5G1LA

A double mutant of dsbg engineered for denitrosylation
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
228
structure length
228
Chain Sequence
LPAPVKAIEKQGITIIKTFDAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNTLIEKEIYAPAGREMWQRMEQSHWLLDGKKDAPVIVYVFADPFCGPCKQFWQQARPWVDSGKVQLRTLLVGVIKPESPATAAAILASKDPAKTWQQYEASGGKLKLNVPANVSTEQMKVLSDNEKLMDDLGANVTPAIYYMSKENTLQQAVGLPDQKTLNIIMGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords THIOL DISULFIDE INTERCHANGE PROTEIN DSBG
publication title Sulfur Denitrosylation by an Engineered Trx-Like Dsbg Enzyme Identifies Nucleophilic Cysteine Hydrogen Bonds as Key Functional Determinant.
pubmed doi rcsb
source organism Escherichia coli
total genus 67
structure length 228
sequence length 228
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 5g1lA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5g1lA02
3VPTA 2EIOA 2GZPA 4MPGA 2ES7A 5DQYA 2C0FA 1A2MA 2B1LA 5KN0A 1HNAA 5KEJA 4HDEA 5EPFA 2GLRA 3QOUA 5GSSA 2BTOT 2PPTA 6GSSA 2K8VA 4ECBA 2DJKA 1T1VA 3KP8A 3P8WA 2KUCA 4OCFA 4KE3A 1V40A 2J9HA 2RM6A 2GQKA 4WBJA 4TXOA 3TOTA 5ECNB 4EXJA 1X5EA 1H75A 1O8XA 1WJKA 1NHOA 5IMCA 2X8CA 1BAYA 2B7KA 1EGOA 3U6VA 2H6ZA 5ECRB 1Z6MA 2PBJA 2HE3A 4TW5A 5LD0A 3DWVA 3TB2A 1YDKA 1AIUA 1TTZA 1ILOA 4BWQA 4KCEA 2VAFA 4FYBA 1TKDB 3WT1A 3BCKA 5DBQA 2FUG2 3IAS2 5D9WA 1XOBA 4POLA 2GSQA 3KXOA 5IPHA 1MD3A 5KN2A 4OWYA 1M2DA 4I2UA 4E8EA 2EIQA 1SKSB 2LNSA 3C1SA 1K0DA 3IE3A 1XZOA 2GZZA 3HXSA 2O7KA 5JWQB 1XWBA 1Z7RA 1AUCA 4F82A 1TU7A 4KW6A 2WRTA 5CAXA 4HUAA 5ECQB 3C7MA 4PUAA 3TKRA 2PVQA 5E59A 1WPIA 5D73A 3Q19A 2AB6A 1RQMA 2B5EA 1OKDA 3F3RA 1PD21 3J7Yb 4I5QA 3O3TA 1S3DA 3TRQA 1SJ6A 1HYUA 5CRWA 2BMXA 5IO2A 4BVYA 1ZL9A 4I2TA 3L9SA 3KZQA 4GRFA 1XIYA 1OE8A 4BPYA 2GDRA 4KGIA 1SYRA 4GLTA 5IQYA 5CP1A 3TJBA 4MJBA 2CVBA 3WGDA 4HQSA 4L0WA 1FG4A 4PQIA 2PMTA 3TKSC 2H1GA 5ENUA 2OKAA 3I6AA 3M9JA 3ZYWA 1TJDA 3HVSA 2JZRA 4NMUA 1YEPA 2DLXA 3FYGA 4MMMA 4WR4A 2HZEA 2P5QA 1GLQA 3VWWA 3IK7A 2H30A 5DVBA 2VLVA 2XBQA 2VD1A 2O87A 3G7IA 1PKZA 4MJEA 1GLPA 3GTUB 4DSSB 1JLVA 4XCSA 3IDVA 2H0GA 3I69A 1EP7A 3DGQA 3HJMA 4KSOA 3KTLA 5INYA 3CSIA 2TRCP 2YANA 4ULXA 4TOPA 4XS1A 3C71A 3KIJA 5IMAA 2X8HA 1SJZA 3ZIJA 4FYCA 2H73A 2CV4A 1XWCA 1PN9A 3IHQA 3IXRA 1Q98A 3APSA 1F37A 2LSTA 4O7HA 1A2JA 2YWMA 4HU9A 1GTUA 1T4YA 5H5SA 4XS4B 2YWIA 3HDCA 1KEBA 2F51A 3TJKA 3TKPA 4LMWA 4L5OA 2OA7A 2YV7A 2VOCA 3HHVA 2ALBA 5DCHA 1V58A 4V2MA 4KUNA 5DCGA 1FOVA 3VK9A 2P31A 1K0NA 2DMMA 4KB3A 2V32A 3HZ4A 1R4WA 3HY2A 1K0MA 2HZFA 2WJUA 3KH7A 1CQHA 1NHYA 2X8GA 5G5EA 2IJYA 5DAKB 3RAZA 5J9CA 4MF7A 5J41A 1X9WB 1QK8A 1M7TA 5E4WA 3APOA 3H93A 1OVNA 3A2WA 1SYXA 5ID2B 2LNTA 4GF0A 1GSEA 3FR9A 1EV9A 2OACA 4V2LA 1OC9B 1XBSA 4WBRD 1X9SB 5IMDA 2JU5A 3QAGA 13GSA 4ZB8A 2DJ2A 4RI7A 2RM5A 2L59A 3ZVJD 2GSRA 5DJLA 1YJ6A 4OD7A 2XC2A 2L5OA 4EO3A 2E0QA 3OR5A 3LXTA 4F0CA 4WEYA 5B6NA 1ZGNA 1DUGA 1TOFA 3RDWA 3FHKA 1ZYEA 4NPBA 2K9FA 4NHWA 3CBUA 2ON5A 3KP9A 1GH2A 4TR1B 4IHUA 4MPFA 4EDZA 2PVOC 3DKSA 4ZILA 4IQAA 3EVIA 3D21A 4IELA 4PXOA 1HQOA 2LQOA 4XRDA 4GCIA 4JZQA 1SKRB 1WOUA 1PMTA 12GSA 5A5KA 3ZMKA 2MMNA 5HR3A 2C3TA 1Y25A 2ZNMA 1FB6A 2VM2A 2YOIA 5G31A 4J57E 4HU7A 4PNGA 2FY6A 2H70A 3GX0A 5G5FA 4JU5A 1K0BA 1XXUA 1O7UA 1O6JA 5ECSA 1ERWA 1OYJA 4N0VA 3ZFBA 2VCWA 4L8EA 3D4MA 4FO5A 1T8EB 1OE7A 2MZCA 3GA4A 4ZBDA 1FB0A 1LBKA 3W6GA 2NPBA 1TP9A 1O73A 5DQSA 1KTEA 2MMZA 1VF3A 3BD2A 2YN1A 1DE2A 3US3A 2R6KA 3GL3A 3Q74A 4MH2A 5COHA 3VWVA 2C8UA 1EP8A 2PUKC 4XRAA 4P3YB 1O8WA 4O32A 1B9YC 2R3XA 2REMA 4Q5NA 1F3AA 3RPNA 2M72A 5C00A 3GKKA 1SK2A 3IPZA 3O76A 3WGEA 4LMVA 1OC3A 2WGRA 4O5RA 1IYHA 3KGKA 4CHSA 1GTAA 1Z6NA 6GSXA 1SL0B 3C73A 3IBHA 3ZFLA 5HQPA 1JFUA 3F4SA 5H5RA 3N9JA 1Z9HA 5HFKA 2IMEA 4MZBA 3TOUA 4KDUA 4ID0A 4V2NA 4GSNA 3C8EA 5KN1A 2PWJA 5ECIB 4PQ1A 1GULA 3HVVA 5GAND 4ZL8A 5FT3A 5D9XA 1SD8A 2DIYA 2HSYA 3MAKA 5J3RA 2YCDA 3J7Yk 2C80A 3U5RE 1WMJA 4TR0A 2MMAA 4OO4A 3LJRA 3F3QA 4RI6A 5DJMA 4IVFA 5D8IA 4XHMA 1DSBA 3A2XA 2MMOA 4ZL7A 2GSSA 3G7YA 1E6BA 5B6MA 2K6VA 1LJRA 3M3MA 1VRSD 2GQLA 4AJ7A 3IV4A 3CRTA 2HXKA 4AJ6A 4YQVA 4N0ZA 4XTSA 3PH9A 4Q5RA 2H8LA 3QD9A 2H1DA 1G0TA 1TU8A 4RQXA 4LL4B 3CTGA 1M9AA 1EOGA 2WS2A 3FR6A 3A3TA 1XVQA 3FY7A 4DSSA 3KD0A 2E2GA 1XWAA 2TIRA 2WDUA 1ZOFA 2ZUPA 3H79A 3GMFA 2O85A 2BJXA 5DALB 2L57A 4JBBA 2V41A 1JZOA 2IMDA 3C1RA 4DVCA 1Y6EA 2LUSA 1K3LA 4NXIA 4K6XA 1GSUA 2B6MA 3IK9A 3ZREA 3UEMA 3APQA 1GSYA 1AW9A 4MF6A 2IMIA 2F9SA 1VGLA 2H76A 2F8FA 1XVWA 6GSUA 1GP1A 3ZIVA 3A5WA 4ZIJA 4IQ1A 5HR0A 1CQGA 1UVZA 5FHIA 2E2MA 2L5LA 1WE0A 1GSQA 2JL4A 3HD5A 1EOHA 3M1GA 3KMOA 1SL2B 4YAVA 3UBLA 3ERGA 4N11A 1OC8A 4KA0A 2P0GA 3TDGA 1A0FA 4K7NA 2V2GA 5EY6A 5KN3A 1ERUA 2VL2C 3TJFA 4AF2A 1U3AA 2N5BA 1OC9A 4IP1A 1PL2A 4H86A 5EVOA 4HI7A 1BX9A 1E2YA 1K0AA 4EKZA 4K0NA 3LORA 5D93A 3GN3A 1MDKA 4MLYA 1G6YA 4ECIA 4D73A 3UAPA 3LWAA 1RW1A 1SD9A 2DJ3A 3LSZA 4ML1A 3VFIA 1VF1A 2B7JA 4F9ZA 1Z3EA 3EYTA 4Q5FA 4ECCA 4IKHA 2GVPA 2YPMA 4ZB9A 2TRXA 5GZZB 5ECHB 2L4CA 2IY2A 1H4OA 3ME7A 4PURA 1ABAA 5AN1A 3EINA 1S3AA 4HJ2A 1J9BA 10GSA 3ED3A 2HYXA 5CRDA 3TJJA 2A2SA 2I4AA 2DJ0A 2DMLA 2NBSA 2XPEA 3QAVA 1TK8B 3G7JA 2JACA 4HOJA 2QGVA 1PX6A 5J5NA 3CXGA 1MTCA 2HRFA 2IMKA 3BJ5A 4HZ4A 1WWJA 2E7PA 1R5AA 2EC4A 3CMIA 2FGXA 3D6IA 3GH9A 5JCWA 1JZWA 1EEMA 5IMVA 3V1WA 3GURA 3HVXA 2GTUA 1UN2A 1FW1A 4PUFC 3KMNA 1XCCA 2IN3A 5C04A 2I3YA 2FA4A 3ZVJA 2AAWA 5A4UA 3UMAA 4IGJA 3W8JA 3UOMA 2VCXA 1PA3A 3GNJA 3SBCA 3GKXA 4L5LA 2N5FA 5ECOB 2CX4A 3GX8A 5AISA 3E9JB 3FZ9A 3CTFA 2OBKA 2VLUA 1TRVA 3FK8A 2VIMA 4KAEA 1F9MA 5IIZA 2HSHA 1A23A 1R5PA 5IOWA 4TKYA 1A8LA 4QL7A 3UL3A 1NM3A 3HYPA 3BBYA 2FWHA 4G10A 4OFNA 5F07A 2VL3A 5F8BA 3D22A 2H71A 1QMVA 4HS1A 4F2IA 2FHEA 4EDYA 1F3BA 1GNEA 5D9TA 5IO0A 3LQ7A 4K2DA 4PQHA 2LJKA 1GUMA 2JSZA 2V6OA 1BYEA 2R2JA 3ZMLA 1SJIA 1BG5A 3H1NA 4G2EA 2WZ9A 2I1UA 2NTOA 4J2FA 5IMZA 1FHEA 1THXA 1X5DA 4ZBBA 2OADA 3W8SA 1ERTA 2VCQA 3HCZA 2MYGA 3PGTA 3VPQA 3EURA 2C3NA 1PL1A 5JCUA 1QXHA 4DSQA 3TKQA 1ON4A 5CNWA 3FEUA 1TRSA 3R2QA 4MF5A 3GSTA 1SK0A 5FWGA 2YJHA 1B48A 1YEXA 2FWEA 1SENA 2H6XA 2X64A 4EUYA 1QFNA 3FRCA 3DIEA 3JCML 2D2ZA 2X99A 4MH3A 17GSA 2IL3A 3LGCA 2HLSA 2KP2A 3DXBA 4FIWA 1GSSA 3IR4A 3ZLPA 4X0XA 1M99A 2NDOA 4IP6A 2RLIA 3QCPA 4AGSA 3DD3A 1YY7A 1M0UA 2GT6A 1B4PA 2DSAA 3Q18A 2HFDA 2HZEB 4NWYA 5HR1A 4V1Ap 3GV1A 2LEGA 3DYRA 1PRXA 1X0RA 3HJOA 5F05A 4ILFA 2B5YA 3FR3A 3EC3A 2C0GA 3I9V2 2I9HA 3H4KA 1XWGA 4O92A 4CW9A 2M80A 4HJMA 2C0DA 2VCZA 2XBIA 2H0IA 1TRUA 1WP0A 3GKMA 4KDXA 3TRPA 5IOXA 4I6XA 2IPAA 5JCGA 2LRNA 4OO5A 2IFQB 5CREA 4YQUA 3D0ZA 4IN0A 1HNBA 2CZ3A 3KM6A 4MJCA 2PU9C 1X5CA 2R5GA 1MDIA 2IWTA 1U6TA 2WULA 2YWOA 2FD3A 4QL9A 2F8AA 5ECPB 2MBTA 2DJ1A 3DVXA 3A2VA 2ON7A 2YZUA 3TKSA 4K7IA 3HZ8A 2YZHA 4MA9A 2H0HA 4TN8A 3QPMA 3F4RA 1USBA 5HFGA 1V2AA 3CYNA 1T3BA 1SKWB 4IJIA 2VUPA 3WT2A 4YAPA 3GUSA 3I43A 1OKTA 1YF1A 2VO4A 3EMPA 3UVTA 1I9DA 6GSTA 5B7CA 16GSA 2GT5A 1GSDA 2PERA 5AIXA 3KEBA 4Z7XA 1M9BA 3F9UA 1PKWA 3O6TA 5ECKB 1SL1B 3KTBA 3ERFA 3F0IA 3VWUA 3M9KA 4GTUA 3L4NA 7GSSA 1X9MB 1XW5A 3L0HA 2YNXA 3HA9A 3RBTA 3NIVA 1GUHA 3L9VA 4BVXA 4IW9A 1PX7A 4ZBAA 2CAQA 3LEFA 2L6CA 3CRUA 1N8JA 3FZ5A 1B9XC 4NV5A 3ERWA 5F06A 5CRHA 4N30A 2JZTA 1R7HA 4TRXA 4MJAA 2JADA 3F8UA 1VF4A 2C1YA 1THOA 4GQFA 1GTIA 2WFCA 1FVKA 4F0BA 2AUVA 1U3IA 2HNLA 3S9FA 2LRTA 4GQCA 1GWCA 1WRYA 2N5AA 2FWGA 3GTUA 2VL9A 2IYJA 3HJPA 2CA8A 5JWRB 1YF0A 3P90A 4GWRA 2IMFA 1HNCA 4RQRA 2WCIA 3MWHA 5LCZA 5IMFA 5CRGA 3ZZXA 2H6YA 3DEXA 5G2ZA 2QSIA 3NZNA 3UBKA 1W4VA 3PINA 4IS0A 1XW6A 1QUWA 2G2QA 1VF2A 3G9BA 1Z5YE 3L78A 1TXXA 4XS4A 6GSYA 4WXTA 1OAZA 1YZXA 3LYKA 4Q5QA 4QQ7A 4I97A 5F0GA 2LKUA 3P7XA 2AV4A 3GYKA 2XHFA 2B5XA 3CSJA 1A2LA 2LS5A 2DJJA 1C72A 3PR8A 1F2EA 1GTBA 2MBSA 2VCTA 2CVKA 3VWXA 3GSSA 4WKWA 1EGRA 1PGTA 3M8NA 1UC7A 3FKFA 4CDOA 4K7OA 2OE0A 4WF5A 2JZSA 1J08A 4DEJA 2GZYA 3UVHA 4K9ZA 2IIYA 4LLRA 3AY8A 1ZYQB 5J9BA 5DAKA 3D4TA 1AQXA 1KBNA 4EVMA 1A8YA 4IBPA 2B1KA 4OFMA 3E0UA 3CSHA 1G7EA 3EU4A 4KDYA 5ID2A 2C3QA 2Z9SA 1F6MC 3KJYA 1EWXA 3Q6OA 1ZMAA 5HFIA 4POMA 1WIKA 1U88A 2ZCTA 1GNWA 1DE1A 3LFLA 2CZ2A 1J0FA 1BJXA 3QR6A 5A4VA 3EMXA 4KNDA 4YH2A 2L4QA 4WETA 4MZCA 1T4ZA 4X43A 1O85A 14GSA 4JE1A 2JSYA 1U87A 4FYUA 4F03A 3D5JA 3IA1A 3MSZA 2J23A 3IC4A 4TR1A 4TR4A 1T00A 1LU4A 3NOFA 4G9HA 2CQ9A 3GKNA 1YKAA 4WR5A 1A24A 5G1KA 2VCVA 4MABA 3UARA 1XFLA 5ECLB 2HI7A 5G1LA 3IRAA 1TDIA 5GSTA 4MCUA 2LJAA 3SWLA 2O8VB 1JZDA 2I81A 1O81A 2FWFA 3VI5A 2LV3A 5HR2A 1QQ2A 3MDKA 2H66A 4TXOB 1GL8A 3QMXA 3TJGA 2DBCA 5CYYA 4V1Ag 2B3SA 1RK4A 1V9WA 5JWOB 1AQVA 1SU9A 4XS6A 3LYPA 1N2AA 2A2RA 4J56E 1Z7PA 20GSA 2KHPA 4NV2A 1JLWA 1GRXA 4FH8A 5ELAA 3ZITA 1K3YA 6GSVA 3GRXA 4PGTA 1YQ1A 2A4VA 2CVDA 2P5RA 3GFKA 1FVJA 4GSSA 2YP6A 4ZXGA 2GGTA 4DSRA 2IFQA 2VM1A 3N5OA 1V98A 1JHBA 2XPDA 4JR6A 1NW2A 2V1MA 1A0RP 5D96A 4K0GA 4NHZA 3ZTLA 1Q4JA 2QKEA 5LNKe 1ML6A 4KSMA 5ABRA 1JZRA 1K0CA 2H1AA 1ZZYA 4HEA2 3RHBA 2H19A 19GSA 4NAXA 2EIRA 1ACVA 3LXZA 4IJ3A 1BQ7A 2DC5A 2VLTA 2FNOA 5CO3A 3P2AA 3ZL5A 4ECJA 4N10A 2GQMA 3UJ1A 3BCIA 4MDCA 3HKRA 4K1FA 2LJRA 4ZB6A 3TGZA 4JR4A 1MD4A 1EEJA 2RUFA 4E8HA 1QGVA 4MZWA 4KX4A 2H75A 3KH9A 3VLNA 1IYIA 1XPVA 3GIXA 1XOAA 4RUVA 2YV9A 2NVLA 2F3MA 1G7OA 3F4TA 1ST9A 1TRWA 2OJLA 3BOAA 4ACSA 3F63A 1S3CA 1M2BA 4GXZA 4BA7A 2FLSA 4D73B 5GAPD 5EL8A 1B8XA 2AJQB 1M2AA 2H1BA 1K0OA 4AJ8A 2KP1A 2WB9A 2H74A 3FZAA 9GSSA 4BWSA 2CX3A 2FA8A 2H72A 2QC7A 3EE2A 4ML6A 2AHEA 4EC0A 3WGXA 4POBA 2R4VA 4PX1A 5B8AA 5AGYA 1V57A 4JRRA 1FAAA 2H01A 2HRNA 4GSTA 3FZ4A 3QAWA 1G6WA 3DVWA 2LQQA 3TCOA 5A4WA 3TKSE 4HZ2A 3TUEA 3L9UA 1BEDA 3VURA 1AQWA 2HT9A 5B8BA 1R26A 1TI1A 3EU3A 2C4JA 3F6DA 3ZRDA 2CAIA 3RHCA 5G30A 4JEDA 5DALA 2DIZA 1ERVA 1PSQA 1AXDA 4HQZA 4ZL9A 2C0EA 5H5QA 4K8MA 1PQNA 5DDLA 4ISDA 2K18A 2VL2A 22GSA 1MDJA 4LL1B 1DBYA 2FCHA 3DRNA 3QDNA 1T7PB 3UIWA 3ISOA 2KOKA 6GSWA 4LA1A 2YJ7A 3IAM2 1TW9A 5AIVA 1TI3A 1MEKA 1EV4A 1GSFA 3RPPA 4XIHA 3TRXA 4PNFA 5J4UA 2PN8A 4WF4A 8GSSA 1TK5B 4I8BA 3KCMA 1KNGA 5ELGA 2V6KA 3E3EA 1GUKA 3K8NA 1I5GA 1XW9A 4X1UA 2L6DA 3DMLA 1TK0B 3GH6A 3MNGA 1EZKA 2YWNA 4OMVA 3H8QA 2K8SA 3EWLA 3QFBC 4TXVA 2CT6A 2O89A 2R37A 2RUEA 4TVEA 4OFTA 5D9VA 1XWKA 2AYTA 2OE3A 2PGTA 3FW2A 2G0FA 4BL7A 1URMA 2M46A 4G19A 3VI7A 2VD0A 1K3OA 3IOSA 4L0UA 1UA5A 3QFAC 4YQMA 2RIIA 2GSTA 1HD2A 5ECMB 2OBIA 4EL1A 1YKCA 5IM9A 2LRCA 3GHAA 18GSA 1W89A 2GS3A 3F6FA 3WYWA 4KH7A 3LG6A 4KCAA 2KLXA 1NSWA 3WD6A 4EE0A 1FO5A 3ME8A 5IPGA 1SK1A 1ZCPA 1AC1A 11GSA 4TR3A 2OE1A 3GL5A 4MP4A 4EF0A 3M0FA 4MK3A 1AAZA 5L71A 2LTKA 4POKA 1B4QA 4OCEA
chains in the Genus database with same CATH superfamily
3SVAA 3FH1A 3VPTA 2EIOA 2GZPA 2F56A 3FKAA 4MPGA 4KVHA 2ES7A 2D1WA 5DQYA 2C0FA 1A2MA 1RCKA 2B1LA 5KN0A 1HNAA 5KEJA 4HDEA 5EPFA 3I0YA 2GLRA 4N6V0 3QOUA 5GSSA 2BTOT 2PPTA 6GSSA 4X2HA 2K8VA 4ECBA 2DJKA 1T1VA 3KP8A 3CCS3 3P8WA 1I2EA 2GSPA 2W04A 3NM7A 2KUCA 2OOVA 1FOHA 4OCFA 4KE3A 1V40A 2J9HA 4KZ1A 1YJN3 3SEDA 2E2TA 2GQKA 2RM6A 2C11A 3LOYA 4J8TA 1DE3A 4WBJA 1JB2A 4TXOA 4BIKA 1T2IA 3TOTA 5ECNB 4EXJA 1X5EA 1H75A 1O8XA 1WJKA 4WFOA 1NHOA 5IMCA 2X8CA 1BAYA 2B7KA 1EGOA 2CG0A 3Q2PA 3U6VA 2H6ZA 5ECRB 4BL3A 1Z6MA 2PBJA 1X1UA 3PS8A 1IVXA 2HE3A 5DRVA 4WYKB 4TW5A 5LD0A 3DWVA 3TB2A 1YDKA 1AIUA 1TTZA 1ILOA 1O7GB 3DUKA 4BWQA 2YFJB 4KCEA 3JUOA 2VAFA 1Q9EA 4FYBA 1TKDB 3WT1A 3BCKA 5DBQA 2FUG2 1SARA 3IAS2 1XOBA 5D9WA 4POLA 1NNVA 1X1XA 3RDEA 1B2UA 2GSQA 3KXOA 2HMNB 3S27A 5IPHA 1MD3A 5KN2A 3F8HA 4OWYA 1GMPA 1M2DA 4I2UA 3GWRA 3S29A 4E8EA 2EIQA 1SKSB 2LNSA 3C1SA 1UUVB 1K0DA 3IE3A 1XZOA 5AI1A 2HRKA 2WOFA 2GZZA 3HXSA 4K1UA 2O7KA 5JWQB 1B2ZA 1XWBA 4RNTA 1OCVA 1Z7RA 1AUCA 4F82A 1TU7A 4KW6A 2WRTA 1YJW3 2HMLB 3ER7A 5CAXA 4HUAA 5ECQB 3OW22 3MYTA 1N5PA 3C7MA 1TIJA 4PUAA 1Q824 1VQ83 3TKRA 1VQ43 2WOHA 3SLUA 2PVQA 5E59A 4X2OA 1Y4KA 3LTAA 1WPIA 5D73A 3Q19A 2AB6A 2CKFB 1RQMA 2B5EA 1FUTA 1NB5I 1OKDA 1BNIA 4O5QA 3F3RA 1PD21 3WMDA 3J7Yb 4I5QA 3O3TA 1S3DA 3TRQA 1SJ6A 1OGZA 1RRHA 1HYUA 3BU4A 5CRWA 2BMXA 2M7OA 5IO2A 4BVYA 1ZL9A 4I2TA 3LTDA 3EX9A 3KZQA 3L9SA 1NO3A 4GRFA 1XIYA 2RSXA 4Z2TA 1OE8A 5HOHA 4BPYA 2GDRA 4KGIA 1SYRA 4GLTA 5IQYA 1IDPA 3EQQB 5CP1A 5AYSC 3TJBA 4K90B 3G8ZA 2CVBA 4MJBA 3WGDA 4HQSA 4EIQA 4L0WA 7STDA 1FG4A 4PQIA 2PMTA 3TKSC 2H1GA 5ENUA 4BVXB 2OKAA 3I6AA 1TRPA 2HRAA 3M9JA 3ZYWA 4HOHA 1TJDA 3HVSA 5EVHA 1BU4A 2JZRA 3WHOA 4NMUA 4IIAA 1YEPA 3GZRA 2DLXA 3MG3A 4HM8B 3FYGA 4MMMA 3MIXA 2XR8B 1XG8A 1RCLA 4WR4A 2HZEA 2P5QA 1GLQA 1YI23 4N6NB 3VWWA 3IK7A 2H30A 5DVBA 2XRXB 2VLVA 2XBQA 2VD1A 3D3LA 2O87A 1ZYNA 3KFQC 4J5GA 1PKZA 3G7IA 4MJEA 1GLPA 4O02B 3GTUB 4DSSB 1JLVA 4CY6A 4XCSA 3IDVA 2H0GA 3I69A 4H3UA 1EP7A 4YKGA 3DGQA 3DGLA 3HJMA 4KSOA 3KTLA 5INYA 3CSIA 2TRCP 1IVUA 1DVDA 2YANA 4ULXA 4TOPA 2GU3A 2CWVA 3HX8A 2HSMA 3DGYA 3C71A 4IT7A 3KIJA 3T8UA 4XS1A 5IMAA 1G96A 2X8HA 1SJZA 3ZIJA 3WODG 4FYCA 2H73A 2CV4A 1XWCA 1PN9A 3IHQA 3NBJA 3IXRA 1Q98A 3APSA 4FCZA 1F37A 1N5HA 2LSTA 4O7HA 1A2JA 2YWMA 4HU9A 1GTUA 1T4YA 5H5SA 4XS4B 4KFDA 3KN4A 2YWIA 1IQXA 3HDCA 1KEBA 3FLJA 2F51A 2KF5A 3TJKA 3TKPA 4LMWA 2UZ8A 3HOHA 4L5OA 2OA7A 1ZO2A 2YV7A 1B2MA 2VOCA 4R80A 2CFWA 3HHVA 2ALBA 4R9LA 3IPTA 5DCHA 1V58A 1F8NA 4V2MA 4KUNA 5DCGA 3K9MC 1FOVA 3VK9A 1QAKA 3LTBA 2P31A 1K0NA 4X4JA 1DMNA 1QJGA 2Z7AA 2DMMA 4KB3A 2V32A 3HZ4A 1R4WA 3HY2A 1K0MA 2HZFA 2WJUA 3KH7A 1YVBI 1CQHA 1N8QA 1NHYA 2X8GA 5G5EA 2IJYA 5DAKB 3RAZA 3VF1A 5J9CA 4MF7A 5J41A 3NM2A 1X9WB 5LC6A 1QK8A 1M7TA 5M19A 1J2BA 2LTKA 5E4WA 1T2HA 1LOVA 3CCJ3 3APOA 1LRAA 1QVF2 3FMWA 3H93A 1OVNA 3A2WA 1SYXA 5ID2B 3GZYB 1I8VA 2LNTA 4GF0A 1GSEA 3FR9A 1EV9A 3F8XA 3FSDA 2OACA 4V2LA 1OC9B 1I2FA 1UCIA 1XBSA 4WBRD 4GB5A 1N9EA 1X9SB 1FGTA 5IMDA 4K1VA 3CCM3 2JU5A 3QAGA 1MWSA 1R4CA 13GSA 2BNGA 4ZB8A 2DJ2A 4RI7A 2RM5A 2L59A 3ZVJD 2GSRA 1YJ6A 4OD7A 5DJLA 1KD14 3X41A 1LOXA 3E99A 2XC2A 2L5OA 1RLSA 4EO3A 2E0QA 3OR5A 2BMRB 3LXTA 3K5TA 4F0CA 3VSYA 1DETA 4WEYA 5B6NA 1WMOA 1ZGNA 1DUGA 1TOFA 1CQSA 1GOUA 2AADA 3RDWA 2OCTA 3FHKA 5M1AA 1ZYEA 4NPBA 2K9FA 4NHWA 3CBUA 2ON5A 1OUNA 3KP9A 1TUHA 4FCMA 2W56A 3CCV3 1GH2A 4TR1B 1BRJA 4IHUA 4MPFA 4EDZA 2PVOC 3DKSA 1BNFA 4ZILA 4IQAA 1I0VA 2Y73A 6RNTA 3EVIA 3D21A 4IELA 5G2GA 2K0MA 4PXOA 1HQOA 2LQOA 4XRDA 4J5KA 1EQKA 4GCIA 4JZQA 1SKRB 5CXOA 1PMTA 1WOUA 12GSA 1RTUA 5A5KA 3ZMKA 2CG1A 2MMNA 4N6TA 5HR3A 2C3TA 1Y25A 1BRSA 2ZNMA 1K41A 1I70A 1FB6A 2VM2A 2YOIA 5G31A 4J57E 4HU7A 1ROAA 4PNGA 1IQ8A 2FY6A 1ISKA 3JUQA 2H70A 1RN4A 2OWPA 3GX0A 5G5FA 4JU5A 1K0BA 1XXUA 1O7UA 4HZ9B 1O6JA 5ECSA 1ERWA 1OYJA 2YFLB 1BNGA 4N0VA 3ZFBA 2VCWA 4L8EA 3D4MA 2W6JH 4FO5A 1HZ1A 3CNXA 1T8EB 1OE7A 4FMDA 4O8SA 2MZCA 3GA4A 2OQEA 4ZBDA 3S28A 1FB0A 1LBKA 1GY6A 1YVSA 3MPHA 3W6GA 2NPBA 8RNTA 1V74A 1TP9A 1O73A 5DQSA 3H51A 1RGCA 4XB5A 1G02A 1KTEA 2MMZA 3F14A 1Q42A 1VF3A 4LMIA 3G713 2CFGA 3BD2A 1AQZA 2YN1A 1ZYPA 1DE2A 2GXFA 3US3A 2R6KA 3GL3A 3PCSA 2OTJ3 1SPUA 3Q74A 4MH2A 5COHA 3VWVA 3UB1A 1RGLA 2C8UA 3SYUA 1EP8A 2PUKC 3CCL3 3NBBA 4XRAA 5D82A 4HYZA 1RGGA 4P3YB 1RNTA 5EQLA 3EBYA 1JN5A 3RGAA 1O8WA 4O32A 2FGTA 1B9YC 2R3XA 2REMA 1F3AA 1PY3A 4Q5NA 1JBRA 2GEXA 3RPNA 2W9PA 2M72A 1B2SA 5C00A 3GKKA 1SK2A 3IPZA 3O76A 1JJ22 3WGEA 1FW7A 1W7CA 4LMVA 1OC3A 2WGRA 4O5RA 1IYHA 3KGKA 4CHSA 5ELJA 1GTAA 4MMZB 1Z6NA 3CCQ3 1QVG2 1TFOA 3Q90A 6GSXA 1SL0B 3C73A 3EE1A 3IBHA 3ZFLA 5HQPA 1JV2B 1JFUA 1VZZA 5IENA 2CHCA 3F4SA 1UI8A 5H5RA 3N9JA 4Z2RA 3D5IA 1Z9HA 5HFKA 2IMEA 4MZBA 4USSA 4KDUA 3TOUA 4ID0A 3DZLA 2SARA 4V2NA 2D42A 3CU3A 4GSNA 3C8EA 5KN1A 2PWJA 5CLKA 1B21A 3PZWA 5ECIB 4PQ1A 1GULA 3HVVA 1MWTA 5GAND 4ZL8A 5FT3A 1W2ZA 5D9XA 1SD8A 2DIYA 2HSYA 3MAKA 5J3RA 2YCDA 4NHFA 2R41A 3J7Yk 2C80A 1S5AA 3U5RE 1WMJA 4TR0A 2MMAA 4OO4A 1JKGB 4MMYB 3LJRA 2C10A 3F3QA 4RI6A 3B8LA 5DJMA 4IVFA 1GMRA 1M1XB 3NV0B 1BAOA 5BRTA 5D8IA 2ZA4A 4XHMA 1YIT3 3CC43 1DSBA 7RNTA 3A2XA 3HIIA 4L8PA 4QWTA 1A2PA 2MMOA 3T0UA 2K3DA 1ASKA 1BSDA 2R0PA 1PN0A 2MF7A 4ZL7A 1GY5A 1AV4A 1VQO3 2GSSA 3G7YA 1E6BA 5B6MA 2K6VA 2HMJB 1LJRA 2IMJA 2P38A 2E2VA 3M3MA 1VRSD 1MGRA 2UX0A 2GQLA 4AJ7A 3IV4A 2XGNA 3CRTA 2HXKA 4AJ6A 4YQVA 4N0ZA 3SXXA 4XTSA 2ML5A 3PH9A 4Q5RA 2H8LA 3QD9A 1K8A4 2H1DA 1G0TA 1TU8A 4RQXA 1IK3A 3N54B 4LL4B 3CTGA 1M9AA 1EOGA 2WS2A 3FR6A 4FMBA 3A3TA 1CEWI 2HMKB 5D81A 4OUQA 1XVQA 1PFOA 3FY7A 4DSSA 3KD0A 2E2GA 1XWAA 2TIRA 2WDUA 4LSOA 1JBSA 1ZOFA 2ZUPA 3H79A 1KQS2 2QEX3 3GMFA 2O85A 2CX0A 2BJXA 5DALB 3CPW2 2L57A 4EYCA 5CF1A 4JBBA 1ULJB 1AVKA 5IG5A 3AHSA 2V41A 1JZOA 2IMDA 3C1RA 4YKFA 1IT7A 1YGEA 3K63A 4K5SA 4DVCA 2Q07A 1Y6EA 2CFKA 2LUSA 1BUQA 2CX1A 1K3LA 4NXIA 2P0XA 4K6XA 1GSUA 2B6MA 3IK9A 4HAAA 3ZREA 3UEMA 1VQM3 3APQA 3H3HA 1GSYA 1AW9A 4MF6A 2IMIA 1NJI4 2F9SA 1VGLA 3BNCA 2H76A 6STDA 3WA2X 2F8FA 3CQFA 2IUJA 1XVWA 6GSUA 1GP1A 2WO0A 3ZIVA 1UI7A 3A5WA 2KF6A 3NXJA 2DKIA 4ZIJA 2C4BA 3B4OA 4IQ1A 5HR0A 1CQGA 2RCDA 1UVZA 5FHIA 2FNQA 2E2MA 2L5LA 1WE0A 3HK4A 1GSQA 4MEIA 2IUKA 2JL4A 1AVLA 3HD5A 5CK6A 3G16A 1EOHA 2AAEA 3M1GA 3DXOA 3KMOA 2X4AA 1SL2B 4YAVA 3UBLA 3ERGA 3X3XA 3G4S3 4N11A 2I9WA 1OC8A 1GS3A 1W6GA 4HKVB 4KA0A 2KF4A 4R1KA 2P0GA 3TDGA 1A0FA 2O3OA 4K7NA 4PTSA 1W00A 2V2GA 5EY6A 5KN3A 2XH9A 1ERUA 2VL2C 3TJFA 3D4AA 4AF2A 2XSOB 1U3AA 5KP4A 2N5BA 1FUSA 3NHXA 3URPA 1Z1SA 4BL7B 5AEUB 1OC9A 3X40A 3R3EA 4IP1A 1PL2A 4H86A 5EVOA 4HI7A 1BX9A 3LXUX 5HGRA 1E2YA 1K0AA 4EKZA 4K0NA 3LORA 5D93A 1Q864 2SBLA 3AMOB 1A90A 1RGEA 3DGMA 3V98A 3GN3A 1MDKA 3UL6A 4MLYA 1BOXA 1G6YA 4ECIA 4D73A 1K9M4 3UAPA 3LWAA 1RW1A 1SD9A 3EHCA 2DJ3A 3LSZA 4K61A 1YJ93 4ML1A 3VFIA 1VF1A 2B7JA 5JPUA 4F9ZA 1Z3EA 3EYTA 4Q5FA 4ECCA 4IKHA 2GVPA 2YPMA 4N6MA 1VQN3 3HVNA 4G0IA 4ZB9A 2TRXA 1E3RA 5GZZB 1JB5A 5ECHB 2L4CA 3MKIA 1Q40B 2IY2A 3NUVA 3Q1CA 1UUGB 1H4OA 3ME7A 4PURA 1ABAA 2OTL3 3ECFA 5AN1A 3EINA 5JPPA 1S3AA 2BMQB 1UDII 4HJ2A 2O9UX 1J9BA 1GD4A 4IPBA 10GSA 3SOYA 3SOAA 1D6UA 3ED3A 2HYXA 5CRDA 3TJJA 1O7NB 1FYSA 4CDLA 2A2SA 3AGNA 3WDGB 2I4AA 2DJ0A 2DMLA 2NBSA 1I3IA 2XPEA 4JF8A 3QAVA 1TK8B 3G7JA 1JRQA 3J7Yd 5TGNA 2JACA 4HOJA 2QGVA 1JB4A 1PX6A 4BIRA 5J5NA 3CXGA 1MTCA 3KE7A 2HRFA 2IMKA 4EV2A 3BJ5A 1US1A 4HZ4A 1WWJA 1W02A 5A0OB 2E7PA 1R5AA 3DGOA 4U13A 3CXC2 2EC4A 3CMIA 2FGXA 3HI7A 3D6IA 1LQMB 3GH9A 1OHPA 3EPTA 1FGMA 2QIYA 2F5WA 3G6E3 2GU1A 5JCWA 1JZWA 1EEMA 5IMVA 3V1WA 2LQVA 2QA2A 3EN1B 4O5UA 1IU7A 3GURA 1O7MB 5FGOA 3HVXA 4JRFA 2GTUA 1UN2A 1FW1A 3ROBA 4PUFC 3KMNA 2RBIA 3MG2A 1XCCA 2IN3A 5C04A 2I3YA 4HVNA 2FA4A 3FG4A 3ZVJA 4FMCA 2AAWA 5A4UA 1E97A 2UGIA 4IGJA 3UMAA 3UOMA 3W8JA 2VCXA 1PA3A 3GNJA 3SBCA 2K54A 3GKXA 4L5LA 2N5FA 5ECOB 2CX4A 3ALAA 3GX8A 5AISA 3E9JB 3FZ9A 5IF6A 3CTFA 1ZGXA 2OBKA 3WA3A 2VLUA 1TRVA 3FK8A 2VIMA 4KAEA 8CHOA 1F9MA 4XBYA 5IIZA 2HSHA 1A23A 1R5PA 5IOWA 4TKYA 1D6YA 5ELUA 3ZFZA 1A8LA 4QL7A 3UL3A 1NM3A 1CH0A 1BRKA 2OOVC 2HMOB 3HYPA 3BBYA 2FWHA 4G10A 4OFNA 5F07A 2VL3A 5F8BA 3D22A 3OX9A 2H71A 2F5MA 2CC3A 4EBGA 1QMVA 4HS1A 2B1XB 4F2IA 2FHEA 4EDYA 1F3BA 1GNEA 5D9TA 1IVVA 3F9SA 3DY5A 5IO0A 3LQ7A 3L0RA 4K2DA 4PQHA 2LJKA 1GUMA 2JSZA 2V6OA 4HM2B 1BYEA 1TP6A 2R2JA 3ZMLA 2R0CA 1I3FA 1SJIA 1BG5A 3H1NA 4G2EA 1ROVA 2WZ9A 3KCHA 2I1UA 2NTOA 4J2FA 5IMZA 3BNDA 1FHEA 2RFRA 3OWUA 1THXA 1X5DA 1LQGC 4ZBBA 2OADA 3W8SA 1ERTA 2VCQA 3HCZA 1W4NA 1OF5A 2R4IA 2MYGA 4BVYB 3PGTA 4RNYA 2CK3H 3VPQA 1B2XA 3EURA 2C3NA 1IT8A 5I97A 1PL1A 5JCUA 1QXHA 4GL6A 4DSQA 3TKQA 2BMOB 1ON4A 5CNWA 3FEUA 1TRSA 3R2QA 1AY7A 3GSTA 4MF5A 1SK0A 5FWGA 2YJHA 1B48A 1YEXA 2FWEA 4DKIA 1SENA 2H6XA 1JKGA 2X64A 4BTYA 4EUYA 3IJEB 1QFNA 3FRCA 4FQUA 3DIEA 3JCML 2D2ZA 3X42A 1GSPA 2X99A 4MH3A 17GSA 2IL3A 1RHLA 3LGCA 2HLSA 1O7HB 2KP2A 4R9KA 3DXBA 3CCU3 4Z2UA 4FIWA 1GSSA 3IR4A 1I2GA 1BANA 3ZLPA 4X0XA 1M99A 2NDOA 4IP6A 2RLIA 3VGNA 3QCPA 2GBWB 1HKXA 4AGSA 3DD3A 2KRTA 1YY7A 3FF2A 2X49A 2F86B 1QMAA 1M0UA 2Z77A 2GT6A 1B4PA 2DSAA 3Q18A 4HM6B 1UW1A 1GOYA 2HFDA 3CMA3 1HYFA 2HZEB 4NWYA 5HR1A 4V1Ap 3GV1A 3MHEA 2LEGA 1WMPA 3DYRA 1PRXA 1X0RA 3HJOA 2W2CA 1STDA 3EJVA 5F05A 3S5CA 4ILFA 4ORLA 1GYBA 2B5YA 3DH2A 5AIGA 1RKYA 3FR3A 4FCJA 3EC3A 2C0GA 5AYRB 2Z6BA 1LNHA 5AEWB 3I9V2 1VQK3 2I9HA 4ICYA 3H4KA 2CH9A 3LTCA 1XWGA 1VQL3 2P05A 4WYKA 4O92A 4CW9A 3N9HA 1M1K4 2M80A 4HJMA 3FF0A 4ZM8A 2C0DA 4K2XA 2VCZA 2XBIA 2H0IA 1TRUA 1WP0A 3GKMA 4KDXA 3TRPA 3UJMA 5IOXA 4I6XA 2IPAA 1BRNL 1KWIA 3AGOA 1NU3A 5JCGA 3GZBA 2LRNA 4OO5A 2IFQB 5CREA 4YQUA 1X1YA 1VQQA 3EBTA 3D0ZA 4IN0A 4EV5A 1HNBA 3V92A 3FG1A 2CZ3A 3KM6A 4MNNA 4MJCA 2PU9C 1X5CA 2R5GA 3GRDA 1BSCA 1MDIA 2IWTA 1U6TA 2WULA 2YWOA 2FD3A 5IEOA 4KFEA 4QL9A 2F8AA 3LYGA 5ECPB 1W2B2 2MBTA 4EXRA 5IG4A 2DJ1A 3DVXA 2BIRA 3A2VA 2ON7A 1E3VA 2L4VA 2YZUA 3TKSA 9RNTA 4K7IA 2F99A 4HM0B 3HZ8A 2FXTA 1M3IA 1B3SA 2YZHA 4MA9A 3NQZA 3DMCA 3WOEB 2KF3A 2BU4A 1UCJA 3A76A 4Q53A 2H0HA 4TN8A 1BNRA 1OGXA 1ZS7A 3F4RA 3QPMA 1USBA 5HFGA 2ZDJA 1V2AA 3CYNA 1T3BA 1SKWB 2YFIB 4IJIA 2VUPA 1UGHI 1VQP3 3WT2A 4YAPA 3MYDA 3GUSA 3PPUA 3I43A 1OKTA 1R4YA 1NB3I 1YF1A 2VO4A 3EMPA 3UVTA 1I9DA 6GSTA 5B7CA 16GSA 2GT5A 1GSDA 2PERA 4BL2A 5AIXA 3KEBA 4Z7XA 1PFPA 4N6LA 1M9BA 3F9UA 4WHAA 1MOLA 2BO9B 4XDVA 1PKWA 3O6TA 3CNMA 5ECKB 5EEOA 1SL1B 3KTBA 3GAXA 3ERFA 3F0IA 3F40A 3VWUA 3M9KA 3EF8A 2ZL8A 4GTUA 3L4NA 1S3RA 7GSSA 1X9MB 1XW5A 3L0HA 4G0KA 4RZMA 2YNXA 1BGSA 3ZG5A 3HA9A 4L8OA 3RBTA 3NIVA 3LW9A 1GUHA 3L9VA 4BVXA 4IW9A 1PX7A 4ZBAA 2BT3A 2CAQA 3BIRA 3LEFA 1K734 2L6CA 2XGLA 3CRUA 1OHOA 5FW5A 1N8JA 3LT8A 3FZ5A 1Q40A 1B9XC 2W56B 3ERWA 4NV5A 5CRHA 5F06A 1UUWB 3CC23 1W5ZA 4N30A 4MMXB 4HM7B 2JZTA 4HJLB 1R7HA 4TRXA 4MJAA 2JADA 3F8UA 2W03A 1VF4A 2C1YA 1THOA 1KSIA 4GQFA 1GTIA 2WFCA 1FVKA 1FZUA 1IV7A 4F0BA 2AUVA 4STDA 1U3IA 2HNLA 1WQLB 3S9FA 2LRTA 4GQCA 1GWCA 1WRYA 5JBSA 1W6CA 3K7CA 2N5AA 5CF2A 2B24B 2FWGA 1WMNA 3BNBA 1MWRA 3GTUA 2VL9A 2IYJA 3HJPA 2CA8A 3MSOA 5JWRB 1YF0A 3P90A 4GWRA 3STDA 2XSHB 3SX1A 2IMFA 4BTXA 1W01A 1HNCA 3ZG0A 2W0QA 2WCIA 3MWHA 4RQRA 5LCZA 5IMFA 2LYXA 4HBRA 5CRGA 3ZZXA 2H6YA 3DEXA 5G2ZA 2QSIA 1BSAA 3NZNA 3UBKA 1W4VA 1K28A 3F7XA 3PINA 5KP3A 1TFKA 1Q7HA 5AIIA 2WGQA 1PU4A 4IS0A 4XBXA 1XW6A 1QUWA 2G2QA 1VF2A 3G9BA 1Z5YE 3L78A 1TXXA 4XS4A 6GSYA 4WXTA 1OAZA 1YZXA 3LYKA 4Q5QA 3OXAA 3D79A 4N6OB 1YHQ3 1SIIA 4QQ7A 4I97A 1MGWA 4XBTA 5IG0A 5F0GA 1RN1A 2LKUA 4BTWA 4HM5B 3P7XA 2AV4A 3V99A 3GYKA 2XHFA 4EW5A 2F98A 1PYLA 3A5IA 4O2HA 1AR0A 3LT9A 2B5XA 1A2LA 1JNQA 1BIRA 2LS5A 1GMQA 2DJJA 3CSJA 1C72A 1RGAA 3PR8A 1O7PB 1F2EA 1GTBA 2MBSA 2VCTA 2CVKA 3VWXA 3GSSA 4WKWA 3IMAB 4HSCX 1JBTA 1EGRA 2UUGC 1A2VA 1PGTA 3M8NA 1UC7A 3FKFA 2L1SA 4CDOA 3PXMA 1RNBA 2OE0A 4K7OA 4WF5A 1WTHA 2JZSA 1J08A 2CW9A 4DEJA 1RDSA 2GZYA 3UVHA 1EG9B 1JN5B 3MWZA 4HZBB 4K9ZA 2IIYA 4G0LA 4LLRA 1BRGA 3AY8A 1ZYQB 2HOHA 2P0MA 1SQWA 3B7CA 5J9BA 5DAKA 3D4TA 2JDIH 1L5GB 1AQXA 1KBNA 4EVMA 5BU4A 4HM4B 1GD3A 6GSPA 2J8XB 1TRQA 1A8YA 4IBPA 2B1KA 3JUMA 4OFMA 5BXQA 4PEJA 3E0UA 1QALA 4I4KA 2F4YA 3CSHA 4WP5A 4RNZA 1G7EA 3EU4A 2PNCA 4KDYA 5ID2A 2C3QA 3F7SA 3EC9A 2Z9SA 1F6MC 1A2KA 3KJYA 1EWXA 3Q6OA 3CC73 2OQEC 3T8NA 1ZMAA 5HFIA 4POMA 1WIKA 1U88A 1RJOA 2ZCTA 1GNWA 3GSPA 1DE1A 2CWUA 1SIHA 3LZAA 3LFLA 2CZ2A 1J0FA 1BJXA 3QR6A 4L7KA 5A4VA 1O7WB 5DREA 1FUWA 4FMAA 3EMXA 4KNDA 1FGRA 4YH2A 3LH4A 2L4QA 1OPYA 4WETA 4MZCA 1T4ZA 1YNVX 5BMUA 3G0KA 1MWUA 4X43A 1O85A 14GSA 1FGQA 4JE1A 2JSYA 1U87A 4FYUA 4NREA 4F03A 3D5JA 3IA1A 1OH0A 3MSZA 1DMQA 2J23A 3IC4A 4TR1A 2DKHA 1BNJA 3MG1A 4TR4A 1T00A 1LU4A 3NOFA 4R4KA 1LXEA 4G9HA 2CQ9A 3GKNA 1YKAA 2PZVA 3B4PA 3O8YA 4WR5A 1VQ63 3BNEA 1B4QA 1A24A 4HM3B 5G1KA 2VCVA 4MABA 3UARA 1DMMA 1XFLA 5ECLB 2HI7A 5G1LA 2XF3A 3IRAA 1RGFA 1TDIA 5GSTA 4MCUA 1FA3A 2LJAA 3SWLA 4OK0A 2O8VB 1JZDA 4J9AA 1LNIA 3BLZA 2I81A 1O81A 2FWFA 3VI5A 4H61A 2LV3A 1U8CB 5HR2A 1QQ2A 4AKZA 3MDKA 2H66A 4TXOB 1DYUA 3DM8A 3QMXA 1GL8A 3TJGA 1N9JA 2DBCA 4LYLB 3M8CA 1HU9A 4KF9A 5CYYA 2HMMB 3JUNA 4V1Ag 3FGYA 1ZX2A 2B3SA 1RK4A 1V9WA 5JWOB 1ULIB 1AQVA 1SU9A 1RRLA 3LYPA 4XS6A 1N2AA 2A2RA 4J56E 1Z7PA 20GSA 2KHPA 4EIPA 5M18A 4NV2A 2YX9A 1JLWA 3S67A 1GRXA 4FH8A 2ML6A 5ELAA 2MC8A 4G1MB 3ZITA 1K3YA 6GSVA 3GRXA 4PGTA 1YQ1A 2A4VA 1KC84 2CVDA 2P5RA 3U1WA 4N3VA 3GFKA 1FVJA 5BIRA 4GSSA 2W9QA 2YP6A 4ZXGA 2GGTA 4DSRA 2IFQA 2VM1A 3N5OA 1V98A 1RSNA 5RNTA 1JHBA 4GHOA 3KSPA 3HZPA 2XPDA 4AKYA 4JR6A 1NW2A 3LMLA 2V1MA 1A0RP 1UGIA 5D96A 3AHWA 4K0GA 4NHZA 3ZTLA 1B27A 1Q4JA 2QKEA 5LNKe 1ML6A 4KSMA 5ABRA 3Q3FA 1JZRA 1K0CA 2H1AA 1ZZYA 4HEA2 1BNSA 3RHBA 1GY7A 2QGUA 2H19A 2A15A 19GSA 4NAXA 2XFSA 2EIRA 1ACVA 2V1LA 2CWTA 3LXZA 4IJ3A 2XEPA 1BQ7A 2DC5A 1M904 2Y74A 2VLTA 5AIHA 2FNOA 5CO3A 3P2AA 3OWSA 3ZL5A 1U5OA 1RGHA 3U97A 4LEHA 4ECJA 4N10A 2GQMA 4HM1B 3UJ1A 3BCIA 4MDCA 4N6UA 4MJDA 3HKRA 4K1FA 2LJRA 3CD63 4ZB6A 3TGZA 1BRHA 5IERA 4JR4A 1T5YA 1RMSA 5LC7A 2RGQA 1A67A 2R0GA 1YGWA 1SJWA 1MD4A 1EEJA 4OVMA 3WOFB 2RUFA 4E8HA 3OWYA 1QGVA 4MZWA 2XFTA 4KX4A 1BVIA 1YIJ3 5AIFA 2H75A 1CYVA 3KH9A 1IYIA 3VLNA 1XPVA 3GIXA 1XOAA 3GZXB 1FGOA 4RUVA 2YV9A 3EN8A 2NVLA 1OHSA 2F3MA 1G7OA 3F4TA 3JUPA 3A5EA 1EKMA 1ST9A 1TRWA 2OJLA 2ZHXB 3BOAA 4ACSA 3F63A 1S3CA 1M2BA 1Q814 4GXZA 3NV0A 3K0ZA 5D83A 4BA7A 2FLSA 4D73B 5GAPD 5EL8A 1B8XA 5IEPA 5KP1A 2AJQB 1M2AA 3QK9A 2H1BA 3X3YA 2CFLA 1K0OA 4CPKA 1IVWA 4AJ8A 2KCDA 3FCSB 2KP1A 2QA43 2WB9A 2H74A 3FZAA 5IW9A 1NDOB 9GSSA 3EB8A 4BWSA 2CX3A 2Z76A 4K5RA 2E2UA 3NBRA 2FA8A 2H72A 2QC7A 3EE2A 4ML6A 2AHEA 4EC0A 4XDWA 3WGXA 4POBA 2R4VA 4LGQA 4PX1A 5B8AA 5AGYA 1V57A 4JRRA 1FAAA 2H01A 2HRNA 3WR2A 4GSTA 3FZ4A 3QAWA 1G6WA 3KIIA 3DVWA 2LQQA 3KKGA 3TCOA 5A4WA 3KZTA 3OV4A 3TKSE 4HZ2A 2KAAA 3TUEA 1NWWA 3L9UA 1EUIC 1BEDA 1AQWA 3VURA 2HT9A 5B8BA 4O3VA 1WNHA 1OACA 1R26A 1TI1A 1N8R4 4KT3B 3FG3A 3EU3A 4GSPA 2C4JA 3F6DA 3NQYA 1M9GA 3ZRDA 2CAIA 3UNLA 3RHCA 1UCLA 1RGKA 1Q7Y4 5G30A 1BSEA 1EA2A 4JEDA 5DALA 2DIZA 1X1WA 1C54A 1ERVA 1PSQA 3CPOA 1AXDA 4HQZA 4ZL9A 1VQ73 1BNEA 2INXA 2C0EA 5H5QA 4K8MA 2GBXB 1PQNA 1W6YA 5DDLA 4ISDA 2K18A 1RN7A 3HIGA 22GSA 1LOYA 1IQYA 1MDJA 2VL2A 4LL1B 1DBYA 2FCHA 3DRNA 3IC8A 3QDNA 5IG3A 1T7PB 4WWUC 3CME3 3X3ZA 1M3JA 3ISOA 3UIWA 2KOKA 6GSWA 3PGBA 4LA1A 2YJ7A 5BVBA 3IAM2 1TU5A 2STDA 3D9RA 1STFI 5KOWA 1TW9A 5AIVA 1TI3A 3JVCA 3BB9A 1MEKA 2JQ5A 1EV4A 1GSFA 3RPPA 3NX0A 4BU4A 4AEQA 4XIHA 3TRXA 4PNFA 3KSED 5J4UA 2PN8A 4WF4A 8GSSA 1TK5B 4I8BA 3KCMA 1KNGA 5ELGA 1I0XA 2V6KA 3UL5A 3CCR3 3E3EA 2RNTA 3QRDA 3RNTA 1GUKA 3K8NA 4KFFA 1QAFA 1I5GA 4XM4A 3FZWA 1XW9A 4CCVA 4X1UA 2L6DA 3DMLA 1TK0B 1CYUA 1BUJA 3GH6A 3MNGA 1EZKA 1IYYA 3DGNA 1VQ53 4RBNA 2A2PA 4EC6A 2YWNA 4OMVA 1GOVA 3H8QA 2K8SA 3EWLA 3QFBC 4TXVA 2WGOA 3I553 2CT6A 2O89A 2GEYA 2R37A 2IA7A 1DVCA 2RUEA 3PYJA 2CIUA 4TVEA 4OFTA 5D9VA 1B20A 4LZIA 1XWKA 2AYTA 2OE3A 2PGTA 3FW2A 2G0FA 3PCRA 4BL7A 1URMA 3IHGA 3RGRA 2M46A 4G19A 3VI7A 2VD0A 1K3OA 4A5PA 3IOSA 4L0UA 1UA5A 3QFAC 4YQMA 4CY8A 2RIIA 2GSTA 2CFDA 1HD2A 5ECMB 4FR9A 2P09A 2OBIA 3AMOA 4EL1A 1YKCA 1D6ZA 1OF5B 2KXGA 5IM9A 5KOXA 2LRCA 3GHAA 18GSA 1W89A 2GS3A 3F6FA 3WYWA 4KH7A 3D5GA 3LG6A 4KCAA 1C7HA 2KLXA 7GSPA 1NSWA 1VQ93 3WD6A 1LOWA 4EE0A 1BRIA 5GSPA 1FO5A 3N8BA 2A4HA 5STDA 1TTOA 3I563 4TX4A 3ME8A 5IPGA 2BHMA 4CJNA 1S723 1SK1A 2QA1A 1IV9A 1ZCPA 1AC1A 3CCE3 11GSA 4TR3A 2OE1A 1UCKA 3GL5A 4MP4A 4EF0A 3M0FA 1LVNA 4MK3A 1AAZA 5L71A 1MNLA 4POKA 1BSBA 4OCEA
chains in the Genus database with same CATH topology
3VPTA 2EIOA 2GZPA 4MPGA 2ES7A 5DQYA 2C0FA 1A2MA 2B1LA 5KN0A 1HNAA 5KEJA 4HDEA 5EPFA 2GLRA 3QOUA 5GSSA 2BTOT 2PPTA 6GSSA 2K8VA 4ECBA 2DJKA 1T1VA 3KP8A 3P8WA 2KUCA 1FOHA 4OCFA 4KE3A 1V40A 2J9HA 2RM6A 2GQKA 4WBJA 4TXOA 3TOTA 5ECNB 4EXJA 1X5EA 1H75A 1O8XA 1WJKA 1NHOA 5IMCA 2X8CA 1BAYA 2B7KA 1EGOA 3U6VA 2H6ZA 5ECRB 1Z6MA 2PBJA 2HE3A 4TW5A 5LD0A 3DWVA 3TB2A 1YDKA 1AIUA 1TTZA 1ILOA 4BWQA 4KCEA 2VAFA 4FYBA 1TKDB 3WT1A 3BCKA 5DBQA 2FUG2 3IAS2 5D9WA 1XOBA 4POLA 2GSQA 3KXOA 5IPHA 1MD3A 5KN2A 4OWYA 1M2DA 4I2UA 4E8EA 2EIQA 1SKSB 2LNSA 3C1SA 1K0DA 3IE3A 1XZOA 2HRKA 2GZZA 3HXSA 2O7KA 5JWQB 1XWBA 1Z7RA 1AUCA 4F82A 1TU7A 4KW6A 2WRTA 5CAXA 4HUAA 5ECQB 3C7MA 4PUAA 3TKRA 2PVQA 5E59A 1WPIA 5D73A 3Q19A 2AB6A 1RQMA 2B5EA 1OKDA 4O5QA 3F3RA 1PD21 3J7Yb 4I5QA 3O3TA 1S3DA 3TRQA 1SJ6A 1HYUA 5CRWA 2BMXA 5IO2A 4BVYA 1ZL9A 4I2TA 3L9SA 3KZQA 4GRFA 1XIYA 4Z2TA 1OE8A 4BPYA 2GDRA 4KGIA 1SYRA 4GLTA 5IQYA 5CP1A 3TJBA 4MJBA 2CVBA 3WGDA 4HQSA 4EIQA 4L0WA 1FG4A 4PQIA 2PMTA 3TKSC 2H1GA 5ENUA 4BVXB 2OKAA 3I6AA 2HRAA 3M9JA 3ZYWA 1TJDA 3HVSA 2JZRA 4NMUA 1YEPA 2DLXA 3FYGA 4MMMA 3MIXA 4WR4A 2HZEA 2P5QA 1GLQA 3VWWA 3IK7A 2H30A 5DVBA 2VLVA 2XBQA 2VD1A 2O87A 1ZYNA 3G7IA 1PKZA 4MJEA 1GLPA 3GTUB 4DSSB 1JLVA 4CY6A 4XCSA 3IDVA 2H0GA 3I69A 1EP7A 4YKGA 3DGQA 3HJMA 4KSOA 3KTLA 5INYA 3CSIA 2TRCP 2YANA 4ULXA 4TOPA 4XS1A 3C71A 2HSMA 3KIJA 5IMAA 2X8HA 1SJZA 3ZIJA 4FYCA 2H73A 2CV4A 1XWCA 1PN9A 3IHQA 3IXRA 1Q98A 3APSA 1F37A 2LSTA 4O7HA 1A2JA 2YWMA 4HU9A 1GTUA 1T4YA 5H5SA 4XS4B 2YWIA 3HDCA 1KEBA 2F51A 3TJKA 3TKPA 4LMWA 2UZ8A 4L5OA 2OA7A 2YV7A 2VOCA 3HHVA 2ALBA 5DCHA 1V58A 4V2MA 4KUNA 5DCGA 1FOVA 3VK9A 2P31A 1K0NA 4X4JA 2DMMA 4KB3A 2V32A 3HZ4A 1R4WA 3HY2A 1K0MA 2HZFA 2WJUA 3KH7A 1CQHA 1NHYA 2X8GA 5G5EA 2IJYA 5DAKB 3RAZA 5J9CA 4MF7A 5J41A 1X9WB 1QK8A 1M7TA 5E4WA 3APOA 3FMWA 3H93A 1OVNA 3A2WA 1SYXA 5ID2B 2LNTA 4GF0A 1GSEA 3FR9A 1EV9A 2OACA 4V2LA 1OC9B 1XBSA 4WBRD 1X9SB 5IMDA 2JU5A 3QAGA 13GSA 4ZB8A 2DJ2A 4RI7A 2RM5A 2L59A 3ZVJD 2GSRA 1YJ6A 4OD7A 5DJLA 2XC2A 2L5OA 4EO3A 2E0QA 3OR5A 3LXTA 4F0CA 4WEYA 5B6NA 1ZGNA 1DUGA 1TOFA 3RDWA 3FHKA 1ZYEA 4NPBA 2K9FA 4NHWA 3CBUA 2ON5A 3KP9A 1GH2A 4TR1B 4IHUA 4MPFA 4EDZA 2PVOC 3DKSA 4ZILA 4IQAA 3EVIA 3D21A 4IELA 4PXOA 1HQOA 2LQOA 4XRDA 4GCIA 4JZQA 1SKRB 1WOUA 1PMTA 12GSA 5A5KA 3ZMKA 2MMNA 5HR3A 2C3TA 1Y25A 2ZNMA 1FB6A 2VM2A 2YOIA 5G31A 4J57E 4HU7A 4PNGA 2FY6A 2H70A 3GX0A 5G5FA 4JU5A 1K0BA 1XXUA 1O7UA 1O6JA 5ECSA 1ERWA 1OYJA 4N0VA 3ZFBA 2VCWA 4L8EA 3D4MA 4FO5A 1T8EB 1OE7A 2MZCA 3GA4A 4ZBDA 1FB0A 1LBKA 3W6GA 2NPBA 1TP9A 1O73A 5DQSA 1KTEA 2MMZA 1VF3A 3BD2A 2YN1A 1ZYPA 1DE2A 3US3A 2R6KA 3GL3A 3Q74A 4MH2A 5COHA 3VWVA 2C8UA 1EP8A 2PUKC 4XRAA 4P3YB 1O8WA 4O32A 1B9YC 2R3XA 2REMA 4Q5NA 1F3AA 3RPNA 2M72A 5C00A 3GKKA 1SK2A 3IPZA 3O76A 3WGEA 4LMVA 1OC3A 2WGRA 4O5RA 1IYHA 3KGKA 4CHSA 1GTAA 1Z6NA 6GSXA 1SL0B 3C73A 3IBHA 3ZFLA 5HQPA 1JFUA 3F4SA 5H5RA 3N9JA 4Z2RA 1Z9HA 5HFKA 2IMEA 4MZBA 4USSA 4KDUA 3TOUA 4ID0A 4V2NA 4GSNA 3C8EA 5KN1A 2PWJA 5ECIB 4PQ1A 1GULA 3HVVA 5GAND 4ZL8A 5FT3A 5D9XA 1SD8A 2DIYA 2HSYA 3MAKA 5J3RA 2YCDA 3J7Yk 2C80A 3U5RE 1WMJA 4TR0A 2MMAA 4OO4A 3LJRA 3F3QA 4RI6A 5DJMA 4IVFA 5BRTA 5D8IA 4XHMA 1DSBA 3A2XA 2MMOA 2R0PA 1PN0A 4ZL7A 2GSSA 3G7YA 1E6BA 5B6MA 2K6VA 1LJRA 3M3MA 1VRSD 2GQLA 4AJ7A 3IV4A 3CRTA 2HXKA 4AJ6A 4YQVA 4N0ZA 4XTSA 3PH9A 4Q5RA 2H8LA 3QD9A 2H1DA 1G0TA 1TU8A 4RQXA 4LL4B 3CTGA 1M9AA 1EOGA 2WS2A 3FR6A 3A3TA 1XVQA 3FY7A 4DSSA 3KD0A 2E2GA 1XWAA 2TIRA 2WDUA 1ZOFA 2ZUPA 3H79A 3GMFA 2O85A 2BJXA 5DALB 2L57A 4JBBA 2V41A 1JZOA 2IMDA 3C1RA 4YKFA 4K5SA 4DVCA 1Y6EA 2LUSA 1K3LA 4NXIA 4K6XA 1GSUA 2B6MA 3IK9A 3ZREA 3UEMA 3APQA 1GSYA 1AW9A 4MF6A 2IMIA 2F9SA 1VGLA 2H76A 2F8FA 1XVWA 6GSUA 1GP1A 3ZIVA 3A5WA 2DKIA 4ZIJA 4IQ1A 5HR0A 1CQGA 1UVZA 5FHIA 2E2MA 2L5LA 1WE0A 1GSQA 2JL4A 3HD5A 1EOHA 3M1GA 3KMOA 2X4AA 1SL2B 4YAVA 3UBLA 3ERGA 4N11A 1OC8A 4KA0A 2P0GA 3TDGA 1A0FA 4K7NA 4PTSA 2V2GA 5EY6A 5KN3A 1ERUA 2VL2C 3TJFA 4AF2A 1U3AA 2N5BA 4BL7B 1OC9A 3R3EA 4IP1A 1PL2A 4H86A 5EVOA 4HI7A 1BX9A 1E2YA 1K0AA 4EKZA 4K0NA 3LORA 5D93A 3GN3A 1MDKA 4MLYA 1G6YA 4ECIA 4D73A 3UAPA 3LWAA 1RW1A 1SD9A 2DJ3A 3LSZA 4ML1A 3VFIA 1VF1A 2B7JA 4F9ZA 1Z3EA 3EYTA 4Q5FA 4ECCA 4IKHA 2GVPA 2YPMA 4G0IA 4ZB9A 2TRXA 5GZZB 5ECHB 2L4CA 2IY2A 1H4OA 3ME7A 4PURA 1ABAA 5AN1A 3EINA 1S3AA 4HJ2A 1J9BA 10GSA 3ED3A 2HYXA 5CRDA 3TJJA 2A2SA 2I4AA 2DJ0A 2DMLA 2NBSA 2XPEA 3QAVA 1TK8B 3G7JA 2JACA 4HOJA 2QGVA 1PX6A 5J5NA 3CXGA 1MTCA 2HRFA 2IMKA 3BJ5A 4HZ4A 1WWJA 2E7PA 1R5AA 2EC4A 3CMIA 2FGXA 3D6IA 3GH9A 3EPTA 5JCWA 1JZWA 1EEMA 5IMVA 3V1WA 2QA2A 4O5UA 3GURA 3HVXA 2GTUA 1UN2A 1FW1A 4PUFC 3KMNA 1XCCA 2IN3A 5C04A 2I3YA 2FA4A 3ZVJA 2AAWA 5A4UA 3UMAA 4IGJA 3W8JA 3UOMA 2VCXA 1PA3A 3GNJA 3SBCA 3GKXA 4L5LA 2N5FA 5ECOB 2CX4A 3GX8A 5AISA 3E9JB 3FZ9A 3CTFA 2OBKA 2VLUA 1TRVA 3FK8A 2VIMA 4KAEA 1F9MA 5IIZA 2HSHA 1A23A 1R5PA 5IOWA 4TKYA 1A8LA 4QL7A 3UL3A 1NM3A 3HYPA 3BBYA 2FWHA 4G10A 4OFNA 5F07A 2VL3A 5F8BA 3D22A 2H71A 1QMVA 4HS1A 4F2IA 2FHEA 4EDYA 1F3BA 1GNEA 5D9TA 5IO0A 3LQ7A 4K2DA 4PQHA 2LJKA 1GUMA 2JSZA 2V6OA 1BYEA 2R2JA 3ZMLA 2R0CA 1SJIA 1BG5A 3H1NA 4G2EA 2WZ9A 2I1UA 2NTOA 4J2FA 5IMZA 1FHEA 1THXA 1X5DA 4ZBBA 2OADA 3W8SA 1ERTA 2VCQA 3HCZA 2MYGA 4BVYB 3PGTA 3VPQA 3EURA 2C3NA 1PL1A 5JCUA 1QXHA 4DSQA 3TKQA 1ON4A 5CNWA 3FEUA 1TRSA 3R2QA 4MF5A 3GSTA 1SK0A 5FWGA 2YJHA 1B48A 1YEXA 2FWEA 1SENA 2H6XA 2X64A 4EUYA 1QFNA 3FRCA 4FQUA 3DIEA 3JCML 2D2ZA 2X99A 4MH3A 17GSA 2IL3A 3LGCA 2HLSA 2KP2A 3DXBA 4Z2UA 4FIWA 1GSSA 3IR4A 3ZLPA 4X0XA 1M99A 2NDOA 4IP6A 2RLIA 3QCPA 4AGSA 3DD3A 1YY7A 2X49A 1M0UA 2GT6A 1B4PA 2DSAA 3Q18A 2HFDA 2HZEB 4NWYA 5HR1A 4V1Ap 3GV1A 2LEGA 3DYRA 1PRXA 1X0RA 3HJOA 5F05A 4ILFA 2B5YA 3FR3A 3EC3A 2C0GA 3I9V2 2I9HA 4ICYA 3H4KA 1XWGA 4O92A 4CW9A 2M80A 4HJMA 2C0DA 4K2XA 2VCZA 2XBIA 2H0IA 1TRUA 1WP0A 3GKMA 4KDXA 3TRPA 5IOXA 4I6XA 2IPAA 5JCGA 2LRNA 4OO5A 2IFQB 5CREA 4YQUA 3D0ZA 4IN0A 1HNBA 2CZ3A 3KM6A 4MNNA 4MJCA 2PU9C 1X5CA 2R5GA 1MDIA 2IWTA 1U6TA 2WULA 2YWOA 2FD3A 4QL9A 2F8AA 5ECPB 2MBTA 2DJ1A 3DVXA 3A2VA 2ON7A 2YZUA 3TKSA 4K7IA 3HZ8A 2YZHA 4MA9A 2H0HA 4TN8A 3QPMA 3F4RA 1USBA 5HFGA 1V2AA 3CYNA 1T3BA 1SKWB 4IJIA 2VUPA 3WT2A 4YAPA 3MYDA 3GUSA 3PPUA 3I43A 1OKTA 1YF1A 2VO4A 3EMPA 3UVTA 1I9DA 6GSTA 5B7CA 16GSA 2GT5A 1GSDA 2PERA 5AIXA 3KEBA 4Z7XA 1M9BA 3F9UA 1PKWA 3O6TA 5ECKB 1SL1B 3KTBA 3ERFA 3F0IA 3VWUA 3M9KA 4GTUA 3L4NA 7GSSA 1X9MB 1XW5A 3L0HA 4G0KA 2YNXA 3HA9A 3RBTA 3NIVA 3LW9A 1GUHA 3L9VA 4BVXA 4IW9A 1PX7A 4ZBAA 2CAQA 3LEFA 2L6CA 3CRUA 1N8JA 3FZ5A 1B9XC 4NV5A 3ERWA 5F06A 5CRHA 4N30A 2JZTA 1R7HA 4TRXA 4MJAA 2JADA 3F8UA 1VF4A 2C1YA 1THOA 4GQFA 1GTIA 2WFCA 1FVKA 4F0BA 2AUVA 1U3IA 2HNLA 3S9FA 2LRTA 4GQCA 1GWCA 1WRYA 2N5AA 2FWGA 3GTUA 2VL9A 2IYJA 3HJPA 2CA8A 5JWRB 1YF0A 3P90A 4GWRA 2IMFA 1HNCA 4RQRA 2WCIA 3MWHA 5LCZA 5IMFA 5CRGA 3ZZXA 2H6YA 3DEXA 5G2ZA 2QSIA 3NZNA 3UBKA 1W4VA 3PINA 4IS0A 1XW6A 1QUWA 2G2QA 1VF2A 3G9BA 1Z5YE 3L78A 1TXXA 4XS4A 6GSYA 4WXTA 1OAZA 1YZXA 3LYKA 4Q5QA 4QQ7A 4I97A 5F0GA 2LKUA 3P7XA 2AV4A 3GYKA 2XHFA 3A5IA 2B5XA 3CSJA 1A2LA 2LS5A 2DJJA 1C72A 3PR8A 1F2EA 1GTBA 2MBSA 2VCTA 2CVKA 3VWXA 3GSSA 4WKWA 1EGRA 1PGTA 3M8NA 1UC7A 3FKFA 4CDOA 4K7OA 2OE0A 4WF5A 2JZSA 1J08A 4DEJA 2GZYA 3UVHA 4K9ZA 2IIYA 4G0LA 4LLRA 3AY8A 1ZYQB 5J9BA 5DAKA 3D4TA 1AQXA 1KBNA 4EVMA 1A8YA 4IBPA 2B1KA 4OFMA 3E0UA 3CSHA 1G7EA 3EU4A 4KDYA 5ID2A 2C3QA 2Z9SA 1F6MC 3KJYA 1EWXA 3Q6OA 1ZMAA 5HFIA 4POMA 1WIKA 1U88A 2ZCTA 1GNWA 1DE1A 3LFLA 2CZ2A 1J0FA 1BJXA 3QR6A 5A4VA 3EMXA 4KNDA 4YH2A 2L4QA 4WETA 4MZCA 1T4ZA 5BMUA 4X43A 1O85A 14GSA 4JE1A 2JSYA 1U87A 4FYUA 4F03A 3D5JA 3IA1A 3MSZA 2J23A 3IC4A 4TR1A 2DKHA 4TR4A 1T00A 1LU4A 3NOFA 4G9HA 2CQ9A 3GKNA 1YKAA 4WR5A 1A24A 5G1KA 2VCVA 4MABA 3UARA 1XFLA 5ECLB 2HI7A 5G1LA 3IRAA 1TDIA 5GSTA 4MCUA 2LJAA 3SWLA 2O8VB 1JZDA 2I81A 1O81A 2FWFA 3VI5A 2LV3A 5HR2A 1QQ2A 3MDKA 2H66A 4TXOB 1GL8A 3QMXA 3TJGA 2DBCA 4KF9A 5CYYA 4V1Ag 2B3SA 1RK4A 1V9WA 5JWOB 1AQVA 1SU9A 4XS6A 3LYPA 1N2AA 2A2RA 4J56E 1Z7PA 20GSA 2KHPA 4EIPA 4NV2A 1JLWA 1GRXA 4FH8A 5ELAA 3ZITA 1K3YA 6GSVA 3GRXA 4PGTA 1YQ1A 2A4VA 2CVDA 2P5RA 3GFKA 1FVJA 4GSSA 2YP6A 4ZXGA 2GGTA 4DSRA 2IFQA 2VM1A 3N5OA 1V98A 1JHBA 2XPDA 4JR6A 1NW2A 2V1MA 1A0RP 5D96A 4K0GA 4NHZA 3ZTLA 1Q4JA 2QKEA 5LNKe 1ML6A 4KSMA 5ABRA 1JZRA 1K0CA 2H1AA 1ZZYA 4HEA2 3RHBA 2H19A 19GSA 4NAXA 2EIRA 1ACVA 3LXZA 4IJ3A 1BQ7A 2DC5A 2VLTA 2FNOA 5CO3A 3P2AA 3ZL5A 4ECJA 4N10A 2GQMA 3UJ1A 3BCIA 4MDCA 3HKRA 4K1FA 2LJRA 4ZB6A 3TGZA 4JR4A 2R0GA 1MD4A 1EEJA 2RUFA 4E8HA 1QGVA 4MZWA 4KX4A 2H75A 3KH9A 3VLNA 1IYIA 1XPVA 3GIXA 1XOAA 4RUVA 2YV9A 2NVLA 2F3MA 1G7OA 3F4TA 1ST9A 1TRWA 2OJLA 3BOAA 4ACSA 3F63A 1S3CA 1M2BA 4GXZA 4BA7A 2FLSA 4D73B 5GAPD 5EL8A 1B8XA 2AJQB 1M2AA 2H1BA 1K0OA 4AJ8A 2KP1A 2WB9A 2H74A 3FZAA 9GSSA 4BWSA 2CX3A 4K5RA 2FA8A 2H72A 2QC7A 3EE2A 4ML6A 2AHEA 4EC0A 3WGXA 4POBA 2R4VA 4PX1A 5B8AA 5AGYA 1V57A 4JRRA 1FAAA 2H01A 2HRNA 4GSTA 3FZ4A 3QAWA 1G6WA 3DVWA 2LQQA 3TCOA 5A4WA 3TKSE 4HZ2A 3TUEA 3L9UA 1BEDA 3VURA 1AQWA 2HT9A 5B8BA 1R26A 1TI1A 3EU3A 2C4JA 3F6DA 3ZRDA 2CAIA 3RHCA 5G30A 4JEDA 5DALA 2DIZA 1ERVA 1PSQA 1AXDA 4HQZA 4ZL9A 2C0EA 5H5QA 4K8MA 1PQNA 5DDLA 4ISDA 2K18A 2VL2A 22GSA 1MDJA 4LL1B 1DBYA 2FCHA 3DRNA 3IC8A 3QDNA 1T7PB 3UIWA 3ISOA 2KOKA 6GSWA 4LA1A 2YJ7A 3IAM2 5KOWA 1TW9A 5AIVA 1TI3A 1MEKA 1EV4A 1GSFA 3RPPA 4XIHA 3TRXA 4PNFA 5J4UA 2PN8A 4WF4A 8GSSA 1TK5B 4I8BA 3KCMA 1KNGA 5ELGA 2V6KA 3E3EA 1GUKA 3K8NA 1I5GA 1XW9A 4X1UA 2L6DA 3DMLA 1TK0B 3GH6A 3MNGA 1EZKA 2A2PA 2YWNA 4OMVA 3H8QA 2K8SA 3EWLA 3QFBC 4TXVA 2CT6A 2O89A 2R37A 2RUEA 4TVEA 4OFTA 5D9VA 1XWKA 2AYTA 2OE3A 2PGTA 3FW2A 2G0FA 4BL7A 1URMA 3IHGA 2M46A 4G19A 3VI7A 2VD0A 1K3OA 4A5PA 3IOSA 4L0UA 1UA5A 3QFAC 4YQMA 4CY8A 2RIIA 2GSTA 1HD2A 5ECMB 2OBIA 4EL1A 1YKCA 5IM9A 5KOXA 2LRCA 3GHAA 18GSA 1W89A 2GS3A 3F6FA 3WYWA 4KH7A 3LG6A 4KCAA 2KLXA 1NSWA 3WD6A 4EE0A 1FO5A 2A4HA 3ME8A 5IPGA 1SK1A 2QA1A 1ZCPA 1AC1A 11GSA 4TR3A 2OE1A 3GL5A 4MP4A 4EF0A 3M0FA 4MK3A 1AAZA 5L71A 2LTKA 4POKA 1B4QA 4OCEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VPT A;  2EIO A;  2GZP A;  4MPG A;  2ES7 A;  5DQY A;  2C0F A;  1A2M A;  2B1L A;  5KN0 A;  1HNA A;  5KEJ A;  4HDE A;  5EPF A;  2GLR A;  3QOU A;  5GSS A;  2BTO T;  2PPT A;  6GSS A;  2K8V A;  4ECB A;  2DJK A;  1T1V A;  3KP8 A;  3P8W A;  2KUC A;  4OCF A;  4KE3 A;  1V40 A;  2J9H A;  2RM6 A;  2GQK A;  4WBJ A;  4TXO A;  3TOT A;  5ECN B;  4EXJ A;  1X5E A;  1H75 A;  1O8X A;  1WJK A;  1NHO A;  5IMC A;  2X8C A;  1BAY A;  2B7K A;  1EGO A;  3U6V A;  2H6Z A;  5ECR B;  1Z6M A;  2PBJ A;  2HE3 A;  4TW5 A;  5LD0 A;  3DWV A;  3TB2 A;  1YDK A;  1AIU A;  1TTZ A;  1ILO A;  4BWQ A;  4KCE A;  2VAF A;  4FYB A;  1TKD B;  3WT1 A;  3BCK A;  5DBQ A;  2FUG 2;  3IAS 2;  5D9W A;  1XOB A;  4POL A;  2GSQ A;  3KXO A;  5IPH A;  1MD3 A;  5KN2 A;  4OWY A;  1M2D A;  4I2U A;  4E8E A;  2EIQ A;  1SKS B;  2LNS A;  3C1S A;  1K0D A;  3IE3 A;  1XZO A;  2GZZ A;  3HXS A;  2O7K A;  5JWQ B;  1XWB A;  1Z7R A;  1AUC A;  4F82 A;  1TU7 A;  4KW6 A;  2WRT A;  5CAX A;  4HUA A;  5ECQ B;  3C7M A;  4PUA A;  3TKR A;  2PVQ A;  5E59 A;  1WPI A;  5D73 A;  3Q19 A;  2AB6 A;  1RQM A;  2B5E A;  1OKD A;  3F3R A;  1PD2 1;  3J7Y b;  4I5Q A;  3O3T A;  1S3D A;  3TRQ A;  1SJ6 A;  1HYU A;  5CRW A;  2BMX A;  5IO2 A;  4BVY A;  1ZL9 A;  4I2T A;  3L9S A;  3KZQ A;  4GRF A;  1XIY A;  1OE8 A;  4BPY A;  2GDR A;  4KGI A;  1SYR A;  4GLT A;  5IQY A;  5CP1 A;  3TJB A;  4MJB A;  2CVB A;  3WGD A;  4HQS A;  4L0W A;  1FG4 A;  4PQI A;  2PMT A;  3TKS C;  2H1G A;  5ENU A;  2OKA A;  3I6A A;  3M9J A;  3ZYW A;  1TJD A;  3HVS A;  2JZR A;  4NMU A;  1YEP A;  2DLX A;  3FYG A;  4MMM A;  4WR4 A;  2HZE A;  2P5Q A;  1GLQ A;  3VWW A;  3IK7 A;  2H30 A;  5DVB A;  2VLV A;  2XBQ A;  2VD1 A;  2O87 A;  3G7I A;  1PKZ A;  4MJE A;  1GLP A;  3GTU B;  4DSS B;  1JLV A;  4XCS A;  3IDV A;  2H0G A;  3I69 A;  1EP7 A;  3DGQ A;  3HJM A;  4KSO A;  3KTL A;  5INY A;  3CSI A;  2TRC P;  2YAN A;  4ULX A;  4TOP A;  4XS1 A;  3C71 A;  3KIJ A;  5IMA A;  2X8H A;  1SJZ A;  3ZIJ A;  4FYC A;  2H73 A;  2CV4 A;  1XWC A;  1PN9 A;  3IHQ A;  3IXR A;  1Q98 A;  3APS A;  1F37 A;  2LST A;  4O7H A;  1A2J A;  2YWM A;  4HU9 A;  1GTU A;  1T4Y A;  5H5S A;  4XS4 B;  2YWI A;  3HDC A;  1KEB A;  2F51 A;  3TJK A;  3TKP A;  4LMW A;  4L5O A;  2OA7 A;  2YV7 A;  2VOC A;  3HHV A;  2ALB A;  5DCH A;  1V58 A;  4V2M A;  4KUN A;  5DCG A;  1FOV A;  3VK9 A;  2P31 A;  1K0N A;  2DMM A;  4KB3 A;  2V32 A;  3HZ4 A;  1R4W A;  3HY2 A;  1K0M A;  2HZF A;  2WJU A;  3KH7 A;  1CQH A;  1NHY A;  2X8G A;  5G5E A;  2IJY A;  5DAK B;  3RAZ A;  5J9C A;  4MF7 A;  5J41 A;  1X9W B;  1QK8 A;  1M7T A;  5E4W A;  3APO A;  3H93 A;  1OVN A;  3A2W A;  1SYX A;  5ID2 B;  2LNT A;  4GF0 A;  1GSE A;  3FR9 A;  1EV9 A;  2OAC A;  4V2L A;  1OC9 B;  1XBS A;  4WBR D;  1X9S B;  5IMD A;  2JU5 A;  3QAG A;  13GS A;  4ZB8 A;  2DJ2 A;  4RI7 A;  2RM5 A;  2L59 A;  3ZVJ D;  2GSR A;  5DJL A;  1YJ6 A;  4OD7 A;  2XC2 A;  2L5O A;  4EO3 A;  2E0Q A;  3OR5 A;  3LXT A;  4F0C A;  4WEY A;  5B6N A;  1ZGN A;  1DUG A;  1TOF A;  3RDW A;  3FHK A;  1ZYE A;  4NPB A;  2K9F A;  4NHW A;  3CBU A;  2ON5 A;  3KP9 A;  1GH2 A;  4TR1 B;  4IHU A;  4MPF A;  4EDZ A;  2PVO C;  3DKS A;  4ZIL A;  4IQA A;  3EVI A;  3D21 A;  4IEL A;  4PXO A;  1HQO A;  2LQO A;  4XRD A;  4GCI A;  4JZQ A;  1SKR B;  1WOU A;  1PMT A;  12GS A;  5A5K A;  3ZMK A;  2MMN A;  5HR3 A;  2C3T A;  1Y25 A;  2ZNM A;  1FB6 A;  2VM2 A;  2YOI A;  5G31 A;  4J57 E;  4HU7 A;  4PNG A;  2FY6 A;  2H70 A;  3GX0 A;  5G5F A;  4JU5 A;  1K0B A;  1XXU A;  1O7U A;  1O6J A;  5ECS A;  1ERW A;  1OYJ A;  4N0V A;  3ZFB A;  2VCW A;  4L8E A;  3D4M A;  4FO5 A;  1T8E B;  1OE7 A;  2MZC A;  3GA4 A;  4ZBD A;  1FB0 A;  1LBK A;  3W6G A;  2NPB A;  1TP9 A;  1O73 A;  5DQS A;  1KTE A;  2MMZ A;  1VF3 A;  3BD2 A;  2YN1 A;  1DE2 A;  3US3 A;  2R6K A;  3GL3 A;  3Q74 A;  4MH2 A;  5COH A;  3VWV A;  2C8U A;  1EP8 A;  2PUK C;  4XRA A;  4P3Y B;  1O8W A;  4O32 A;  1B9Y C;  2R3X A;  2REM A;  4Q5N A;  1F3A A;  3RPN A;  2M72 A;  5C00 A;  3GKK A;  1SK2 A;  3IPZ A;  3O76 A;  3WGE A;  4LMV A;  1OC3 A;  2WGR A;  4O5R A;  1IYH A;  3KGK A;  4CHS A;  1GTA A;  1Z6N A;  6GSX A;  1SL0 B;  3C73 A;  3IBH A;  3ZFL A;  5HQP A;  1JFU A;  3F4S A;  5H5R A;  3N9J A;  1Z9H A;  5HFK A;  2IME A;  4MZB A;  3TOU A;  4KDU A;  4ID0 A;  4V2N A;  4GSN A;  3C8E A;  5KN1 A;  2PWJ A;  5ECI B;  4PQ1 A;  1GUL A;  3HVV A;  5GAN D;  4ZL8 A;  5FT3 A;  5D9X A;  1SD8 A;  2DIY A;  2HSY A;  3MAK A;  5J3R A;  2YCD A;  3J7Y k;  2C80 A;  3U5R E;  1WMJ A;  4TR0 A;  2MMA A;  4OO4 A;  3LJR A;  3F3Q A;  4RI6 A;  5DJM A;  4IVF A;  5D8I A;  4XHM A;  1DSB A;  3A2X A;  2MMO A;  4ZL7 A;  2GSS A;  3G7Y A;  1E6B A;  5B6M A;  2K6V A;  1LJR A;  3M3M A;  1VRS D;  2GQL A;  4AJ7 A;  3IV4 A;  3CRT A;  2HXK A;  4AJ6 A;  4YQV A;  4N0Z A;  4XTS A;  3PH9 A;  4Q5R A;  2H8L A;  3QD9 A;  2H1D A;  1G0T A;  1TU8 A;  4RQX A;  4LL4 B;  3CTG A;  1M9A A;  1EOG A;  2WS2 A;  3FR6 A;  3A3T A;  1XVQ A;  3FY7 A;  4DSS A;  3KD0 A;  2E2G A;  1XWA A;  2TIR A;  2WDU A;  1ZOF A;  2ZUP A;  3H79 A;  3GMF A;  2O85 A;  2BJX A;  5DAL B;  2L57 A;  4JBB A;  2V41 A;  1JZO A;  2IMD A;  3C1R A;  4DVC A;  1Y6E A;  2LUS A;  1K3L A;  4NXI A;  4K6X A;  1GSU A;  2B6M A;  3IK9 A;  3ZRE A;  3UEM A;  3APQ A;  1GSY A;  1AW9 A;  4MF6 A;  2IMI A;  2F9S A;  1VGL A;  2H76 A;  2F8F A;  1XVW A;  6GSU A;  1GP1 A;  3ZIV A;  3A5W A;  4ZIJ A;  4IQ1 A;  5HR0 A;  1CQG A;  1UVZ A;  5FHI A;  2E2M A;  2L5L A;  1WE0 A;  1GSQ A;  2JL4 A;  3HD5 A;  1EOH A;  3M1G A;  3KMO A;  1SL2 B;  4YAV A;  3UBL A;  3ERG A;  4N11 A;  1OC8 A;  4KA0 A;  2P0G A;  3TDG A;  1A0F A;  4K7N A;  2V2G A;  5EY6 A;  5KN3 A;  1ERU A;  2VL2 C;  3TJF A;  4AF2 A;  1U3A A;  2N5B A;  1OC9 A;  4IP1 A;  1PL2 A;  4H86 A;  5EVO A;  4HI7 A;  1BX9 A;  1E2Y A;  1K0A A;  4EKZ A;  4K0N A;  3LOR A;  5D93 A;  3GN3 A;  1MDK A;  4MLY A;  1G6Y A;  4ECI A;  4D73 A;  3UAP A;  3LWA A;  1RW1 A;  1SD9 A;  2DJ3 A;  3LSZ A;  4ML1 A;  3VFI A;  1VF1 A;  2B7J A;  4F9Z A;  1Z3E A;  3EYT A;  4Q5F A;  4ECC A;  4IKH A;  2GVP A;  2YPM A;  4ZB9 A;  2TRX A;  5GZZ B;  5ECH B;  2L4C A;  2IY2 A;  1H4O A;  3ME7 A;  4PUR A;  1ABA A;  5AN1 A;  3EIN A;  1S3A A;  4HJ2 A;  1J9B A;  10GS A;  3ED3 A;  2HYX A;  5CRD A;  3TJJ A;  2A2S A;  2I4A A;  2DJ0 A;  2DML A;  2NBS A;  2XPE A;  3QAV A;  1TK8 B;  3G7J A;  2JAC A;  4HOJ A;  2QGV A;  1PX6 A;  5J5N A;  3CXG A;  1MTC A;  2HRF A;  2IMK A;  3BJ5 A;  4HZ4 A;  1WWJ A;  2E7P A;  1R5A A;  2EC4 A;  3CMI A;  2FGX A;  3D6I A;  3GH9 A;  5JCW A;  1JZW A;  1EEM A;  5IMV A;  3V1W A;  3GUR A;  3HVX A;  2GTU A;  1UN2 A;  1FW1 A;  4PUF C;  3KMN A;  1XCC A;  2IN3 A;  5C04 A;  2I3Y A;  2FA4 A;  3ZVJ A;  2AAW A;  5A4U A;  3UMA A;  4IGJ A;  3W8J A;  3UOM A;  2VCX A;  1PA3 A;  3GNJ A;  3SBC A;  3GKX A;  4L5L A;  2N5F A;  5ECO B;  2CX4 A;  3GX8 A;  5AIS A;  3E9J B;  3FZ9 A;  3CTF A;  2OBK A;  2VLU A;  1TRV A;  3FK8 A;  2VIM A;  4KAE A;  1F9M A;  5IIZ A;  2HSH A;  1A23 A;  1R5P A;  5IOW A;  4TKY A;  1A8L A;  4QL7 A;  3UL3 A;  1NM3 A;  3HYP A;  3BBY A;  2FWH A;  4G10 A;  4OFN A;  5F07 A;  2VL3 A;  5F8B A;  3D22 A;  2H71 A;  1QMV A;  4HS1 A;  4F2I A;  2FHE A;  4EDY A;  1F3B A;  1GNE A;  5D9T A;  5IO0 A;  3LQ7 A;  4K2D A;  4PQH A;  2LJK A;  1GUM A;  2JSZ A;  2V6O A;  1BYE A;  2R2J A;  3ZML A;  1SJI A;  1BG5 A;  3H1N A;  4G2E A;  2WZ9 A;  2I1U A;  2NTO A;  4J2F A;  5IMZ A;  1FHE A;  1THX A;  1X5D A;  4ZBB A;  2OAD A;  3W8S A;  1ERT A;  2VCQ A;  3HCZ A;  2MYG A;  3PGT A;  3VPQ A;  3EUR A;  2C3N A;  1PL1 A;  5JCU A;  1QXH A;  4DSQ A;  3TKQ A;  1ON4 A;  5CNW A;  3FEU A;  1TRS A;  3R2Q A;  4MF5 A;  3GST A;  1SK0 A;  5FWG A;  2YJH A;  1B48 A;  1YEX A;  2FWE A;  1SEN A;  2H6X A;  2X64 A;  4EUY A;  1QFN A;  3FRC A;  3DIE A;  3JCM L;  2D2Z A;  2X99 A;  4MH3 A;  17GS A;  2IL3 A;  3LGC A;  2HLS A;  2KP2 A;  3DXB A;  4FIW A;  1GSS A;  3IR4 A;  3ZLP A;  4X0X A;  1M99 A;  2NDO A;  4IP6 A;  2RLI A;  3QCP A;  4AGS A;  3DD3 A;  1YY7 A;  1M0U A;  2GT6 A;  1B4P A;  2DSA A;  3Q18 A;  2HFD A;  2HZE B;  4NWY A;  5HR1 A;  4V1A p;  3GV1 A;  2LEG A;  3DYR A;  1PRX A;  1X0R A;  3HJO A;  5F05 A;  4ILF A;  2B5Y A;  3FR3 A;  3EC3 A;  2C0G A;  3I9V 2;  2I9H A;  3H4K A;  1XWG A;  4O92 A;  4CW9 A;  2M80 A;  4HJM A;  2C0D A;  2VCZ A;  2XBI A;  2H0I A;  1TRU A;  1WP0 A;  3GKM A;  4KDX A;  3TRP A;  5IOX A;  4I6X A;  2IPA A;  5JCG A;  2LRN A;  4OO5 A;  2IFQ B;  5CRE A;  4YQU A;  3D0Z A;  4IN0 A;  1HNB A;  2CZ3 A;  3KM6 A;  4MJC A;  2PU9 C;  1X5C A;  2R5G A;  1MDI A;  2IWT A;  1U6T A;  2WUL A;  2YWO A;  2FD3 A;  4QL9 A;  2F8A A;  5ECP B;  2MBT A;  2DJ1 A;  3DVX A;  3A2V A;  2ON7 A;  2YZU A;  3TKS A;  4K7I A;  3HZ8 A;  2YZH A;  4MA9 A;  2H0H A;  4TN8 A;  3QPM A;  3F4R A;  1USB A;  5HFG A;  1V2A A;  3CYN A;  1T3B A;  1SKW B;  4IJI A;  2VUP A;  3WT2 A;  4YAP A;  3GUS A;  3I43 A;  1OKT A;  1YF1 A;  2VO4 A;  3EMP A;  3UVT A;  1I9D A;  6GST A;  5B7C A;  16GS A;  2GT5 A;  1GSD A;  2PER A;  5AIX A;  3KEB A;  4Z7X A;  1M9B A;  3F9U A;  1PKW A;  3O6T A;  5ECK B;  1SL1 B;  3KTB A;  3ERF A;  3F0I A;  3VWU A;  3M9K A;  4GTU A;  3L4N A;  7GSS A;  1X9M B;  1XW5 A;  3L0H A;  2YNX A;  3HA9 A;  3RBT A;  3NIV A;  1GUH A;  3L9V A;  4BVX A;  4IW9 A;  1PX7 A;  4ZBA A;  2CAQ A;  3LEF A;  2L6C A;  3CRU A;  1N8J A;  3FZ5 A;  1B9X C;  4NV5 A;  3ERW A;  5F06 A;  5CRH A;  4N30 A;  2JZT A;  1R7H A;  4TRX A;  4MJA A;  2JAD A;  3F8U A;  1VF4 A;  2C1Y A;  1THO A;  4GQF A;  1GTI A;  2WFC A;  1FVK A;  4F0B A;  2AUV A;  1U3I A;  2HNL A;  3S9F A;  2LRT A;  4GQC A;  1GWC A;  1WRY A;  2N5A A;  2FWG A;  3GTU A;  2VL9 A;  2IYJ A;  3HJP A;  2CA8 A;  5JWR B;  1YF0 A;  3P90 A;  4GWR A;  2IMF A;  1HNC A;  4RQR A;  2WCI A;  3MWH A;  5LCZ A;  5IMF A;  5CRG A;  3ZZX A;  2H6Y A;  3DEX A;  5G2Z A;  2QSI A;  3NZN A;  3UBK A;  1W4V A;  3PIN A;  4IS0 A;  1XW6 A;  1QUW A;  2G2Q A;  1VF2 A;  3G9B A;  1Z5Y E;  3L78 A;  1TXX A;  4XS4 A;  6GSY A;  4WXT A;  1OAZ A;  1YZX A;  3LYK A;  4Q5Q A;  4QQ7 A;  4I97 A;  5F0G A;  2LKU A;  3P7X A;  2AV4 A;  3GYK A;  2XHF A;  2B5X A;  3CSJ A;  1A2L A;  2LS5 A;  2DJJ A;  1C72 A;  3PR8 A;  1F2E A;  1GTB A;  2MBS A;  2VCT A;  2CVK A;  3VWX A;  3GSS A;  4WKW A;  1EGR A;  1PGT A;  3M8N A;  1UC7 A;  3FKF A;  4CDO A;  4K7O A;  2OE0 A;  4WF5 A;  2JZS A;  1J08 A;  4DEJ A;  2GZY A;  3UVH A;  4K9Z A;  2IIY A;  4LLR A;  3AY8 A;  1ZYQ B;  5J9B A;  5DAK A;  3D4T A;  1AQX A;  1KBN A;  4EVM A;  1A8Y A;  4IBP A;  2B1K A;  4OFM A;  3E0U A;  3CSH A;  1G7E A;  3EU4 A;  4KDY A;  5ID2 A;  2C3Q A;  2Z9S A;  1F6M C;  3KJY A;  1EWX A;  3Q6O A;  1ZMA A;  5HFI A;  4POM A;  1WIK A;  1U88 A;  2ZCT A;  1GNW A;  1DE1 A;  3LFL A;  2CZ2 A;  1J0F A;  1BJX A;  3QR6 A;  5A4V A;  3EMX A;  4KND A;  4YH2 A;  2L4Q A;  4WET A;  4MZC A;  1T4Z A;  4X43 A;  1O85 A;  14GS A;  4JE1 A;  2JSY A;  1U87 A;  4FYU A;  4F03 A;  3D5J A;  3IA1 A;  3MSZ A;  2J23 A;  3IC4 A;  4TR1 A;  4TR4 A;  1T00 A;  1LU4 A;  3NOF A;  4G9H A;  2CQ9 A;  3GKN A;  1YKA A;  4WR5 A;  1A24 A;  5G1K A;  2VCV A;  4MAB A;  3UAR A;  1XFL A;  5ECL B;  2HI7 A;  5G1L A;  3IRA A;  1TDI A;  5GST A;  4MCU A;  2LJA A;  3SWL A;  2O8V B;  1JZD A;  2I81 A;  1O81 A;  2FWF A;  3VI5 A;  2LV3 A;  5HR2 A;  1QQ2 A;  3MDK A;  2H66 A;  4TXO B;  1GL8 A;  3QMX A;  3TJG A;  2DBC A;  5CYY A;  4V1A g;  2B3S A;  1RK4 A;  1V9W A;  5JWO B;  1AQV A;  1SU9 A;  4XS6 A;  3LYP A;  1N2A A;  2A2R A;  4J56 E;  1Z7P A;  20GS A;  2KHP A;  4NV2 A;  1JLW A;  1GRX A;  4FH8 A;  5ELA A;  3ZIT A;  1K3Y A;  6GSV A;  3GRX A;  4PGT A;  1YQ1 A;  2A4V A;  2CVD A;  2P5R A;  3GFK A;  1FVJ A;  4GSS A;  2YP6 A;  4ZXG A;  2GGT A;  4DSR A;  2IFQ A;  2VM1 A;  3N5O A;  1V98 A;  1JHB A;  2XPD A;  4JR6 A;  1NW2 A;  2V1M A;  1A0R P;  5D96 A;  4K0G A;  4NHZ A;  3ZTL A;  1Q4J A;  2QKE A;  5LNK e;  1ML6 A;  4KSM A;  5ABR A;  1JZR A;  1K0C A;  2H1A A;  1ZZY A;  4HEA 2;  3RHB A;  2H19 A;  19GS A;  4NAX A;  2EIR A;  1ACV A;  3LXZ A;  4IJ3 A;  1BQ7 A;  2DC5 A;  2VLT A;  2FNO A;  5CO3 A;  3P2A A;  3ZL5 A;  4ECJ A;  4N10 A;  2GQM A;  3UJ1 A;  3BCI A;  4MDC A;  3HKR A;  4K1F A;  2LJR A;  4ZB6 A;  3TGZ A;  4JR4 A;  1MD4 A;  1EEJ A;  2RUF A;  4E8H A;  1QGV A;  4MZW A;  4KX4 A;  2H75 A;  3KH9 A;  3VLN A;  1IYI A;  1XPV A;  3GIX A;  1XOA A;  4RUV A;  2YV9 A;  2NVL A;  2F3M A;  1G7O A;  3F4T A;  1ST9 A;  1TRW A;  2OJL A;  3BOA A;  4ACS A;  3F63 A;  1S3C A;  1M2B A;  4GXZ A;  4BA7 A;  2FLS A;  4D73 B;  5GAP D;  5EL8 A;  1B8X A;  2AJQ B;  1M2A A;  2H1B A;  1K0O A;  4AJ8 A;  2KP1 A;  2WB9 A;  2H74 A;  3FZA A;  9GSS A;  4BWS A;  2CX3 A;  2FA8 A;  2H72 A;  2QC7 A;  3EE2 A;  4ML6 A;  2AHE A;  4EC0 A;  3WGX A;  4POB A;  2R4V A;  4PX1 A;  5B8A A;  5AGY A;  1V57 A;  4JRR A;  1FAA A;  2H01 A;  2HRN A;  4GST A;  3FZ4 A;  3QAW A;  1G6W A;  3DVW A;  2LQQ A;  3TCO A;  5A4W A;  3TKS E;  4HZ2 A;  3TUE A;  3L9U A;  1BED A;  3VUR A;  1AQW A;  2HT9 A;  5B8B A;  1R26 A;  1TI1 A;  3EU3 A;  2C4J A;  3F6D A;  3ZRD A;  2CAI A;  3RHC A;  5G30 A;  4JED A;  5DAL A;  2DIZ A;  1ERV A;  1PSQ A;  1AXD A;  4HQZ A;  4ZL9 A;  2C0E A;  5H5Q A;  4K8M A;  1PQN A;  5DDL A;  4ISD A;  2K18 A;  2VL2 A;  22GS A;  1MDJ A;  4LL1 B;  1DBY A;  2FCH A;  3DRN A;  3QDN A;  1T7P B;  3UIW A;  3ISO A;  2KOK A;  6GSW A;  4LA1 A;  2YJ7 A;  3IAM 2;  1TW9 A;  5AIV A;  1TI3 A;  1MEK A;  1EV4 A;  1GSF A;  3RPP A;  4XIH A;  3TRX A;  4PNF A;  5J4U A;  2PN8 A;  4WF4 A;  8GSS A;  1TK5 B;  4I8B A;  3KCM A;  1KNG A;  5ELG A;  2V6K A;  3E3E A;  1GUK A;  3K8N A;  1I5G A;  1XW9 A;  4X1U A;  2L6D A;  3DML A;  1TK0 B;  3GH6 A;  3MNG A;  1EZK A;  2YWN A;  4OMV A;  3H8Q A;  2K8S A;  3EWL A;  3QFB C;  4TXV A;  2CT6 A;  2O89 A;  2R37 A;  2RUE A;  4TVE A;  4OFT A;  5D9V A;  1XWK A;  2AYT A;  2OE3 A;  2PGT A;  3FW2 A;  2G0F A;  4BL7 A;  1URM A;  2M46 A;  4G19 A;  3VI7 A;  2VD0 A;  1K3O A;  3IOS A;  4L0U A;  1UA5 A;  3QFA C;  4YQM A;  2RII A;  2GST A;  1HD2 A;  5ECM B;  2OBI A;  4EL1 A;  1YKC A;  5IM9 A;  2LRC A;  3GHA A;  18GS A;  1W89 A;  2GS3 A;  3F6F A;  3WYW A;  4KH7 A;  3LG6 A;  4KCA A;  2KLX A;  1NSW A;  3WD6 A;  4EE0 A;  1FO5 A;  3ME8 A;  5IPG A;  1SK1 A;  1ZCP A;  1AC1 A;  11GS A;  4TR3 A;  2OE1 A;  3GL5 A;  4MP4 A;  4EF0 A;  3M0F A;  4MK3 A;  1AAZ A;  5L71 A;  2LTK A;  4POK A;  1B4Q A;  4OCE A; 
#chains in the Genus database with same CATH topology
 3SVA A;  3FH1 A;  3VPT A;  2EIO A;  2GZP A;  2F56 A;  3FKA A;  4MPG A;  4KVH A;  2ES7 A;  2D1W A;  5DQY A;  2C0F A;  1A2M A;  1RCK A;  2B1L A;  5KN0 A;  1HNA A;  5KEJ A;  4HDE A;  5EPF A;  3I0Y A;  2GLR A;  4N6V 0;  3QOU A;  5GSS A;  2BTO T;  2PPT A;  6GSS A;  4X2H A;  2K8V A;  4ECB A;  2DJK A;  1T1V A;  3KP8 A;  3CCS 3;  3P8W A;  1I2E A;  2GSP A;  2W04 A;  3NM7 A;  2KUC A;  2OOV A;  1FOH A;  4OCF A;  4KE3 A;  1V40 A;  2J9H A;  4KZ1 A;  1YJN 3;  3SED A;  2E2T A;  2GQK A;  2RM6 A;  2C11 A;  3LOY A;  4J8T A;  1DE3 A;  4WBJ A;  1JB2 A;  4TXO A;  4BIK A;  1T2I A;  3TOT A;  5ECN B;  4EXJ A;  1X5E A;  1H75 A;  1O8X A;  1WJK A;  4WFO A;  1NHO A;  5IMC A;  2X8C A;  1BAY A;  2B7K A;  1EGO A;  2CG0 A;  3Q2P A;  3U6V A;  2H6Z A;  5ECR B;  4BL3 A;  1Z6M A;  2PBJ A;  1X1U A;  3PS8 A;  1IVX A;  2HE3 A;  5DRV A;  4WYK B;  4TW5 A;  5LD0 A;  3DWV A;  3TB2 A;  1YDK A;  1AIU A;  1TTZ A;  1ILO A;  1O7G B;  3DUK A;  4BWQ A;  2YFJ B;  4KCE A;  3JUO A;  2VAF A;  1Q9E A;  4FYB A;  1TKD B;  3WT1 A;  3BCK A;  5DBQ A;  2FUG 2;  1SAR A;  3IAS 2;  1XOB A;  5D9W A;  4POL A;  1NNV A;  1X1X A;  3RDE A;  1B2U A;  2GSQ A;  3KXO A;  2HMN B;  3S27 A;  5IPH A;  1MD3 A;  5KN2 A;  3F8H A;  4OWY A;  1GMP A;  1M2D A;  4I2U A;  3GWR A;  3S29 A;  4E8E A;  2EIQ A;  1SKS B;  2LNS A;  3C1S A;  1UUV B;  1K0D A;  3IE3 A;  1XZO A;  5AI1 A;  2HRK A;  2WOF A;  2GZZ A;  3HXS A;  4K1U A;  2O7K A;  5JWQ B;  1B2Z A;  1XWB A;  4RNT A;  1OCV A;  1Z7R A;  1AUC A;  4F82 A;  1TU7 A;  4KW6 A;  2WRT A;  1YJW 3;  2HML B;  3ER7 A;  5CAX A;  4HUA A;  5ECQ B;  3OW2 2;  3MYT A;  1N5P A;  3C7M A;  1TIJ A;  4PUA A;  1Q82 4;  1VQ8 3;  3TKR A;  1VQ4 3;  2WOH A;  3SLU A;  2PVQ A;  5E59 A;  4X2O A;  1Y4K A;  3LTA A;  1WPI A;  5D73 A;  3Q19 A;  2AB6 A;  2CKF B;  1RQM A;  2B5E A;  1FUT A;  1NB5 I;  1OKD A;  1BNI A;  4O5Q A;  3F3R A;  1PD2 1;  3WMD A;  3J7Y b;  4I5Q A;  3O3T A;  1S3D A;  3TRQ A;  1SJ6 A;  1OGZ A;  1RRH A;  1HYU A;  3BU4 A;  5CRW A;  2BMX A;  2M7O A;  5IO2 A;  4BVY A;  1ZL9 A;  4I2T A;  3LTD A;  3EX9 A;  3KZQ A;  3L9S A;  1NO3 A;  4GRF A;  1XIY A;  2RSX A;  4Z2T A;  1OE8 A;  5HOH A;  4BPY A;  2GDR A;  4KGI A;  1SYR A;  4GLT A;  5IQY A;  1IDP A;  3EQQ B;  5CP1 A;  5AYS C;  3TJB A;  4K90 B;  3G8Z A;  2CVB A;  4MJB A;  3WGD A;  4HQS A;  4EIQ A;  4L0W A;  7STD A;  1FG4 A;  4PQI A;  2PMT A;  3TKS C;  2H1G A;  5ENU A;  4BVX B;  2OKA A;  3I6A A;  1TRP A;  2HRA A;  3M9J A;  3ZYW A;  4HOH A;  1TJD A;  3HVS A;  5EVH A;  1BU4 A;  2JZR A;  3WHO A;  4NMU A;  4IIA A;  1YEP A;  3GZR A;  2DLX A;  3MG3 A;  4HM8 B;  3FYG A;  4MMM A;  3MIX A;  2XR8 B;  1XG8 A;  1RCL A;  4WR4 A;  2HZE A;  2P5Q A;  1GLQ A;  1YI2 3;  4N6N B;  3VWW A;  3IK7 A;  2H30 A;  5DVB A;  2XRX B;  2VLV A;  2XBQ A;  2VD1 A;  3D3L A;  2O87 A;  1ZYN A;  3KFQ C;  4J5G A;  1PKZ A;  3G7I A;  4MJE A;  1GLP A;  4O02 B;  3GTU B;  4DSS B;  1JLV A;  4CY6 A;  4XCS A;  3IDV A;  2H0G A;  3I69 A;  4H3U A;  1EP7 A;  4YKG A;  3DGQ A;  3DGL A;  3HJM A;  4KSO A;  3KTL A;  5INY A;  3CSI A;  2TRC P;  1IVU A;  1DVD A;  2YAN A;  4ULX A;  4TOP A;  2GU3 A;  2CWV A;  3HX8 A;  2HSM A;  3DGY A;  3C71 A;  4IT7 A;  3KIJ A;  3T8U A;  4XS1 A;  5IMA A;  1G96 A;  2X8H A;  1SJZ A;  3ZIJ A;  3WOD G;  4FYC A;  2H73 A;  2CV4 A;  1XWC A;  1PN9 A;  3IHQ A;  3NBJ A;  3IXR A;  1Q98 A;  3APS A;  4FCZ A;  1F37 A;  1N5H A;  2LST A;  4O7H A;  1A2J A;  2YWM A;  4HU9 A;  1GTU A;  1T4Y A;  5H5S A;  4XS4 B;  4KFD A;  3KN4 A;  2YWI A;  1IQX A;  3HDC A;  1KEB A;  3FLJ A;  2F51 A;  2KF5 A;  3TJK A;  3TKP A;  4LMW A;  2UZ8 A;  3HOH A;  4L5O A;  2OA7 A;  1ZO2 A;  2YV7 A;  1B2M A;  2VOC A;  4R80 A;  2CFW A;  3HHV A;  2ALB A;  4R9L A;  3IPT A;  5DCH A;  1V58 A;  1F8N A;  4V2M A;  4KUN A;  5DCG A;  3K9M C;  1FOV A;  3VK9 A;  1QAK A;  3LTB A;  2P31 A;  1K0N A;  4X4J A;  1DMN A;  1QJG A;  2Z7A A;  2DMM A;  4KB3 A;  2V32 A;  3HZ4 A;  1R4W A;  3HY2 A;  1K0M A;  2HZF A;  2WJU A;  3KH7 A;  1YVB I;  1CQH A;  1N8Q A;  1NHY A;  2X8G A;  5G5E A;  2IJY A;  5DAK B;  3RAZ A;  3VF1 A;  5J9C A;  4MF7 A;  5J41 A;  3NM2 A;  1X9W B;  5LC6 A;  1QK8 A;  1M7T A;  5M19 A;  1J2B A;  2LTK A;  5E4W A;  1T2H A;  1LOV A;  3CCJ 3;  3APO A;  1LRA A;  1QVF 2;  3FMW A;  3H93 A;  1OVN A;  3A2W A;  1SYX A;  5ID2 B;  3GZY B;  1I8V A;  2LNT A;  4GF0 A;  1GSE A;  3FR9 A;  1EV9 A;  3F8X A;  3FSD A;  2OAC A;  4V2L A;  1OC9 B;  1I2F A;  1UCI A;  1XBS A;  4WBR D;  4GB5 A;  1N9E A;  1X9S B;  1FGT A;  5IMD A;  4K1V A;  3CCM 3;  2JU5 A;  3QAG A;  1MWS A;  1R4C A;  13GS A;  2BNG A;  4ZB8 A;  2DJ2 A;  4RI7 A;  2RM5 A;  2L59 A;  3ZVJ D;  2GSR A;  1YJ6 A;  4OD7 A;  5DJL A;  1KD1 4;  3X41 A;  1LOX A;  3E99 A;  2XC2 A;  2L5O A;  1RLS A;  4EO3 A;  2E0Q A;  3OR5 A;  2BMR B;  3LXT A;  3K5T A;  4F0C A;  3VSY A;  1DET A;  4WEY A;  5B6N A;  1WMO A;  1ZGN A;  1DUG A;  1TOF A;  1CQS A;  1GOU A;  2AAD A;  3RDW A;  2OCT A;  3FHK A;  5M1A A;  1ZYE A;  4NPB A;  2K9F A;  4NHW A;  3CBU A;  2ON5 A;  1OUN A;  3KP9 A;  1TUH A;  4FCM A;  2W56 A;  3CCV 3;  1GH2 A;  4TR1 B;  1BRJ A;  4IHU A;  4MPF A;  4EDZ A;  2PVO C;  3DKS A;  1BNF A;  4ZIL A;  4IQA A;  1I0V A;  2Y73 A;  6RNT A;  3EVI A;  3D21 A;  4IEL A;  5G2G A;  2K0M A;  4PXO A;  1HQO A;  2LQO A;  4XRD A;  4J5K A;  1EQK A;  4GCI A;  4JZQ A;  1SKR B;  5CXO A;  1PMT A;  1WOU A;  12GS A;  1RTU A;  5A5K A;  3ZMK A;  2CG1 A;  2MMN A;  4N6T A;  5HR3 A;  2C3T A;  1Y25 A;  1BRS A;  2ZNM A;  1K41 A;  1I70 A;  1FB6 A;  2VM2 A;  2YOI A;  5G31 A;  4J57 E;  4HU7 A;  1ROA A;  4PNG A;  1IQ8 A;  2FY6 A;  1ISK A;  3JUQ A;  2H70 A;  1RN4 A;  2OWP A;  3GX0 A;  5G5F A;  4JU5 A;  1K0B A;  1XXU A;  1O7U A;  4HZ9 B;  1O6J A;  5ECS A;  1ERW A;  1OYJ A;  2YFL B;  1BNG A;  4N0V A;  3ZFB A;  2VCW A;  4L8E A;  3D4M A;  2W6J H;  4FO5 A;  1HZ1 A;  3CNX A;  1T8E B;  1OE7 A;  4FMD A;  4O8S A;  2MZC A;  3GA4 A;  2OQE A;  4ZBD A;  3S28 A;  1FB0 A;  1LBK A;  1GY6 A;  1YVS A;  3MPH A;  3W6G A;  2NPB A;  8RNT A;  1V74 A;  1TP9 A;  1O73 A;  5DQS A;  3H51 A;  1RGC A;  4XB5 A;  1G02 A;  1KTE A;  2MMZ A;  3F14 A;  1Q42 A;  1VF3 A;  4LMI A;  3G71 3;  2CFG A;  3BD2 A;  1AQZ A;  2YN1 A;  1ZYP A;  1DE2 A;  2GXF A;  3US3 A;  2R6K A;  3GL3 A;  3PCS A;  2OTJ 3;  1SPU A;  3Q74 A;  4MH2 A;  5COH A;  3VWV A;  3UB1 A;  1RGL A;  2C8U A;  3SYU A;  1EP8 A;  2PUK C;  3CCL 3;  3NBB A;  4XRA A;  5D82 A;  4HYZ A;  1RGG A;  4P3Y B;  1RNT A;  5EQL A;  3EBY A;  1JN5 A;  3RGA A;  1O8W A;  4O32 A;  2FGT A;  1B9Y C;  2R3X A;  2REM A;  1F3A A;  1PY3 A;  4Q5N A;  1JBR A;  2GEX A;  3RPN A;  2W9P A;  2M72 A;  1B2S A;  5C00 A;  3GKK A;  1SK2 A;  3IPZ A;  3O76 A;  1JJ2 2;  3WGE A;  1FW7 A;  1W7C A;  4LMV A;  1OC3 A;  2WGR A;  4O5R A;  1IYH A;  3KGK A;  4CHS A;  5ELJ A;  1GTA A;  4MMZ B;  1Z6N A;  3CCQ 3;  1QVG 2;  1TFO A;  3Q90 A;  6GSX A;  1SL0 B;  3C73 A;  3EE1 A;  3IBH A;  3ZFL A;  5HQP A;  1JV2 B;  1JFU A;  1VZZ A;  5IEN A;  2CHC A;  3F4S A;  1UI8 A;  5H5R A;  3N9J A;  4Z2R A;  3D5I A;  1Z9H A;  5HFK A;  2IME A;  4MZB A;  4USS A;  4KDU A;  3TOU A;  4ID0 A;  3DZL A;  2SAR A;  4V2N A;  2D42 A;  3CU3 A;  4GSN A;  3C8E A;  5KN1 A;  2PWJ A;  5CLK A;  1B21 A;  3PZW A;  5ECI B;  4PQ1 A;  1GUL A;  3HVV A;  1MWT A;  5GAN D;  4ZL8 A;  5FT3 A;  1W2Z A;  5D9X A;  1SD8 A;  2DIY A;  2HSY A;  3MAK A;  5J3R A;  2YCD A;  4NHF A;  2R41 A;  3J7Y k;  2C80 A;  1S5A A;  3U5R E;  1WMJ A;  4TR0 A;  2MMA A;  4OO4 A;  1JKG B;  4MMY B;  3LJR A;  2C10 A;  3F3Q A;  4RI6 A;  3B8L A;  5DJM A;  4IVF A;  1GMR A;  1M1X B;  3NV0 B;  1BAO A;  5BRT A;  5D8I A;  2ZA4 A;  4XHM A;  1YIT 3;  3CC4 3;  1DSB A;  7RNT A;  3A2X A;  3HII A;  4L8P A;  4QWT A;  1A2P A;  2MMO A;  3T0U A;  2K3D A;  1ASK A;  1BSD A;  2R0P A;  1PN0 A;  2MF7 A;  4ZL7 A;  1GY5 A;  1AV4 A;  1VQO 3;  2GSS A;  3G7Y A;  1E6B A;  5B6M A;  2K6V A;  2HMJ B;  1LJR A;  2IMJ A;  2P38 A;  2E2V A;  3M3M A;  1VRS D;  1MGR A;  2UX0 A;  2GQL A;  4AJ7 A;  3IV4 A;  2XGN A;  3CRT A;  2HXK A;  4AJ6 A;  4YQV A;  4N0Z A;  3SXX A;  4XTS A;  2ML5 A;  3PH9 A;  4Q5R A;  2H8L A;  3QD9 A;  1K8A 4;  2H1D A;  1G0T A;  1TU8 A;  4RQX A;  1IK3 A;  3N54 B;  4LL4 B;  3CTG A;  1M9A A;  1EOG A;  2WS2 A;  3FR6 A;  4FMB A;  3A3T A;  1CEW I;  2HMK B;  5D81 A;  4OUQ A;  1XVQ A;  1PFO A;  3FY7 A;  4DSS A;  3KD0 A;  2E2G A;  1XWA A;  2TIR A;  2WDU A;  4LSO A;  1JBS A;  1ZOF A;  2ZUP A;  3H79 A;  1KQS 2;  2QEX 3;  3GMF A;  2O85 A;  2CX0 A;  2BJX A;  5DAL B;  3CPW 2;  2L57 A;  4EYC A;  5CF1 A;  4JBB A;  1ULJ B;  1AVK A;  5IG5 A;  3AHS A;  2V41 A;  1JZO A;  2IMD A;  3C1R A;  4YKF A;  1IT7 A;  1YGE A;  3K63 A;  4K5S A;  4DVC A;  2Q07 A;  1Y6E A;  2CFK A;  2LUS A;  1BUQ A;  2CX1 A;  1K3L A;  4NXI A;  2P0X A;  4K6X A;  1GSU A;  2B6M A;  3IK9 A;  4HAA A;  3ZRE A;  3UEM A;  1VQM 3;  3APQ A;  3H3H A;  1GSY A;  1AW9 A;  4MF6 A;  2IMI A;  1NJI 4;  2F9S A;  1VGL A;  3BNC A;  2H76 A;  6STD A;  3WA2 X;  2F8F A;  3CQF A;  2IUJ A;  1XVW A;  6GSU A;  1GP1 A;  2WO0 A;  3ZIV A;  1UI7 A;  3A5W A;  2KF6 A;  3NXJ A;  2DKI A;  4ZIJ A;  2C4B A;  3B4O A;  4IQ1 A;  5HR0 A;  1CQG A;  2RCD A;  1UVZ A;  5FHI A;  2FNQ A;  2E2M A;  2L5L A;  1WE0 A;  3HK4 A;  1GSQ A;  4MEI A;  2IUK A;  2JL4 A;  1AVL A;  3HD5 A;  5CK6 A;  3G16 A;  1EOH A;  2AAE A;  3M1G A;  3DXO A;  3KMO A;  2X4A A;  1SL2 B;  4YAV A;  3UBL A;  3ERG A;  3X3X A;  3G4S 3;  4N11 A;  2I9W A;  1OC8 A;  1GS3 A;  1W6G A;  4HKV B;  4KA0 A;  2KF4 A;  4R1K A;  2P0G A;  3TDG A;  1A0F A;  2O3O A;  4K7N A;  4PTS A;  1W00 A;  2V2G A;  5EY6 A;  5KN3 A;  2XH9 A;  1ERU A;  2VL2 C;  3TJF A;  3D4A A;  4AF2 A;  2XSO B;  1U3A A;  5KP4 A;  2N5B A;  1FUS A;  3NHX A;  3URP A;  1Z1S A;  4BL7 B;  5AEU B;  1OC9 A;  3X40 A;  3R3E A;  4IP1 A;  1PL2 A;  4H86 A;  5EVO A;  4HI7 A;  1BX9 A;  3LXU X;  5HGR A;  1E2Y A;  1K0A A;  4EKZ A;  4K0N A;  3LOR A;  5D93 A;  1Q86 4;  2SBL A;  3AMO B;  1A90 A;  1RGE A;  3DGM A;  3V98 A;  3GN3 A;  1MDK A;  3UL6 A;  4MLY A;  1BOX A;  1G6Y A;  4ECI A;  4D73 A;  1K9M 4;  3UAP A;  3LWA A;  1RW1 A;  1SD9 A;  3EHC A;  2DJ3 A;  3LSZ A;  4K61 A;  1YJ9 3;  4ML1 A;  3VFI A;  1VF1 A;  2B7J A;  5JPU A;  4F9Z A;  1Z3E A;  3EYT A;  4Q5F A;  4ECC A;  4IKH A;  2GVP A;  2YPM A;  4N6M A;  1VQN 3;  3HVN A;  4G0I A;  4ZB9 A;  2TRX A;  1E3R A;  5GZZ B;  1JB5 A;  5ECH B;  2L4C A;  3MKI A;  1Q40 B;  2IY2 A;  3NUV A;  3Q1C A;  1UUG B;  1H4O A;  3ME7 A;  4PUR A;  1ABA A;  2OTL 3;  3ECF A;  5AN1 A;  3EIN A;  5JPP A;  1S3A A;  2BMQ B;  1UDI I;  4HJ2 A;  2O9U X;  1J9B A;  1GD4 A;  4IPB A;  10GS A;  3SOY A;  3SOA A;  1D6U A;  3ED3 A;  2HYX A;  5CRD A;  3TJJ A;  1O7N B;  1FYS A;  4CDL A;  2A2S A;  3AGN A;  3WDG B;  2I4A A;  2DJ0 A;  2DML A;  2NBS A;  1I3I A;  2XPE A;  4JF8 A;  3QAV A;  1TK8 B;  3G7J A;  1JRQ A;  3J7Y d;  5TGN A;  2JAC A;  4HOJ A;  2QGV A;  1JB4 A;  1PX6 A;  4BIR A;  5J5N A;  3CXG A;  1MTC A;  3KE7 A;  2HRF A;  2IMK A;  4EV2 A;  3BJ5 A;  1US1 A;  4HZ4 A;  1WWJ A;  1W02 A;  5A0O B;  2E7P A;  1R5A A;  3DGO A;  4U13 A;  3CXC 2;  2EC4 A;  3CMI A;  2FGX A;  3HI7 A;  3D6I A;  1LQM B;  3GH9 A;  1OHP A;  3EPT A;  1FGM A;  2QIY A;  2F5W A;  3G6E 3;  2GU1 A;  5JCW A;  1JZW A;  1EEM A;  5IMV A;  3V1W A;  2LQV A;  2QA2 A;  3EN1 B;  4O5U A;  1IU7 A;  3GUR A;  1O7M B;  5FGO A;  3HVX A;  4JRF A;  2GTU A;  1UN2 A;  1FW1 A;  3ROB A;  4PUF C;  3KMN A;  2RBI A;  3MG2 A;  1XCC A;  2IN3 A;  5C04 A;  2I3Y A;  4HVN A;  2FA4 A;  3FG4 A;  3ZVJ A;  4FMC A;  2AAW A;  5A4U A;  1E97 A;  2UGI A;  4IGJ A;  3UMA A;  3UOM A;  3W8J A;  2VCX A;  1PA3 A;  3GNJ A;  3SBC A;  2K54 A;  3GKX A;  4L5L A;  2N5F A;  5ECO B;  2CX4 A;  3ALA A;  3GX8 A;  5AIS A;  3E9J B;  3FZ9 A;  5IF6 A;  3CTF A;  1ZGX A;  2OBK A;  3WA3 A;  2VLU A;  1TRV A;  3FK8 A;  2VIM A;  4KAE A;  8CHO A;  1F9M A;  4XBY A;  5IIZ A;  2HSH A;  1A23 A;  1R5P A;  5IOW A;  4TKY A;  1D6Y A;  5ELU A;  3ZFZ A;  1A8L A;  4QL7 A;  3UL3 A;  1NM3 A;  1CH0 A;  1BRK A;  2OOV C;  2HMO B;  3HYP A;  3BBY A;  2FWH A;  4G10 A;  4OFN A;  5F07 A;  2VL3 A;  5F8B A;  3D22 A;  3OX9 A;  2H71 A;  2F5M A;  2CC3 A;  4EBG A;  1QMV A;  4HS1 A;  2B1X B;  4F2I A;  2FHE A;  4EDY A;  1F3B A;  1GNE A;  5D9T A;  1IVV A;  3F9S A;  3DY5 A;  5IO0 A;  3LQ7 A;  3L0R A;  4K2D A;  4PQH A;  2LJK A;  1GUM A;  2JSZ A;  2V6O A;  4HM2 B;  1BYE A;  1TP6 A;  2R2J A;  3ZML A;  2R0C A;  1I3F A;  1SJI A;  1BG5 A;  3H1N A;  4G2E A;  1ROV A;  2WZ9 A;  3KCH A;  2I1U A;  2NTO A;  4J2F A;  5IMZ A;  3BND A;  1FHE A;  2RFR A;  3OWU A;  1THX A;  1X5D A;  1LQG C;  4ZBB A;  2OAD A;  3W8S A;  1ERT A;  2VCQ A;  3HCZ A;  1W4N A;  1OF5 A;  2R4I A;  2MYG A;  4BVY B;  3PGT A;  4RNY A;  2CK3 H;  3VPQ A;  1B2X A;  3EUR A;  2C3N A;  1IT8 A;  5I97 A;  1PL1 A;  5JCU A;  1QXH A;  4GL6 A;  4DSQ A;  3TKQ A;  2BMO B;  1ON4 A;  5CNW A;  3FEU A;  1TRS A;  3R2Q A;  1AY7 A;  3GST A;  4MF5 A;  1SK0 A;  5FWG A;  2YJH A;  1B48 A;  1YEX A;  2FWE A;  4DKI A;  1SEN A;  2H6X A;  1JKG A;  2X64 A;  4BTY A;  4EUY A;  3IJE B;  1QFN A;  3FRC A;  4FQU A;  3DIE A;  3JCM L;  2D2Z A;  3X42 A;  1GSP A;  2X99 A;  4MH3 A;  17GS A;  2IL3 A;  1RHL A;  3LGC A;  2HLS A;  1O7H B;  2KP2 A;  4R9K A;  3DXB A;  3CCU 3;  4Z2U A;  4FIW A;  1GSS A;  3IR4 A;  1I2G A;  1BAN A;  3ZLP A;  4X0X A;  1M99 A;  2NDO A;  4IP6 A;  2RLI A;  3VGN A;  3QCP A;  2GBW B;  1HKX A;  4AGS A;  3DD3 A;  2KRT A;  1YY7 A;  3FF2 A;  2X49 A;  2F86 B;  1QMA A;  1M0U A;  2Z77 A;  2GT6 A;  1B4P A;  2DSA A;  3Q18 A;  4HM6 B;  1UW1 A;  1GOY A;  2HFD A;  3CMA 3;  1HYF A;  2HZE B;  4NWY A;  5HR1 A;  4V1A p;  3GV1 A;  3MHE A;  2LEG A;  1WMP A;  3DYR A;  1PRX A;  1X0R A;  3HJO A;  2W2C A;  1STD A;  3EJV A;  5F05 A;  3S5C A;  4ILF A;  4ORL A;  1GYB A;  2B5Y A;  3DH2 A;  5AIG A;  1RKY A;  3FR3 A;  4FCJ A;  3EC3 A;  2C0G A;  5AYR B;  2Z6B A;  1LNH A;  5AEW B;  3I9V 2;  1VQK 3;  2I9H A;  4ICY A;  3H4K A;  2CH9 A;  3LTC A;  1XWG A;  1VQL 3;  2P05 A;  4WYK A;  4O92 A;  4CW9 A;  3N9H A;  1M1K 4;  2M80 A;  4HJM A;  3FF0 A;  4ZM8 A;  2C0D A;  4K2X A;  2VCZ A;  2XBI A;  2H0I A;  1TRU A;  1WP0 A;  3GKM A;  4KDX A;  3TRP A;  3UJM A;  5IOX A;  4I6X A;  2IPA A;  1BRN L;  1KWI A;  3AGO A;  1NU3 A;  5JCG A;  3GZB A;  2LRN A;  4OO5 A;  2IFQ B;  5CRE A;  4YQU A;  1X1Y A;  1VQQ A;  3EBT A;  3D0Z A;  4IN0 A;  4EV5 A;  1HNB A;  3V92 A;  3FG1 A;  2CZ3 A;  3KM6 A;  4MNN A;  4MJC A;  2PU9 C;  1X5C A;  2R5G A;  3GRD A;  1BSC A;  1MDI A;  2IWT A;  1U6T A;  2WUL A;  2YWO A;  2FD3 A;  5IEO A;  4KFE A;  4QL9 A;  2F8A A;  3LYG A;  5ECP B;  1W2B 2;  2MBT A;  4EXR A;  5IG4 A;  2DJ1 A;  3DVX A;  2BIR A;  3A2V A;  2ON7 A;  1E3V A;  2L4V A;  2YZU A;  3TKS A;  9RNT A;  4K7I A;  2F99 A;  4HM0 B;  3HZ8 A;  2FXT A;  1M3I A;  1B3S A;  2YZH A;  4MA9 A;  3NQZ A;  3DMC A;  3WOE B;  2KF3 A;  2BU4 A;  1UCJ A;  3A76 A;  4Q53 A;  2H0H A;  4TN8 A;  1BNR A;  1OGX A;  1ZS7 A;  3F4R A;  3QPM A;  1USB A;  5HFG A;  2ZDJ A;  1V2A A;  3CYN A;  1T3B A;  1SKW B;  2YFI B;  4IJI A;  2VUP A;  1UGH I;  1VQP 3;  3WT2 A;  4YAP A;  3MYD A;  3GUS A;  3PPU A;  3I43 A;  1OKT A;  1R4Y A;  1NB3 I;  1YF1 A;  2VO4 A;  3EMP A;  3UVT A;  1I9D A;  6GST A;  5B7C A;  16GS A;  2GT5 A;  1GSD A;  2PER A;  4BL2 A;  5AIX A;  3KEB A;  4Z7X A;  1PFP A;  4N6L A;  1M9B A;  3F9U A;  4WHA A;  1MOL A;  2BO9 B;  4XDV A;  1PKW A;  3O6T A;  3CNM A;  5ECK B;  5EEO A;  1SL1 B;  3KTB A;  3GAX A;  3ERF A;  3F0I A;  3F40 A;  3VWU A;  3M9K A;  3EF8 A;  2ZL8 A;  4GTU A;  3L4N A;  1S3R A;  7GSS A;  1X9M B;  1XW5 A;  3L0H A;  4G0K A;  4RZM A;  2YNX A;  1BGS A;  3ZG5 A;  3HA9 A;  4L8O A;  3RBT A;  3NIV A;  3LW9 A;  1GUH A;  3L9V A;  4BVX A;  4IW9 A;  1PX7 A;  4ZBA A;  2BT3 A;  2CAQ A;  3BIR A;  3LEF A;  1K73 4;  2L6C A;  2XGL A;  3CRU A;  1OHO A;  5FW5 A;  1N8J A;  3LT8 A;  3FZ5 A;  1Q40 A;  1B9X C;  2W56 B;  3ERW A;  4NV5 A;  5CRH A;  5F06 A;  1UUW B;  3CC2 3;  1W5Z A;  4N30 A;  4MMX B;  4HM7 B;  2JZT A;  4HJL B;  1R7H A;  4TRX A;  4MJA A;  2JAD A;  3F8U A;  2W03 A;  1VF4 A;  2C1Y A;  1THO A;  1KSI A;  4GQF A;  1GTI A;  2WFC A;  1FVK A;  1FZU A;  1IV7 A;  4F0B A;  2AUV A;  4STD A;  1U3I A;  2HNL A;  1WQL B;  3S9F A;  2LRT A;  4GQC A;  1GWC A;  1WRY A;  5JBS A;  1W6C A;  3K7C A;  2N5A A;  5CF2 A;  2B24 B;  2FWG A;  1WMN A;  3BNB A;  1MWR A;  3GTU A;  2VL9 A;  2IYJ A;  3HJP A;  2CA8 A;  3MSO A;  5JWR B;  1YF0 A;  3P90 A;  4GWR A;  3STD A;  2XSH B;  3SX1 A;  2IMF A;  4BTX A;  1W01 A;  1HNC A;  3ZG0 A;  2W0Q A;  2WCI A;  3MWH A;  4RQR A;  5LCZ A;  5IMF A;  2LYX A;  4HBR A;  5CRG A;  3ZZX A;  2H6Y A;  3DEX A;  5G2Z A;  2QSI A;  1BSA A;  3NZN A;  3UBK A;  1W4V A;  1K28 A;  3F7X A;  3PIN A;  5KP3 A;  1TFK A;  1Q7H A;  5AII A;  2WGQ A;  1PU4 A;  4IS0 A;  4XBX A;  1XW6 A;  1QUW A;  2G2Q A;  1VF2 A;  3G9B A;  1Z5Y E;  3L78 A;  1TXX A;  4XS4 A;  6GSY A;  4WXT A;  1OAZ A;  1YZX A;  3LYK A;  4Q5Q A;  3OXA A;  3D79 A;  4N6O B;  1YHQ 3;  1SII A;  4QQ7 A;  4I97 A;  1MGW A;  4XBT A;  5IG0 A;  5F0G A;  1RN1 A;  2LKU A;  4BTW A;  4HM5 B;  3P7X A;  2AV4 A;  3V99 A;  3GYK A;  2XHF A;  4EW5 A;  2F98 A;  1PYL A;  3A5I A;  4O2H A;  1AR0 A;  3LT9 A;  2B5X A;  1A2L A;  1JNQ A;  1BIR A;  2LS5 A;  1GMQ A;  2DJJ A;  3CSJ A;  1C72 A;  1RGA A;  3PR8 A;  1O7P B;  1F2E A;  1GTB A;  2MBS A;  2VCT A;  2CVK A;  3VWX A;  3GSS A;  4WKW A;  3IMA B;  4HSC X;  1JBT A;  1EGR A;  2UUG C;  1A2V A;  1PGT A;  3M8N A;  1UC7 A;  3FKF A;  2L1S A;  4CDO A;  3PXM A;  1RNB A;  2OE0 A;  4K7O A;  4WF5 A;  1WTH A;  2JZS A;  1J08 A;  2CW9 A;  4DEJ A;  1RDS A;  2GZY A;  3UVH A;  1EG9 B;  1JN5 B;  3MWZ A;  4HZB B;  4K9Z A;  2IIY A;  4G0L A;  4LLR A;  1BRG A;  3AY8 A;  1ZYQ B;  2HOH A;  2P0M A;  1SQW A;  3B7C A;  5J9B A;  5DAK A;  3D4T A;  2JDI H;  1L5G B;  1AQX A;  1KBN A;  4EVM A;  5BU4 A;  4HM4 B;  1GD3 A;  6GSP A;  2J8X B;  1TRQ A;  1A8Y A;  4IBP A;  2B1K A;  3JUM A;  4OFM A;  5BXQ A;  4PEJ A;  3E0U A;  1QAL A;  4I4K A;  2F4Y A;  3CSH A;  4WP5 A;  4RNZ A;  1G7E A;  3EU4 A;  2PNC A;  4KDY A;  5ID2 A;  2C3Q A;  3F7S A;  3EC9 A;  2Z9S A;  1F6M C;  1A2K A;  3KJY A;  1EWX A;  3Q6O A;  3CC7 3;  2OQE C;  3T8N A;  1ZMA A;  5HFI A;  4POM A;  1WIK A;  1U88 A;  1RJO A;  2ZCT A;  1GNW A;  3GSP A;  1DE1 A;  2CWU A;  1SIH A;  3LZA A;  3LFL A;  2CZ2 A;  1J0F A;  1BJX A;  3QR6 A;  4L7K A;  5A4V A;  1O7W B;  5DRE A;  1FUW A;  4FMA A;  3EMX A;  4KND A;  1FGR A;  4YH2 A;  3LH4 A;  2L4Q A;  1OPY A;  4WET A;  4MZC A;  1T4Z A;  1YNV X;  5BMU A;  3G0K A;  1MWU A;  4X43 A;  1O85 A;  14GS A;  1FGQ A;  4JE1 A;  2JSY A;  1U87 A;  4FYU A;  4NRE A;  4F03 A;  3D5J A;  3IA1 A;  1OH0 A;  3MSZ A;  1DMQ A;  2J23 A;  3IC4 A;  4TR1 A;  2DKH A;  1BNJ A;  3MG1 A;  4TR4 A;  1T00 A;  1LU4 A;  3NOF A;  4R4K A;  1LXE A;  4G9H A;  2CQ9 A;  3GKN A;  1YKA A;  2PZV A;  3B4P A;  3O8Y A;  4WR5 A;  1VQ6 3;  3BNE A;  1B4Q A;  1A24 A;  4HM3 B;  5G1K A;  2VCV A;  4MAB A;  3UAR A;  1DMM A;  1XFL A;  5ECL B;  2HI7 A;  5G1L A;  2XF3 A;  3IRA A;  1RGF A;  1TDI A;  5GST A;  4MCU A;  1FA3 A;  2LJA A;  3SWL A;  4OK0 A;  2O8V B;  1JZD A;  4J9A A;  1LNI A;  3BLZ A;  2I81 A;  1O81 A;  2FWF A;  3VI5 A;  4H61 A;  2LV3 A;  1U8C B;  5HR2 A;  1QQ2 A;  4AKZ A;  3MDK A;  2H66 A;  4TXO B;  1DYU A;  3DM8 A;  3QMX A;  1GL8 A;  3TJG A;  1N9J A;  2DBC A;  4LYL B;  3M8C A;  1HU9 A;  4KF9 A;  5CYY A;  2HMM B;  3JUN A;  4V1A g;  3FGY A;  1ZX2 A;  2B3S A;  1RK4 A;  1V9W A;  5JWO B;  1ULI B;  1AQV A;  1SU9 A;  1RRL A;  3LYP A;  4XS6 A;  1N2A A;  2A2R A;  4J56 E;  1Z7P A;  20GS A;  2KHP A;  4EIP A;  5M18 A;  4NV2 A;  2YX9 A;  1JLW A;  3S67 A;  1GRX A;  4FH8 A;  2ML6 A;  5ELA A;  2MC8 A;  4G1M B;  3ZIT A;  1K3Y A;  6GSV A;  3GRX A;  4PGT A;  1YQ1 A;  2A4V A;  1KC8 4;  2CVD A;  2P5R A;  3U1W A;  4N3V A;  3GFK A;  1FVJ A;  5BIR A;  4GSS A;  2W9Q A;  2YP6 A;  4ZXG A;  2GGT A;  4DSR A;  2IFQ A;  2VM1 A;  3N5O A;  1V98 A;  1RSN A;  5RNT A;  1JHB A;  4GHO A;  3KSP A;  3HZP A;  2XPD A;  4AKY A;  4JR6 A;  1NW2 A;  3LML A;  2V1M A;  1A0R P;  1UGI A;  5D96 A;  3AHW A;  4K0G A;  4NHZ A;  3ZTL A;  1B27 A;  1Q4J A;  2QKE A;  5LNK e;  1ML6 A;  4KSM A;  5ABR A;  3Q3F A;  1JZR A;  1K0C A;  2H1A A;  1ZZY A;  4HEA 2;  1BNS A;  3RHB A;  1GY7 A;  2QGU A;  2H19 A;  2A15 A;  19GS A;  4NAX A;  2XFS A;  2EIR A;  1ACV A;  2V1L A;  2CWT A;  3LXZ A;  4IJ3 A;  2XEP A;  1BQ7 A;  2DC5 A;  1M90 4;  2Y74 A;  2VLT A;  5AIH A;  2FNO A;  5CO3 A;  3P2A A;  3OWS A;  3ZL5 A;  1U5O A;  1RGH A;  3U97 A;  4LEH A;  4ECJ A;  4N10 A;  2GQM A;  4HM1 B;  3UJ1 A;  3BCI A;  4MDC A;  4N6U A;  4MJD A;  3HKR A;  4K1F A;  2LJR A;  3CD6 3;  4ZB6 A;  3TGZ A;  1BRH A;  5IER A;  4JR4 A;  1T5Y A;  1RMS A;  5LC7 A;  2RGQ A;  1A67 A;  2R0G A;  1YGW A;  1SJW A;  1MD4 A;  1EEJ A;  4OVM A;  3WOF B;  2RUF A;  4E8H A;  3OWY A;  1QGV A;  4MZW A;  2XFT A;  4KX4 A;  1BVI A;  1YIJ 3;  5AIF A;  2H75 A;  1CYV A;  3KH9 A;  1IYI A;  3VLN A;  1XPV A;  3GIX A;  1XOA A;  3GZX B;  1FGO A;  4RUV A;  2YV9 A;  3EN8 A;  2NVL A;  1OHS A;  2F3M A;  1G7O A;  3F4T A;  3JUP A;  3A5E A;  1EKM A;  1ST9 A;  1TRW A;  2OJL A;  2ZHX B;  3BOA A;  4ACS A;  3F63 A;  1S3C A;  1M2B A;  1Q81 4;  4GXZ A;  3NV0 A;  3K0Z A;  5D83 A;  4BA7 A;  2FLS A;  4D73 B;  5GAP D;  5EL8 A;  1B8X A;  5IEP A;  5KP1 A;  2AJQ B;  1M2A A;  3QK9 A;  2H1B A;  3X3Y A;  2CFL A;  1K0O A;  4CPK A;  1IVW A;  4AJ8 A;  2KCD A;  3FCS B;  2KP1 A;  2QA4 3;  2WB9 A;  2H74 A;  3FZA A;  5IW9 A;  1NDO B;  9GSS A;  3EB8 A;  4BWS A;  2CX3 A;  2Z76 A;  4K5R A;  2E2U A;  3NBR A;  2FA8 A;  2H72 A;  2QC7 A;  3EE2 A;  4ML6 A;  2AHE A;  4EC0 A;  4XDW A;  3WGX A;  4POB A;  2R4V A;  4LGQ A;  4PX1 A;  5B8A A;  5AGY A;  1V57 A;  4JRR A;  1FAA A;  2H01 A;  2HRN A;  3WR2 A;  4GST A;  3FZ4 A;  3QAW A;  1G6W A;  3KII A;  3DVW A;  2LQQ A;  3KKG A;  3TCO A;  5A4W A;  3KZT A;  3OV4 A;  3TKS E;  4HZ2 A;  2KAA A;  3TUE A;  1NWW A;  3L9U A;  1EUI C;  1BED A;  1AQW A;  3VUR A;  2HT9 A;  5B8B A;  4O3V A;  1WNH A;  1OAC A;  1R26 A;  1TI1 A;  1N8R 4;  4KT3 B;  3FG3 A;  3EU3 A;  4GSP A;  2C4J A;  3F6D A;  3NQY A;  1M9G A;  3ZRD A;  2CAI A;  3UNL A;  3RHC A;  1UCL A;  1RGK A;  1Q7Y 4;  5G30 A;  1BSE A;  1EA2 A;  4JED A;  5DAL A;  2DIZ A;  1X1W A;  1C54 A;  1ERV A;  1PSQ A;  3CPO A;  1AXD A;  4HQZ A;  4ZL9 A;  1VQ7 3;  1BNE A;  2INX A;  2C0E A;  5H5Q A;  4K8M A;  2GBX B;  1PQN A;  1W6Y A;  5DDL A;  4ISD A;  2K18 A;  1RN7 A;  3HIG A;  22GS A;  1LOY A;  1IQY A;  1MDJ A;  2VL2 A;  4LL1 B;  1DBY A;  2FCH A;  3DRN A;  3IC8 A;  3QDN A;  5IG3 A;  1T7P B;  4WWU C;  3CME 3;  3X3Z A;  1M3J A;  3ISO A;  3UIW A;  2KOK A;  6GSW A;  3PGB A;  4LA1 A;  2YJ7 A;  5BVB A;  3IAM 2;  1TU5 A;  2STD A;  3D9R A;  1STF I;  5KOW A;  1TW9 A;  5AIV A;  1TI3 A;  3JVC A;  3BB9 A;  1MEK A;  2JQ5 A;  1EV4 A;  1GSF A;  3RPP A;  3NX0 A;  4BU4 A;  4AEQ A;  4XIH A;  3TRX A;  4PNF A;  3KSE D;  5J4U A;  2PN8 A;  4WF4 A;  8GSS A;  1TK5 B;  4I8B A;  3KCM A;  1KNG A;  5ELG A;  1I0X A;  2V6K A;  3UL5 A;  3CCR 3;  3E3E A;  2RNT A;  3QRD A;  3RNT A;  1GUK A;  3K8N A;  4KFF A;  1QAF A;  1I5G A;  4XM4 A;  3FZW A;  1XW9 A;  4CCV A;  4X1U A;  2L6D A;  3DML A;  1TK0 B;  1CYU A;  1BUJ A;  3GH6 A;  3MNG A;  1EZK A;  1IYY A;  3DGN A;  1VQ5 3;  4RBN A;  2A2P A;  4EC6 A;  2YWN A;  4OMV A;  1GOV A;  3H8Q A;  2K8S A;  3EWL A;  3QFB C;  4TXV A;  2WGO A;  3I55 3;  2CT6 A;  2O89 A;  2GEY A;  2R37 A;  2IA7 A;  1DVC A;  2RUE A;  3PYJ A;  2CIU A;  4TVE A;  4OFT A;  5D9V A;  1B20 A;  4LZI A;  1XWK A;  2AYT A;  2OE3 A;  2PGT A;  3FW2 A;  2G0F A;  3PCR A;  4BL7 A;  1URM A;  3IHG A;  3RGR A;  2M46 A;  4G19 A;  3VI7 A;  2VD0 A;  1K3O A;  4A5P A;  3IOS A;  4L0U A;  1UA5 A;  3QFA C;  4YQM A;  4CY8 A;  2RII A;  2GST A;  2CFD A;  1HD2 A;  5ECM B;  4FR9 A;  2P09 A;  2OBI A;  3AMO A;  4EL1 A;  1YKC A;  1D6Z A;  1OF5 B;  2KXG A;  5IM9 A;  5KOX A;  2LRC A;  3GHA A;  18GS A;  1W89 A;  2GS3 A;  3F6F A;  3WYW A;  4KH7 A;  3D5G A;  3LG6 A;  4KCA A;  1C7H A;  2KLX A;  7GSP A;  1NSW A;  1VQ9 3;  3WD6 A;  1LOW A;  4EE0 A;  1BRI A;  5GSP A;  1FO5 A;  3N8B A;  2A4H A;  5STD A;  1TTO A;  3I56 3;  4TX4 A;  3ME8 A;  5IPG A;  2BHM A;  4CJN A;  1S72 3;  1SK1 A;  2QA1 A;  1IV9 A;  1ZCP A;  1AC1 A;  3CCE 3;  11GS A;  4TR3 A;  2OE1 A;  1UCK A;  3GL5 A;  4MP4 A;  4EF0 A;  3M0F A;  1LVN A;  4MK3 A;  1AAZ A;  5L71 A;  1MNL A;  4POK A;  1BSB A;  4OCE A; 
#chains in the Genus database with same CATH homology
 3VPT A;  2EIO A;  2GZP A;  4MPG A;  2ES7 A;  5DQY A;  2C0F A;  1A2M A;  2B1L A;  5KN0 A;  1HNA A;  5KEJ A;  4HDE A;  5EPF A;  2GLR A;  3QOU A;  5GSS A;  2BTO T;  2PPT A;  6GSS A;  2K8V A;  4ECB A;  2DJK A;  1T1V A;  3KP8 A;  3P8W A;  2KUC A;  1FOH A;  4OCF A;  4KE3 A;  1V40 A;  2J9H A;  2RM6 A;  2GQK A;  4WBJ A;  4TXO A;  3TOT A;  5ECN B;  4EXJ A;  1X5E A;  1H75 A;  1O8X A;  1WJK A;  1NHO A;  5IMC A;  2X8C A;  1BAY A;  2B7K A;  1EGO A;  3U6V A;  2H6Z A;  5ECR B;  1Z6M A;  2PBJ A;  2HE3 A;  4TW5 A;  5LD0 A;  3DWV A;  3TB2 A;  1YDK A;  1AIU A;  1TTZ A;  1ILO A;  4BWQ A;  4KCE A;  2VAF A;  4FYB A;  1TKD B;  3WT1 A;  3BCK A;  5DBQ A;  2FUG 2;  3IAS 2;  5D9W A;  1XOB A;  4POL A;  2GSQ A;  3KXO A;  5IPH A;  1MD3 A;  5KN2 A;  4OWY A;  1M2D A;  4I2U A;  4E8E A;  2EIQ A;  1SKS B;  2LNS A;  3C1S A;  1K0D A;  3IE3 A;  1XZO A;  2HRK A;  2GZZ A;  3HXS A;  2O7K A;  5JWQ B;  1XWB A;  1Z7R A;  1AUC A;  4F82 A;  1TU7 A;  4KW6 A;  2WRT A;  5CAX A;  4HUA A;  5ECQ B;  3C7M A;  4PUA A;  3TKR A;  2PVQ A;  5E59 A;  1WPI A;  5D73 A;  3Q19 A;  2AB6 A;  1RQM A;  2B5E A;  1OKD A;  4O5Q A;  3F3R A;  1PD2 1;  3J7Y b;  4I5Q A;  3O3T A;  1S3D A;  3TRQ A;  1SJ6 A;  1HYU A;  5CRW A;  2BMX A;  5IO2 A;  4BVY A;  1ZL9 A;  4I2T A;  3L9S A;  3KZQ A;  4GRF A;  1XIY A;  4Z2T A;  1OE8 A;  4BPY A;  2GDR A;  4KGI A;  1SYR A;  4GLT A;  5IQY A;  5CP1 A;  3TJB A;  4MJB A;  2CVB A;  3WGD A;  4HQS A;  4EIQ A;  4L0W A;  1FG4 A;  4PQI A;  2PMT A;  3TKS C;  2H1G A;  5ENU A;  4BVX B;  2OKA A;  3I6A A;  2HRA A;  3M9J A;  3ZYW A;  1TJD A;  3HVS A;  2JZR A;  4NMU A;  1YEP A;  2DLX A;  3FYG A;  4MMM A;  3MIX A;  4WR4 A;  2HZE A;  2P5Q A;  1GLQ A;  3VWW A;  3IK7 A;  2H30 A;  5DVB A;  2VLV A;  2XBQ A;  2VD1 A;  2O87 A;  1ZYN A;  3G7I A;  1PKZ A;  4MJE A;  1GLP A;  3GTU B;  4DSS B;  1JLV A;  4CY6 A;  4XCS A;  3IDV A;  2H0G A;  3I69 A;  1EP7 A;  4YKG A;  3DGQ A;  3HJM A;  4KSO A;  3KTL A;  5INY A;  3CSI A;  2TRC P;  2YAN A;  4ULX A;  4TOP A;  4XS1 A;  3C71 A;  2HSM A;  3KIJ A;  5IMA A;  2X8H A;  1SJZ A;  3ZIJ A;  4FYC A;  2H73 A;  2CV4 A;  1XWC A;  1PN9 A;  3IHQ A;  3IXR A;  1Q98 A;  3APS A;  1F37 A;  2LST A;  4O7H A;  1A2J A;  2YWM A;  4HU9 A;  1GTU A;  1T4Y A;  5H5S A;  4XS4 B;  2YWI A;  3HDC A;  1KEB A;  2F51 A;  3TJK A;  3TKP A;  4LMW A;  2UZ8 A;  4L5O A;  2OA7 A;  2YV7 A;  2VOC A;  3HHV A;  2ALB A;  5DCH A;  1V58 A;  4V2M A;  4KUN A;  5DCG A;  1FOV A;  3VK9 A;  2P31 A;  1K0N A;  4X4J A;  2DMM A;  4KB3 A;  2V32 A;  3HZ4 A;  1R4W A;  3HY2 A;  1K0M A;  2HZF A;  2WJU A;  3KH7 A;  1CQH A;  1NHY A;  2X8G A;  5G5E A;  2IJY A;  5DAK B;  3RAZ A;  5J9C A;  4MF7 A;  5J41 A;  1X9W B;  1QK8 A;  1M7T A;  5E4W A;  3APO A;  3FMW A;  3H93 A;  1OVN A;  3A2W A;  1SYX A;  5ID2 B;  2LNT A;  4GF0 A;  1GSE A;  3FR9 A;  1EV9 A;  2OAC A;  4V2L A;  1OC9 B;  1XBS A;  4WBR D;  1X9S B;  5IMD A;  2JU5 A;  3QAG A;  13GS A;  4ZB8 A;  2DJ2 A;  4RI7 A;  2RM5 A;  2L59 A;  3ZVJ D;  2GSR A;  1YJ6 A;  4OD7 A;  5DJL A;  2XC2 A;  2L5O A;  4EO3 A;  2E0Q A;  3OR5 A;  3LXT A;  4F0C A;  4WEY A;  5B6N A;  1ZGN A;  1DUG A;  1TOF A;  3RDW A;  3FHK A;  1ZYE A;  4NPB A;  2K9F A;  4NHW A;  3CBU A;  2ON5 A;  3KP9 A;  1GH2 A;  4TR1 B;  4IHU A;  4MPF A;  4EDZ A;  2PVO C;  3DKS A;  4ZIL A;  4IQA A;  3EVI A;  3D21 A;  4IEL A;  4PXO A;  1HQO A;  2LQO A;  4XRD A;  4GCI A;  4JZQ A;  1SKR B;  1WOU A;  1PMT A;  12GS A;  5A5K A;  3ZMK A;  2MMN A;  5HR3 A;  2C3T A;  1Y25 A;  2ZNM A;  1FB6 A;  2VM2 A;  2YOI A;  5G31 A;  4J57 E;  4HU7 A;  4PNG A;  2FY6 A;  2H70 A;  3GX0 A;  5G5F A;  4JU5 A;  1K0B A;  1XXU A;  1O7U A;  1O6J A;  5ECS A;  1ERW A;  1OYJ A;  4N0V A;  3ZFB A;  2VCW A;  4L8E A;  3D4M A;  4FO5 A;  1T8E B;  1OE7 A;  2MZC A;  3GA4 A;  4ZBD A;  1FB0 A;  1LBK A;  3W6G A;  2NPB A;  1TP9 A;  1O73 A;  5DQS A;  1KTE A;  2MMZ A;  1VF3 A;  3BD2 A;  2YN1 A;  1ZYP A;  1DE2 A;  3US3 A;  2R6K A;  3GL3 A;  3Q74 A;  4MH2 A;  5COH A;  3VWV A;  2C8U A;  1EP8 A;  2PUK C;  4XRA A;  4P3Y B;  1O8W A;  4O32 A;  1B9Y C;  2R3X A;  2REM A;  4Q5N A;  1F3A A;  3RPN A;  2M72 A;  5C00 A;  3GKK A;  1SK2 A;  3IPZ A;  3O76 A;  3WGE A;  4LMV A;  1OC3 A;  2WGR A;  4O5R A;  1IYH A;  3KGK A;  4CHS A;  1GTA A;  1Z6N A;  6GSX A;  1SL0 B;  3C73 A;  3IBH A;  3ZFL A;  5HQP A;  1JFU A;  3F4S A;  5H5R A;  3N9J A;  4Z2R A;  1Z9H A;  5HFK A;  2IME A;  4MZB A;  4USS A;  4KDU A;  3TOU A;  4ID0 A;  4V2N A;  4GSN A;  3C8E A;  5KN1 A;  2PWJ A;  5ECI B;  4PQ1 A;  1GUL A;  3HVV A;  5GAN D;  4ZL8 A;  5FT3 A;  5D9X A;  1SD8 A;  2DIY A;  2HSY A;  3MAK A;  5J3R A;  2YCD A;  3J7Y k;  2C80 A;  3U5R E;  1WMJ A;  4TR0 A;  2MMA A;  4OO4 A;  3LJR A;  3F3Q A;  4RI6 A;  5DJM A;  4IVF A;  5BRT A;  5D8I A;  4XHM A;  1DSB A;  3A2X A;  2MMO A;  2R0P A;  1PN0 A;  4ZL7 A;  2GSS A;  3G7Y A;  1E6B A;  5B6M A;  2K6V A;  1LJR A;  3M3M A;  1VRS D;  2GQL A;  4AJ7 A;  3IV4 A;  3CRT A;  2HXK A;  4AJ6 A;  4YQV A;  4N0Z A;  4XTS A;  3PH9 A;  4Q5R A;  2H8L A;  3QD9 A;  2H1D A;  1G0T A;  1TU8 A;  4RQX A;  4LL4 B;  3CTG A;  1M9A A;  1EOG A;  2WS2 A;  3FR6 A;  3A3T A;  1XVQ A;  3FY7 A;  4DSS A;  3KD0 A;  2E2G A;  1XWA A;  2TIR A;  2WDU A;  1ZOF A;  2ZUP A;  3H79 A;  3GMF A;  2O85 A;  2BJX A;  5DAL B;  2L57 A;  4JBB A;  2V41 A;  1JZO A;  2IMD A;  3C1R A;  4YKF A;  4K5S A;  4DVC A;  1Y6E A;  2LUS A;  1K3L A;  4NXI A;  4K6X A;  1GSU A;  2B6M A;  3IK9 A;  3ZRE A;  3UEM A;  3APQ A;  1GSY A;  1AW9 A;  4MF6 A;  2IMI A;  2F9S A;  1VGL A;  2H76 A;  2F8F A;  1XVW A;  6GSU A;  1GP1 A;  3ZIV A;  3A5W A;  2DKI A;  4ZIJ A;  4IQ1 A;  5HR0 A;  1CQG A;  1UVZ A;  5FHI A;  2E2M A;  2L5L A;  1WE0 A;  1GSQ A;  2JL4 A;  3HD5 A;  1EOH A;  3M1G A;  3KMO A;  2X4A A;  1SL2 B;  4YAV A;  3UBL A;  3ERG A;  4N11 A;  1OC8 A;  4KA0 A;  2P0G A;  3TDG A;  1A0F A;  4K7N A;  4PTS A;  2V2G A;  5EY6 A;  5KN3 A;  1ERU A;  2VL2 C;  3TJF A;  4AF2 A;  1U3A A;  2N5B A;  4BL7 B;  1OC9 A;  3R3E A;  4IP1 A;  1PL2 A;  4H86 A;  5EVO A;  4HI7 A;  1BX9 A;  1E2Y A;  1K0A A;  4EKZ A;  4K0N A;  3LOR A;  5D93 A;  3GN3 A;  1MDK A;  4MLY A;  1G6Y A;  4ECI A;  4D73 A;  3UAP A;  3LWA A;  1RW1 A;  1SD9 A;  2DJ3 A;  3LSZ A;  4ML1 A;  3VFI A;  1VF1 A;  2B7J A;  4F9Z A;  1Z3E A;  3EYT A;  4Q5F A;  4ECC A;  4IKH A;  2GVP A;  2YPM A;  4G0I A;  4ZB9 A;  2TRX A;  5GZZ B;  5ECH B;  2L4C A;  2IY2 A;  1H4O A;  3ME7 A;  4PUR A;  1ABA A;  5AN1 A;  3EIN A;  1S3A A;  4HJ2 A;  1J9B A;  10GS A;  3ED3 A;  2HYX A;  5CRD A;  3TJJ A;  2A2S A;  2I4A A;  2DJ0 A;  2DML A;  2NBS A;  2XPE A;  3QAV A;  1TK8 B;  3G7J A;  2JAC A;  4HOJ A;  2QGV A;  1PX6 A;  5J5N A;  3CXG A;  1MTC A;  2HRF A;  2IMK A;  3BJ5 A;  4HZ4 A;  1WWJ A;  2E7P A;  1R5A A;  2EC4 A;  3CMI A;  2FGX A;  3D6I A;  3GH9 A;  3EPT A;  5JCW A;  1JZW A;  1EEM A;  5IMV A;  3V1W A;  2QA2 A;  4O5U A;  3GUR A;  3HVX A;  2GTU A;  1UN2 A;  1FW1 A;  4PUF C;  3KMN A;  1XCC A;  2IN3 A;  5C04 A;  2I3Y A;  2FA4 A;  3ZVJ A;  2AAW A;  5A4U A;  3UMA A;  4IGJ A;  3W8J A;  3UOM A;  2VCX A;  1PA3 A;  3GNJ A;  3SBC A;  3GKX A;  4L5L A;  2N5F A;  5ECO B;  2CX4 A;  3GX8 A;  5AIS A;  3E9J B;  3FZ9 A;  3CTF A;  2OBK A;  2VLU A;  1TRV A;  3FK8 A;  2VIM A;  4KAE A;  1F9M A;  5IIZ A;  2HSH A;  1A23 A;  1R5P A;  5IOW A;  4TKY A;  1A8L A;  4QL7 A;  3UL3 A;  1NM3 A;  3HYP A;  3BBY A;  2FWH A;  4G10 A;  4OFN A;  5F07 A;  2VL3 A;  5F8B A;  3D22 A;  2H71 A;  1QMV A;  4HS1 A;  4F2I A;  2FHE A;  4EDY A;  1F3B A;  1GNE A;  5D9T A;  5IO0 A;  3LQ7 A;  4K2D A;  4PQH A;  2LJK A;  1GUM A;  2JSZ A;  2V6O A;  1BYE A;  2R2J A;  3ZML A;  2R0C A;  1SJI A;  1BG5 A;  3H1N A;  4G2E A;  2WZ9 A;  2I1U A;  2NTO A;  4J2F A;  5IMZ A;  1FHE A;  1THX A;  1X5D A;  4ZBB A;  2OAD A;  3W8S A;  1ERT A;  2VCQ A;  3HCZ A;  2MYG A;  4BVY B;  3PGT A;  3VPQ A;  3EUR A;  2C3N A;  1PL1 A;  5JCU A;  1QXH A;  4DSQ A;  3TKQ A;  1ON4 A;  5CNW A;  3FEU A;  1TRS A;  3R2Q A;  4MF5 A;  3GST A;  1SK0 A;  5FWG A;  2YJH A;  1B48 A;  1YEX A;  2FWE A;  1SEN A;  2H6X A;  2X64 A;  4EUY A;  1QFN A;  3FRC A;  4FQU A;  3DIE A;  3JCM L;  2D2Z A;  2X99 A;  4MH3 A;  17GS A;  2IL3 A;  3LGC A;  2HLS A;  2KP2 A;  3DXB A;  4Z2U A;  4FIW A;  1GSS A;  3IR4 A;  3ZLP A;  4X0X A;  1M99 A;  2NDO A;  4IP6 A;  2RLI A;  3QCP A;  4AGS A;  3DD3 A;  1YY7 A;  2X49 A;  1M0U A;  2GT6 A;  1B4P A;  2DSA A;  3Q18 A;  2HFD A;  2HZE B;  4NWY A;  5HR1 A;  4V1A p;  3GV1 A;  2LEG A;  3DYR A;  1PRX A;  1X0R A;  3HJO A;  5F05 A;  4ILF A;  2B5Y A;  3FR3 A;  3EC3 A;  2C0G A;  3I9V 2;  2I9H A;  4ICY A;  3H4K A;  1XWG A;  4O92 A;  4CW9 A;  2M80 A;  4HJM A;  2C0D A;  4K2X A;  2VCZ A;  2XBI A;  2H0I A;  1TRU A;  1WP0 A;  3GKM A;  4KDX A;  3TRP A;  5IOX A;  4I6X A;  2IPA A;  5JCG A;  2LRN A;  4OO5 A;  2IFQ B;  5CRE A;  4YQU A;  3D0Z A;  4IN0 A;  1HNB A;  2CZ3 A;  3KM6 A;  4MNN A;  4MJC A;  2PU9 C;  1X5C A;  2R5G A;  1MDI A;  2IWT A;  1U6T A;  2WUL A;  2YWO A;  2FD3 A;  4QL9 A;  2F8A A;  5ECP B;  2MBT A;  2DJ1 A;  3DVX A;  3A2V A;  2ON7 A;  2YZU A;  3TKS A;  4K7I A;  3HZ8 A;  2YZH A;  4MA9 A;  2H0H A;  4TN8 A;  3QPM A;  3F4R A;  1USB A;  5HFG A;  1V2A A;  3CYN A;  1T3B A;  1SKW B;  4IJI A;  2VUP A;  3WT2 A;  4YAP A;  3MYD A;  3GUS A;  3PPU A;  3I43 A;  1OKT A;  1YF1 A;  2VO4 A;  3EMP A;  3UVT A;  1I9D A;  6GST A;  5B7C A;  16GS A;  2GT5 A;  1GSD A;  2PER A;  5AIX A;  3KEB A;  4Z7X A;  1M9B A;  3F9U A;  1PKW A;  3O6T A;  5ECK B;  1SL1 B;  3KTB A;  3ERF A;  3F0I A;  3VWU A;  3M9K A;  4GTU A;  3L4N A;  7GSS A;  1X9M B;  1XW5 A;  3L0H A;  4G0K A;  2YNX A;  3HA9 A;  3RBT A;  3NIV A;  3LW9 A;  1GUH A;  3L9V A;  4BVX A;  4IW9 A;  1PX7 A;  4ZBA A;  2CAQ A;  3LEF A;  2L6C A;  3CRU A;  1N8J A;  3FZ5 A;  1B9X C;  4NV5 A;  3ERW A;  5F06 A;  5CRH A;  4N30 A;  2JZT A;  1R7H A;  4TRX A;  4MJA A;  2JAD A;  3F8U A;  1VF4 A;  2C1Y A;  1THO A;  4GQF A;  1GTI A;  2WFC A;  1FVK A;  4F0B A;  2AUV A;  1U3I A;  2HNL A;  3S9F A;  2LRT A;  4GQC A;  1GWC A;  1WRY A;  2N5A A;  2FWG A;  3GTU A;  2VL9 A;  2IYJ A;  3HJP A;  2CA8 A;  5JWR B;  1YF0 A;  3P90 A;  4GWR A;  2IMF A;  1HNC A;  4RQR A;  2WCI A;  3MWH A;  5LCZ A;  5IMF A;  5CRG A;  3ZZX A;  2H6Y A;  3DEX A;  5G2Z A;  2QSI A;  3NZN A;  3UBK A;  1W4V A;  3PIN A;  4IS0 A;  1XW6 A;  1QUW A;  2G2Q A;  1VF2 A;  3G9B A;  1Z5Y E;  3L78 A;  1TXX A;  4XS4 A;  6GSY A;  4WXT A;  1OAZ A;  1YZX A;  3LYK A;  4Q5Q A;  4QQ7 A;  4I97 A;  5F0G A;  2LKU A;  3P7X A;  2AV4 A;  3GYK A;  2XHF A;  3A5I A;  2B5X A;  3CSJ A;  1A2L A;  2LS5 A;  2DJJ A;  1C72 A;  3PR8 A;  1F2E A;  1GTB A;  2MBS A;  2VCT A;  2CVK A;  3VWX A;  3GSS A;  4WKW A;  1EGR A;  1PGT A;  3M8N A;  1UC7 A;  3FKF A;  4CDO A;  4K7O A;  2OE0 A;  4WF5 A;  2JZS A;  1J08 A;  4DEJ A;  2GZY A;  3UVH A;  4K9Z A;  2IIY A;  4G0L A;  4LLR A;  3AY8 A;  1ZYQ B;  5J9B A;  5DAK A;  3D4T A;  1AQX A;  1KBN A;  4EVM A;  1A8Y A;  4IBP A;  2B1K A;  4OFM A;  3E0U A;  3CSH A;  1G7E A;  3EU4 A;  4KDY A;  5ID2 A;  2C3Q A;  2Z9S A;  1F6M C;  3KJY A;  1EWX A;  3Q6O A;  1ZMA A;  5HFI A;  4POM A;  1WIK A;  1U88 A;  2ZCT A;  1GNW A;  1DE1 A;  3LFL A;  2CZ2 A;  1J0F A;  1BJX A;  3QR6 A;  5A4V A;  3EMX A;  4KND A;  4YH2 A;  2L4Q A;  4WET A;  4MZC A;  1T4Z A;  5BMU A;  4X43 A;  1O85 A;  14GS A;  4JE1 A;  2JSY A;  1U87 A;  4FYU A;  4F03 A;  3D5J A;  3IA1 A;  3MSZ A;  2J23 A;  3IC4 A;  4TR1 A;  2DKH A;  4TR4 A;  1T00 A;  1LU4 A;  3NOF A;  4G9H A;  2CQ9 A;  3GKN A;  1YKA A;  4WR5 A;  1A24 A;  5G1K A;  2VCV A;  4MAB A;  3UAR A;  1XFL A;  5ECL B;  2HI7 A;  5G1L A;  3IRA A;  1TDI A;  5GST A;  4MCU A;  2LJA A;  3SWL A;  2O8V B;  1JZD A;  2I81 A;  1O81 A;  2FWF A;  3VI5 A;  2LV3 A;  5HR2 A;  1QQ2 A;  3MDK A;  2H66 A;  4TXO B;  1GL8 A;  3QMX A;  3TJG A;  2DBC A;  4KF9 A;  5CYY A;  4V1A g;  2B3S A;  1RK4 A;  1V9W A;  5JWO B;  1AQV A;  1SU9 A;  4XS6 A;  3LYP A;  1N2A A;  2A2R A;  4J56 E;  1Z7P A;  20GS A;  2KHP A;  4EIP A;  4NV2 A;  1JLW A;  1GRX A;  4FH8 A;  5ELA A;  3ZIT A;  1K3Y A;  6GSV A;  3GRX A;  4PGT A;  1YQ1 A;  2A4V A;  2CVD A;  2P5R A;  3GFK A;  1FVJ A;  4GSS A;  2YP6 A;  4ZXG A;  2GGT A;  4DSR A;  2IFQ A;  2VM1 A;  3N5O A;  1V98 A;  1JHB A;  2XPD A;  4JR6 A;  1NW2 A;  2V1M A;  1A0R P;  5D96 A;  4K0G A;  4NHZ A;  3ZTL A;  1Q4J A;  2QKE A;  5LNK e;  1ML6 A;  4KSM A;  5ABR A;  1JZR A;  1K0C A;  2H1A A;  1ZZY A;  4HEA 2;  3RHB A;  2H19 A;  19GS A;  4NAX A;  2EIR A;  1ACV A;  3LXZ A;  4IJ3 A;  1BQ7 A;  2DC5 A;  2VLT A;  2FNO A;  5CO3 A;  3P2A A;  3ZL5 A;  4ECJ A;  4N10 A;  2GQM A;  3UJ1 A;  3BCI A;  4MDC A;  3HKR A;  4K1F A;  2LJR A;  4ZB6 A;  3TGZ A;  4JR4 A;  2R0G A;  1MD4 A;  1EEJ A;  2RUF A;  4E8H A;  1QGV A;  4MZW A;  4KX4 A;  2H75 A;  3KH9 A;  3VLN A;  1IYI A;  1XPV A;  3GIX A;  1XOA A;  4RUV A;  2YV9 A;  2NVL A;  2F3M A;  1G7O A;  3F4T A;  1ST9 A;  1TRW A;  2OJL A;  3BOA A;  4ACS A;  3F63 A;  1S3C A;  1M2B A;  4GXZ A;  4BA7 A;  2FLS A;  4D73 B;  5GAP D;  5EL8 A;  1B8X A;  2AJQ B;  1M2A A;  2H1B A;  1K0O A;  4AJ8 A;  2KP1 A;  2WB9 A;  2H74 A;  3FZA A;  9GSS A;  4BWS A;  2CX3 A;  4K5R A;  2FA8 A;  2H72 A;  2QC7 A;  3EE2 A;  4ML6 A;  2AHE A;  4EC0 A;  3WGX A;  4POB A;  2R4V A;  4PX1 A;  5B8A A;  5AGY A;  1V57 A;  4JRR A;  1FAA A;  2H01 A;  2HRN A;  4GST A;  3FZ4 A;  3QAW A;  1G6W A;  3DVW A;  2LQQ A;  3TCO A;  5A4W A;  3TKS E;  4HZ2 A;  3TUE A;  3L9U A;  1BED A;  3VUR A;  1AQW A;  2HT9 A;  5B8B A;  1R26 A;  1TI1 A;  3EU3 A;  2C4J A;  3F6D A;  3ZRD A;  2CAI A;  3RHC A;  5G30 A;  4JED A;  5DAL A;  2DIZ A;  1ERV A;  1PSQ A;  1AXD A;  4HQZ A;  4ZL9 A;  2C0E A;  5H5Q A;  4K8M A;  1PQN A;  5DDL A;  4ISD A;  2K18 A;  2VL2 A;  22GS A;  1MDJ A;  4LL1 B;  1DBY A;  2FCH A;  3DRN A;  3IC8 A;  3QDN A;  1T7P B;  3UIW A;  3ISO A;  2KOK A;  6GSW A;  4LA1 A;  2YJ7 A;  3IAM 2;  5KOW A;  1TW9 A;  5AIV A;  1TI3 A;  1MEK A;  1EV4 A;  1GSF A;  3RPP A;  4XIH A;  3TRX A;  4PNF A;  5J4U A;  2PN8 A;  4WF4 A;  8GSS A;  1TK5 B;  4I8B A;  3KCM A;  1KNG A;  5ELG A;  2V6K A;  3E3E A;  1GUK A;  3K8N A;  1I5G A;  1XW9 A;  4X1U A;  2L6D A;  3DML A;  1TK0 B;  3GH6 A;  3MNG A;  1EZK A;  2A2P A;  2YWN A;  4OMV A;  3H8Q A;  2K8S A;  3EWL A;  3QFB C;  4TXV A;  2CT6 A;  2O89 A;  2R37 A;  2RUE A;  4TVE A;  4OFT A;  5D9V A;  1XWK A;  2AYT A;  2OE3 A;  2PGT A;  3FW2 A;  2G0F A;  4BL7 A;  1URM A;  3IHG A;  2M46 A;  4G19 A;  3VI7 A;  2VD0 A;  1K3O A;  4A5P A;  3IOS A;  4L0U A;  1UA5 A;  3QFA C;  4YQM A;  4CY8 A;  2RII A;  2GST A;  1HD2 A;  5ECM B;  2OBI A;  4EL1 A;  1YKC A;  5IM9 A;  5KOX A;  2LRC A;  3GHA A;  18GS A;  1W89 A;  2GS3 A;  3F6F A;  3WYW A;  4KH7 A;  3LG6 A;  4KCA A;  2KLX A;  1NSW A;  3WD6 A;  4EE0 A;  1FO5 A;  2A4H A;  3ME8 A;  5IPG A;  1SK1 A;  2QA1 A;  1ZCP A;  1AC1 A;  11GS A;  4TR3 A;  2OE1 A;  3GL5 A;  4MP4 A;  4EF0 A;  3M0F A;  4MK3 A;  1AAZ A;  5L71 A;  2LTK A;  4POK A;  1B4Q A;  4OCE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...