3WR2A

Rnase po1 complexed with 3'gmp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
101
structure length
101
Chain Sequence
QTGVRSCNCAGRSFTGTDVTNAIRSARAGGSGNYPHVYNNFEGFSFSCTPTFFEFPVFRGSVYSGGSPGADRVIYDQSGRFCACLTHTGAPSTNGFVECRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RNase Po1 complexed with 3'GMP
rcsb
source organism Pleurotus ostreatus
molecule tags Hydrolase
molecule keywords Guanyl-specific ribonuclease Po1
total genus 25
structure length 101
sequence length 101
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2014-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 3wr2A00
1FZUA 1LRAA 1B2ZA 4GSPA 2BU4A 1LOVA 5HOHA 1I0XA 4HAAA 1BNRA 1GMPA 2F56A 2RNTA 1RGHA 1RGEA 3AGNA 3AGOA 2KF3A 3BIRA 1MGWA 1BRIA 1RGGA 1RCKA 1I2FA 1B2XA 1RHLA 1BNEA 1RGLA 1BANA 3URPA 1A2PA 1CH0A 1BGSA 1TRQA 1JBTA 3WR2A 6GSPA 1RDSA 1HZ1A 1UCKA 1RCLA 1BU4A 4BU4A 3SYUA 3D4AA 1I70A 3RNTA 1DETA 1B21A 1AQZA 8RNTA 3WHOA 7GSPA 2F5MA 1JBSA 1MGRA 1BSEA 1BOXA 2F5WA 1BSBA 1R4YA 1FYSA 1BUJA 1BNSA 1RSNA 9RNTA 1RLSA 2AAEA 3AHWA 1G02A 1JBRA 3D5IA 1I8VA 4J5KA 1BRNL 5BU4A 2KF6A 1UCIA 1X1WA 1TRPA 2AADA 1BSCA 1RMSA 5RNTA 3AHSA 1B2SA 5GSPA 1GMQA 2F4YA 1AY7A 1T2HA 1SARA 1T2IA 1I2GA 1I3FA 1RGCA 1YVSA 1BSAA 1BNIA 1BRGA 1BVIA 2ZA4A 1RGFA 1I0VA 2KAAA 1X1XA 1RN1A 1I3IA 1GOVA 1GSPA 1RNBA 1BAOA 1BIRA 1ZGXA 2HOHA 1BRKA 5BIRA 3A5EA 3DGYA 1DE3A 1BNFA 1LOYA 1YNVX 1B3SA 1B2UA 1B20A 1GOUA 3D5GA 4GHOA 1X1UA 4BIRA 1BRHA 2BIRA 1LOWA 4J5GA 1FW7A 1PYLA 3GSPA 3KCHA 1UCLA 1IYYA 1I2EA 1BSDA 1TTOA 1C54A 2C4BA 3BU4A 1PY3A 1BNJA 1LNIA 1RNTA 1B27A 1GOYA 1UCJA 1GMRA 2GSPA 1B2MA 1RGAA 1RGKA 4HOHA 1RTUA 1BRJA 1BNGA 3DH2A 1Q9EA 1BRSA 1HYFA 1FUSA 2RBIA 1X1YA 3HOHA 2KF5A 4RNTA 1RN4A 3Q3FA 1YGWA 6RNTA 2SARA 1FUTA 7RNTA 2KF4A
chains in the Genus database with same CATH superfamily
4KFFA 2W2CA 3FG4A 1U5OA 2MC8A 2BU4A 4O3VA 5IG4A 4R9KA 1BNRA 1GMPA 1W4NA 2F56A 2FXTA 2GU3A 3IMAB 4KVHA 5I97A 2BHMA 3NV0A 2ML6A 3AGNA 5EVHA 3AGOA 1JV2B 5CK6A 3FKAA 4AEQA 1Q42A 3BIRA 3NQZA 2CFDA 3DXOA 2P09A 4CJNA 1M9GA 2W6JH 1WNHA 1I2FA 3EBYA 3M8CA 1B2XA 5JBSA 1BNEA 2W9QA 3H51A 1BANA 3EBTA 4RNZA 2W04A 3URPA 1JJ22 3TDGA 1A2PA 1U8CB 1JNQA 4L8OA 2K3DA 4ZM8A 1QVF2 1HZ1A 2P05A 1W02A 4XDVA 1A2KA 2W56B 4BU4A 1MWTA 2R4IA 3D4AA 2W56A 3EB8A 2XSHB 5BXQA 1NU3A 1T3BA 3NBBA 4XBXA 3RNTA 1A90A 1JBSA 2F5MA 1OPYA 1OHPA 1JN5B 3KSPA 1NJI4 1ISKA 4FMBA 1TIJA 2WO0A 2IY2A 3S67A 2F5WA 2W9PA 2D1WA 4FCMA 1VQ63 4XBYA 1W6CA 5AEUB 2LQVA 2OQEC 3WA2X 3AHWA 4RNYA 2W03A 3D5IA 3N8BA 1BRNL 3VGNA 2P38A 3BNEA 1OF5A 2KF6A 2XFTA 3EX9A 1MWUA 2BMRB 2L1SA 1O7MB 2B24B 1WQLB 2K0MA 5KP4A 3NXJA 1GMQA 4FCJA 3DGOA 3SOAA 1NDOB 3H3HA 1T2IA 1I2GA 1I3FA 3X40A 1BRGA 1RN7A 1VQO3 3L0RA 4IIAA 4HM8B 3MHEA 1MWSA 4O2HA 1ROVA 3N9HA 1RN1A 3PZWA 3PYJA 1G0TA 3OV4A 3RGRA 4AKYA 3I563 1BRKA 1HU9A 3WA3A 1GS3A 5LC6A 3RDEA 1YIT3 4H61A 1LOYA 4NREA 1B3SA 1B2UA 3EC9A 4KZ1A 1B20A 1IVWA 2XEPA 2QGUA 7STDA 1WTHA 3I553 3CCL3 2QIYA 1YI23 1O7NB 2IUKA 2C4BA 3LOYA 1PFPA 1ULJB 3FF2A 4R4KA 3VSYA 2XF3A 1OACA 5IEOA 2GSPA 1B2MA 1FGTA 3JVCA 1JB2A 1RGKA 4LEHA 2H0IA 2W0QA 1Q9EA 1NWWA 2KXGA 4HZ9B 2HMNB 4WYKA 2XH9A 1A67A 3LH4A 3T8NA 3DGNA 2QA43 1IVXA 2CFKA 1JN5A 2CW9A 1RN4A 1SQWA 3Q3FA 6RNTA 2OWPA 1IDPA 1FUTA 3MG1A 3RGAA 1JZOA 3B4PA 1M1XB 1LRAA 4FMDA 1IT8A 2IMJA 4GSPA 4K1UA 3ZFZA 1UGIA 3CC43 1TUHA 1ZS7A 2CKFB 3JUMA 1MOLA 3CCJ3 1W2B2 3MYTA 1OHSA 4EBGA 1DVDA 1WMPA 4IT7A 8CHOA 5JPPA 1BRIA 2H0GA 3EN8A 1RGGA 4FMAA 1F8NA 1IVVA 1N9EA 2CHCA 4EYCA 5IG5A 2RFRA 3FH1A 3G0KA 1VQL3 1BGSA 2BT3A 3WR2A 1Q814 1UCKA 4L7KA 4NPBA 1R4CA 5DREA 1FUWA 4RBNA 3K5TA 2FGTA 4N6TA 1GY6A 1B21A 1K41A 2I9WA 5AEWB 3AMOA 3S29A 1M904 1DMNA 2IUJA 4I5QA 1O7PB 1Q864 4LYLB 3S5CA 2BNGA 3PCSA 1BOXA 2KCDA 1VQ83 1BSBA 1STFI 1CYVA 2CWVA 1KWIA 5FW5A 3B4OA 3GZBA 4DKIA 3SOYA 3X3XA 9RNTA 1UUGB 1RLSA 5AIIA 2AAEA 1Q40A 1G02A 1Q40B 1A2VA 5AYRB 5CF1A 5CF2A 5AIFA 5BU4A 5EQLA 1HKXA 3CCE3 4HZBB 2OTL3 2MF7A 1ZX2A 3CNXA 2CG0A 2JDIH 5RNTA 1QMAA 4HM6B 1LVNA 1OUNA 2IYJA 5D81A 4EC6A 5TGNA 5GSPA 5KP3A 4OVMA 3K63A 2INXA 1SARA 4N6LA 1V74A 1RGCA 1N8QA 3T0UA 3UL5A 1BVIA 2ZA4A 4MMXB 1DYUA 1IQYA 1RGFA 3SVAA 3HIGA 2KAAA 1X1XA 1D6YA 1GD4A 1YVBI 2HMJB 1GSPA 3CU3A 3I0YA 1QAKA 4N6MA 2M7OA 3OWUA 1BIRA 1UGHI 2F99A 1OF5B 4FMCA 1TP6A 1K8A4 2R41A 1SIHA 2CH9A 1OCVA 4N3VA 1IQ8A 2GBWB 2O3OA 3D5GA 1W7CA 3FGYA 3GZRA 3KZTA 4BIRA 5JPUA 4EV5A 2STDA 3CME3 3G8ZA 4J5GA 4HM2B 3DUKA 3KCHA 3Q2PA 1GYBA 1OH0A 1TTOA 1C54A 4HM5B 1IVUA 3WOFB 3BU4A 1BNJA 1LNIA 3PGBA 3NM2A 1V57A 1AR0A 4ILFA 3CCS3 1B27A 1YGEA 3X41A 1RGAA 2ZL8A 3CNMA 5IEPA 4R1KA 1BRJA 3OX9A 3GAXA 4WHAA 2OQEA 3X3ZA 1BRSA 3HIIA 4XDWA 4N6V0 1HYFA 1C7HA 2CFGA 3K9MC 2CWTA 3FSDA 2RBIA 1X1YA 3OWYA 4R80A 1AV4A 1CEWI 2GU1A 3U1WA 4RNTA 3LXUX 1Y4KA 3FG3A 4FCZA 2CIUA 3GZYB 3NM7A 5EEOA 2KRTA 5M19A 1VQP3 1UDII 2SARA 1EG9B 1W6GA 3V92A 1BUJA 1GY5A 4OK0A 4WP5A 4CCVA 1B2ZA 5AIGA 2OTJ3 1OGZA 2CFLA 4STDA 3CXC2 3KE7A 3LTDA 2CFWA 1OGXA 2RNTA 1VQQA 3LZAA 3MG2A 1RGEA 1EA2A 2WGQA 2KF3A 5G2GA 1ULIB 3D3LA 1MGWA 3CPOA 3KFQC 2OOVC 2YFLB 1L5GB 3V98A 2LYXA 3Q90A 4K1VA 3BNCA 3D9RA 1N5PA 1JBTA 3F8HA 3F14A 5D83A 1V58A 3UNLA 1RDSA 3WDGB 4BL3A 1S723 1O7WB 1JRQA 3UJMA 1BU4A 1UUVB 4FR9A 2OCTA 4GL6A 1I70A 2SBLA 4RZMA 1J2BA 1AQZA 8RNTA 4QWTA 7GSPA 2HMKB 1JB4A 1MGRA 3HK4A 1FGMA 1Q824 2XSOB 2YFJB 4BL2A 1O7GB 4LSOA 3CC23 1FA3A 5IERA 1FYSA 4HYZA 1SPUA 4WYKB 2H0HA 4WFOA 3A76A 3UL6A 3LT8A 3ER7A 3NHXA 1W01A 3ZG5A 2F86B 3EN1B 3J7Yd 1JBRA 1CYUA 4J5KA 3EQQB 1ROAA 4WWUC 1JZDA 1X1WA 2UUGC 1YJW3 1FGRA 3ECFA 1RMSA 3F8XA 3AHSA 1TJDA 2A15A 2CG1A 2BMQB 3S27A 1B2SA 3LTBA 2F4YA 1AY7A 2BMOB 4H3UA 1US1A 4NHFA 3FG1A 4KT3B 2PNCA 3MWZA 3T8UA 2B1XB 4CPKA 1RRHA 1BNIA 3D79A 3G16A 1N8R4 3OWSA 1I0VA 5AIHA 3HX8A 1IV7A 5STDA 1QALA 1RNBA 1BAOA 2BO9B 3ZG0A 2HOHA 1SIIA 3NQYA 3JUOA 5IG0A 3X42A 3CCV3 1YIJ3 3DGYA 1BNFA 4IPBA 3LYGA 1ZO2A 2O9UX 3EF8A 1IV9A 2PZVA 4HM0B 5CXOA 5D82A 1VQ53 1NB5I 1EKMA 2GEXA 3EJVA 3GRDA 1X1UA 3SEDA 1W6YA 2CK3H 2BIRA 3VF1A 4R9LA 2ZHXB 4U13A 1LOWA 2GXFA 3F40A 2XGNA 1KQS2 1DVCA 1FW7A 3GSPA 1UCLA 1GY7A 1I2EA 4BTXA 1VQM3 1M1K4 1JB5A 2UX0A 2JQ5A 3WODG 1IQXA 1UI8A 3MG3A 1MWRA 4HM4B 3CMA3 4HM1B 4MEIA 4O02B 2J8XB 3NUVA 3QRDA 1RNTA 3DM8A 2V1LA 1UCJA 3PXMA 1GMRA 4JF8A 3CPW2 5IW9A 1RTUA 4J8TA 4N6OB 5G1LA 3DH2A 1SJWA 2HMMB 1NNVA 2C10A 1VQK3 3DGLA 1YJN3 5IF6A 2Z7AA 4CDLA 3HOHA 4HJLB 2UGIA 3BNDA 3PCRA 2KF5A 3JUPA 2GBXB 4MJDA 1AVKA 1T5YA 1LOXA 3UB1A 3FLJA 2E2TA 2Y73A 3LTCA 4OUQA 1BUQA 7RNTA 3KN4A 2KF4A 4K61A 1LNHA 2YFIB 1TU5A 1LQGC 1FZUA 2YX9A 3K7CA 1AVLA 4LZIA 3KIIA 4PEJA 5M1AA 3SX1A 4EW5A 2HMLB 2E2UA 1LOVA 1TFOA 2RSXA 1I0XA 4HAAA 4ORLA 5HOHA 2FNQA 1KD14 2ML5A 1JKGB 1RGHA 3DGMA 2HMOB 1FGQA 2P0MA 4AKZA 3F9SA 4EV2A 4KFEA 1QVG2 3U97A 1W2ZA 3BB9A 1IU7A 3GZXB 1RCKA 3ROBA 3CCR3 3SXXA 5A0OB 1RHLA 4MMZB 1O7HB 3FZWA 1RGLA 3NBRA 4XB5A 1CQSA 3WOEB 3CCU3 4K90B 3NBJA 1CH0A 1RRLA 1TRQA 3N54B 1VQ93 3GWRA 5AYSC 3AMOB 6GSPA 4XBTA 3DMCA 5ELUA 3JUQA 2GEYA 3STDA 3FCSB 1OHOA 1RCLA 3X3YA 3JUNA 3SYUA 1DMQA 5CLKA 5M18A 1WMOA 1LQMB 1N5HA 2XR8B 2Z76A 3PS8A 3MSOA 1DETA 3Q1CA 1NB3I 4LGQA 3B8LA 2D42A 2ZDJA 5AI1A 1K28A 2CX0A 1ASKA 1TFKA 3OXAA 3WHOA 3G4S3 1G96A 3EE1A 2WOHA 3QK9A 1BSEA 1E97A 4TX4A 3LMLA 1R4YA 4I4KA 1S5AA 1BNSA 1QJGA 3K0ZA 1RSNA 2OOVA 5IENA 2RGQA 1YHQ3 1Z1SA 1E3RA 4BTYA 3KSED 4HM3B 1I8VA 3O8YA 2CX1A 4N6UA 1RJOA 1VQ73 1UCIA 4J9AA 2AADA 1TRPA 2F98A 2K54A 5LC7A 1BSCA 2Q07A 1PU4A 1Q7Y4 2RCDA 4O8SA 4X2HA 5IG3A 3DY5A 5BVBA 3NX0A 1T2HA 2Z77A 3CD63 1IT7A 1KSIA 1YVSA 2C11A 2WGOA 4LMIA 1BSAA 1KC84 4MMYB 2XFSA 3ALAA 3WMDA 3B7CA 3DZLA 2CWUA 1VQN3 1Q7HA 1I3IA 4BTWA 1WMNA 1GOVA 1VZZA 4XM4A 3CCQ3 1ZGXA 1E3VA 1D6UA 1FGOA 5BIRA 3A5EA 1RKYA 1DE3A 1MNLA 5FGOA 1YNVX 3KKGA 5KP1A 1D6ZA 3BNBA 4KFDA 4L8PA 1UI7A 1W5ZA 4JRFA 1GOUA 3IJEB 4GHOA 3LTAA 1BRHA 4HKVB 1IK3A 1LXEA 4HVNA 4G1MB 3OW22 1PYLA 2IA7A 1IYYA 3V99A 2E2VA 1BSDA 1JKGA 3E99A 3HI7A 3IPTA 2P0XA 3LT9A 3MPHA 1EEJA 4HBRA 1UUWB 1YJ93 1PY3A 4N6NB 2L4VA 3HZPA 1EQKA 2Z6BA 2CC3A 2XRXB 1GOYA 4GB5A 1STDA 3F7XA 3FF0A 1W00A 1EUIC 2XGLA 1K734 3BLZA 4HOHA 4HM7B 1BNGA 5DRVA 1K9M4 4Q53A 3EHCA 3SLUA 3G713 3CCM3 5ELJA 3S28A 6STDA 3CC73 1FUSA 3F7SA 1DMMA 4EXRA 3MKIA 1UW1A 1QAFA 5G1KA 1GD3A 1YGWA 3G6E3 2QEX3 1N9JA 5HGRA 2WOFA 4X2OA 1NO3A 2Y74A 1VQ43 3NV0B
chains in the Genus database with same CATH topology
1FZUA 1LRAA 1B2ZA 4GSPA 2BU4A 1LOVA 5HOHA 1I0XA 4HAAA 1BNRA 1GMPA 2F56A 2RNTA 1RGHA 1RGEA 3AGNA 3AGOA 2KF3A 3BIRA 1MGWA 1BRIA 1RGGA 1RCKA 1I2FA 1B2XA 1RHLA 1BNEA 1RGLA 1BANA 3URPA 1A2PA 1CH0A 1BGSA 1TRQA 1JBTA 3WR2A 6GSPA 1RDSA 1HZ1A 1UCKA 1RCLA 1BU4A 4BU4A 3SYUA 3D4AA 1I70A 3RNTA 1DETA 1B21A 1AQZA 8RNTA 3WHOA 7GSPA 2F5MA 1JBSA 1MGRA 1BSEA 1BOXA 2F5WA 1BSBA 1R4YA 1FYSA 1BUJA 1BNSA 1RSNA 9RNTA 1RLSA 2AAEA 3AHWA 1G02A 1JBRA 3D5IA 1I8VA 4J5KA 1BRNL 5BU4A 2KF6A 1UCIA 1X1WA 1TRPA 2AADA 1BSCA 1RMSA 5RNTA 3AHSA 1B2SA 5GSPA 1GMQA 2F4YA 1AY7A 1T2HA 1SARA 1T2IA 1I2GA 1I3FA 1RGCA 1YVSA 1BSAA 1BNIA 1BRGA 1BVIA 2ZA4A 1RGFA 1I0VA 2KAAA 1X1XA 1RN1A 1I3IA 1GOVA 1GSPA 1RNBA 1BAOA 1BIRA 1ZGXA 2HOHA 1BRKA 5BIRA 3A5EA 3DGYA 1DE3A 1BNFA 1LOYA 1YNVX 1B3SA 1B2UA 1B20A 1GOUA 3D5GA 4GHOA 1X1UA 4BIRA 1BRHA 2BIRA 1LOWA 4J5GA 1FW7A 1PYLA 3GSPA 3KCHA 1UCLA 1IYYA 1I2EA 1BSDA 1TTOA 1C54A 2C4BA 3BU4A 1PY3A 1BNJA 1LNIA 1RNTA 1B27A 1GOYA 1UCJA 1GMRA 2GSPA 1B2MA 1RGAA 1RGKA 4HOHA 1RTUA 1BRJA 1BNGA 3DH2A 1Q9EA 1BRSA 1HYFA 1FUSA 2RBIA 1X1YA 3HOHA 2KF5A 4RNTA 1RN4A 3Q3FA 1YGWA 6RNTA 2SARA 1FUTA 7RNTA 2KF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZU A;  1LRA A;  1B2Z A;  4GSP A;  2BU4 A;  1LOV A;  5HOH A;  1I0X A;  4HAA A;  1BNR A;  1GMP A;  2F56 A;  2RNT A;  1RGH A;  1RGE A;  3AGN A;  3AGO A;  2KF3 A;  3BIR A;  1MGW A;  1BRI A;  1RGG A;  1RCK A;  1I2F A;  1B2X A;  1RHL A;  1BNE A;  1RGL A;  1BAN A;  3URP A;  1A2P A;  1CH0 A;  1BGS A;  1TRQ A;  1JBT A;  3WR2 A;  6GSP A;  1RDS A;  1HZ1 A;  1UCK A;  1RCL A;  1BU4 A;  4BU4 A;  3SYU A;  3D4A A;  1I70 A;  3RNT A;  1DET A;  1B21 A;  1AQZ A;  8RNT A;  3WHO A;  7GSP A;  2F5M A;  1JBS A;  1MGR A;  1BSE A;  1BOX A;  2F5W A;  1BSB A;  1R4Y A;  1FYS A;  1BUJ A;  1BNS A;  1RSN A;  9RNT A;  1RLS A;  2AAE A;  3AHW A;  1G02 A;  1JBR A;  3D5I A;  1I8V A;  4J5K A;  1BRN L;  5BU4 A;  2KF6 A;  1UCI A;  1X1W A;  1TRP A;  2AAD A;  1BSC A;  1RMS A;  5RNT A;  3AHS A;  1B2S A;  5GSP A;  1GMQ A;  2F4Y A;  1AY7 A;  1T2H A;  1SAR A;  1T2I A;  1I2G A;  1I3F A;  1RGC A;  1YVS A;  1BSA A;  1BNI A;  1BRG A;  1BVI A;  2ZA4 A;  1RGF A;  1I0V A;  2KAA A;  1X1X A;  1RN1 A;  1I3I A;  1GOV A;  1GSP A;  1RNB A;  1BAO A;  1BIR A;  1ZGX A;  2HOH A;  1BRK A;  5BIR A;  3A5E A;  3DGY A;  1DE3 A;  1BNF A;  1LOY A;  1YNV X;  1B3S A;  1B2U A;  1B20 A;  1GOU A;  3D5G A;  4GHO A;  1X1U A;  4BIR A;  1BRH A;  2BIR A;  1LOW A;  4J5G A;  1FW7 A;  1PYL A;  3GSP A;  3KCH A;  1UCL A;  1IYY A;  1I2E A;  1BSD A;  1TTO A;  1C54 A;  2C4B A;  3BU4 A;  1PY3 A;  1BNJ A;  1LNI A;  1RNT A;  1B27 A;  1GOY A;  1UCJ A;  1GMR A;  2GSP A;  1B2M A;  1RGA A;  1RGK A;  4HOH A;  1RTU A;  1BRJ A;  1BNG A;  3DH2 A;  1Q9E A;  1BRS A;  1HYF A;  1FUS A;  2RBI A;  1X1Y A;  3HOH A;  2KF5 A;  4RNT A;  1RN4 A;  3Q3F A;  1YGW A;  6RNT A;  2SAR A;  1FUT A;  7RNT A;  2KF4 A; 
#chains in the Genus database with same CATH topology
 4KFF A;  2W2C A;  3FG4 A;  1U5O A;  2MC8 A;  2BU4 A;  4O3V A;  5IG4 A;  4R9K A;  1BNR A;  1GMP A;  1W4N A;  2F56 A;  2FXT A;  2GU3 A;  3IMA B;  4KVH A;  5I97 A;  2BHM A;  3NV0 A;  2ML6 A;  3AGN A;  5EVH A;  3AGO A;  1JV2 B;  5CK6 A;  3FKA A;  4AEQ A;  1Q42 A;  3BIR A;  3NQZ A;  2CFD A;  3DXO A;  2P09 A;  4CJN A;  1M9G A;  2W6J H;  1WNH A;  1I2F A;  3EBY A;  3M8C A;  1B2X A;  5JBS A;  1BNE A;  2W9Q A;  3H51 A;  1BAN A;  3EBT A;  4RNZ A;  2W04 A;  3URP A;  1JJ2 2;  3TDG A;  1A2P A;  1U8C B;  1JNQ A;  4L8O A;  2K3D A;  4ZM8 A;  1QVF 2;  1HZ1 A;  2P05 A;  1W02 A;  4XDV A;  1A2K A;  2W56 B;  4BU4 A;  1MWT A;  2R4I A;  3D4A A;  2W56 A;  3EB8 A;  2XSH B;  5BXQ A;  1NU3 A;  1T3B A;  3NBB A;  4XBX A;  3RNT A;  1A90 A;  1JBS A;  2F5M A;  1OPY A;  1OHP A;  1JN5 B;  3KSP A;  1NJI 4;  1ISK A;  4FMB A;  1TIJ A;  2WO0 A;  2IY2 A;  3S67 A;  2F5W A;  2W9P A;  2D1W A;  4FCM A;  1VQ6 3;  4XBY A;  1W6C A;  5AEU B;  2LQV A;  2OQE C;  3WA2 X;  3AHW A;  4RNY A;  2W03 A;  3D5I A;  3N8B A;  1BRN L;  3VGN A;  2P38 A;  3BNE A;  1OF5 A;  2KF6 A;  2XFT A;  3EX9 A;  1MWU A;  2BMR B;  2L1S A;  1O7M B;  2B24 B;  1WQL B;  2K0M A;  5KP4 A;  3NXJ A;  1GMQ A;  4FCJ A;  3DGO A;  3SOA A;  1NDO B;  3H3H A;  1T2I A;  1I2G A;  1I3F A;  3X40 A;  1BRG A;  1RN7 A;  1VQO 3;  3L0R A;  4IIA A;  4HM8 B;  3MHE A;  1MWS A;  4O2H A;  1ROV A;  3N9H A;  1RN1 A;  3PZW A;  3PYJ A;  1G0T A;  3OV4 A;  3RGR A;  4AKY A;  3I56 3;  1BRK A;  1HU9 A;  3WA3 A;  1GS3 A;  5LC6 A;  3RDE A;  1YIT 3;  4H61 A;  1LOY A;  4NRE A;  1B3S A;  1B2U A;  3EC9 A;  4KZ1 A;  1B20 A;  1IVW A;  2XEP A;  2QGU A;  7STD A;  1WTH A;  3I55 3;  3CCL 3;  2QIY A;  1YI2 3;  1O7N B;  2IUK A;  2C4B A;  3LOY A;  1PFP A;  1ULJ B;  3FF2 A;  4R4K A;  3VSY A;  2XF3 A;  1OAC A;  5IEO A;  2GSP A;  1B2M A;  1FGT A;  3JVC A;  1JB2 A;  1RGK A;  4LEH A;  2H0I A;  2W0Q A;  1Q9E A;  1NWW A;  2KXG A;  4HZ9 B;  2HMN B;  4WYK A;  2XH9 A;  1A67 A;  3LH4 A;  3T8N A;  3DGN A;  2QA4 3;  1IVX A;  2CFK A;  1JN5 A;  2CW9 A;  1RN4 A;  1SQW A;  3Q3F A;  6RNT A;  2OWP A;  1IDP A;  1FUT A;  3MG1 A;  3RGA A;  1JZO A;  3B4P A;  1M1X B;  1LRA A;  4FMD A;  1IT8 A;  2IMJ A;  4GSP A;  4K1U A;  3ZFZ A;  1UGI A;  3CC4 3;  1TUH A;  1ZS7 A;  2CKF B;  3JUM A;  1MOL A;  3CCJ 3;  1W2B 2;  3MYT A;  1OHS A;  4EBG A;  1DVD A;  1WMP A;  4IT7 A;  8CHO A;  5JPP A;  1BRI A;  2H0G A;  3EN8 A;  1RGG A;  4FMA A;  1F8N A;  1IVV A;  1N9E A;  2CHC A;  4EYC A;  5IG5 A;  2RFR A;  3FH1 A;  3G0K A;  1VQL 3;  1BGS A;  2BT3 A;  3WR2 A;  1Q81 4;  1UCK A;  4L7K A;  4NPB A;  1R4C A;  5DRE A;  1FUW A;  4RBN A;  3K5T A;  2FGT A;  4N6T A;  1GY6 A;  1B21 A;  1K41 A;  2I9W A;  5AEW B;  3AMO A;  3S29 A;  1M90 4;  1DMN A;  2IUJ A;  4I5Q A;  1O7P B;  1Q86 4;  4LYL B;  3S5C A;  2BNG A;  3PCS A;  1BOX A;  2KCD A;  1VQ8 3;  1BSB A;  1STF I;  1CYV A;  2CWV A;  1KWI A;  5FW5 A;  3B4O A;  3GZB A;  4DKI A;  3SOY A;  3X3X A;  9RNT A;  1UUG B;  1RLS A;  5AII A;  2AAE A;  1Q40 A;  1G02 A;  1Q40 B;  1A2V A;  5AYR B;  5CF1 A;  5CF2 A;  5AIF A;  5BU4 A;  5EQL A;  1HKX A;  3CCE 3;  4HZB B;  2OTL 3;  2MF7 A;  1ZX2 A;  3CNX A;  2CG0 A;  2JDI H;  5RNT A;  1QMA A;  4HM6 B;  1LVN A;  1OUN A;  2IYJ A;  5D81 A;  4EC6 A;  5TGN A;  5GSP A;  5KP3 A;  4OVM A;  3K63 A;  2INX A;  1SAR A;  4N6L A;  1V74 A;  1RGC A;  1N8Q A;  3T0U A;  3UL5 A;  1BVI A;  2ZA4 A;  4MMX B;  1DYU A;  1IQY A;  1RGF A;  3SVA A;  3HIG A;  2KAA A;  1X1X A;  1D6Y A;  1GD4 A;  1YVB I;  2HMJ B;  1GSP A;  3CU3 A;  3I0Y A;  1QAK A;  4N6M A;  2M7O A;  3OWU A;  1BIR A;  1UGH I;  2F99 A;  1OF5 B;  4FMC A;  1TP6 A;  1K8A 4;  2R41 A;  1SIH A;  2CH9 A;  1OCV A;  4N3V A;  1IQ8 A;  2GBW B;  2O3O A;  3D5G A;  1W7C A;  3FGY A;  3GZR A;  3KZT A;  4BIR A;  5JPU A;  4EV5 A;  2STD A;  3CME 3;  3G8Z A;  4J5G A;  4HM2 B;  3DUK A;  3KCH A;  3Q2P A;  1GYB A;  1OH0 A;  1TTO A;  1C54 A;  4HM5 B;  1IVU A;  3WOF B;  3BU4 A;  1BNJ A;  1LNI A;  3PGB A;  3NM2 A;  1V57 A;  1AR0 A;  4ILF A;  3CCS 3;  1B27 A;  1YGE A;  3X41 A;  1RGA A;  2ZL8 A;  3CNM A;  5IEP A;  4R1K A;  1BRJ A;  3OX9 A;  3GAX A;  4WHA A;  2OQE A;  3X3Z A;  1BRS A;  3HII A;  4XDW A;  4N6V 0;  1HYF A;  1C7H A;  2CFG A;  3K9M C;  2CWT A;  3FSD A;  2RBI A;  1X1Y A;  3OWY A;  4R80 A;  1AV4 A;  1CEW I;  2GU1 A;  3U1W A;  4RNT A;  3LXU X;  1Y4K A;  3FG3 A;  4FCZ A;  2CIU A;  3GZY B;  3NM7 A;  5EEO A;  2KRT A;  5M19 A;  1VQP 3;  1UDI I;  2SAR A;  1EG9 B;  1W6G A;  3V92 A;  1BUJ A;  1GY5 A;  4OK0 A;  4WP5 A;  4CCV A;  1B2Z A;  5AIG A;  2OTJ 3;  1OGZ A;  2CFL A;  4STD A;  3CXC 2;  3KE7 A;  3LTD A;  2CFW A;  1OGX A;  2RNT A;  1VQQ A;  3LZA A;  3MG2 A;  1RGE A;  1EA2 A;  2WGQ A;  2KF3 A;  5G2G A;  1ULI B;  3D3L A;  1MGW A;  3CPO A;  3KFQ C;  2OOV C;  2YFL B;  1L5G B;  3V98 A;  2LYX A;  3Q90 A;  4K1V A;  3BNC A;  3D9R A;  1N5P A;  1JBT A;  3F8H A;  3F14 A;  5D83 A;  1V58 A;  3UNL A;  1RDS A;  3WDG B;  4BL3 A;  1S72 3;  1O7W B;  1JRQ A;  3UJM A;  1BU4 A;  1UUV B;  4FR9 A;  2OCT A;  4GL6 A;  1I70 A;  2SBL A;  4RZM A;  1J2B A;  1AQZ A;  8RNT A;  4QWT A;  7GSP A;  2HMK B;  1JB4 A;  1MGR A;  3HK4 A;  1FGM A;  1Q82 4;  2XSO B;  2YFJ B;  4BL2 A;  1O7G B;  4LSO A;  3CC2 3;  1FA3 A;  5IER A;  1FYS A;  4HYZ A;  1SPU A;  4WYK B;  2H0H A;  4WFO A;  3A76 A;  3UL6 A;  3LT8 A;  3ER7 A;  3NHX A;  1W01 A;  3ZG5 A;  2F86 B;  3EN1 B;  3J7Y d;  1JBR A;  1CYU A;  4J5K A;  3EQQ B;  1ROA A;  4WWU C;  1JZD A;  1X1W A;  2UUG C;  1YJW 3;  1FGR A;  3ECF A;  1RMS A;  3F8X A;  3AHS A;  1TJD A;  2A15 A;  2CG1 A;  2BMQ B;  3S27 A;  1B2S A;  3LTB A;  2F4Y A;  1AY7 A;  2BMO B;  4H3U A;  1US1 A;  4NHF A;  3FG1 A;  4KT3 B;  2PNC A;  3MWZ A;  3T8U A;  2B1X B;  4CPK A;  1RRH A;  1BNI A;  3D79 A;  3G16 A;  1N8R 4;  3OWS A;  1I0V A;  5AIH A;  3HX8 A;  1IV7 A;  5STD A;  1QAL A;  1RNB A;  1BAO A;  2BO9 B;  3ZG0 A;  2HOH A;  1SII A;  3NQY A;  3JUO A;  5IG0 A;  3X42 A;  3CCV 3;  1YIJ 3;  3DGY A;  1BNF A;  4IPB A;  3LYG A;  1ZO2 A;  2O9U X;  3EF8 A;  1IV9 A;  2PZV A;  4HM0 B;  5CXO A;  5D82 A;  1VQ5 3;  1NB5 I;  1EKM A;  2GEX A;  3EJV A;  3GRD A;  1X1U A;  3SED A;  1W6Y A;  2CK3 H;  2BIR A;  3VF1 A;  4R9L A;  2ZHX B;  4U13 A;  1LOW A;  2GXF A;  3F40 A;  2XGN A;  1KQS 2;  1DVC A;  1FW7 A;  3GSP A;  1UCL A;  1GY7 A;  1I2E A;  4BTX A;  1VQM 3;  1M1K 4;  1JB5 A;  2UX0 A;  2JQ5 A;  3WOD G;  1IQX A;  1UI8 A;  3MG3 A;  1MWR A;  4HM4 B;  3CMA 3;  4HM1 B;  4MEI A;  4O02 B;  2J8X B;  3NUV A;  3QRD A;  1RNT A;  3DM8 A;  2V1L A;  1UCJ A;  3PXM A;  1GMR A;  4JF8 A;  3CPW 2;  5IW9 A;  1RTU A;  4J8T A;  4N6O B;  5G1L A;  3DH2 A;  1SJW A;  2HMM B;  1NNV A;  2C10 A;  1VQK 3;  3DGL A;  1YJN 3;  5IF6 A;  2Z7A A;  4CDL A;  3HOH A;  4HJL B;  2UGI A;  3BND A;  3PCR A;  2KF5 A;  3JUP A;  2GBX B;  4MJD A;  1AVK A;  1T5Y A;  1LOX A;  3UB1 A;  3FLJ A;  2E2T A;  2Y73 A;  3LTC A;  4OUQ A;  1BUQ A;  7RNT A;  3KN4 A;  2KF4 A;  4K61 A;  1LNH A;  2YFI B;  1TU5 A;  1LQG C;  1FZU A;  2YX9 A;  3K7C A;  1AVL A;  4LZI A;  3KII A;  4PEJ A;  5M1A A;  3SX1 A;  4EW5 A;  2HML B;  2E2U A;  1LOV A;  1TFO A;  2RSX A;  1I0X A;  4HAA A;  4ORL A;  5HOH A;  2FNQ A;  1KD1 4;  2ML5 A;  1JKG B;  1RGH A;  3DGM A;  2HMO B;  1FGQ A;  2P0M A;  4AKZ A;  3F9S A;  4EV2 A;  4KFE A;  1QVG 2;  3U97 A;  1W2Z A;  3BB9 A;  1IU7 A;  3GZX B;  1RCK A;  3ROB A;  3CCR 3;  3SXX A;  5A0O B;  1RHL A;  4MMZ B;  1O7H B;  3FZW A;  1RGL A;  3NBR A;  4XB5 A;  1CQS A;  3WOE B;  3CCU 3;  4K90 B;  3NBJ A;  1CH0 A;  1RRL A;  1TRQ A;  3N54 B;  1VQ9 3;  3GWR A;  5AYS C;  3AMO B;  6GSP A;  4XBT A;  3DMC A;  5ELU A;  3JUQ A;  2GEY A;  3STD A;  3FCS B;  1OHO A;  1RCL A;  3X3Y A;  3JUN A;  3SYU A;  1DMQ A;  5CLK A;  5M18 A;  1WMO A;  1LQM B;  1N5H A;  2XR8 B;  2Z76 A;  3PS8 A;  3MSO A;  1DET A;  3Q1C A;  1NB3 I;  4LGQ A;  3B8L A;  2D42 A;  2ZDJ A;  5AI1 A;  1K28 A;  2CX0 A;  1ASK A;  1TFK A;  3OXA A;  3WHO A;  3G4S 3;  1G96 A;  3EE1 A;  2WOH A;  3QK9 A;  1BSE A;  1E97 A;  4TX4 A;  3LML A;  1R4Y A;  4I4K A;  1S5A A;  1BNS A;  1QJG A;  3K0Z A;  1RSN A;  2OOV A;  5IEN A;  2RGQ A;  1YHQ 3;  1Z1S A;  1E3R A;  4BTY A;  3KSE D;  4HM3 B;  1I8V A;  3O8Y A;  2CX1 A;  4N6U A;  1RJO A;  1VQ7 3;  1UCI A;  4J9A A;  2AAD A;  1TRP A;  2F98 A;  2K54 A;  5LC7 A;  1BSC A;  2Q07 A;  1PU4 A;  1Q7Y 4;  2RCD A;  4O8S A;  4X2H A;  5IG3 A;  3DY5 A;  5BVB A;  3NX0 A;  1T2H A;  2Z77 A;  3CD6 3;  1IT7 A;  1KSI A;  1YVS A;  2C11 A;  2WGO A;  4LMI A;  1BSA A;  1KC8 4;  4MMY B;  2XFS A;  3ALA A;  3WMD A;  3B7C A;  3DZL A;  2CWU A;  1VQN 3;  1Q7H A;  1I3I A;  4BTW A;  1WMN A;  1GOV A;  1VZZ A;  4XM4 A;  3CCQ 3;  1ZGX A;  1E3V A;  1D6U A;  1FGO A;  5BIR A;  3A5E A;  1RKY A;  1DE3 A;  1MNL A;  5FGO A;  1YNV X;  3KKG A;  5KP1 A;  1D6Z A;  3BNB A;  4KFD A;  4L8P A;  1UI7 A;  1W5Z A;  4JRF A;  1GOU A;  3IJE B;  4GHO A;  3LTA A;  1BRH A;  4HKV B;  1IK3 A;  1LXE A;  4HVN A;  4G1M B;  3OW2 2;  1PYL A;  2IA7 A;  1IYY A;  3V99 A;  2E2V A;  1BSD A;  1JKG A;  3E99 A;  3HI7 A;  3IPT A;  2P0X A;  3LT9 A;  3MPH A;  1EEJ A;  4HBR A;  1UUW B;  1YJ9 3;  1PY3 A;  4N6N B;  2L4V A;  3HZP A;  1EQK A;  2Z6B A;  2CC3 A;  2XRX B;  1GOY A;  4GB5 A;  1STD A;  3F7X A;  3FF0 A;  1W00 A;  1EUI C;  2XGL A;  1K73 4;  3BLZ A;  4HOH A;  4HM7 B;  1BNG A;  5DRV A;  1K9M 4;  4Q53 A;  3EHC A;  3SLU A;  3G71 3;  3CCM 3;  5ELJ A;  3S28 A;  6STD A;  3CC7 3;  1FUS A;  3F7S A;  1DMM A;  4EXR A;  3MKI A;  1UW1 A;  1QAF A;  5G1K A;  1GD3 A;  1YGW A;  3G6E 3;  2QEX 3;  1N9J A;  5HGR A;  2WOF A;  4X2O A;  1NO3 A;  2Y74 A;  1VQ4 3;  3NV0 B; 
#chains in the Genus database with same CATH homology
 1FZU A;  1LRA A;  1B2Z A;  4GSP A;  2BU4 A;  1LOV A;  5HOH A;  1I0X A;  4HAA A;  1BNR A;  1GMP A;  2F56 A;  2RNT A;  1RGH A;  1RGE A;  3AGN A;  3AGO A;  2KF3 A;  3BIR A;  1MGW A;  1BRI A;  1RGG A;  1RCK A;  1I2F A;  1B2X A;  1RHL A;  1BNE A;  1RGL A;  1BAN A;  3URP A;  1A2P A;  1CH0 A;  1BGS A;  1TRQ A;  1JBT A;  3WR2 A;  6GSP A;  1RDS A;  1HZ1 A;  1UCK A;  1RCL A;  1BU4 A;  4BU4 A;  3SYU A;  3D4A A;  1I70 A;  3RNT A;  1DET A;  1B21 A;  1AQZ A;  8RNT A;  3WHO A;  7GSP A;  2F5M A;  1JBS A;  1MGR A;  1BSE A;  1BOX A;  2F5W A;  1BSB A;  1R4Y A;  1FYS A;  1BUJ A;  1BNS A;  1RSN A;  9RNT A;  1RLS A;  2AAE A;  3AHW A;  1G02 A;  1JBR A;  3D5I A;  1I8V A;  4J5K A;  1BRN L;  5BU4 A;  2KF6 A;  1UCI A;  1X1W A;  1TRP A;  2AAD A;  1BSC A;  1RMS A;  5RNT A;  3AHS A;  1B2S A;  5GSP A;  1GMQ A;  2F4Y A;  1AY7 A;  1T2H A;  1SAR A;  1T2I A;  1I2G A;  1I3F A;  1RGC A;  1YVS A;  1BSA A;  1BNI A;  1BRG A;  1BVI A;  2ZA4 A;  1RGF A;  1I0V A;  2KAA A;  1X1X A;  1RN1 A;  1I3I A;  1GOV A;  1GSP A;  1RNB A;  1BAO A;  1BIR A;  1ZGX A;  2HOH A;  1BRK A;  5BIR A;  3A5E A;  3DGY A;  1DE3 A;  1BNF A;  1LOY A;  1YNV X;  1B3S A;  1B2U A;  1B20 A;  1GOU A;  3D5G A;  4GHO A;  1X1U A;  4BIR A;  1BRH A;  2BIR A;  1LOW A;  4J5G A;  1FW7 A;  1PYL A;  3GSP A;  3KCH A;  1UCL A;  1IYY A;  1I2E A;  1BSD A;  1TTO A;  1C54 A;  2C4B A;  3BU4 A;  1PY3 A;  1BNJ A;  1LNI A;  1RNT A;  1B27 A;  1GOY A;  1UCJ A;  1GMR A;  2GSP A;  1B2M A;  1RGA A;  1RGK A;  4HOH A;  1RTU A;  1BRJ A;  1BNG A;  3DH2 A;  1Q9E A;  1BRS A;  1HYF A;  1FUS A;  2RBI A;  1X1Y A;  3HOH A;  2KF5 A;  4RNT A;  1RN4 A;  3Q3F A;  1YGW A;  6RNT A;  2SAR A;  1FUT A;  7RNT A;  2KF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...