 5LC7A 2JADA 3LQ7A 2PVOC 3LT9A 3F9UA 1YNVX 3ZIVA 4MABA 1CEWI 4H86A 2OTJ3 1M2AA 2VCXA 4USSA 8GSSA 1B9XC 3FZ9A 5JCWA 1SARA 4EXRA 1O8XA 1FUWA 3G6E3 4NMUA 3A2VA 4OCEA 3EWLA 2RGQA 1LXEA 9GSSA 3W6GA 1QMVA 3FHKA 4L7KA 3D5GA 3D4TA 1XW5A 3IC8A 2Z76A 4BIRA 1OF5A 1BRNL 1WP0A 4TR0A 3PYJA 1N2AA 2X64A 3D5IA 1T4YA 2BIRA 3WT2A 3TOUA 2DJJA 2GEYA 3CC73 3RBTA 3NM7A 3GKNA 2OADA 1RGHA 1PQNA 3CCQ3 1SIIA 1TXXA 1GY5A 1ZX2A 3G7YA 5DQSA 1TRPA 2C0FA 5IG5A 3ZVJA 1OHPA 4PUAA 4KNDA 2F98A 4A5PA 5ID2A 4F0BA 4RQXA 1W89A 2H1BA 3PCSA 3D5JA 3WR2A 3IC4A 3K8NA 5ELGA 4NHZA 3VWWA 4FYBA 3IE3A 2H66A 2GSQA 4KFDA 3FLJA 5IW9A 1EV9A 2JDIH 1KWIA 1DETA 1N5PA 1UW1A 2R0PA 3FF2A 4NV2A 1JB5A 2I9WA 4K2DA 2E2TA 4MJEA 5CLKA 2VO4A 3IHQA 5M18A 6GSVA 4OFNA 2QKEA 5AIHA 4MF5A 2JU5A 5KN2A 1YKCA 1SD8A 3KH7A 4V2NA 5AI1A 1W6GA 1BYEA 2LJRA 3VWVA 3KD0A 2LQOA 1DMQA 3FR9A 5CRWA 1KC84 2PERA 2FWHA 2H75A 4WR4A 2DBCA 5D82A 1BEDA 2C1YA 4IGJA 1D6ZA 3W8JA 2VD0A 4LLRA 4HOJA 3N8BA 4WFOA 3BJ5A 5DJLA 3D4AA 3IHGA 3B8LA 13GSA 2ZL8A 1GMQA 4LL1B 4BL3A 3F40A 2F86B 3FG1A 3AGNA 2ON5A 4TRXA 4JRFA 3G0KA 5IQYA 2XBQA 3B7CA 2B5XA 3HZ8A 2AB6A 4GSSA 2CV4A 4YQMA 4WP5A 2BU4A 2H73A 3TDGA 4IJ3A 4ISDA 3MG3A 1G0TA 1LOWA 3SOAA 4BTYA 5IPGA 4R1KA 4WXTA 3EBYA 3IDVA 2CH9A 1UCLA 1SKWB 2M7OA 2M80A 3C73A 4BVYB 2PN8A 4YQUA 3OR5A 5B8BA 4QQ7A 4HM2B 4OWYA 3AHSA 2DKIA 3CNMA 1EP8A 3RGAA 3QR6A 4ULXA 2R2JA 4R80A 2EC4A 3CCS3 4HI7A 4X43A 3F3QA 2JSZA 3FYGA 4POKA 3VPQA 2DC5A 1VF4A 2FNOA 4EIPA 3DZLA 1VF3A 1S3RA 2WDUA 4FQUA 3Q19A 2FUG2 4GCIA 3TKSA 4CCVA 1SJIA 3GKMA 5AYSC 2GEXA 2X49A 1ZCPA 2L6DA 1FAAA 3UB1A 2PGTA 4MMXB 3Q90A 3C8EA 1Q9EA 1UUWB 1Z6MA 4N0VA 1TTOA 3FG4A 5M19A 1HNCA 3ISOA 5IOWA 3OV4A 2IY2A 2XRXB 4PEJA 5F05A 1C7HA 4IBPA 1TP9A 2LSTA 2VCWA 1GS3A 3H79A 3IOSA 2XFTA 1RGKA 2MBTA 5HR2A 2GBXB 2L1SA 1MNLA 1TK8B 1XBSA 5J41A 3IPZA 5ELJA 4MJAA 3TJKA 3GMFA 5KOWA 2RCDA 4K7IA 4MCUA 3LJRA 2H01A 3OWYA 1GP1A 5IOXA 1ON4A 1YEPA 1XFLA 4XM4A 4PXOA 1IVVA 5BXQA 4FMBA 1GMRA 4FO5A 3X40A 1JV2B 3WA2X 4EV2A 1OCVA 1TIJA 2BMRB 1O8WA 1HYFA 3ZFZA 3CBUA 1V58A 4MJCA 4LMWA 2WFCA 5D9XA 3TRXA 1CQGA 3V1WA 3BLZA 4BWQA 1WMOA 1Z5YE 2JSYA 3H1NA 2AUVA 3W8SA 1RSNA 1FW1A 2GLRA 1Q98A 4PNFA 1A2LA 3WT1A 1O7WB 5FW5A 4KW6A 2QA1A 4JZQA 1FYSA 3EE2A 1OACA 2IMEA 1SD9A 4BTXA 2R5GA 1X5EA 4FMDA 2CX4A 3GURA 5ECQB 2H0IA 5JWQB 5AGYA 1SJWA 2DJKA 3APOA 2RUFA 4RBNA 3C1SA 1X5DA 4MNNA 4HJMA 3TB2A 1PA3A 4WF4A 5DREA 3ERFA 1GNEA 1ZGNA 2EIQA 1TDIA 4Q5QA 4K7OA 3PGBA 2OE1A 1ABAA 1VZZA 4ZL7A 4NAXA 1DE2A 2AADA 1VQ43 4MMZB 2K0MA 2C10A 4PQHA 3A2WA 4BVXB 3TJBA 3BOAA 3H93A 5IG4A 3ZLPA 2WULA 1U5OA 2W03A 2YCDA 1B8XA 1EOGA 1DE3A 4XBXA 22GSA 3EX9A 1VQ53 7RNTA 1YVBI 1B20A 4F03A 3BBYA 1BNJA 4WWUC 4CDOA 4N0ZA 2GXFA 3O8YA 3GZBA 1TP6A 1R7HA 2VLTA 4F0CA 1AC1A 4MK3A 2CC3A 10GSA 1IYHA 1Z1SA 3ME8A 4TXOB 1I9DA 2IMDA 4KCEA 4L0WA 2V1LA 1RGGA 1SL1B 4IJIA 5KN1A 1I2EA 3L9SA 4GQFA 5A5KA 3ER7A 3ZG0A 4F9ZA 5LNKe 3NBJA 1F2EA 5ID2B 3J7Yd 5CAXA 1GL8A 3QK9A 1I0VA 2F5MA 3O76A 4GRFA 4L0UA 1BSEA 2R41A 1MOLA 2I81A 1GH2A 1R4WA 5CRHA 1F3BA 1JRQA 2MC8A 5ECRB 5IMZA 5INYA 2VL2C 3OXAA 3V98A 5IMAA 5IENA 2F99A 3HDCA 3UJ1A 2F3MA 3P2AA 3D9RA 5AEWB 2QGVA 3MPHA 3FZ5A 1US1A 5IMCA 4L5OA 4HQZA 3HK4A 1A0FA 3Q3FA 1PL2A 3PCRA 3IK7A 1XPVA 1IV7A 5G2GA 1A2PA 1LQGC 1UUGB 3P8WA 3A5EA 2E0QA 2ZA4A 2PPTA 2IN3A 3FKFA 4KFEA 3UL5A 2R6KA 3DGLA 1JBTA 3JUQA 3WMDA 1AQXA 1MDIA 4AF2A 1RW1A 1TFOA 4FMCA 1PKZA 2X8CA 1TUHA 4KDYA 3F7SA 1M1XB 1M0UA 1M904 3WGEA 1AXDA 1NWWA 2FCHA 2I1UA 5B8AA 3I6AA 1Y25A 2HFDA 2FWGA 1QGVA 1Q4JA 4N6V0 3S27A 3EN1B 2CVKA 1TRQA 3KZTA 3UIWA 2XFSA 2X4AA 1SKRB 6GSTA 5DVBA 2BTOT 5D93A 2CFDA 3NBRA 2L4CA 5HFKA 3RPPA 1VRSD 3KH9A 4KH7A 4IHUA 1T00A 5D9TA 1BSBA 1TRSA 2IMKA 4O7HA 1UCKA 4J9AA 4JEDA 2QGUA 4ZM8A 1NW2A 3FR6A 2P0GA 1PRXA 4OO4A 1HKXA 1YVSA 1WWJA 5ECMB 5C04A 2HRFA 3FG3A 2CX0A 1PFPA 1BSAA 2GU3A 2I9HA 2WS2A 3SOYA 1IQXA 1FVJA 2OJLA 2O8VB 3IBHA 4HOHA 3TCOA 2VM1A 2CK3H 1DVCA 2DJ2A 3ROBA 3E3EA 3EQQB 4HM3B 1XXUA 3LW9A 1EV4A 1GLPA 1V74A 4IVFA 1U6TA 3N9JA 4EXJA 1GUKA 3KE7A 5IERA 3EYTA 5F0GA 2F9SA 1T3BA 2BHMA 3SXXA 1ILOA 1ZMAA 1BRJA 4XDWA 4Z2UA 1K0MA 2OE3A 3LGCA 1T5YA 1JLVA 3F0IA 3KSED 1E6BA 4ZL9A 3UAPA 1ULIB 1BRIA 1X1YA 3X3ZA 3N54B 3PXMA 5ELUA 2KRTA 5D81A 2IUJA 2Z9SA 1LJRA 1Z3EA 1AVLA 4MEIA 1AQVA 3L0RA 1EA2A 2JQ5A 3M9JA 2OBKA 3IMAB 1GULA 11GSA 3QRDA 5B6MA 2CG0A 1QUWA 3HJOA 1VQO3 2FD3A 5KEJA 5KP1A 4HU7A 3IV4A 3KIIA 1CQHA 4GHOA 3UBKA 3X42A 5D9WA 1NSWA 2A2SA 3TJJA 18GSA 3K7CA 4QL7A 1GTAA 1AUCA 1TW9A 1O7GB 1W4NA 4K2XA 4XIHA 1NM3A 4NV5A 3UVTA 2YFJB 3T8UA 4EBGA 5I97A 1RGFA 2TIRA 3HJPA 3QPMA 5DDLA 4IS0A 3AGOA 2Z6BA 3I69A 1LOVA 3G9BA 4QL9A 1RRLA 2XSHB 2AJQB 4P3YB 2Y73A 3UMAA 2HMMB 1XWGA 20GSA 4FH8A 2WB9A 14GSA 4R9LA 3HKRA 4GTUA 1BRHA 2E2UA 5CO3A 1K0DA 1G6YA 1ZOFA 3HA9A 1JZDA 1PU4A 5GZZB 1Z7PA 4Q5NA 2IMFA 2GTUA 2P09A 2GSSA 5COHA 3K0ZA 5C00A 3U6VA 1G7OA 1CQSA 1ERWA 1SENA 2V6OA 3KMNA 2MYGA 1M7TA 4O8SA 1BJXA 1K0OA 1RLSA 3FGYA 5CP1A 1B27A 2DKHA 1ZO2A 3VGNA 1GWCA 2JL4A 2CVBA 4K5SA 2MBSA 1ST9A 1I3IA 1ERUA 2IL3A 1OE7A 3Q6OA 1OE8A 3CC43 1XW6A 3JUPA 4J2FA 1BU4A 2H6ZA 4MZWA 2PZVA 2IWTA 4WEYA 5DAKB 3SEDA 4BWSA 4FYCA 3G16A 3LTAA 2CW9A 5ECSA 2LNSA 3AY8A 5L71A 3L0HA 5AIVA 2WRTA 8CHOA 1M3IA 2RFRA 3DD3A 3HVSA 2YZUA 4K1VA 2PMTA 2KCDA 4O2HA 1W6YA 5DBQA 1K8A4 4AJ7A 2W9QA 2RNTA 2HLSA 1B2SA 4BVXA 2B6MA 2RIIA 2IFQB 2INXA 1LU4A 1VQK3 4V2MA 1PSQA 2YOIA 1GSPA 1UUVB 4ZXGA 1GUHA 2MMNA 5B7CA 4MJBA 3GIXA 4NWYA 3ZREA 4XRAA 4J5GA 1JLWA 1GD3A 4I2UA 1T8EB 3CU3A 5F8BA 4CPKA 3IAS2 1F9MA 3QFBC 4KE3A 3VK9A 2YX9A 3S5CA 2F51A 3HI7A 3DRNA 4RI7A 4XS1A 2AYTA 5BIRA 3FMWA 4N30A 3MSOA 3JUMA 4TXOA 2HZEA 4G0KA 3GAXA 1Z7RA 4G0LA 5RNTA 3RGRA 4ZBBA 4ZB9A 4ECCA 2F8FA 1EUIC 4EV5A 2A15A 5CRGA 3EC3A 2F5WA 1VQ63 3JUOA 3DGNA 1TTZA
chains in the Genus database with same CATH topology
5J3RA 3HVVA 1KEBA 2XHFA 1K0AA 3D4MA 3MSZA 3TUEA 3HY2A 2PUKC 5D73A 2FGXA 1U87A 2L5LA 5G31A 1EGRA 1XOAA 2H76A 2LNTA 1XCCA 3WYWA 2VCQA 4XS4A 4DSRA 3ED3A 1ZYQB 1M9AA 4G10A 4TN8A 3KXOA 5F07A 2C0GA 4KA0A 1A2JA 1SK0A 2RLIA 2CA8A 2YV9A 1EWXA 2UZ8A 2LKUA 1O85A 1EZKA 3TKQA 3ZZXA 1XW9A 2GZZA 2B3SA 2TRXA 5BRTA 3LSZA 3BCIA 1UVZA 2YNXA 5ECLB 1OC9B 2DIYA 4YQVA 1TOFA 6GSUA 1TK5B 4KX4A 3ERGA 1N8JA 2FLSA 3VWUA 3PPUA 2NDOA 2HXKA 2CAIA 2E2MA 1XWAA 4HJ2A 1XWCA 3IA1A 1TRWA 5H5SA 2H6XA 1XOBA 3F3RA 3S9FA 1QFNA 2B1LA 3D0ZA 2VD1A 19GSA 4HU9A 3L78A 4MF7A 1K0BA 2H72A 3LEFA 3GSSA 4EO3A 3D6IA 1RQMA 3MYDA 5G5EA 1WJKA 2VLUA 4E8EA 1LBKA 3VI5A 1M2DA 1XWBA 1Z6NA 1WRYA 1V2AA 3A2XA 3C7MA 3EURA 1F37A 4BPYA 2IIYA 1DUGA 4IQ1A 4ML1A 2H8LA 3UARA 3M0FA 1S3DA 3KTLA 4EE0A 2DLXA 3UVHA 1R5AA 2XPDA 3TGZA 3WGXA 1ML6A 3H8QA 4K8MA 1JZOA 1JHBA 1V40A 1X0RA 2L6CA 2DIZA 4Z2RA 5J4UA 5DCGA 2DMMA 2QA2A 2NVLA 2HYXA 2O89A 5G30A 4I2TA 2GS3A 1XIYA 5AN1A 3Q18A 5EVOA 4NPBA 3KP8A 2H1GA 4JR4A 4PGTA 3QD9A 1OC3A 1M99A 3GTUB 4YAVA 1VF1A 1AAZA 3WD6A 2EIRA 2E7PA 1NHYA 2VOCA 2BJXA 1MTCA 4PNGA 4K1FA 6GSWA 3MDKA 2R37A 3KIJA 2HT9A 2RM5A 3TJFA 4MZCA 2YWMA 2PWJA 3DXBA 3QFAC 1GTBA 2AAWA 2WZ9A 4PURA 3CSHA 2N5BA 5DAKA 1A0RP 1SK1A 4F2IA 3GFKA 2H0GA 4G2EA 2GQLA 1X9SB 3LXTA 1SYRA 2M72A 1B48A 2HRAA 3GL5A 3ZL5A 3D22A 3CRTA 5ENUA 2YWNA 3APSA 1MEKA 2HZEB 3GYKA 5ECKB 1U88A 3EPTA 2YJ7A 2FY6A 1V57A 3KP9A 1PMTA 2IFQA 2MMAA 1OAZA 1YZXA 4MF6A 4PX1A 1BQ7A 2B1KA 2RUEA 5ECHB 2O87A 5DALA 4GLTA 2D2ZA 1MDJA 3GV1A 3ZVJD 1J08A 1HQOA 1SL0B 5FT3A 4PTSA 1EEJA 1GRXA 4KB3A 1FO5A 5HQPA 3HD5A 5G2ZA 4TR3A 2H71A 2VUPA 3GRXA 3CTFA 2VLVA 3IAM2 4XS4B 1YKAA 2WGRA 4L5LA 5FWGA 3MWHA 3LYPA 1TI3A 4K0GA 1ZL9A 3QAWA 16GSA 3L9VA 4XCSA 1H75A 4YAPA 5IO2A 4GXZA 3LORA 3RAZA 1EOHA 3EU3A 3MNGA 3RDWA 3PGTA 4WBJA 2A2RA 2YJHA 4V1Ap 5H5RA 1F6MC 4ECJA 1SYXA 2WJUA 4TR4A 2H0HA 2ES7A 3JCML 3A5WA 2ALBA 3GKXA 2YV7A 1V98A 4KSMA 3M9KA 4I8BA 3PR8A 2B7KA 3EMXA 2EIOA 5IMDA 2X8GA 2YPMA 1OC9A 1T1VA 1SKSB 1PGTA 3DEXA 4J56E 3NOFA 2H19A 3CRUA 1MD3A 4ECIA 5IIZA 1B4PA 4GSNA 1GSQA 3IXRA 4D73B 1AIUA 1UA5A 4EKZA 3KTBA 2DJ1A 4DSQA 3US3A 1E2YA 3F8UA 1A8YA 4TR1B 5H5QA 1C72A 3CXGA 2B5EA 2A2PA 4RQRA 3DIEA 4MDCA 1G6WA 2C4JA 3ZYWA 2MMOA 2V41A 2VL2A 2GT5A 5IO0A 2DJ3A 3SWLA 2JZRA 3NIVA 4EC0A 4I97A 2I4AA 2GVPA 1WOUA 5ECNB 5LD0A 1XWKA 1I5GA 3LWAA 2X99A 4LMVA 2VIMA 1ZYEA 4KUNA 2QC7A 4XRDA 3GH9A 1QK8A 2GQKA 3MAKA 2JZTA 3TRPA 1X9WB 2R4VA 1A24A 1XVWA 2J9HA 4GF0A 3VWXA 4EVMA 5DCHA 1O81A 4K5RA 2GQMA 2WCIA 2FA4A 5GAND 3QDNA 4EF0A 3RHBA 5KN3A 1UN2A 2KUCA 2MMZA 1OC8A 5A4VA 4WF5A 2OKAA 4MZBA 3BD2A 1GSDA 3L9UA 4DEJA 3EU4A 1VGLA 4JRRA 3APQA 1T4ZA 2R0CA 2YP6A 3F6FA 2ON7A 2CQ9A 1KNGA 2XBIA 5IMFA 1FG4A 3F4RA 2LTKA 3ZFBA 1TKDB 2J23A 4Z7XA 3J7Yb 3GTUA 1IYIA 1HYUA 4WKWA 3KMOA 4JE1A 2ZCTA 1PN9A 1EGOA 4WBRD 4IN0A 4PQIA 2IPAA 2K6VA 2XC2A 1YJ6A 2C0EA 5D9VA 4LL4B 1FOHA 3IR4A 1K3YA 2L59A 3VI7A 2XPEA 5EY6A 1K3OA 1TRVA 1PD21 5BMUA 2G0FA 5DALB 2R0GA 3GN3A 4JBBA 5EPFA 3A5IA 2KP2A 3M1GA 4EDYA 5LCZA 2K9FA 3HVXA 5J5NA 1J0FA 4NHWA 1X9MB 5CRDA 1M9BA 1GSEA 3GH6A 3QCPA 3C71A 3FY7A 2HE3A 3CSIA 2O85A 3C1RA 2HI7A 4IW9A 2CZ2A 3GKKA 3QOUA 4GSTA 2L4QA 4EDZA 2CX3A 4AGSA 1K0CA 2KP1A 2VAFA 4ZB8A 1AQWA 2KOKA 4OMVA 4ZB6A 4O92A 1YF1A 3TKSC 5AISA 5A4WA 5EL8A 3DWVA 4X4JA 3CSJA 4RI6A 4IP1A 4FIWA 3O3TA 4HZ2A 2VL3A 2VL9A 2NBSA 3FK8A 4HS1A 5E4WA 1USBA 3VLNA 1AW9A 4KDUA 5HFGA 1VF2A 3TKPA 3H4KA 4MH2A 3ZFLA 3CMIA 4K7NA 1DBYA 17GSA 5CNWA 3Q74A 2B7JA 1ZYNA 4POLA 2GDRA 4TOPA 5AIXA 2B5YA 1WPIA 1TJDA 3UEMA 3MIXA 1F3AA 1NHOA 4Q5FA 5IMVA 3GSTA 4OCFA 2HSYA 5IPHA 1TU8A 3HXSA 1OYJA 4YKGA 3ZMKA 3R2QA 5KOXA 1U3AA 1BG5A 4O5UA 2H74A 5J9BA 1JZRA 3F4TA 2V2GA 1G7EA 3GX0A 2P5RA 2LQQA 2E2GA 2HRKA 3VFIA 3F4SA 3PINA 3KGKA 4K6XA 3UL3A 3P7XA 1W4VA 4AJ8A 3G7IA 1B4QA 4ZBDA 2LS5A 1ERTA 4E8HA 3DVWA 2C3TA 3KM6A 4MP4A 1FB0A 3F6DA 4O32A 4D73A 4O5QA 1YQ1A 2GZYA 4DSSB 2C80A 1QQ2A 3DGQA 4JU5A 2P31A 2FWFA 3EMPA 3LYKA 1O6JA 4TR1A 4ZILA 4CY8A 1YDKA 3UBLA 1ACVA 1WIKA 2H1DA 5HR3A 5JCGA 2LJAA 3FW2A 4ZBAA 5KN0A 3TKSE 3F63A 3GA4A 3HCZA 2L57A 1GSUA 2LRCA 2M46A 1PX6A 5HR0A 5G5FA 5B6NA 2L5OA 4G0IA 3GHAA 1JZWA 2PBJA 4V1Ag 4O5RA 1PKWA 4MMMA 2HZFA 3QAGA 4WR5A 12GSA 4L8EA 4N10A 5G1LA 1FVKA 2FWEA 4POBA 1SU9A 1J9BA 5ECIB 1X5CA 3J7Yk 3ME7A 1GTUA 4OFMA 3HHVA 4JR6A 4FYUA 4OFTA 1WE0A 2CT6A 1T7PB 3TOTA 2ZUPA 2H6YA 2LRNA 2C8UA 2LRTA 5A4UA 4V2LA 2RM6A 3E9JB 5IM9A 4XTSA 4N11A 3RHCA 2JACA 4EUYA 2LV3A 2YWOA 2DJ0A 5HFIA 6GSSA 5FHIA 1OVNA 2K8SA 5DJMA 3FR3A 2HRNA 2KLXA 2IJYA 4ML6A 2K18A 5E59A 4K0NA 4ILFA 1THXA 2YWIA 4KGIA 3TJGA 1URMA 3FZ4A 1GSYA 4BL7B 1GSFA 2YANA 4ZL8A 3FRCA 1EP7A 1A23A 3D21A 2YZHA 1M2BA 2R3XA 4RUVA 5CYYA 4KSOA 7GSSA 3GNJA 2MZCA 3QAVA 4BA7A 1GUMA 3A3TA 4DVCA 4F82A 2FHEA 2CVDA 3GL3A 2O7KA 5GSTA 1BX9A 1O73A 2A4HA 4ZIJA 4X1UA 4IP6A 2JZSA 3G7JA 4KDXA 1O7UA 1XVQA 5D8IA 4X0XA 4NXIA 2YN1A 2BMXA 3ZTLA 3P90A 1TU7A 2CAQA 4YH2A 4GQCA 5ECPB 3CTGA 1A8LA 5J9CA 3TRQA 4XHMA 1SJZA 4HDEA 2H30A 4K9ZA 2DMLA 3VURA 3QMXA 3I9V2 2C3NA 3TKRA 5ECOB 4ICYA 1XZOA 4YKFA 1KTEA 3IK9A 4CY6A 3I43A 3DKSA 3PH9A 4ID0A 4MH3A 4TXVA 3U5RE 4PUFC 3N5OA 1PN0A 1GTIA 2HSHA 1R26A 3NZNA 1FOVA 2N5AA 5GAPD 1GNWA 2OA7A 3M8NA 2AV4A 4KF9A 4TVEA 4MPFA 5HR1A 3M3MA 4XS6A 5D96A 1GLQA 3HYPA 4CHSA 3DYRA 2NPBA 1TI1A 1UC7A 3GUSA 3ZRDA 2AHEA 6GSYA 1OKTA 5JCUA 1A2MA 2LJKA 3SBCA 4WETA 2IYJA 1SL2B 3BCKA 6GSXA 4OO5A 2A4VA 1B9YC 2V6KA 2GSRA 2DSAA 2OBIA 5ABRA 4ACSA 4IQAA 1YEXA 4LA1A 4G19A 1ZZYA 4Z2TA 3FZAA 1HNBA 2LUSA 1R5PA 2GT6A 1ERVA 5GSSA 3HJMA 1TRUA 3GX8A 5F06A 2V32A 2G2QA 2VCZA 3EINA 5DQYA 1Y6EA 1Z9HA 4IELA 2KHPA 4BVYA 1K3LA 2OACA 3KJYA 2VM2A 4ECBA 1KBNA 1JFUA 2C0DA 1V9WA 1SK2A 1QXHA 3R3EA 4OD7A 4DSSA 4KCAA 1K0NA 3E0UA 2X8HA 4HUAA 2GZPA 5G1KA 2V1MA 1DE1A 3RPNA 2LEGA 1YY7A 5CREA 4MA9A 2OE0A 2REMA 1BAYA 3DMLA 3VPTA 2HNLA 4EIQA 4CW9A 5JWOB 1MDKA 2H1AA 2PU9C 3O6TA 2CZ3A 1H4OA 2N5FA 3WGDA 4GWRA 4TW5A 4MPGA 4MLYA 3KEBA 4TKYA 1ZYPA 1DSBA 2HSMA 2I3YA 2GGTA 3ERWA 2QSIA 2VCTA 4EL1A 1THOA 2P5QA 3ZIJA 3ZITA 1FB6A 3L4NA 4J57E 1EEMA 3FEUA 1WMJA 1U3IA 3ZMLA 2FA8A 3CYNA 2K8VA 1OKDA 3KZQA 4I6XA 1RK4A 2PVQA 3KCMA 2NTOA 2ZNMA 4HQSA 1FHEA 1GSSA 2VCVA 3DVXA 4G9HA 4AJ6A 5ELAA 1YF0A 4HEA2 3HZ4A 2C3QA 4IKHA 3UOMA 2IMIA 1HD2A 4HZ4A 1TK0B 2H70A 3LXZA 4PQ1A 1MD4A 1S3CA 2GSTA 1HNAA 5JWRB 3LFLA 1PX7A 2F8AA 4KAEA 3LG6A 3IRAA 1S3AA 4BL7A 4Q5RA 4I5QA 4POMA 2TRCP 1SJ6A 1PL1A 3EVIA 2JADA 3LQ7A 2PVOC 3F9UA 3ZIVA 4MABA 4H86A 1M2AA 2VCXA 4USSA 8GSSA 1B9XC 3FZ9A 5JCWA 1O8XA 4NMUA 3A2VA 4OCEA 3EWLA 9GSSA 3W6GA 1QMVA 3FHKA 3D4TA 1XW5A 3IC8A 4TR0A 1WP0A 1N2AA 2X64A 1T4YA 3WT2A 3TOUA 2DJJA 3RBTA 3GKNA 2OADA 1PQNA 1TXXA 3G7YA 5DQSA 2C0FA 3ZVJA 4PUAA 4KNDA 4A5PA 5ID2A 4F0BA 4RQXA 1W89A 2H1BA 3D5JA 3IC4A 3K8NA 5ELGA 4NHZA 3VWWA 4FYBA 3IE3A 2H66A 2GSQA 1EV9A 2R0PA 4NV2A 4K2DA 4MJEA 2VO4A 3IHQA 6GSVA 4OFNA 2QKEA 4MF5A 2JU5A 5KN2A 3KH7A 4V2NA 1SD8A 1YKCA 2LJRA 3VWVA 1BYEA 3KD0A 2LQOA 3FR9A 5CRWA 2PERA 2FWHA 2H75A 4WR4A 2DBCA 1BEDA 2C1YA 4IGJA 3W8JA 2VD0A 4LLRA 4HOJA 3BJ5A 5DJLA 3IHGA 13GSA 4LL1B 2ON5A 4TRXA 5IQYA 2XBQA 2B5XA 3HZ8A 2AB6A 4GSSA 2CV4A 4YQMA 2H73A 4IJ3A 3TDGA 4ISDA 5IPGA 1G0TA 4WXTA 3IDVA 1SKWB 2M80A 3C73A 4BVYB 2PN8A 4YQUA 3OR5A 5B8BA 4QQ7A 4OWYA 2DKIA 1EP8A 3QR6A 4ULXA 2R2JA 2EC4A 4HI7A 4X43A 3F3QA 2JSZA 3FYGA 4POKA 3VPQA 2DC5A 1VF4A 2FNOA 4EIPA 1VF3A 2WDUA 4FQUA 3Q19A 2FUG2 4GCIA 3TKSA 1SJIA 3GKMA 2X49A 1ZCPA 2L6DA 1FAAA 2PGTA 3C8EA 1Z6MA 4N0VA 3ISOA 1HNCA 5IOWA 2IY2A 5F05A 4IBPA 1TP9A 2LSTA 2VCWA 3H79A 3IOSA 5HR2A 2MBTA 1TK8B 1XBSA 5J41A 3IPZA 4MJAA 3TJKA 3GMFA 5KOWA 4MCUA 4K7IA 3LJRA 2H01A 1GP1A 5IOXA 1ON4A 1YEPA 1XFLA 4PXOA 4FO5A 1O8WA 3CBUA 1V58A 4MJCA 4LMWA 2WFCA 5D9XA 3TRXA 1CQGA 3V1WA 4BWQA 1Z5YE 2JSYA 3H1NA 2AUVA 3W8SA 1FW1A 2GLRA 1Q98A 4PNFA 1A2LA 3WT1A 4KW6A 2QA1A 4JZQA 3EE2A 2IMEA 1SD9A 2R5GA 1X5EA 2CX4A 3GURA 5ECQB 2H0IA 5JWQB 5AGYA 2DJKA 3APOA 2RUFA 3C1SA 1X5DA 4MNNA 4HJMA 3TB2A 1PA3A 4WF4A 3ERFA 1GNEA 1ZGNA 2EIQA 1TDIA 4Q5QA 4K7OA 2OE1A 1ABAA 4ZL7A 4NAXA 1DE2A 4PQHA 3A2WA 4BVXB 3TJBA 3BOAA 3H93A 3ZLPA 2WULA 2YCDA 1B8XA 1EOGA 22GSA 4F03A 3BBYA 4CDOA 4N0ZA 1R7HA 2VLTA 4F0CA 1AC1A 4MK3A 10GSA 1IYHA 3ME8A 4TXOB 1I9DA 2IMDA 4KCEA 4L0WA 1SL1B 4IJIA 5KN1A 3L9SA 4GQFA 5A5KA 4F9ZA 5LNKe 1F2EA 5ID2B 5CAXA 1GL8A 3O76A 4GRFA 4L0UA 2I81A 1GH2A 1R4WA 5CRHA 1F3BA 5ECRB 5IMZA 5INYA 2VL2C 5IMAA 3HDCA 3UJ1A 2F3MA 3P2AA 2QGVA 3FZ5A 5IMCA 4L5OA 4HQZA 1A0FA 1PL2A 3IK7A 1XPVA 3P8WA 2E0QA 2PPTA 2IN3A 3FKFA 2R6KA 1AQXA 1MDIA 4AF2A 1RW1A 2X8CA 1PKZA 4KDYA 1M0UA 3WGEA 1AXDA 2FCHA 2I1UA 5B8AA 3I6AA 1Y25A 2HFDA 2FWGA 1QGVA 1Q4JA 2CVKA 3UIWA 2X4AA 1SKRB 6GSTA 5DVBA 2BTOT 5D93A 2L4CA 5HFKA 3RPPA 1VRSD 3KH9A 4KH7A 4IHUA 1T00A 5D9TA 1TRSA 2IMKA 4O7HA 4JEDA 1NW2A 3FR6A 2P0GA 1PRXA 4OO4A 1WWJA 5ECMB 5C04A 2HRFA 2I9HA 2WS2A 1FVJA 2OJLA 2O8VB 3IBHA 3TCOA 2VM1A 2DJ2A 3E3EA 1XXUA 3LW9A 1EV4A 1GLPA 4IVFA 1U6TA 3N9JA 4EXJA 1GUKA 3EYTA 5F0GA 2F9SA 1T3BA 1ILOA 1ZMAA 4Z2UA 1K0MA 2OE3A 3LGCA 1JLVA 3F0IA 1E6BA 4ZL9A 3UAPA 2Z9SA 1LJRA 1Z3EA 1AQVA 3M9JA 2OBKA 1GULA 11GSA 5B6MA 5KEJA 1QUWA 3HJOA 2FD3A 4HU7A 3IV4A 1CQHA 3UBKA 5D9WA 1NSWA 2A2SA 3TJJA 18GSA 4QL7A 1GTAA 1AUCA 1TW9A 4K2XA 4XIHA 1NM3A 4NV5A 3UVTA 5DDLA 2TIRA 3HJPA 3QPMA 4IS0A 3I69A 3G9BA 4QL9A 2AJQB 4P3YB 3UMAA 1XWGA 20GSA 4FH8A 2WB9A 14GSA 3HKRA 4GTUA 5CO3A 1K0DA 1G6YA 1ZOFA 3HA9A 1JZDA 5GZZB 1Z7PA 4Q5NA 2IMFA 2GTUA 2GSSA 5COHA 5C00A 3U6VA 1G7OA 1ERWA 1SENA 2V6OA 3KMNA 2MYGA 1M7TA 1BJXA 1K0OA 5CP1A 2DKHA 1GWCA 2JL4A 2CVBA 4K5SA 2MBSA 1ST9A 1ERUA 2IL3A 1OE7A 3Q6OA 1OE8A 1XW6A 4J2FA 2H6ZA 4MZWA 2IWTA 4WEYA 5DAKB 4BWSA 4FYCA 5ECSA 2LNSA 3AY8A 5L71A 3L0HA 5AIVA 2WRTA 3DD3A 3HVSA 2YZUA 2PMTA 5DBQA 4AJ7A 2HLSA 4BVXA 2B6MA 2RIIA 2IFQB 1LU4A 4V2MA 1PSQA 2YOIA 4ZXGA 1GUHA 2MMNA 5B7CA 4MJBA 3GIXA 4NWYA 3ZREA 4XRAA 1JLWA 4I2UA 1T8EB 5F8BA 3IAS2 1F9MA 3QFBC 4KE3A 3VK9A 2F51A 4RI7A 4XS1A 3DRNA 2AYTA 3FMWA 4N30A 4TXOA 2HZEA 4G0KA 1Z7RA 4G0LA 4ZBBA 4ZB9A 4ECCA 2F8FA 5CRGA 3EC3A 1TTZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J3R A;  3HVV A;  1KEB A;  2XHF A;  1K0A A;  3D4M A;  3MSZ A;  3TUE A;  3HY2 A;  2PUK C;  5D73 A;  2FGX A;  1U87 A;  2L5L A;  5G31 A;  1EGR A;  1XOA A;  2H76 A;  2LNT A;  1XCC A;  3WYW A;  2VCQ A;  4XS4 A;  4DSR A;  3ED3 A;  1ZYQ B;  1M9A A;  4G10 A;  4TN8 A;  3KXO A;  5F07 A;  2C0G A;  4KA0 A;  1A2J A;  1SK0 A;  2RLI A;  2CA8 A;  2YV9 A;  1EWX A;  2LKU A;  1O85 A;  1EZK A;  3TKQ A;  3ZZX A;  1XW9 A;  2GZZ A;  2B3S A;  2TRX A;  3LSZ A;  3BCI A;  1UVZ A;  2YNX A;  5ECL B;  1OC9 B;  2DIY A;  4YQV A;  1TOF A;  6GSU A;  1TK5 B;  4KX4 A;  3ERG A;  1N8J A;  2FLS A;  3VWU A;  2NDO A;  2HXK A;  2CAI A;  2E2M A;  1XWA A;  4HJ2 A;  1XWC A;  3IA1 A;  1TRW A;  5H5S A;  2H6X A;  1XOB A;  3F3R A;  3S9F A;  1QFN A;  2B1L A;  3D0Z A;  2VD1 A;  19GS A;  4HU9 A;  3L78 A;  4MF7 A;  1K0B A;  2H72 A;  3LEF A;  3GSS A;  4EO3 A;  3D6I A;  1RQM A;  5G5E A;  1WJK A;  2VLU A;  4E8E A;  1LBK A;  3VI5 A;  1M2D A;  1XWB A;  1Z6N A;  1WRY A;  1V2A A;  3A2X A;  3C7M A;  3EUR A;  1F37 A;  4BPY A;  2IIY A;  1DUG A;  4IQ1 A;  4ML1 A;  2H8L A;  3UAR A;  3M0F A;  1S3D A;  3KTL A;  4EE0 A;  2DLX A;  3UVH A;  1R5A A;  2XPD A;  3TGZ A;  3WGX A;  1ML6 A;  3H8Q A;  4K8M A;  1JZO A;  1JHB A;  1V40 A;  1X0R A;  2L6C A;  2DIZ A;  5J4U A;  5DCG A;  2DMM A;  2NVL A;  2HYX A;  2O89 A;  5G30 A;  4I2T A;  2GS3 A;  1XIY A;  5AN1 A;  3Q18 A;  5EVO A;  4NPB A;  3KP8 A;  2H1G A;  4JR4 A;  4PGT A;  3QD9 A;  1OC3 A;  1M99 A;  3GTU B;  4YAV A;  1VF1 A;  1AAZ A;  3WD6 A;  2EIR A;  2E7P A;  1NHY A;  2VOC A;  2BJX A;  1MTC A;  4PNG A;  4K1F A;  6GSW A;  3MDK A;  2R37 A;  3KIJ A;  2HT9 A;  2RM5 A;  3TJF A;  4MZC A;  2YWM A;  2PWJ A;  3DXB A;  3QFA C;  1GTB A;  2AAW A;  2WZ9 A;  4PUR A;  3CSH A;  2N5B A;  5DAK A;  1A0R P;  1SK1 A;  4F2I A;  3GFK A;  2H0G A;  4G2E A;  2GQL A;  1X9S B;  3LXT A;  1SYR A;  2M72 A;  1B48 A;  3GL5 A;  3ZL5 A;  3D22 A;  3CRT A;  5ENU A;  2YWN A;  3APS A;  1MEK A;  2HZE B;  3GYK A;  5ECK B;  1U88 A;  2YJ7 A;  2FY6 A;  1V57 A;  3KP9 A;  1PMT A;  2IFQ A;  2MMA A;  1OAZ A;  1YZX A;  4MF6 A;  4PX1 A;  1BQ7 A;  2B1K A;  2RUE A;  5ECH B;  2O87 A;  5DAL A;  4GLT A;  2D2Z A;  1MDJ A;  3GV1 A;  3ZVJ D;  1J08 A;  1HQO A;  1SL0 B;  5FT3 A;  1EEJ A;  1GRX A;  4KB3 A;  1FO5 A;  5HQP A;  3HD5 A;  5G2Z A;  4TR3 A;  2H71 A;  2VUP A;  3GRX A;  3CTF A;  2VLV A;  3IAM 2;  4XS4 B;  1YKA A;  2WGR A;  4L5L A;  5FWG A;  3MWH A;  3LYP A;  1TI3 A;  4K0G A;  1ZL9 A;  3QAW A;  16GS A;  3L9V A;  4XCS A;  1H75 A;  4YAP A;  5IO2 A;  4GXZ A;  3LOR A;  3RAZ A;  1EOH A;  3EU3 A;  3MNG A;  3RDW A;  3PGT A;  4WBJ A;  2A2R A;  2YJH A;  4V1A p;  5H5R A;  1F6M C;  4ECJ A;  1SYX A;  2WJU A;  4TR4 A;  2H0H A;  2ES7 A;  3JCM L;  3A5W A;  2ALB A;  3GKX A;  2YV7 A;  1V98 A;  4KSM A;  3M9K A;  4I8B A;  3PR8 A;  2B7K A;  3EMX A;  2EIO A;  5IMD A;  2X8G A;  2YPM A;  1OC9 A;  1T1V A;  1SKS B;  1PGT A;  3DEX A;  4J56 E;  3NOF A;  2H19 A;  3CRU A;  1MD3 A;  4ECI A;  5IIZ A;  1B4P A;  4GSN A;  1GSQ A;  3IXR A;  4D73 B;  1AIU A;  1UA5 A;  4EKZ A;  3KTB A;  2DJ1 A;  4DSQ A;  3US3 A;  1E2Y A;  3F8U A;  1A8Y A;  4TR1 B;  5H5Q A;  1C72 A;  3CXG A;  2B5E A;  4RQR A;  3DIE A;  4MDC A;  1G6W A;  2C4J A;  3ZYW A;  2MMO A;  2V41 A;  2VL2 A;  2GT5 A;  5IO0 A;  2DJ3 A;  3SWL A;  2JZR A;  3NIV A;  4EC0 A;  4I97 A;  2I4A A;  2GVP A;  1WOU A;  5ECN B;  5LD0 A;  1XWK A;  1I5G A;  3LWA A;  2X99 A;  4LMV A;  2VIM A;  1ZYE A;  4KUN A;  2QC7 A;  4XRD A;  3GH9 A;  1QK8 A;  2GQK A;  3MAK A;  2JZT A;  3TRP A;  1X9W B;  2R4V A;  1A24 A;  1XVW A;  2J9H A;  4GF0 A;  3VWX A;  4EVM A;  5DCH A;  1O81 A;  2GQM A;  2WCI A;  2FA4 A;  5GAN D;  3QDN A;  4EF0 A;  3RHB A;  5KN3 A;  1UN2 A;  2KUC A;  2MMZ A;  1OC8 A;  5A4V A;  4WF5 A;  2OKA A;  4MZB A;  3BD2 A;  1GSD A;  3L9U A;  4DEJ A;  3EU4 A;  1VGL A;  4JRR A;  3APQ A;  1T4Z A;  2YP6 A;  3F6F A;  2ON7 A;  2CQ9 A;  1KNG A;  2XBI A;  5IMF A;  1FG4 A;  3F4R A;  2LTK A;  3ZFB A;  1TKD B;  2J23 A;  4Z7X A;  3J7Y b;  3GTU A;  1IYI A;  1HYU A;  4WKW A;  3KMO A;  4JE1 A;  2ZCT A;  1PN9 A;  1EGO A;  4WBR D;  4IN0 A;  4PQI A;  2IPA A;  2K6V A;  2XC2 A;  1YJ6 A;  2C0E A;  5D9V A;  4LL4 B;  3IR4 A;  1K3Y A;  2L59 A;  3VI7 A;  2XPE A;  5EY6 A;  1K3O A;  1TRV A;  1PD2 1;  2G0F A;  5DAL B;  3GN3 A;  4JBB A;  5EPF A;  2KP2 A;  3M1G A;  4EDY A;  5LCZ A;  2K9F A;  3HVX A;  5J5N A;  1J0F A;  4NHW A;  1X9M B;  5CRD A;  1M9B A;  1GSE A;  3GH6 A;  3QCP A;  3C71 A;  3FY7 A;  2HE3 A;  3CSI A;  2O85 A;  3C1R A;  2HI7 A;  4IW9 A;  2CZ2 A;  3GKK A;  3QOU A;  4GST A;  2L4Q A;  4EDZ A;  2CX3 A;  4AGS A;  1K0C A;  2KP1 A;  2VAF A;  4ZB8 A;  1AQW A;  2KOK A;  4OMV A;  4ZB6 A;  4O92 A;  1YF1 A;  3TKS C;  5AIS A;  5A4W A;  5EL8 A;  3DWV A;  3CSJ A;  4RI6 A;  4IP1 A;  4FIW A;  3O3T A;  4HZ2 A;  2VL3 A;  2VL9 A;  2NBS A;  3FK8 A;  4HS1 A;  5E4W A;  1USB A;  3VLN A;  1AW9 A;  4KDU A;  5HFG A;  1VF2 A;  3TKP A;  3H4K A;  4MH2 A;  3ZFL A;  3CMI A;  4K7N A;  1DBY A;  17GS A;  5CNW A;  3Q74 A;  2B7J A;  4POL A;  2GDR A;  5AIX A;  4TOP A;  2B5Y A;  1WPI A;  1TJD A;  3UEM A;  1F3A A;  1NHO A;  4Q5F A;  5IMV A;  3GST A;  4OCF A;  2HSY A;  5IPH A;  1TU8 A;  3HXS A;  1OYJ A;  3ZMK A;  3R2Q A;  1U3A A;  1BG5 A;  5J9B A;  2H74 A;  1JZR A;  3F4T A;  2V2G A;  1G7E A;  3GX0 A;  2P5R A;  2LQQ A;  2E2G A;  3VFI A;  3F4S A;  3PIN A;  3KGK A;  4K6X A;  3UL3 A;  3P7X A;  1W4V A;  4AJ8 A;  3G7I A;  1B4Q A;  4ZBD A;  2LS5 A;  1ERT A;  4E8H A;  3DVW A;  2C3T A;  3KM6 A;  4MP4 A;  1FB0 A;  3F6D A;  4O32 A;  4D73 A;  1YQ1 A;  2GZY A;  4DSS B;  2C80 A;  1QQ2 A;  3DGQ A;  4JU5 A;  2P31 A;  2FWF A;  3EMP A;  3LYK A;  1O6J A;  4TR1 A;  4ZIL A;  1YDK A;  3UBL A;  1ACV A;  1WIK A;  2H1D A;  5HR3 A;  5JCG A;  2LJA A;  3FW2 A;  4ZBA A;  5KN0 A;  3TKS E;  3F63 A;  3GA4 A;  3HCZ A;  2L57 A;  1GSU A;  2LRC A;  2M46 A;  1PX6 A;  5HR0 A;  5G5F A;  5B6N A;  2L5O A;  3GHA A;  1JZW A;  2PBJ A;  4V1A g;  4O5R A;  1PKW A;  4MMM A;  2HZF A;  3QAG A;  4WR5 A;  12GS A;  4L8E A;  4N10 A;  5G1L A;  1FVK A;  2FWE A;  4POB A;  1SU9 A;  1J9B A;  5ECI B;  1X5C A;  3J7Y k;  3ME7 A;  1GTU A;  4OFM A;  3HHV A;  4JR6 A;  4FYU A;  4OFT A;  1WE0 A;  2CT6 A;  1T7P B;  3TOT A;  2ZUP A;  2H6Y A;  2LRN A;  2C8U A;  2LRT A;  5A4U A;  4V2L A;  2RM6 A;  3E9J B;  5IM9 A;  4XTS A;  4N11 A;  3RHC A;  2JAC A;  4EUY A;  2LV3 A;  2YWO A;  2DJ0 A;  5HFI A;  6GSS A;  5FHI A;  1OVN A;  2K8S A;  5DJM A;  3FR3 A;  2HRN A;  2KLX A;  2IJY A;  4ML6 A;  2K18 A;  5E59 A;  4K0N A;  4ILF A;  1THX A;  2YWI A;  4KGI A;  3TJG A;  1URM A;  3FZ4 A;  1GSY A;  1GSF A;  2YAN A;  4ZL8 A;  3FRC A;  1EP7 A;  1A23 A;  3D21 A;  2YZH A;  1M2B A;  2R3X A;  4RUV A;  5CYY A;  4KSO A;  7GSS A;  3GNJ A;  2MZC A;  3QAV A;  4BA7 A;  1GUM A;  3A3T A;  4DVC A;  4F82 A;  2FHE A;  2CVD A;  3GL3 A;  2O7K A;  5GST A;  1BX9 A;  1O73 A;  4ZIJ A;  4IP6 A;  4X1U A;  2JZS A;  3G7J A;  4KDX A;  1O7U A;  1XVQ A;  5D8I A;  4X0X A;  4NXI A;  2YN1 A;  2BMX A;  3ZTL A;  3P90 A;  1TU7 A;  2CAQ A;  4YH2 A;  4GQC A;  5ECP B;  3CTG A;  1A8L A;  5J9C A;  3TRQ A;  4XHM A;  1SJZ A;  4HDE A;  2H30 A;  4K9Z A;  2DML A;  3VUR A;  3QMX A;  3I9V 2;  2C3N A;  3TKR A;  5ECO B;  1XZO A;  1KTE A;  3IK9 A;  3I43 A;  3DKS A;  3PH9 A;  4ID0 A;  4MH3 A;  4TXV A;  3U5R E;  4PUF C;  3N5O A;  1GTI A;  2HSH A;  1R26 A;  3NZN A;  1FOV A;  2N5A A;  5GAP D;  1GNW A;  2OA7 A;  3M8N A;  2AV4 A;  4TVE A;  4MPF A;  5HR1 A;  3M3M A;  4XS6 A;  5D96 A;  1GLQ A;  3HYP A;  4CHS A;  3DYR A;  2NPB A;  1TI1 A;  1UC7 A;  3GUS A;  3ZRD A;  2AHE A;  6GSY A;  1OKT A;  5JCU A;  1A2M A;  2LJK A;  3SBC A;  4WET A;  2IYJ A;  1SL2 B;  3BCK A;  6GSX A;  4OO5 A;  2A4V A;  1B9Y C;  2V6K A;  2GSR A;  2DSA A;  2OBI A;  5ABR A;  4ACS A;  4IQA A;  1YEX A;  4LA1 A;  4G19 A;  1ZZY A;  3FZA A;  1HNB A;  2LUS A;  1R5P A;  2GT6 A;  1ERV A;  5GSS A;  3HJM A;  1TRU A;  3GX8 A;  5F06 A;  2V32 A;  2G2Q A;  2VCZ A;  3EIN A;  5DQY A;  1Y6E A;  1Z9H A;  4IEL A;  2KHP A;  4BVY A;  1K3L A;  2OAC A;  3KJY A;  2VM2 A;  4ECB A;  1KBN A;  1JFU A;  2C0D A;  1V9W A;  1SK2 A;  1QXH A;  4OD7 A;  4DSS A;  4KCA A;  1K0N A;  3E0U A;  2X8H A;  4HUA A;  2GZP A;  5G1K A;  2V1M A;  1DE1 A;  3RPN A;  2LEG A;  1YY7 A;  5CRE A;  4MA9 A;  2OE0 A;  2REM A;  1BAY A;  3DML A;  3VPT A;  2HNL A;  4CW9 A;  5JWO B;  1MDK A;  2H1A A;  2PU9 C;  3O6T A;  2CZ3 A;  1H4O A;  2N5F A;  3WGD A;  4GWR A;  4TW5 A;  4MPG A;  4MLY A;  3KEB A;  4TKY A;  1DSB A;  2I3Y A;  2GGT A;  3ERW A;  2QSI A;  2VCT A;  4EL1 A;  1THO A;  2P5Q A;  3ZIJ A;  3ZIT A;  1FB6 A;  3L4N A;  4J57 E;  1EEM A;  3FEU A;  1WMJ A;  1U3I A;  3ZML A;  2FA8 A;  3CYN A;  2K8V A;  1OKD A;  3KZQ A;  4I6X A;  1RK4 A;  2PVQ A;  3KCM A;  2NTO A;  2ZNM A;  4HQS A;  1FHE A;  1GSS A;  2VCV A;  3DVX A;  4G9H A;  4AJ6 A;  5ELA A;  1YF0 A;  4HEA 2;  3HZ4 A;  2C3Q A;  4IKH A;  3UOM A;  2IMI A;  1HD2 A;  4HZ4 A;  1TK0 B;  2H70 A;  3LXZ A;  4PQ1 A;  1MD4 A;  1S3C A;  2GST A;  1HNA A;  5JWR B;  3LFL A;  1PX7 A;  2F8A A;  4KAE A;  3LG6 A;  3IRA A;  1S3A A;  4BL7 A;  4Q5R A;  4I5Q A;  4POM A;  2TRC P;  1SJ6 A;  1PL1 A;  3EVI A;  2JAD A;  3LQ7 A;  2PVO C;  3F9U A;  3ZIV A;  4MAB A;  4H86 A;  1M2A A;  2VCX A;  8GSS A;  1B9X C;  3FZ9 A;  5JCW A;  1O8X A;  4NMU A;  3A2V A;  4OCE A;  3EWL A;  9GSS A;  3W6G A;  1QMV A;  3FHK A;  3D4T A;  1XW5 A;  4TR0 A;  1WP0 A;  1N2A A;  2X64 A;  1T4Y A;  3WT2 A;  3TOU A;  2DJJ A;  3RBT A;  3GKN A;  2OAD A;  1PQN A;  1TXX A;  3G7Y A;  5DQS A;  2C0F A;  3ZVJ A;  4PUA A;  4KND A;  5ID2 A;  4F0B A;  4RQX A;  1W89 A;  2H1B A;  3D5J A;  3IC4 A;  3K8N A;  5ELG A;  4NHZ A;  3VWW A;  4FYB A;  3IE3 A;  2H66 A;  2GSQ A;  1EV9 A;  4NV2 A;  4K2D A;  4MJE A;  2VO4 A;  3IHQ A;  6GSV A;  4OFN A;  2QKE A;  4MF5 A;  2JU5 A;  5KN2 A;  3KH7 A;  4V2N A;  1SD8 A;  1YKC A;  2LJR A;  3VWV A;  1BYE A;  3KD0 A;  2LQO A;  3FR9 A;  5CRW A;  2PER A;  2FWH A;  2H75 A;  4WR4 A;  2DBC A;  1BED A;  2C1Y A;  4IGJ A;  3W8J A;  2VD0 A;  4LLR A;  4HOJ A;  3BJ5 A;  5DJL A;  13GS A;  4LL1 B;  2ON5 A;  4TRX A;  5IQY A;  2XBQ A;  2B5X A;  3HZ8 A;  2AB6 A;  4GSS A;  2CV4 A;  4YQM A;  2H73 A;  4IJ3 A;  3TDG A;  4ISD A;  5IPG A;  1G0T A;  4WXT A;  3IDV A;  1SKW B;  2M80 A;  3C73 A;  2PN8 A;  4YQU A;  3OR5 A;  5B8B A;  4QQ7 A;  4OWY A;  1EP8 A;  3QR6 A;  4ULX A;  2R2J A;  2EC4 A;  4HI7 A;  4X43 A;  3F3Q A;  2JSZ A;  3FYG A;  4POK A;  3VPQ A;  2DC5 A;  1VF4 A;  2FNO A;  1VF3 A;  2WDU A;  3Q19 A;  2FUG 2;  4GCI A;  3TKS A;  1SJI A;  3GKM A;  1ZCP A;  2L6D A;  1FAA A;  2PGT A;  3C8E A;  1Z6M A;  4N0V A;  3ISO A;  1HNC A;  5IOW A;  2IY2 A;  5F05 A;  4IBP A;  1TP9 A;  2LST A;  2VCW A;  3H79 A;  3IOS A;  5HR2 A;  2MBT A;  1TK8 B;  1XBS A;  5J41 A;  3IPZ A;  4MJA A;  3TJK A;  3GMF A;  4MCU A;  4K7I A;  3LJR A;  2H01 A;  1GP1 A;  5IOX A;  1ON4 A;  1YEP A;  1XFL A;  4PXO A;  4FO5 A;  1O8W A;  3CBU A;  1V58 A;  4MJC A;  4LMW A;  2WFC A;  5D9X A;  3TRX A;  1CQG A;  3V1W A;  4BWQ A;  1Z5Y E;  2JSY A;  3H1N A;  2AUV A;  3W8S A;  1FW1 A;  2GLR A;  1Q98 A;  4PNF A;  1A2L A;  3WT1 A;  4KW6 A;  4JZQ A;  3EE2 A;  2IME A;  1SD9 A;  2R5G A;  1X5E A;  2CX4 A;  3GUR A;  5ECQ B;  2H0I A;  5JWQ B;  5AGY A;  2DJK A;  3APO A;  2RUF A;  3C1S A;  1X5D A;  4HJM A;  3TB2 A;  1PA3 A;  4WF4 A;  3ERF A;  1GNE A;  1ZGN A;  2EIQ A;  1TDI A;  4Q5Q A;  4K7O A;  2OE1 A;  1ABA A;  4ZL7 A;  4NAX A;  1DE2 A;  4PQH A;  3A2W A;  3TJB A;  3BOA A;  3H93 A;  3ZLP A;  2WUL A;  2YCD A;  1B8X A;  1EOG A;  22GS A;  4F03 A;  3BBY A;  4CDO A;  4N0Z A;  1R7H A;  2VLT A;  4F0C A;  1AC1 A;  4MK3 A;  10GS A;  1IYH A;  3ME8 A;  4TXO B;  1I9D A;  2IMD A;  4KCE A;  4L0W A;  1SL1 B;  4IJI A;  5KN1 A;  3L9S A;  4GQF A;  5A5K A;  4F9Z A;  5LNK e;  1F2E A;  5ID2 B;  5CAX A;  1GL8 A;  3O76 A;  4GRF A;  4L0U A;  2I81 A;  1GH2 A;  1R4W A;  5CRH A;  1F3B A;  5ECR B;  5IMZ A;  5INY A;  2VL2 C;  5IMA A;  3HDC A;  3UJ1 A;  2F3M A;  3P2A A;  2QGV A;  3FZ5 A;  5IMC A;  4L5O A;  4HQZ A;  1A0F A;  1PL2 A;  3IK7 A;  1XPV A;  3P8W A;  2E0Q A;  2PPT A;  2IN3 A;  3FKF A;  2R6K A;  1AQX A;  1MDI A;  4AF2 A;  1RW1 A;  2X8C A;  1PKZ A;  4KDY A;  1M0U A;  3WGE A;  1AXD A;  2FCH A;  2I1U A;  5B8A A;  3I6A A;  1Y25 A;  2HFD A;  2FWG A;  1QGV A;  1Q4J A;  2CVK A;  3UIW A;  1SKR B;  6GST A;  5DVB A;  2BTO T;  5D93 A;  2L4C A;  5HFK A;  3RPP A;  1VRS D;  3KH9 A;  4KH7 A;  4IHU A;  1T00 A;  5D9T A;  1TRS A;  2IMK A;  4O7H A;  4JED A;  1NW2 A;  3FR6 A;  2P0G A;  1PRX A;  4OO4 A;  1WWJ A;  5ECM B;  5C04 A;  2HRF A;  2I9H A;  2WS2 A;  1FVJ A;  2OJL A;  2O8V B;  3IBH A;  3TCO A;  2VM1 A;  2DJ2 A;  3E3E A;  1XXU A;  1EV4 A;  1GLP A;  4IVF A;  1U6T A;  3N9J A;  4EXJ A;  1GUK A;  3EYT A;  5F0G A;  2F9S A;  1T3B A;  1ILO A;  1ZMA A;  1K0M A;  2OE3 A;  3LGC A;  1JLV A;  3F0I A;  1E6B A;  4ZL9 A;  3UAP A;  2Z9S A;  1LJR A;  1Z3E A;  1AQV A;  3M9J A;  2OBK A;  1GUL A;  11GS A;  5B6M A;  5KEJ A;  1QUW A;  3HJO A;  2FD3 A;  4HU7 A;  3IV4 A;  1CQH A;  3UBK A;  5D9W A;  1NSW A;  2A2S A;  3TJJ A;  18GS A;  4QL7 A;  1GTA A;  1AUC A;  1TW9 A;  4XIH A;  1NM3 A;  4NV5 A;  3UVT A;  5DDL A;  2TIR A;  3HJP A;  3QPM A;  4IS0 A;  3I69 A;  3G9B A;  4QL9 A;  2AJQ B;  4P3Y B;  3UMA A;  1XWG A;  20GS A;  4FH8 A;  2WB9 A;  14GS A;  3HKR A;  4GTU A;  5CO3 A;  1K0D A;  1G6Y A;  1ZOF A;  3HA9 A;  1JZD A;  5GZZ B;  1Z7P A;  4Q5N A;  2IMF A;  2GTU A;  2GSS A;  5COH A;  5C00 A;  3U6V A;  1G7O A;  1ERW A;  1SEN A;  2V6O A;  3KMN A;  2MYG A;  1M7T A;  1BJX A;  1K0O A;  5CP1 A;  1GWC A;  2JL4 A;  2CVB A;  2MBS A;  1ST9 A;  1ERU A;  2IL3 A;  1OE7 A;  3Q6O A;  1OE8 A;  1XW6 A;  4J2F A;  2H6Z A;  4MZW A;  2IWT A;  4WEY A;  5DAK B;  4BWS A;  4FYC A;  5ECS A;  2LNS A;  3AY8 A;  5L71 A;  3L0H A;  5AIV A;  2WRT A;  3DD3 A;  3HVS A;  2YZU A;  2PMT A;  5DBQ A;  4AJ7 A;  2HLS A;  4BVX A;  2B6M A;  2RII A;  2IFQ B;  1LU4 A;  4V2M A;  1PSQ A;  2YOI A;  4ZXG A;  1GUH A;  2MMN A;  5B7C A;  4MJB A;  3GIX A;  4NWY A;  3ZRE A;  4XRA A;  1JLW A;  4I2U A;  1T8E B;  5F8B A;  3IAS 2;  1F9M A;  3QFB C;  4KE3 A;  3VK9 A;  2F51 A;  3DRN A;  4XS1 A;  4RI7 A;  2AYT A;  4N30 A;  4TXO A;  2HZE A;  1Z7R A;  4ZBB A;  4ZB9 A;  4ECC A;  2F8F A;  5CRG A;  3EC3 A;  1TTZ A; 
#chains in the Genus database with same CATH topology
 5J3R A;  3HVV A;  1KEB A;  2XHF A;  1MGW A;  1K0A A;  3D4M A;  2CWU A;  3MSZ A;  3TUE A;  3HY2 A;  2PUK C;  5D73 A;  2FGX A;  1U87 A;  2L5L A;  5G31 A;  2IMJ A;  1EGR A;  1XOA A;  2H76 A;  2Y74 A;  2LNT A;  4IPB A;  5JPU A;  1XCC A;  3WYW A;  2VCQ A;  2ZHX B;  4XS4 A;  4DSR A;  2HML B;  3CCU 3;  3ED3 A;  1STD A;  1TU5 A;  1ZYQ B;  1M9A A;  4G10 A;  4TN8 A;  3KXO A;  5F07 A;  2C0G A;  4KA0 A;  4HM8 B;  1UGI A;  5FGO A;  1A2J A;  1SK0 A;  3K63 A;  3JUN A;  1YIT 3;  2RLI A;  2B24 B;  1FA3 A;  2CA8 A;  2YV9 A;  2CFW A;  2Z77 A;  1O7M B;  1EWX A;  2UZ8 A;  1D6Y A;  2LKU A;  1O85 A;  1SIH A;  1EZK A;  3TKQ A;  3ZZX A;  4HVN A;  1XW9 A;  2GZZ A;  2B3S A;  2TRX A;  5BRT A;  3LSZ A;  2W2C A;  3BCI A;  1MWT A;  3OWS A;  1UVZ A;  2YNX A;  1CH0 A;  5ECL B;  1OC9 B;  5EQL A;  2DIY A;  4YQV A;  2UUG C;  1Q82 4;  1TOF A;  6GSU A;  1QAL A;  2OOV A;  1TK5 B;  4KX4 A;  1Q81 4;  3ERG A;  1N8J A;  2FLS A;  3VWU A;  1BSD A;  3PPU A;  2NDO A;  2HXK A;  3KCH A;  2CAI A;  2E2M A;  1XWA A;  4HJ2 A;  4R9K A;  2GBW B;  2R4I A;  1JN5 B;  1XWC A;  1BNS A;  3IA1 A;  1TRW A;  5H5S A;  2H6X A;  1XOB A;  2W6J H;  3F3R A;  3S9F A;  1QFN A;  2B1L A;  3D0Z A;  2BNG A;  4OUQ A;  2VD1 A;  2XF3 A;  8RNT A;  19GS A;  5CF1 A;  4HU9 A;  3L78 A;  4MF7 A;  1RGA A;  1K0B A;  2H72 A;  5BVB A;  3LEF A;  3BNB A;  1RKY A;  3GSS A;  1VQQ A;  3EC9 A;  4OK0 A;  4EO3 A;  3D6I A;  1LRA A;  1RQM A;  3MYD A;  1BRK A;  3STD A;  5G5E A;  1D6U A;  1WJK A;  3S29 A;  2VLU A;  4E8E A;  1EKM A;  1LBK A;  3VI5 A;  1M2D A;  1XWB A;  1Z6N A;  2UGI A;  1WRY A;  1V2A A;  3A2X A;  3A76 A;  2K54 A;  3C7M A;  3EUR A;  3HX8 A;  1F37 A;  4BPY A;  2IIY A;  1DUG A;  3JVC A;  2CG1 A;  4IQ1 A;  3BNC A;  1E97 A;  3GRD A;  1RGL A;  2F56 A;  4ML1 A;  2H8L A;  3UAR A;  3M0F A;  1S3D A;  3KTL A;  4EE0 A;  2DLX A;  3UNL A;  3UVH A;  3VSY A;  1R5A A;  2XPD A;  3TGZ A;  3WGX A;  1ML6 A;  3CXC 2;  3H8Q A;  4K8M A;  1JZO A;  1JHB A;  1V40 A;  1X0R A;  3FZW A;  2L6C A;  3B4O A;  3PZW A;  2DIZ A;  1YGW A;  1RN4 A;  1VQM 3;  4Z2R A;  5J4U A;  2CKF B;  5DCG A;  1RCL A;  2W0Q A;  4J8T A;  4I4K A;  2DMM A;  2QA2 A;  3KN4 A;  2NVL A;  4KZ1 A;  2HYX A;  2KF4 A;  3PS8 A;  2O89 A;  1F8N A;  5G30 A;  4I2T A;  2GS3 A;  3DY5 A;  3OX9 A;  1XIY A;  5AN1 A;  3Q18 A;  5EVO A;  4H61 A;  4NPB A;  3KP8 A;  1W5Z A;  2H1G A;  4JR4 A;  1X1X A;  4PGT A;  3QD9 A;  1OC3 A;  1M99 A;  3GTU B;  1Q42 A;  1FGQ A;  2CX1 A;  4YAV A;  1VF1 A;  1AAZ A;  3WD6 A;  2EIR A;  2E7P A;  4LZI A;  1NHY A;  2VOC A;  4HSC X;  2BJX A;  1MTC A;  4K90 B;  4PNG A;  2D42 A;  5DRV A;  4K1F A;  6GSW A;  5M1A A;  3MDK A;  2R37 A;  3KIJ A;  4JF8 A;  2HT9 A;  3X41 A;  1LNI A;  2RM5 A;  3TJF A;  4MZC A;  4LMI A;  3ZG5 A;  2YWM A;  2PWJ A;  3AMO B;  3CCV 3;  3DXB A;  3QFA C;  1GTB A;  4KFF A;  2AAW A;  2WZ9 A;  3LT8 A;  4PUR A;  3CSH A;  2N5B A;  2O3O A;  5DAK A;  1A0R P;  1AR0 A;  1SK1 A;  4F2I A;  5CF2 A;  3GFK A;  2H0G A;  4G2E A;  2GQL A;  1X9S B;  1WQL B;  5GSP A;  3LXT A;  2CFK A;  1SYR A;  2M72 A;  1GY7 A;  1B48 A;  2HRA A;  3GL5 A;  3ZL5 A;  3D22 A;  3CRT A;  5ENU A;  1RGE A;  1UDI I;  5TGN A;  1GOV A;  2YWN A;  3APS A;  1MEK A;  3CC2 3;  4RNT A;  2HZE B;  3GYK A;  5ECK B;  1U88 A;  3EPT A;  3LXU X;  2YJ7 A;  2WOF A;  2FY6 A;  3HZP A;  1LVN A;  1V57 A;  3KP9 A;  1PMT A;  2IFQ A;  2MMA A;  1OAZ A;  1YZX A;  1Q7H A;  1OPY A;  1IYY A;  4MF6 A;  4PX1 A;  1C54 A;  1BQ7 A;  2B1K A;  2RUE A;  5ECH B;  4KT3 B;  2O87 A;  5DAL A;  1ZS7 A;  1YGE A;  1OGX A;  1A67 A;  4GLT A;  2D2Z A;  1MDJ A;  3GV1 A;  3ZVJ D;  1J08 A;  1HQO A;  3FKA A;  2Z7A A;  1SL0 B;  5FT3 A;  4PTS A;  1EEJ A;  3MYT A;  1GRX A;  4EYC A;  4KB3 A;  1FO5 A;  5HQP A;  1BAN A;  3HD5 A;  5G2Z A;  4TR3 A;  2H71 A;  2VUP A;  1WTH A;  3GRX A;  3CTF A;  2VLV A;  3IAM 2;  4XS4 B;  3KFQ C;  1YKA A;  2WGR A;  4L5L A;  3E99 A;  5FWG A;  3MWH A;  1I8V A;  1YJN 3;  3LYP A;  1TI3 A;  4K0G A;  1HZ1 A;  1WMN A;  1ZL9 A;  2IUK A;  3F9S A;  1MWR A;  2UX0 A;  3QAW A;  16GS A;  3UJM A;  3WDG B;  2CFL A;  3L9V A;  3G8Z A;  4XCS A;  1PY3 A;  4HM1 B;  1ROA A;  1H75 A;  4YAP A;  1RN7 A;  3V99 A;  5IO2 A;  4GXZ A;  3LOR A;  3RAZ A;  1EOH A;  3EU3 A;  3MNG A;  3RDW A;  3PGT A;  4WBJ A;  3WOF B;  2A2R A;  2YJH A;  4K1U A;  4V1A p;  2J8X B;  2FGT A;  5H5R A;  1F6M C;  4FR9 A;  4ECJ A;  1SYX A;  4LEH A;  2WJU A;  2HMN B;  6GSP A;  4TR4 A;  2H0H A;  2ES7 A;  4OVM A;  3ALA A;  3JCM L;  2AAE A;  3MG2 A;  3A5W A;  2ALB A;  1VQL 3;  2BO9 B;  3GKX A;  1W7C A;  2YV7 A;  1V98 A;  4KSM A;  3M9K A;  4I8B A;  3PR8 A;  1BNG A;  3SVA A;  2B7K A;  3EMX A;  2EIO A;  5IMD A;  1MWS A;  2X8G A;  4WYK A;  2YPM A;  1OC9 A;  1T1V A;  1SKS B;  1PGT A;  3DEX A;  1UCJ A;  1FGR A;  1RTU A;  3EN8 A;  1OH0 A;  2K3D A;  4J56 E;  4ORL A;  1NDO B;  2H19 A;  3NOF A;  3CRU A;  1IQY A;  1MD3 A;  4ECI A;  1JN5 A;  5IIZ A;  1B4P A;  4GSN A;  1GSQ A;  2LQV A;  3IXR A;  4D73 B;  1AIU A;  1IK3 A;  3LOY A;  3WOD G;  1E3R A;  1UA5 A;  4EKZ A;  3KTB A;  2DJ1 A;  4L8P A;  2WGO A;  1FZU A;  4DSQ A;  1K41 A;  3US3 A;  1Q40 B;  1E2Y A;  3F8U A;  1A8Y A;  4QWT A;  4BL2 A;  2GSP A;  2OQE C;  4TR1 B;  1YJW 3;  5H5Q A;  1C72 A;  3CXG A;  4HZ9 B;  2B5E A;  2A2P A;  4LGQ A;  1SPU A;  4RQR A;  1ULJ B;  3DIE A;  2C4B A;  3KKG A;  1G6W A;  4MDC A;  2C4J A;  3ZYW A;  2MMO A;  2V41 A;  2VL2 A;  2ZDJ A;  2RSX A;  1JBS A;  2GT5 A;  2W9P A;  1E3V A;  5IO0 A;  3Q2P A;  4HBR A;  2DJ3 A;  3BIR A;  1BUJ A;  3SWL A;  2JZR A;  3NIV A;  4EC0 A;  4I97 A;  3HVN A;  2I4A A;  2GVP A;  1WOU A;  2XEP A;  5ECN B;  1G96 A;  3LH4 A;  5LD0 A;  1XWK A;  1I5G A;  3LWA A;  2X99 A;  4LMV A;  2VIM A;  1ZYE A;  4KUN A;  2QC7 A;  2LYX A;  1GYB A;  4XRD A;  3GH9 A;  1BSC A;  5HOH A;  1QK8 A;  2GQK A;  3MAK A;  2JZT A;  3TRP A;  3WA3 A;  1X9W B;  5AIG A;  1A2V A;  3GSP A;  2R4V A;  1A24 A;  3D79 A;  1XVW A;  1K73 4;  2J9H A;  4XBT A;  4GF0 A;  5AII A;  3VWX A;  1RMS A;  4EVM A;  4U13 A;  5DCH A;  1HU9 A;  1O81 A;  4K5R A;  2GQM A;  4XDV A;  2WCI A;  3DMC A;  1W2B 2;  2FA4 A;  5GAN D;  2HMK B;  3QDN A;  4LYL B;  1K9M 4;  4EF0 A;  3RHB A;  5KN3 A;  4IT7 A;  1UN2 A;  3D3L A;  2KUC A;  2MMZ A;  2HMO B;  1OC8 A;  5A4V A;  4WF5 A;  2OKA A;  4MZB A;  3BD2 A;  1GSD A;  4IIA A;  3L9U A;  2RBI A;  4DEJ A;  3EU4 A;  4HYZ A;  1VGL A;  4JRR A;  3NXJ A;  2XGL A;  3APQ A;  3K5T A;  1T4Z A;  2R0C A;  2YP6 A;  3F6F A;  2ON7 A;  1MWU A;  2CQ9 A;  3LML A;  1KNG A;  2XBI A;  5IMF A;  3DGY A;  1K28 A;  2YFL B;  1BRS A;  1FG4 A;  3F4R A;  3EE1 A;  3NBB A;  3MWZ A;  1L5G B;  5IG3 A;  2LTK A;  1B2M A;  3ZFB A;  1BNE A;  2BMQ B;  1TKD B;  1IQ8 A;  2PNC A;  2J23 A;  4H3U A;  4Z7X A;  3J7Y b;  3GTU A;  1IT8 A;  1CYV A;  1IYI A;  1STF I;  1HYU A;  4L8O A;  4WKW A;  3KMO A;  4K61 A;  4JE1 A;  2ZCT A;  1J2B A;  1PN9 A;  1EGO A;  1I0X A;  4WBR D;  4IN0 A;  3RNT A;  3KSP A;  1BAO A;  4PQI A;  2IPA A;  3U1W A;  1DMN A;  2K6V A;  2XC2 A;  4HM7 B;  4BTW A;  1YJ6 A;  2C0E A;  5D9V A;  4LL4 B;  1FOH A;  3IR4 A;  1M9G A;  3AMO A;  1K3Y A;  1W00 A;  2QIY A;  2L59 A;  3VI7 A;  2XPE A;  5EY6 A;  1K3O A;  3CME 3;  3FF0 A;  3I56 3;  1TRV A;  1PD2 1;  1YI2 3;  4G1M B;  3Q1C A;  5BMU A;  2G0F A;  5DAL B;  2R0G A;  3GN3 A;  1BRG A;  4JBB A;  5EPF A;  3A5I A;  1Q86 4;  2KP2 A;  3M1G A;  4EDY A;  5LCZ A;  1FUS A;  1O7P B;  2K9F A;  3HVX A;  5J5N A;  1J0F A;  4NHW A;  3CCL 3;  1QVF 2;  1X9M B;  1JB2 A;  5CRD A;  1M9B A;  1GSE A;  3GH6 A;  3QCP A;  3C71 A;  3FY7 A;  2HE3 A;  3CSI A;  2O85 A;  3C1R A;  2HI7 A;  4IW9 A;  2CZ2 A;  2FNQ A;  3GKK A;  3QOU A;  3M8C A;  5CK6 A;  4GST A;  2L4Q A;  4EDZ A;  3H3H A;  2CX3 A;  3K9M C;  1RN1 A;  1K0C A;  4AGS A;  1NB5 I;  2KP1 A;  3G4S 3;  2WOH A;  2VAF A;  1EQK A;  3RDE A;  2FXT A;  4X2O A;  4ZB8 A;  1AQW A;  2KOK A;  3ECF A;  1QJG A;  4OMV A;  4ZB6 A;  4O92 A;  2E2V A;  1YF1 A;  3TKS C;  1AV4 A;  5AIS A;  3N9H A;  5A4W A;  3WOE B;  5EL8 A;  3DWV A;  3NUV A;  4X4J A;  3NV0 B;  1VQ9 3;  4LSO A;  3CSJ A;  4RI6 A;  4IP1 A;  4FIW A;  3O3T A;  4HZ2 A;  4WHA A;  2VL3 A;  2VL9 A;  1WMP A;  3CCR 3;  2NBS A;  3FK8 A;  4HS1 A;  2P0X A;  5E4W A;  1USB A;  1S5A A;  3VLN A;  3BU4 A;  1AW9 A;  4KDU A;  5HFG A;  3CQF A;  1VF2 A;  4N6M A;  1CYU A;  3TKP A;  1B3S A;  3H4K A;  1OHO A;  4NHF A;  4MH2 A;  1JNQ A;  3ZFL A;  4CDL A;  2OTL 3;  3CMI A;  2XH9 A;  1OHS A;  1VQP 3;  1DMM A;  4K7N A;  1DBY A;  17GS A;  3T8N A;  5CNW A;  3Q74 A;  2B7J A;  1ZYN A;  4POL A;  2P38 A;  2GDR A;  4TOP A;  3GWR A;  5AIX A;  1NU3 A;  2B5Y A;  1WPI A;  4WYK B;  5IEP A;  1TJD A;  3UEM A;  3MIX A;  1F3A A;  3BB9 A;  1NHO A;  4Q5F A;  5IMV A;  3GST A;  4OCF A;  3CPW 2;  2HSY A;  1BNI A;  5IPH A;  1I3F A;  1UCI A;  1TU8 A;  3HXS A;  1OYJ A;  2OWP A;  4YKG A;  3CCE 3;  1RDS A;  3ZMK A;  3R2Q A;  5KOX A;  6RNT A;  2IA7 A;  1JKG A;  1MGR A;  5LC6 A;  1U3A A;  1BG5 A;  4O5U A;  2H74 A;  5J9B A;  1ISK A;  1JZR A;  3F4T A;  2V2G A;  1G7E A;  1RHL A;  4DKI A;  3GX0 A;  2P5R A;  3CMA 3;  2QA4 3;  2LQQ A;  2E2G A;  2HRK A;  3VFI A;  3F4S A;  1VQ8 3;  3KGK A;  3PIN A;  4K6X A;  3P7X A;  3UL3 A;  4GSP A;  1W4V A;  4AJ8 A;  3B4P A;  3BNE A;  3OW2 2;  5STD A;  3G7I A;  1B4Q A;  4ZBD A;  3UL6 A;  2LS5 A;  2STD A;  1ERT A;  1VQ7 3;  4BIK A;  4E8H A;  5IEO A;  3DVW A;  1GOU A;  2C3T A;  3KM6 A;  1LOY A;  4MP4 A;  1FGM A;  3S28 A;  2KXG A;  1FB0 A;  4AKZ A;  3F6D A;  4O32 A;  4D73 A;  4O5Q A;  3IPT A;  1YQ1 A;  2GZY A;  4DSS B;  1QAF A;  2C80 A;  2L4V A;  5AYR B;  1QQ2 A;  3DGQ A;  4JU5 A;  1Q40 A;  2P31 A;  2FWF A;  3EMP A;  1A90 A;  3LYK A;  1YHQ 3;  1O6J A;  4TR1 A;  4ZIL A;  3DUK A;  4CY8 A;  2D1W A;  3FCS B;  1YDK A;  3UBL A;  3EHC A;  1ACV A;  1WIK A;  2H1D A;  4MJD A;  5HR3 A;  5JCG A;  2LJA A;  1FGO A;  3FW2 A;  4ZBA A;  1RGC A;  5KN0 A;  3F7X A;  3TKS E;  3F63 A;  3LTC A;  2KF5 A;  1W01 A;  3GA4 A;  1FW7 A;  3HCZ A;  1IVW A;  1GSU A;  2L57 A;  2LRC A;  2M46 A;  1PX6 A;  5HR0 A;  5G5F A;  4NRE A;  5B6N A;  1N8R 4;  2OCT A;  2L5O A;  4G0I A;  2BMO B;  3GHA A;  1JZW A;  2PBJ A;  1WNH A;  3G71 3;  4V1A g;  3DGO A;  1YJ9 3;  4O5R A;  1PKW A;  4MMM A;  3MG1 A;  2HZF A;  3QAG A;  4RZM A;  1R4Y A;  4WR5 A;  1G02 A;  1BIR A;  12GS A;  1GY6 A;  1IU7 A;  4L8E A;  4N10 A;  1UI7 A;  1S72 3;  3DGM A;  5G1L A;  1FVK A;  2FWE A;  1IVU A;  1SU9 A;  1FGT A;  4POB A;  1J9B A;  5ECI B;  1LQM B;  1X5C A;  3J7Y k;  3ME7 A;  2XSO B;  3NQZ A;  4KVH A;  1GTU A;  4OFM A;  1I2F A;  3HHV A;  4JR6 A;  1KD1 4;  4FYU A;  4OFT A;  1B2U A;  1U8C B;  1WE0 A;  2CT6 A;  2HOH A;  5AEU B;  1T7P B;  3TOT A;  2ZUP A;  2XR8 B;  1EG9 B;  2H6Y A;  2LRN A;  2C8U A;  2LRT A;  5A4U A;  1BVI A;  4V2L A;  2CWT A;  1I2G A;  2RM6 A;  3E9J B;  3EBT A;  5IM9 A;  2W56 B;  4XTS A;  3CCM 3;  4N11 A;  3RHC A;  2JAC A;  4EUY A;  2LV3 A;  3VF1 A;  1N9J A;  4N3V A;  3CD6 3;  2YWO A;  2DJ0 A;  5HFI A;  4HAA A;  1ZGX A;  4GB5 A;  6GSS A;  3AHW A;  5FHI A;  1OVN A;  2K8S A;  5DJM A;  3FR3 A;  1OUN A;  3LYG A;  2HRN A;  6STD A;  2KLX A;  2IJY A;  4ML6 A;  2K18 A;  5E59 A;  1RRH A;  2F4Y A;  2C11 A;  4K0N A;  4ILF A;  1THX A;  4AKY A;  2YWI A;  4KGI A;  3TJG A;  1NJI 4;  1URM A;  1N8Q A;  3FZ4 A;  1GSY A;  3NX0 A;  4BL7 B;  1SQW A;  4J5K A;  1GSF A;  4EW5 A;  3FSD A;  2YAN A;  3DM8 A;  4ZL8 A;  1JJ2 2;  1W6C A;  3FRC A;  3WHO A;  1ROV A;  3CNX A;  1EP7 A;  3HII A;  1A23 A;  3D21 A;  2YZH A;  1M2B A;  2R3X A;  4RUV A;  3F8H A;  4HM0 B;  5CYY A;  4KSO A;  1OGZ A;  3CPO A;  2ML6 A;  7GSS A;  3GNJ A;  2MZC A;  3QAV A;  4BA7 A;  1GUM A;  3NM2 A;  3A3T A;  4DVC A;  1NO3 A;  4F82 A;  3I0Y A;  2FHE A;  2CVD A;  3GL3 A;  3S67 A;  2O7K A;  5GST A;  1RCK A;  1BX9 A;  1O73 A;  2A4H A;  9RNT A;  1OF5 B;  3T0U A;  4ZIJ A;  4IP6 A;  4X1U A;  1XG8 A;  2JZS A;  3G7J A;  5IF6 A;  3SYU A;  4KDX A;  1O7U A;  1XVQ A;  5D8I A;  4X0X A;  1AVK A;  4NXI A;  3LZA A;  2YN1 A;  5IG0 A;  2BMX A;  3ZTL A;  3P90 A;  1TU7 A;  2CAQ A;  4YH2 A;  1KSI A;  4GQC A;  5ECP B;  4O02 B;  3GZX B;  3CTG A;  1A8L A;  1Y4K A;  5EVH A;  5J9C A;  3TRQ A;  4XHM A;  1SJZ A;  4HDE A;  2H30 A;  2CFG A;  4R4K A;  2DML A;  4K9Z A;  3VUR A;  3QMX A;  3SX1 A;  3H51 A;  3I9V 2;  3I55 3;  2C3N A;  3TKR A;  3EB8 A;  3MHE A;  3NQY A;  4Q53 A;  7GSP A;  1A2K A;  5ECO B;  4ICY A;  1XZO A;  4YKF A;  1KTE A;  3IK9 A;  4CY6 A;  3I43 A;  2WO0 A;  1AY7 A;  3DH2 A;  2P05 A;  3DKS A;  4CJN A;  3PH9 A;  4ID0 A;  4MH3 A;  1DYU A;  4TXV A;  3U5R E;  4N6L A;  3NV0 A;  2P0M A;  4PUF C;  4MMY B;  2CWV A;  1W2Z A;  2WGQ A;  4N6U A;  3N5O A;  1PN0 A;  4TX4 A;  1GTI A;  2HSH A;  1R26 A;  3IJE B;  3NZN A;  1FOV A;  1KQS 2;  2CHC A;  2N5A A;  5GAP D;  1GNW A;  2OA7 A;  3M8N A;  3LTD A;  2AV4 A;  1QVG 2;  4KF9 A;  1UGH I;  4TVE A;  4MPF A;  5HR1 A;  3M3M A;  3OWU A;  1GMP A;  1FUT A;  4XS6 A;  5AIF A;  5D96 A;  4RNY A;  1GLQ A;  3HYP A;  1T2H A;  1ASK A;  3DYR A;  4CHS A;  4HZB B;  2NPB A;  1JKG B;  1TI1 A;  1UC7 A;  1IVX A;  4HM4 B;  3EF8 A;  3GUS A;  3ZRD A;  2YFI B;  2AHE A;  6GSY A;  1OKT A;  5CXO A;  1BUQ A;  2KAA A;  5JCU A;  1A2M A;  1PYL A;  2LJK A;  1PFO A;  3SBC A;  4WET A;  4RNZ A;  1IDP A;  2IYJ A;  1SL2 B;  2Q07 A;  1N9E A;  3SLU A;  3BCK A;  6GSX A;  4OO5 A;  2QEX 3;  2A4V A;  1B9Y C;  4X2H A;  2V6K A;  2GSR A;  2DSA A;  2OBI A;  3FH1 A;  4FCJ A;  3LTB A;  1BOX A;  5ABR A;  2GU1 A;  4ACS A;  4GL6 A;  4IQA A;  1QMA A;  1YEX A;  4LA1 A;  4G19 A;  1ZZY A;  4Z2T A;  3FZA A;  1HNB A;  1JB4 A;  2LUS A;  1R5P A;  2GT6 A;  1ERV A;  5GSS A;  1QAK A;  3GZR A;  1O7H B;  1W02 A;  3HJM A;  4EC6 A;  1VQN 3;  1TRU A;  3GX8 A;  5F06 A;  1RNB A;  2V32 A;  2G2Q A;  2VCZ A;  3EIN A;  2CIU A;  5DQY A;  3NHX A;  1Y6E A;  1GOY A;  1Z9H A;  1M1K 4;  3URP A;  5JPP A;  4IEL A;  2XGN A;  2KHP A;  4BVY A;  1K3L A;  2OAC A;  3KJY A;  2VM2 A;  4ECB A;  3X3X A;  1BGS A;  5D83 A;  1IT7 A;  1JFU A;  1KBN A;  2C0D A;  1V9W A;  1SK2 A;  1LNH A;  4XBY A;  5KP3 A;  4STD A;  1QXH A;  3R3E A;  4OD7 A;  4DSS A;  4KCA A;  1K0N A;  3E0U A;  1N5H A;  2X8H A;  4HUA A;  3HIG A;  1B21 A;  2GZP A;  5G1K A;  5A0O B;  2V1M A;  1RJO A;  1DE1 A;  5JBS A;  2SAR A;  4AEQ A;  3RPN A;  1DVD A;  3V92 A;  2KF6 A;  3EJV A;  2LEG A;  1YY7 A;  5CRE A;  4MA9 A;  2OE0 A;  4HJL B;  1X1U A;  2REM A;  1O7N B;  1BAY A;  3DML A;  3VPT A;  4FCM A;  2HNL A;  2KF3 A;  4EIQ A;  4CW9 A;  5JWO B;  1MDK A;  2H1A A;  2PU9 C;  3O6T A;  5BU4 A;  1BNR A;  2CZ3 A;  4FCZ A;  1IV9 A;  1LOX A;  1H4O A;  3F8X A;  1BNF A;  3HOH A;  2N5F A;  3WGD A;  4GWR A;  4TW5 A;  4MPG A;  4MLY A;  3KEB A;  4N6T A;  4TKY A;  1ZYP A;  1DSB A;  2HSM A;  2I3Y A;  4O3V A;  2GGT A;  2BT3 A;  3ERW A;  1NB3 I;  1RNT A;  2QSI A;  5HGR A;  2VCT A;  4EL1 A;  3U97 A;  1THO A;  2P5Q A;  3ZIJ A;  3ZIT A;  3CCJ 3;  4FMA A;  1B2Z A;  1FB6 A;  3L4N A;  1EEM A;  4J57 E;  3FEU A;  7STD A;  1WMJ A;  1U3I A;  3ZML A;  2FA8 A;  3CYN A;  2K8V A;  2HMJ B;  1OKD A;  3KZQ A;  4I6X A;  1RK4 A;  2PVQ A;  3KCM A;  2NTO A;  2ZNM A;  4HQS A;  1FHE A;  1GSS A;  1B2X A;  1UI8 A;  3DXO A;  2VCV A;  2ML5 A;  3F14 A;  3DVX A;  4G9H A;  1JBR A;  4AJ6 A;  3MKI A;  4N6N B;  5ELA A;  1TFK A;  1YF0 A;  4HEA 2;  2SBL A;  3HZ4 A;  2C3Q A;  1YIJ 3;  4IKH A;  2O9U X;  1X1W A;  3UOM A;  2W56 A;  3X3Y A;  3BND A;  4HKV B;  2IMI A;  1HD2 A;  1NNV A;  1R4C A;  4HZ4 A;  1TK0 B;  1I70 A;  2H70 A;  3LXZ A;  4PQ1 A;  1GD4 A;  1MD4 A;  3GZY B;  1S3C A;  1HNA A;  2GST A;  5JWR B;  3LFL A;  5EEO A;  1PX7 A;  5KP4 A;  2B1X B;  1T2I A;  2F8A A;  2OQE A;  4KAE A;  3LG6 A;  1Q7Y 4;  1AQZ A;  4HM5 B;  2W04 A;  4HM6 B;  2OOV C;  4BU4 A;  3IRA A;  1S3A A;  4N6O B;  4BL7 A;  4Q5R A;  1M3J A;  4I5Q A;  2MF7 A;  4XB5 A;  2TRC P;  4POM A;  1SJ6 A;  1PL1 A;  3EVI A;  5LC7 A;  2JAD A;  3LQ7 A;  2PVO C;  3LT9 A;  3F9U A;  1YNV X;  3ZIV A;  4MAB A;  1CEW I;  4H86 A;  2OTJ 3;  1M2A A;  2VCX A;  4USS A;  8GSS A;  1B9X C;  3FZ9 A;  5JCW A;  1SAR A;  4EXR A;  1O8X A;  1FUW A;  3G6E 3;  4NMU A;  3A2V A;  4OCE A;  3EWL A;  2RGQ A;  1LXE A;  9GSS A;  3W6G A;  1QMV A;  3FHK A;  4L7K A;  3D5G A;  3D4T A;  1XW5 A;  3IC8 A;  2Z76 A;  4BIR A;  1OF5 A;  1BRN L;  1WP0 A;  4TR0 A;  3PYJ A;  1N2A A;  2X64 A;  3D5I A;  1T4Y A;  2BIR A;  3WT2 A;  3TOU A;  2DJJ A;  2GEY A;  3CC7 3;  3RBT A;  3NM7 A;  3GKN A;  2OAD A;  1RGH A;  1PQN A;  3CCQ 3;  1SII A;  1TXX A;  1GY5 A;  1ZX2 A;  3G7Y A;  5DQS A;  1TRP A;  2C0F A;  5IG5 A;  3ZVJ A;  1OHP A;  4PUA A;  4KND A;  2F98 A;  4A5P A;  5ID2 A;  4F0B A;  4RQX A;  1W89 A;  2H1B A;  3PCS A;  3D5J A;  3WR2 A;  3IC4 A;  3K8N A;  5ELG A;  4NHZ A;  3VWW A;  4FYB A;  3IE3 A;  2H66 A;  2GSQ A;  4KFD A;  3FLJ A;  5IW9 A;  1EV9 A;  2JDI H;  1KWI A;  1DET A;  1N5P A;  1UW1 A;  2R0P A;  3FF2 A;  4NV2 A;  1JB5 A;  2I9W A;  4K2D A;  2E2T A;  4MJE A;  5CLK A;  2VO4 A;  3IHQ A;  5M18 A;  6GSV A;  4OFN A;  2QKE A;  5AIH A;  4MF5 A;  2JU5 A;  5KN2 A;  1YKC A;  1SD8 A;  3KH7 A;  4V2N A;  5AI1 A;  1W6G A;  1BYE A;  2LJR A;  3VWV A;  3KD0 A;  2LQO A;  1DMQ A;  3FR9 A;  5CRW A;  1KC8 4;  2PER A;  2FWH A;  2H75 A;  4WR4 A;  2DBC A;  5D82 A;  1BED A;  2C1Y A;  4IGJ A;  1D6Z A;  3W8J A;  2VD0 A;  4LLR A;  4HOJ A;  3N8B A;  4WFO A;  3BJ5 A;  5DJL A;  3D4A A;  3IHG A;  3B8L A;  13GS A;  2ZL8 A;  1GMQ A;  4LL1 B;  4BL3 A;  3F40 A;  2F86 B;  3FG1 A;  3AGN A;  2ON5 A;  4TRX A;  4JRF A;  3G0K A;  5IQY A;  2XBQ A;  3B7C A;  2B5X A;  3HZ8 A;  2AB6 A;  4GSS A;  2CV4 A;  4YQM A;  4WP5 A;  2BU4 A;  2H73 A;  3TDG A;  4IJ3 A;  4ISD A;  3MG3 A;  1G0T A;  1LOW A;  3SOA A;  4BTY A;  5IPG A;  4R1K A;  4WXT A;  3EBY A;  3IDV A;  2CH9 A;  1UCL A;  1SKW B;  2M7O A;  2M80 A;  3C73 A;  4BVY B;  2PN8 A;  4YQU A;  3OR5 A;  5B8B A;  4QQ7 A;  4HM2 B;  4OWY A;  3AHS A;  2DKI A;  3CNM A;  1EP8 A;  3RGA A;  3QR6 A;  4ULX A;  2R2J A;  4R80 A;  2EC4 A;  3CCS 3;  4HI7 A;  4X43 A;  3F3Q A;  2JSZ A;  3FYG A;  4POK A;  3VPQ A;  2DC5 A;  1VF4 A;  2FNO A;  4EIP A;  3DZL A;  1VF3 A;  1S3R A;  2WDU A;  4FQU A;  3Q19 A;  2FUG 2;  4GCI A;  3TKS A;  4CCV A;  1SJI A;  3GKM A;  5AYS C;  2GEX A;  2X49 A;  1ZCP A;  2L6D A;  1FAA A;  3UB1 A;  2PGT A;  4MMX B;  3Q90 A;  3C8E A;  1Q9E A;  1UUW B;  1Z6M A;  4N0V A;  1TTO A;  3FG4 A;  5M19 A;  1HNC A;  3ISO A;  5IOW A;  3OV4 A;  2IY2 A;  2XRX B;  4PEJ A;  5F05 A;  1C7H A;  4IBP A;  1TP9 A;  2LST A;  2VCW A;  1GS3 A;  3H79 A;  3IOS A;  2XFT A;  1RGK A;  2MBT A;  5HR2 A;  2GBX B;  2L1S A;  1MNL A;  1TK8 B;  1XBS A;  5J41 A;  3IPZ A;  5ELJ A;  4MJA A;  3TJK A;  3GMF A;  5KOW A;  2RCD A;  4K7I A;  4MCU A;  3LJR A;  2H01 A;  3OWY A;  1GP1 A;  5IOX A;  1ON4 A;  1YEP A;  1XFL A;  4XM4 A;  4PXO A;  1IVV A;  5BXQ A;  4FMB A;  1GMR A;  4FO5 A;  3X40 A;  1JV2 B;  3WA2 X;  4EV2 A;  1OCV A;  1TIJ A;  2BMR B;  1O8W A;  1HYF A;  3ZFZ A;  3CBU A;  1V58 A;  4MJC A;  4LMW A;  2WFC A;  5D9X A;  3TRX A;  1CQG A;  3V1W A;  3BLZ A;  4BWQ A;  1WMO A;  1Z5Y E;  2JSY A;  3H1N A;  2AUV A;  3W8S A;  1RSN A;  1FW1 A;  2GLR A;  1Q98 A;  4PNF A;  1A2L A;  3WT1 A;  1O7W B;  5FW5 A;  4KW6 A;  2QA1 A;  4JZQ A;  1FYS A;  3EE2 A;  1OAC A;  2IME A;  1SD9 A;  4BTX A;  2R5G A;  1X5E A;  4FMD A;  2CX4 A;  3GUR A;  5ECQ B;  2H0I A;  5JWQ B;  5AGY A;  1SJW A;  2DJK A;  3APO A;  2RUF A;  4RBN A;  3C1S A;  1X5D A;  4MNN A;  4HJM A;  3TB2 A;  1PA3 A;  4WF4 A;  5DRE A;  3ERF A;  1GNE A;  1ZGN A;  2EIQ A;  1TDI A;  4Q5Q A;  4K7O A;  3PGB A;  2OE1 A;  1ABA A;  1VZZ A;  4ZL7 A;  4NAX A;  1DE2 A;  2AAD A;  1VQ4 3;  4MMZ B;  2K0M A;  2C10 A;  4PQH A;  3A2W A;  4BVX B;  3TJB A;  3BOA A;  3H93 A;  5IG4 A;  3ZLP A;  2WUL A;  1U5O A;  2W03 A;  2YCD A;  1B8X A;  1EOG A;  1DE3 A;  4XBX A;  22GS A;  3EX9 A;  1VQ5 3;  7RNT A;  1YVB I;  1B20 A;  4F03 A;  3BBY A;  1BNJ A;  4WWU C;  4CDO A;  4N0Z A;  2GXF A;  3O8Y A;  3GZB A;  1TP6 A;  1R7H A;  2VLT A;  4F0C A;  1AC1 A;  4MK3 A;  2CC3 A;  10GS A;  1IYH A;  1Z1S A;  3ME8 A;  4TXO B;  1I9D A;  2IMD A;  4KCE A;  4L0W A;  2V1L A;  1RGG A;  1SL1 B;  4IJI A;  5KN1 A;  1I2E A;  3L9S A;  4GQF A;  5A5K A;  3ER7 A;  3ZG0 A;  4F9Z A;  5LNK e;  3NBJ A;  1F2E A;  5ID2 B;  3J7Y d;  5CAX A;  1GL8 A;  3QK9 A;  1I0V A;  2F5M A;  3O76 A;  4GRF A;  4L0U A;  1BSE A;  2R41 A;  1MOL A;  2I81 A;  1GH2 A;  1R4W A;  5CRH A;  1F3B A;  1JRQ A;  2MC8 A;  5ECR B;  5IMZ A;  5INY A;  2VL2 C;  3OXA A;  3V98 A;  5IMA A;  5IEN A;  2F99 A;  3HDC A;  3UJ1 A;  2F3M A;  3P2A A;  3D9R A;  5AEW B;  2QGV A;  3MPH A;  3FZ5 A;  1US1 A;  5IMC A;  4L5O A;  4HQZ A;  3HK4 A;  1A0F A;  3Q3F A;  1PL2 A;  3PCR A;  3IK7 A;  1XPV A;  1IV7 A;  5G2G A;  1A2P A;  1LQG C;  1UUG B;  3P8W A;  3A5E A;  2E0Q A;  2ZA4 A;  2PPT A;  2IN3 A;  3FKF A;  4KFE A;  3UL5 A;  2R6K A;  3DGL A;  1JBT A;  3JUQ A;  3WMD A;  1AQX A;  1MDI A;  4AF2 A;  1RW1 A;  1TFO A;  4FMC A;  1PKZ A;  2X8C A;  1TUH A;  4KDY A;  3F7S A;  1M1X B;  1M0U A;  1M90 4;  3WGE A;  1AXD A;  1NWW A;  2FCH A;  2I1U A;  5B8A A;  3I6A A;  1Y25 A;  2HFD A;  2FWG A;  1QGV A;  1Q4J A;  4N6V 0;  3S27 A;  3EN1 B;  2CVK A;  1TRQ A;  3KZT A;  3UIW A;  2XFS A;  2X4A A;  1SKR B;  6GST A;  5DVB A;  2BTO T;  5D93 A;  2CFD A;  3NBR A;  2L4C A;  5HFK A;  3RPP A;  1VRS D;  3KH9 A;  4KH7 A;  4IHU A;  1T00 A;  5D9T A;  1BSB A;  1TRS A;  2IMK A;  4O7H A;  1UCK A;  4J9A A;  4JED A;  2QGU A;  4ZM8 A;  1NW2 A;  3FR6 A;  2P0G A;  1PRX A;  4OO4 A;  1HKX A;  1YVS A;  1WWJ A;  5ECM B;  5C04 A;  2HRF A;  3FG3 A;  2CX0 A;  1PFP A;  1BSA A;  2GU3 A;  2I9H A;  2WS2 A;  3SOY A;  1IQX A;  1FVJ A;  2OJL A;  2O8V B;  3IBH A;  4HOH A;  3TCO A;  2VM1 A;  2CK3 H;  1DVC A;  2DJ2 A;  3ROB A;  3E3E A;  3EQQ B;  4HM3 B;  1XXU A;  3LW9 A;  1EV4 A;  1GLP A;  1V74 A;  4IVF A;  1U6T A;  3N9J A;  4EXJ A;  1GUK A;  3KE7 A;  5IER A;  3EYT A;  5F0G A;  2F9S A;  1T3B A;  2BHM A;  3SXX A;  1ILO A;  1ZMA A;  1BRJ A;  4XDW A;  4Z2U A;  1K0M A;  2OE3 A;  3LGC A;  1T5Y A;  1JLV A;  3F0I A;  3KSE D;  1E6B A;  4ZL9 A;  3UAP A;  1ULI B;  1BRI A;  1X1Y A;  3X3Z A;  3N54 B;  3PXM A;  5ELU A;  2KRT A;  5D81 A;  2IUJ A;  2Z9S A;  1LJR A;  1Z3E A;  1AVL A;  4MEI A;  1AQV A;  3L0R A;  1EA2 A;  2JQ5 A;  3M9J A;  2OBK A;  3IMA B;  1GUL A;  11GS A;  3QRD A;  5B6M A;  2CG0 A;  1QUW A;  3HJO A;  1VQO 3;  2FD3 A;  5KEJ A;  5KP1 A;  4HU7 A;  3IV4 A;  3KII A;  1CQH A;  4GHO A;  3UBK A;  3X42 A;  5D9W A;  1NSW A;  2A2S A;  3TJJ A;  18GS A;  3K7C A;  4QL7 A;  1GTA A;  1AUC A;  1TW9 A;  1O7G B;  1W4N A;  4K2X A;  4XIH A;  1NM3 A;  4NV5 A;  3UVT A;  2YFJ B;  3T8U A;  4EBG A;  5I97 A;  1RGF A;  2TIR A;  3HJP A;  3QPM A;  5DDL A;  4IS0 A;  3AGO A;  2Z6B A;  3I69 A;  1LOV A;  3G9B A;  4QL9 A;  1RRL A;  2XSH B;  2AJQ B;  4P3Y B;  2Y73 A;  3UMA A;  2HMM B;  1XWG A;  20GS A;  4FH8 A;  2WB9 A;  14GS A;  4R9L A;  3HKR A;  4GTU A;  1BRH A;  2E2U A;  5CO3 A;  1K0D A;  1G6Y A;  1ZOF A;  3HA9 A;  1JZD A;  1PU4 A;  5GZZ B;  1Z7P A;  4Q5N A;  2IMF A;  2GTU A;  2P09 A;  2GSS A;  5COH A;  3K0Z A;  5C00 A;  3U6V A;  1G7O A;  1CQS A;  1ERW A;  1SEN A;  2V6O A;  3KMN A;  2MYG A;  1M7T A;  4O8S A;  1BJX A;  1K0O A;  1RLS A;  3FGY A;  5CP1 A;  1B27 A;  2DKH A;  1ZO2 A;  3VGN A;  1GWC A;  2JL4 A;  2CVB A;  4K5S A;  2MBS A;  1ST9 A;  1I3I A;  1ERU A;  2IL3 A;  1OE7 A;  3Q6O A;  1OE8 A;  3CC4 3;  1XW6 A;  3JUP A;  4J2F A;  1BU4 A;  2H6Z A;  4MZW A;  2PZV A;  2IWT A;  4WEY A;  5DAK B;  3SED A;  4BWS A;  4FYC A;  3G16 A;  3LTA A;  2CW9 A;  5ECS A;  2LNS A;  3AY8 A;  5L71 A;  3L0H A;  5AIV A;  2WRT A;  8CHO A;  1M3I A;  2RFR A;  3DD3 A;  3HVS A;  2YZU A;  4K1V A;  2PMT A;  2KCD A;  4O2H A;  1W6Y A;  5DBQ A;  1K8A 4;  4AJ7 A;  2W9Q A;  2RNT A;  2HLS A;  1B2S A;  4BVX A;  2B6M A;  2RII A;  2IFQ B;  2INX A;  1LU4 A;  1VQK 3;  4V2M A;  1PSQ A;  2YOI A;  1GSP A;  1UUV B;  4ZXG A;  1GUH A;  2MMN A;  5B7C A;  4MJB A;  3GIX A;  4NWY A;  3ZRE A;  4XRA A;  4J5G A;  1JLW A;  1GD3 A;  4I2U A;  1T8E B;  3CU3 A;  5F8B A;  4CPK A;  3IAS 2;  1F9M A;  3QFB C;  4KE3 A;  3VK9 A;  2YX9 A;  3S5C A;  2F51 A;  3HI7 A;  3DRN A;  4RI7 A;  4XS1 A;  2AYT A;  5BIR A;  3FMW A;  4N30 A;  3MSO A;  3JUM A;  4TXO A;  2HZE A;  4G0K A;  3GAX A;  1Z7R A;  4G0L A;  5RNT A;  3RGR A;  4ZBB A;  4ZB9 A;  4ECC A;  2F8F A;  1EUI C;  4EV5 A;  2A15 A;  5CRG A;  3EC3 A;  2F5W A;  1VQ6 3;  3JUO A;  3DGN A;  1TTZ A; 
#chains in the Genus database with same CATH homology
 5J3R A;  3HVV A;  1KEB A;  2XHF A;  1K0A A;  3D4M A;  3MSZ A;  3TUE A;  3HY2 A;  2PUK C;  5D73 A;  2FGX A;  1U87 A;  2L5L A;  5G31 A;  1EGR A;  1XOA A;  2H76 A;  2LNT A;  1XCC A;  3WYW A;  2VCQ A;  4XS4 A;  4DSR A;  3ED3 A;  1ZYQ B;  1M9A A;  4G10 A;  4TN8 A;  3KXO A;  5F07 A;  2C0G A;  4KA0 A;  1A2J A;  1SK0 A;  2RLI A;  2CA8 A;  2YV9 A;  1EWX A;  2UZ8 A;  2LKU A;  1O85 A;  1EZK A;  3TKQ A;  3ZZX A;  1XW9 A;  2GZZ A;  2B3S A;  2TRX A;  5BRT A;  3LSZ A;  3BCI A;  1UVZ A;  2YNX A;  5ECL B;  1OC9 B;  2DIY A;  4YQV A;  1TOF A;  6GSU A;  1TK5 B;  4KX4 A;  3ERG A;  1N8J A;  2FLS A;  3VWU A;  3PPU A;  2NDO A;  2HXK A;  2CAI A;  2E2M A;  1XWA A;  4HJ2 A;  1XWC A;  3IA1 A;  1TRW A;  5H5S A;  2H6X A;  1XOB A;  3F3R A;  3S9F A;  1QFN A;  2B1L A;  3D0Z A;  2VD1 A;  19GS A;  4HU9 A;  3L78 A;  4MF7 A;  1K0B A;  2H72 A;  3LEF A;  3GSS A;  4EO3 A;  3D6I A;  1RQM A;  3MYD A;  5G5E A;  1WJK A;  2VLU A;  4E8E A;  1LBK A;  3VI5 A;  1M2D A;  1XWB A;  1Z6N A;  1WRY A;  1V2A A;  3A2X A;  3C7M A;  3EUR A;  1F37 A;  4BPY A;  2IIY A;  1DUG A;  4IQ1 A;  4ML1 A;  2H8L A;  3UAR A;  3M0F A;  1S3D A;  3KTL A;  4EE0 A;  2DLX A;  3UVH A;  1R5A A;  2XPD A;  3TGZ A;  3WGX A;  1ML6 A;  3H8Q A;  4K8M A;  1JZO A;  1JHB A;  1V40 A;  1X0R A;  2L6C A;  2DIZ A;  4Z2R A;  5J4U A;  5DCG A;  2DMM A;  2QA2 A;  2NVL A;  2HYX A;  2O89 A;  5G30 A;  4I2T A;  2GS3 A;  1XIY A;  5AN1 A;  3Q18 A;  5EVO A;  4NPB A;  3KP8 A;  2H1G A;  4JR4 A;  4PGT A;  3QD9 A;  1OC3 A;  1M99 A;  3GTU B;  4YAV A;  1VF1 A;  1AAZ A;  3WD6 A;  2EIR A;  2E7P A;  1NHY A;  2VOC A;  2BJX A;  1MTC A;  4PNG A;  4K1F A;  6GSW A;  3MDK A;  2R37 A;  3KIJ A;  2HT9 A;  2RM5 A;  3TJF A;  4MZC A;  2YWM A;  2PWJ A;  3DXB A;  3QFA C;  1GTB A;  2AAW A;  2WZ9 A;  4PUR A;  3CSH A;  2N5B A;  5DAK A;  1A0R P;  1SK1 A;  4F2I A;  3GFK A;  2H0G A;  4G2E A;  2GQL A;  1X9S B;  3LXT A;  1SYR A;  2M72 A;  1B48 A;  2HRA A;  3GL5 A;  3ZL5 A;  3D22 A;  3CRT A;  5ENU A;  2YWN A;  3APS A;  1MEK A;  2HZE B;  3GYK A;  5ECK B;  1U88 A;  3EPT A;  2YJ7 A;  2FY6 A;  1V57 A;  3KP9 A;  1PMT A;  2IFQ A;  2MMA A;  1OAZ A;  1YZX A;  4MF6 A;  4PX1 A;  1BQ7 A;  2B1K A;  2RUE A;  5ECH B;  2O87 A;  5DAL A;  4GLT A;  2D2Z A;  1MDJ A;  3GV1 A;  3ZVJ D;  1J08 A;  1HQO A;  1SL0 B;  5FT3 A;  4PTS A;  1EEJ A;  1GRX A;  4KB3 A;  1FO5 A;  5HQP A;  3HD5 A;  5G2Z A;  4TR3 A;  2H71 A;  2VUP A;  3GRX A;  3CTF A;  2VLV A;  3IAM 2;  4XS4 B;  1YKA A;  2WGR A;  4L5L A;  5FWG A;  3MWH A;  3LYP A;  1TI3 A;  4K0G A;  1ZL9 A;  3QAW A;  16GS A;  3L9V A;  4XCS A;  1H75 A;  4YAP A;  5IO2 A;  4GXZ A;  3LOR A;  3RAZ A;  1EOH A;  3EU3 A;  3MNG A;  3RDW A;  3PGT A;  4WBJ A;  2A2R A;  2YJH A;  4V1A p;  5H5R A;  1F6M C;  4ECJ A;  1SYX A;  2WJU A;  4TR4 A;  2H0H A;  2ES7 A;  3JCM L;  3A5W A;  2ALB A;  3GKX A;  2YV7 A;  1V98 A;  4KSM A;  3M9K A;  4I8B A;  3PR8 A;  2B7K A;  3EMX A;  2EIO A;  5IMD A;  2X8G A;  2YPM A;  1OC9 A;  1T1V A;  1SKS B;  1PGT A;  3DEX A;  4J56 E;  3NOF A;  2H19 A;  3CRU A;  1MD3 A;  4ECI A;  5IIZ A;  1B4P A;  4GSN A;  1GSQ A;  3IXR A;  4D73 B;  1AIU A;  1UA5 A;  4EKZ A;  3KTB A;  2DJ1 A;  4DSQ A;  3US3 A;  1E2Y A;  3F8U A;  1A8Y A;  4TR1 B;  5H5Q A;  1C72 A;  3CXG A;  2B5E A;  2A2P A;  4RQR A;  3DIE A;  4MDC A;  1G6W A;  2C4J A;  3ZYW A;  2MMO A;  2V41 A;  2VL2 A;  2GT5 A;  5IO0 A;  2DJ3 A;  3SWL A;  2JZR A;  3NIV A;  4EC0 A;  4I97 A;  2I4A A;  2GVP A;  1WOU A;  5ECN B;  5LD0 A;  1XWK A;  1I5G A;  3LWA A;  2X99 A;  4LMV A;  2VIM A;  1ZYE A;  4KUN A;  2QC7 A;  4XRD A;  3GH9 A;  1QK8 A;  2GQK A;  3MAK A;  2JZT A;  3TRP A;  1X9W B;  2R4V A;  1A24 A;  1XVW A;  2J9H A;  4GF0 A;  3VWX A;  4EVM A;  5DCH A;  1O81 A;  4K5R A;  2GQM A;  2WCI A;  2FA4 A;  5GAN D;  3QDN A;  4EF0 A;  3RHB A;  5KN3 A;  1UN2 A;  2KUC A;  2MMZ A;  1OC8 A;  5A4V A;  4WF5 A;  2OKA A;  4MZB A;  3BD2 A;  1GSD A;  3L9U A;  4DEJ A;  3EU4 A;  1VGL A;  4JRR A;  3APQ A;  1T4Z A;  2R0C A;  2YP6 A;  3F6F A;  2ON7 A;  2CQ9 A;  1KNG A;  2XBI A;  5IMF A;  1FG4 A;  3F4R A;  2LTK A;  3ZFB A;  1TKD B;  2J23 A;  4Z7X A;  3J7Y b;  3GTU A;  1IYI A;  1HYU A;  4WKW A;  3KMO A;  4JE1 A;  2ZCT A;  1PN9 A;  1EGO A;  4WBR D;  4IN0 A;  4PQI A;  2IPA A;  2K6V A;  2XC2 A;  1YJ6 A;  2C0E A;  5D9V A;  4LL4 B;  1FOH A;  3IR4 A;  1K3Y A;  2L59 A;  3VI7 A;  2XPE A;  5EY6 A;  1K3O A;  1TRV A;  1PD2 1;  5BMU A;  2G0F A;  5DAL B;  2R0G A;  3GN3 A;  4JBB A;  5EPF A;  3A5I A;  2KP2 A;  3M1G A;  4EDY A;  5LCZ A;  2K9F A;  3HVX A;  5J5N A;  1J0F A;  4NHW A;  1X9M B;  5CRD A;  1M9B A;  1GSE A;  3GH6 A;  3QCP A;  3C71 A;  3FY7 A;  2HE3 A;  3CSI A;  2O85 A;  3C1R A;  2HI7 A;  4IW9 A;  2CZ2 A;  3GKK A;  3QOU A;  4GST A;  2L4Q A;  4EDZ A;  2CX3 A;  4AGS A;  1K0C A;  2KP1 A;  2VAF A;  4ZB8 A;  1AQW A;  2KOK A;  4OMV A;  4ZB6 A;  4O92 A;  1YF1 A;  3TKS C;  5AIS A;  5A4W A;  5EL8 A;  3DWV A;  4X4J A;  3CSJ A;  4RI6 A;  4IP1 A;  4FIW A;  3O3T A;  4HZ2 A;  2VL3 A;  2VL9 A;  2NBS A;  3FK8 A;  4HS1 A;  5E4W A;  1USB A;  3VLN A;  1AW9 A;  4KDU A;  5HFG A;  1VF2 A;  3TKP A;  3H4K A;  4MH2 A;  3ZFL A;  3CMI A;  4K7N A;  1DBY A;  17GS A;  5CNW A;  3Q74 A;  2B7J A;  1ZYN A;  4POL A;  2GDR A;  4TOP A;  5AIX A;  2B5Y A;  1WPI A;  1TJD A;  3UEM A;  3MIX A;  1F3A A;  1NHO A;  4Q5F A;  5IMV A;  3GST A;  4OCF A;  2HSY A;  5IPH A;  1TU8 A;  3HXS A;  1OYJ A;  4YKG A;  3ZMK A;  3R2Q A;  5KOX A;  1U3A A;  1BG5 A;  4O5U A;  2H74 A;  5J9B A;  1JZR A;  3F4T A;  2V2G A;  1G7E A;  3GX0 A;  2P5R A;  2LQQ A;  2E2G A;  2HRK A;  3VFI A;  3F4S A;  3PIN A;  3KGK A;  4K6X A;  3UL3 A;  3P7X A;  1W4V A;  4AJ8 A;  3G7I A;  1B4Q A;  4ZBD A;  2LS5 A;  1ERT A;  4E8H A;  3DVW A;  2C3T A;  3KM6 A;  4MP4 A;  1FB0 A;  3F6D A;  4O32 A;  4D73 A;  4O5Q A;  1YQ1 A;  2GZY A;  4DSS B;  2C80 A;  1QQ2 A;  3DGQ A;  4JU5 A;  2P31 A;  2FWF A;  3EMP A;  3LYK A;  1O6J A;  4TR1 A;  4ZIL A;  4CY8 A;  1YDK A;  3UBL A;  1ACV A;  1WIK A;  2H1D A;  5HR3 A;  5JCG A;  2LJA A;  3FW2 A;  4ZBA A;  5KN0 A;  3TKS E;  3F63 A;  3GA4 A;  3HCZ A;  2L57 A;  1GSU A;  2LRC A;  2M46 A;  1PX6 A;  5HR0 A;  5G5F A;  5B6N A;  2L5O A;  4G0I A;  3GHA A;  1JZW A;  2PBJ A;  4V1A g;  4O5R A;  1PKW A;  4MMM A;  2HZF A;  3QAG A;  4WR5 A;  12GS A;  4L8E A;  4N10 A;  5G1L A;  1FVK A;  2FWE A;  4POB A;  1SU9 A;  1J9B A;  5ECI B;  1X5C A;  3J7Y k;  3ME7 A;  1GTU A;  4OFM A;  3HHV A;  4JR6 A;  4FYU A;  4OFT A;  1WE0 A;  2CT6 A;  1T7P B;  3TOT A;  2ZUP A;  2H6Y A;  2LRN A;  2C8U A;  2LRT A;  5A4U A;  4V2L A;  2RM6 A;  3E9J B;  5IM9 A;  4XTS A;  4N11 A;  3RHC A;  2JAC A;  4EUY A;  2LV3 A;  2YWO A;  2DJ0 A;  5HFI A;  6GSS A;  5FHI A;  1OVN A;  2K8S A;  5DJM A;  3FR3 A;  2HRN A;  2KLX A;  2IJY A;  4ML6 A;  2K18 A;  5E59 A;  4K0N A;  4ILF A;  1THX A;  2YWI A;  4KGI A;  3TJG A;  1URM A;  3FZ4 A;  1GSY A;  4BL7 B;  1GSF A;  2YAN A;  4ZL8 A;  3FRC A;  1EP7 A;  1A23 A;  3D21 A;  2YZH A;  1M2B A;  2R3X A;  4RUV A;  5CYY A;  4KSO A;  7GSS A;  3GNJ A;  2MZC A;  3QAV A;  4BA7 A;  1GUM A;  3A3T A;  4DVC A;  4F82 A;  2FHE A;  2CVD A;  3GL3 A;  2O7K A;  5GST A;  1BX9 A;  1O73 A;  2A4H A;  4ZIJ A;  4X1U A;  4IP6 A;  2JZS A;  3G7J A;  4KDX A;  1O7U A;  1XVQ A;  5D8I A;  4X0X A;  4NXI A;  2YN1 A;  2BMX A;  3ZTL A;  3P90 A;  1TU7 A;  2CAQ A;  4YH2 A;  4GQC A;  5ECP B;  3CTG A;  1A8L A;  5J9C A;  3TRQ A;  4XHM A;  1SJZ A;  4HDE A;  2H30 A;  4K9Z A;  2DML A;  3VUR A;  3QMX A;  3I9V 2;  2C3N A;  3TKR A;  5ECO B;  4ICY A;  1XZO A;  4YKF A;  1KTE A;  3IK9 A;  4CY6 A;  3I43 A;  3DKS A;  3PH9 A;  4ID0 A;  4MH3 A;  4TXV A;  3U5R E;  4PUF C;  3N5O A;  1PN0 A;  1GTI A;  2HSH A;  1R26 A;  3NZN A;  1FOV A;  2N5A A;  5GAP D;  1GNW A;  2OA7 A;  3M8N A;  2AV4 A;  4KF9 A;  4TVE A;  4MPF A;  5HR1 A;  3M3M A;  4XS6 A;  5D96 A;  1GLQ A;  3HYP A;  4CHS A;  3DYR A;  2NPB A;  1TI1 A;  1UC7 A;  3GUS A;  3ZRD A;  2AHE A;  6GSY A;  1OKT A;  5JCU A;  1A2M A;  2LJK A;  3SBC A;  4WET A;  2IYJ A;  1SL2 B;  3BCK A;  6GSX A;  4OO5 A;  2A4V A;  1B9Y C;  2V6K A;  2GSR A;  2DSA A;  2OBI A;  5ABR A;  4ACS A;  4IQA A;  1YEX A;  4LA1 A;  4G19 A;  1ZZY A;  4Z2T A;  3FZA A;  1HNB A;  2LUS A;  1R5P A;  2GT6 A;  1ERV A;  5GSS A;  3HJM A;  1TRU A;  3GX8 A;  5F06 A;  2V32 A;  2G2Q A;  2VCZ A;  3EIN A;  5DQY A;  1Y6E A;  1Z9H A;  4IEL A;  2KHP A;  4BVY A;  1K3L A;  2OAC A;  3KJY A;  2VM2 A;  4ECB A;  1KBN A;  1JFU A;  2C0D A;  1V9W A;  1SK2 A;  1QXH A;  3R3E A;  4OD7 A;  4DSS A;  4KCA A;  1K0N A;  3E0U A;  2X8H A;  4HUA A;  2GZP A;  5G1K A;  2V1M A;  1DE1 A;  3RPN A;  2LEG A;  1YY7 A;  5CRE A;  4MA9 A;  2OE0 A;  2REM A;  1BAY A;  3DML A;  3VPT A;  2HNL A;  4EIQ A;  4CW9 A;  5JWO B;  1MDK A;  2H1A A;  2PU9 C;  3O6T A;  2CZ3 A;  1H4O A;  2N5F A;  3WGD A;  4GWR A;  4TW5 A;  4MPG A;  4MLY A;  3KEB A;  4TKY A;  1ZYP A;  1DSB A;  2HSM A;  2I3Y A;  2GGT A;  3ERW A;  2QSI A;  2VCT A;  4EL1 A;  1THO A;  2P5Q A;  3ZIJ A;  3ZIT A;  1FB6 A;  3L4N A;  4J57 E;  1EEM A;  3FEU A;  1WMJ A;  1U3I A;  3ZML A;  2FA8 A;  3CYN A;  2K8V A;  1OKD A;  3KZQ A;  4I6X A;  1RK4 A;  2PVQ A;  3KCM A;  2NTO A;  2ZNM A;  4HQS A;  1FHE A;  1GSS A;  2VCV A;  3DVX A;  4G9H A;  4AJ6 A;  5ELA A;  1YF0 A;  4HEA 2;  3HZ4 A;  2C3Q A;  4IKH A;  3UOM A;  2IMI A;  1HD2 A;  4HZ4 A;  1TK0 B;  2H70 A;  3LXZ A;  4PQ1 A;  1MD4 A;  1S3C A;  2GST A;  1HNA A;  5JWR B;  3LFL A;  1PX7 A;  2F8A A;  4KAE A;  3LG6 A;  3IRA A;  1S3A A;  4BL7 A;  4Q5R A;  4I5Q A;  4POM A;  2TRC P;  1SJ6 A;  1PL1 A;  3EVI A;  2JAD A;  3LQ7 A;  2PVO C;  3F9U A;  3ZIV A;  4MAB A;  4H86 A;  1M2A A;  2VCX A;  4USS A;  8GSS A;  1B9X C;  3FZ9 A;  5JCW A;  1O8X A;  4NMU A;  3A2V A;  4OCE A;  3EWL A;  9GSS A;  3W6G A;  1QMV A;  3FHK A;  3D4T A;  1XW5 A;  3IC8 A;  4TR0 A;  1WP0 A;  1N2A A;  2X64 A;  1T4Y A;  3WT2 A;  3TOU A;  2DJJ A;  3RBT A;  3GKN A;  2OAD A;  1PQN A;  1TXX A;  3G7Y A;  5DQS A;  2C0F A;  3ZVJ A;  4PUA A;  4KND A;  4A5P A;  5ID2 A;  4F0B A;  4RQX A;  1W89 A;  2H1B A;  3D5J A;  3IC4 A;  3K8N A;  5ELG A;  4NHZ A;  3VWW A;  4FYB A;  3IE3 A;  2H66 A;  2GSQ A;  1EV9 A;  2R0P A;  4NV2 A;  4K2D A;  4MJE A;  2VO4 A;  3IHQ A;  6GSV A;  4OFN A;  2QKE A;  4MF5 A;  2JU5 A;  5KN2 A;  3KH7 A;  4V2N A;  1SD8 A;  1YKC A;  2LJR A;  3VWV A;  1BYE A;  3KD0 A;  2LQO A;  3FR9 A;  5CRW A;  2PER A;  2FWH A;  2H75 A;  4WR4 A;  2DBC A;  1BED A;  2C1Y A;  4IGJ A;  3W8J A;  2VD0 A;  4LLR A;  4HOJ A;  3BJ5 A;  5DJL A;  3IHG A;  13GS A;  4LL1 B;  2ON5 A;  4TRX A;  5IQY A;  2XBQ A;  2B5X A;  3HZ8 A;  2AB6 A;  4GSS A;  2CV4 A;  4YQM A;  2H73 A;  4IJ3 A;  3TDG A;  4ISD A;  5IPG A;  1G0T A;  4WXT A;  3IDV A;  1SKW B;  2M80 A;  3C73 A;  4BVY B;  2PN8 A;  4YQU A;  3OR5 A;  5B8B A;  4QQ7 A;  4OWY A;  2DKI A;  1EP8 A;  3QR6 A;  4ULX A;  2R2J A;  2EC4 A;  4HI7 A;  4X43 A;  3F3Q A;  2JSZ A;  3FYG A;  4POK A;  3VPQ A;  2DC5 A;  1VF4 A;  2FNO A;  4EIP A;  1VF3 A;  2WDU A;  4FQU A;  3Q19 A;  2FUG 2;  4GCI A;  3TKS A;  1SJI A;  3GKM A;  2X49 A;  1ZCP A;  2L6D A;  1FAA A;  2PGT A;  3C8E A;  1Z6M A;  4N0V A;  3ISO A;  1HNC A;  5IOW A;  2IY2 A;  5F05 A;  4IBP A;  1TP9 A;  2LST A;  2VCW A;  3H79 A;  3IOS A;  5HR2 A;  2MBT A;  1TK8 B;  1XBS A;  5J41 A;  3IPZ A;  4MJA A;  3TJK A;  3GMF A;  5KOW A;  4MCU A;  4K7I A;  3LJR A;  2H01 A;  1GP1 A;  5IOX A;  1ON4 A;  1YEP A;  1XFL A;  4PXO A;  4FO5 A;  1O8W A;  3CBU A;  1V58 A;  4MJC A;  4LMW A;  2WFC A;  5D9X A;  3TRX A;  1CQG A;  3V1W A;  4BWQ A;  1Z5Y E;  2JSY A;  3H1N A;  2AUV A;  3W8S A;  1FW1 A;  2GLR A;  1Q98 A;  4PNF A;  1A2L A;  3WT1 A;  4KW6 A;  2QA1 A;  4JZQ A;  3EE2 A;  2IME A;  1SD9 A;  2R5G A;  1X5E A;  2CX4 A;  3GUR A;  5ECQ B;  2H0I A;  5JWQ B;  5AGY A;  2DJK A;  3APO A;  2RUF A;  3C1S A;  1X5D A;  4MNN A;  4HJM A;  3TB2 A;  1PA3 A;  4WF4 A;  3ERF A;  1GNE A;  1ZGN A;  2EIQ A;  1TDI A;  4Q5Q A;  4K7O A;  2OE1 A;  1ABA A;  4ZL7 A;  4NAX A;  1DE2 A;  4PQH A;  3A2W A;  4BVX B;  3TJB A;  3BOA A;  3H93 A;  3ZLP A;  2WUL A;  2YCD A;  1B8X A;  1EOG A;  22GS A;  4F03 A;  3BBY A;  4CDO A;  4N0Z A;  1R7H A;  2VLT A;  4F0C A;  1AC1 A;  4MK3 A;  10GS A;  1IYH A;  3ME8 A;  4TXO B;  1I9D A;  2IMD A;  4KCE A;  4L0W A;  1SL1 B;  4IJI A;  5KN1 A;  3L9S A;  4GQF A;  5A5K A;  4F9Z A;  5LNK e;  1F2E A;  5ID2 B;  5CAX A;  1GL8 A;  3O76 A;  4GRF A;  4L0U A;  2I81 A;  1GH2 A;  1R4W A;  5CRH A;  1F3B A;  5ECR B;  5IMZ A;  5INY A;  2VL2 C;  5IMA A;  3HDC A;  3UJ1 A;  2F3M A;  3P2A A;  2QGV A;  3FZ5 A;  5IMC A;  4L5O A;  4HQZ A;  1A0F A;  1PL2 A;  3IK7 A;  1XPV A;  3P8W A;  2E0Q A;  2PPT A;  2IN3 A;  3FKF A;  2R6K A;  1AQX A;  1MDI A;  4AF2 A;  1RW1 A;  2X8C A;  1PKZ A;  4KDY A;  1M0U A;  3WGE A;  1AXD A;  2FCH A;  2I1U A;  5B8A A;  3I6A A;  1Y25 A;  2HFD A;  2FWG A;  1QGV A;  1Q4J A;  2CVK A;  3UIW A;  2X4A A;  1SKR B;  6GST A;  5DVB A;  2BTO T;  5D93 A;  2L4C A;  5HFK A;  3RPP A;  1VRS D;  3KH9 A;  4KH7 A;  4IHU A;  1T00 A;  5D9T A;  1TRS A;  2IMK A;  4O7H A;  4JED A;  1NW2 A;  3FR6 A;  2P0G A;  1PRX A;  4OO4 A;  1WWJ A;  5ECM B;  5C04 A;  2HRF A;  2I9H A;  2WS2 A;  1FVJ A;  2OJL A;  2O8V B;  3IBH A;  3TCO A;  2VM1 A;  2DJ2 A;  3E3E A;  1XXU A;  3LW9 A;  1EV4 A;  1GLP A;  4IVF A;  1U6T A;  3N9J A;  4EXJ A;  1GUK A;  3EYT A;  5F0G A;  2F9S A;  1T3B A;  1ILO A;  1ZMA A;  4Z2U A;  1K0M A;  2OE3 A;  3LGC A;  1JLV A;  3F0I A;  1E6B A;  4ZL9 A;  3UAP A;  2Z9S A;  1LJR A;  1Z3E A;  1AQV A;  3M9J A;  2OBK A;  1GUL A;  11GS A;  5B6M A;  5KEJ A;  1QUW A;  3HJO A;  2FD3 A;  4HU7 A;  3IV4 A;  1CQH A;  3UBK A;  5D9W A;  1NSW A;  2A2S A;  3TJJ A;  18GS A;  4QL7 A;  1GTA A;  1AUC A;  1TW9 A;  4K2X A;  4XIH A;  1NM3 A;  4NV5 A;  3UVT A;  5DDL A;  2TIR A;  3HJP A;  3QPM A;  4IS0 A;  3I69 A;  3G9B A;  4QL9 A;  2AJQ B;  4P3Y B;  3UMA A;  1XWG A;  20GS A;  4FH8 A;  2WB9 A;  14GS A;  3HKR A;  4GTU A;  5CO3 A;  1K0D A;  1G6Y A;  1ZOF A;  3HA9 A;  1JZD A;  5GZZ B;  1Z7P A;  4Q5N A;  2IMF A;  2GTU A;  2GSS A;  5COH A;  5C00 A;  3U6V A;  1G7O A;  1ERW A;  1SEN A;  2V6O A;  3KMN A;  2MYG A;  1M7T A;  1BJX A;  1K0O A;  5CP1 A;  2DKH A;  1GWC A;  2JL4 A;  2CVB A;  4K5S A;  2MBS A;  1ST9 A;  1ERU A;  2IL3 A;  1OE7 A;  3Q6O A;  1OE8 A;  1XW6 A;  4J2F A;  2H6Z A;  4MZW A;  2IWT A;  4WEY A;  5DAK B;  4BWS A;  4FYC A;  5ECS A;  2LNS A;  3AY8 A;  5L71 A;  3L0H A;  5AIV A;  2WRT A;  3DD3 A;  3HVS A;  2YZU A;  2PMT A;  5DBQ A;  4AJ7 A;  2HLS A;  4BVX A;  2B6M A;  2RII A;  2IFQ B;  1LU4 A;  4V2M A;  1PSQ A;  2YOI A;  4ZXG A;  1GUH A;  2MMN A;  5B7C A;  4MJB A;  3GIX A;  4NWY A;  3ZRE A;  4XRA A;  1JLW A;  4I2U A;  1T8E B;  5F8B A;  3IAS 2;  1F9M A;  3QFB C;  4KE3 A;  3VK9 A;  2F51 A;  4RI7 A;  4XS1 A;  3DRN A;  2AYT A;  3FMW A;  4N30 A;  4TXO A;  2HZE A;  4G0K A;  1Z7R A;  4G0L A;  4ZBB A;  4ZB9 A;  4ECC A;  2F8F A;  5CRG A;  3EC3 A;  1TTZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...