3WR2A

Rnase po1 complexed with 3'gmp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
101
structure length
101
Chain Sequence
QTGVRSCNCAGRSFTGTDVTNAIRSARAGGSGNYPHVYNNFEGFSFSCTPTFFEFPVFRGSVYSGGSPGADRVIYDQSGRFCACLTHTGAPSTNGFVECRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Guanyl-specific ribonuclease Po1
publication title RNase Po1 complexed with 3'GMP
rcsb
source organism Pleurotus ostreatus
total genus 25
structure length 101
sequence length 101
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2014-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 3wr2A00
3WR2A 1BRHA 1BRGA 1BAOA 1RGKA 1LOYA 4J5GA 2GSPA 5BU4A 1AQZA 1GMRA 2BU4A 1MGRA 1X1UA 4BU4A 1RGCA 1GOUA 2HOHA 1FZUA 1RGGA 1B21A 1BSAA 1BRNL 1JBRA 3SYUA 1FYSA 7RNTA 3BIRA 4RNTA 1X1XA 1BANA 2C4BA 1ZGXA 1BU4A 1I3FA 1UCLA 3GSPA 1DETA 1UCKA 3D5IA 1C54A 9RNTA 5BIRA 1RGLA 6RNTA 1B2ZA 2F4YA 1A2PA 2RBIA 2KF3A 2RNTA 3AHWA 1PYLA 1I2EA 1BRJA 2ZA4A 1BRIA 1RN1A 1GOVA 1I70A 1TRQA 1BSBA 1BUJA 2BIRA 1MGWA 1BSDA 5HOHA 1BRSA 1PY3A 2KF5A 1RCLA 3KCHA 5GSPA 3BU4A 3AHSA 1JBTA 1RN4A 1RNBA 3DGYA 1B27A 1BNSA 1T2HA 4HAAA 1LOWA 8RNTA 1DE3A 1BIRA 1Q9EA 1GSPA 1LRAA 1RGFA 1FUTA 1BVIA 2F5MA 6GSPA 2KAAA 2AADA 1B2UA 1B20A 1I0XA 1HZ1A 1R4YA 3HOHA 1I2GA 1X1WA 1BNEA 1BSCA 1B3SA 1RTUA 1TTOA 4GHOA 1B2XA 5RNTA 1BRKA 1JBSA 3A5EA 1FW7A 1LNIA 1RCKA 1BGSA 1BOXA 1RDSA 1RNTA 1B2MA 1AY7A 1I2FA 1I3IA 1I0VA 1G02A 1BNGA 1YVSA 1GMQA 3AGNA 3RNTA 7GSPA 1BNRA 3WHOA 1UCIA 1UCJA 1RLSA 1CH0A 1GOYA 1RHLA 1B2SA 4J5KA 1SARA 4HOHA 1I8VA 1GMPA 1RGAA 1BNIA 1HYFA 1BSEA 3URPA 3D4AA 3D5GA 2KF4A 1IYYA 1BNJA 2SARA 2KF6A 4BIRA 1RGEA 1YNVX 1RMSA 1T2IA 1BNFA 1FUSA 3Q3FA 1RSNA 3DH2A 1YGWA 2AAEA 4GSPA 2F5WA 1TRPA 1X1YA 2F56A 1RGHA 3AGOA 1LOVA
chains in the Genus database with same CATH superfamily
1A2VA 2OWPA 5DRVA 2W03A 4R1KA 3LYGA 3EC9A 2CG0A 3F40A 5EVHA 5LC6A 1TUHA 5IG0A 1YIJ3 3NV0A 2GSPA 1C7HA 1IV7A 2XSHB 4WP5A 1X1UA 1LQGC 2YFIB 3MYTA 3S5CA 1GD3A 3F14A 4HM6B 1RGGA 3O8YA 2W2CA 1BRNL 1JZDA 2HMOB 1K734 2BMQB 3EJVA 1FYSA 4OVMA 4EV5A 1M904 4STDA 5BXQA 4R4KA 1ZGXA 3NBRA 1AV4A 1K9M4 4LZIA 4CJNA 3GSPA 1DETA 3D5IA 5IG4A 3GRDA 5BIRA 1O7PB 1N9JA 2IA7A 2WGQA 2OCTA 2W9PA 4J9AA 1D6ZA 1K8A4 3ALAA 3LXUX 4FMDA 3K9MC 2PNCA 1IVXA 1I2EA 4IPBA 2R41A 5A0OB 1FGMA 2Z76A 1N8R4 4FCMA 1IK3A 1RN1A 3CCV3 1LNHA 5AIFA 1JN5B 2XFSA 3HX8A 3WMDA 3OV4A 1Q42A 1BUJA 1S5AA 5FW5A 4XBXA 1E97A 4H61A 3T8NA 1QAKA 2WO0A 4O3VA 1WMNA 5AYSC 4N6MA 5HOHA 3V99A 1NJI4 2KF5A 2OQEA 1JRQA 1OHSA 1RCLA 1JB5A 2ZL8A 3BU4A 5G2GA 2W6JH 1VQ83 3F8XA 3DGYA 1BNSA 4EYCA 2CW9A 4JF8A 4K1VA 1JJ22 3EB8A 1LRAA 3DGNA 4O8SA 3S27A 3CPW2 1SJWA 1DMNA 4XBTA 3EHCA 2QA43 5AEWB 4O2HA 4H3UA 2HMNB 1HZ1A 1R4YA 2F86B 3B8LA 3E99A 3N54B 3PCSA 2HMLB 1IQ8A 1BSCA 2F99A 2GEXA 3NHXA 1NNVA 1DVDA 4GHOA 1O7MB 3F7XA 1VQ43 1UI8A 1JNQA 2OOVA 1QVF2 2CHCA 3PCRA 1LNIA 3L0RA 2KRTA 5CK6A 3DY5A 3FLJA 1N9EA 1RDSA 3S67A 1DMMA 2V1LA 1AY7A 4EW5A 1HKXA 2QGUA 4N6UA 4R9LA 3OWYA 7GSPA 2W0QA 2XR8B 3KE7A 1UGIA 4KFDA 1RLSA 3NM2A 2XH9A 3NUVA 4BTYA 1OGXA 3JUQA 3I563 1B2SA 5EQLA 3CCR3 4HOHA 3FSDA 1LVNA 1N5PA 2W56B 1V57A 1ZO2A 1UUVB 4FR9A 4LYLB 5LC7A 2CWVA 3G6E3 1MNLA 2Z77A 2ZHXB 3EE1A 1O7GB 1BSEA 4N6NB 5JPUA 2H0GA 3D5GA 3DGLA 1KD14 2W04A 2P0MA 4ILFA 1AR0A 3PYJA 3DH2A 1YGWA 3BNEA 3G713 3EN8A 4GSPA 3MG2A 1EQKA 3SXXA 3FG4A 3K5TA 2K3DA 4GB5A 3KFQC 1LOVA 1NB3I 3V98A 1W6CA 3GZRA 1BRGA 5KP1A 4HVNA 3KSPA 1RGKA 3LTCA 2Y73A 2QEX3 4OUQA 2ZDJA 4MMZB 1VQ93 4HM4B 3LOYA 2HMKB 3NV0B 3I0YA 5IEPA 1EEJA 1RJOA 2CFWA 2B1XB 2HOHA 3FG1A 3S29A 2MC8A 2GU3A 4NPBA 1BSAA 2CG1A 4BTWA 1NB5I 3LT9A 2XF3A 3FF0A 1Q814 1UGHI 3BIRA 3LT8A 2H0IA 2E2UA 3B7CA 3N8BA 4HKVB 4IT7A 2BHMA 3NX0A 1BANA 1NU3A 4RNTA 3MWZA 3J7Yd 1IU7A 5AIIA 1I3FA 3DGOA 5CF2A 5IG3A 1TP6A 1VQQA 4KVHA 3U1WA 1JKGA 2GXFA 2KXGA 4RNYA 1OCVA 3GAXA 4L7KA 6RNTA 1V74A 1TU5A 1IQXA 3N9HA 1A2PA 1N5HA 2RNTA 4QWTA 4EBGA 1MWRA 2P05A 1TIJA 1OUNA 2GU1A 3KZTA 4LGQA 4MJDA 2XSOB 1BRJA 2IY2A 2RCDA 3NXJA 3PZWA 3LZAA 1EG9B 1OH0A 4MMYB 1GOVA 4R9KA 3U97A 1WQLB 4RBNA 1JB4A 1YVBI 1FA3A 2C10A 4FMAA 4EC6A 2OTJ3 1BSDA 1QALA 5STDA 4LSOA 1PY3A 3FG3A 1W00A 4BL3A 1IT8A 1FGRA 2O9UX 1HU9A 1AVKA 3AHSA 1JBTA 1OHPA 1Q40A 1B27A 1IQYA 3BNDA 3CC43 2YFJB 8RNTA 2Z6BA 5AYRB 3BNBA 3MKIA 3UL6A 1RGFA 3CD63 3AMOA 1FUTA 2UGIA 3MHEA 3LTDA 3X3XA 3ZG0A 5IF6A 1GY6A 2CKFB 3QRDA 3HZPA 4HJLB 1IVUA 4WFOA 4L8PA 4N6LA 2HMMB 4K90B 2RGQA 3SX1A 3HOHA 1I2GA 5CF1A 1X1WA 1Q864 3B4PA 3FKAA 2INXA 2K0MA 1RTUA 1TTOA 4KFFA 3OW22 2GBWB 2CFLA 3ER7A 3K0ZA 3T0UA 3A5EA 1SIIA 3D9RA 1VQO3 8CHOA 4U13A 3DXOA 1VQK3 3UNLA 1RCKA 1BGSA 1BOXA 4KFEA 3WA3A 1RKYA 1B2MA 4CCVA 1G02A 1BNGA 3GZXB 3K7CA 2RFRA 3PGBA 2F98A 4N6OB 1AVLA 4HZ9B 1STFI 3RNTA 1GYBA 1UCIA 3OWUA 4HM7B 2XGLA 2QIYA 4WYKA 3X41A 1QMAA 1GOYA 1J2BA 1TFOA 3DM8A 1Q7Y4 3JVCA 4R80A 5CXOA 5D83A 1BNIA 4L8OA 3G4S3 5ELJA 2CFKA 3URPA 4PEJA 4Q53A 3EF8A 1IV9A 4BIRA 2W9QA 4HM8B 1YNVX 1CQSA 1T2IA 1IVWA 1N8QA 4DKIA 1FUSA 1YI23 1RSNA 3G0KA 1TFKA 2AAEA 2A15A 1YHQ3 1A67A 1X1YA 4ORLA 1RGHA 4TX4A 3WR2A 1QJGA 1BRHA 2IYJA 5KP3A 3BNCA 1BAOA 2PZVA 1YGEA 2L1SA 2M7OA 4AKZA 5BU4A 6STDA 1GMRA 1MGRA 2CC3A 1GD4A 5I97A 3GZYB 4HM3B 4XB5A 4BL2A 1W2B2 5DREA 1RGCA 1VQL3 1G0TA 2CFGA 2FNQA 3TDGA 1FZUA 1B21A 2YX9A 3WDGB 1M1K4 3VSYA 1JBRA 3K63A 5CLKA 3UJMA 2P38A 1VQN3 1D6UA 2OQEC 1ULJB 4KZ1A 4XDWA 1X1XA 1PFPA 1YJN3 5FGOA 1BU4A 1LXEA 1O7HB 2WOFA 5ELUA 1S723 1UCLA 2BO9B 1C54A 3UB1A 4I4KA 2YFLB 3H51A 9RNTA 4XDVA 4XM4A 2F4YA 1UDII 2RBIA 3JUPA 2KF3A 1W2ZA 3JUMA 3HIGA 1PYLA 3X3YA 1JKGB 1W6GA 5TGNA 4GL6A 4MEIA 2SBLA 1W4NA 1JZOA 1UW1A 1W5ZA 1I70A 1WNHA 3MG1A 1BSBA 2E2TA 3SVAA 2BIRA 3CNMA 5M18A 1IT7A 2ML6A 2OOVC 4HBRA 2RSXA 2CWUA 3CPOA 1ZX2A 3SLUA 1BRSA 3H3HA 1CYUA 3HIIA 3EX9A 3KCHA 3NM7A 4N3VA 5GSPA 1YJW3 1RN4A 3FF2A 4G1MB 3DMCA 4FCZA 1IDPA 1LQMB 3MSOA 4HAAA 1LOWA 4I5QA 1OACA 1KWIA 2C11A 1BIRA 2GBXB 1GSPA 1GY5A 2BT3A 3IJEB 3RGRA 1BVIA 1Q40B 1NO3A 1FGTA 2E2VA 2P0XA 2STDA 1MWUA 1W01A 3M8CA 2CK3H 2CX0A 4O02B 1VQM3 2WGOA 3AMOB 3PXMA 3OXAA 3CNXA 1MOLA 2BMRB 3X3ZA 1BNEA 2K54A 3LTBA 1B3SA 5RNTA 4HM2B 1BRKA 2BNGA 3WOFB 3CXC2 1JBSA 1NDOB 2UX0A 1A2KA 3RGAA 1M9GA 3KIIA 1F8NA 1L5GB 2CH9A 3CMA3 5M1AA 1RNBA 3DZLA 1UI7A 1UUWB 3D3LA 3X40A 1RNTA 4ZM8A 3SOAA 1FGOA 1I3IA 1I0VA 3B4OA 4OK0A 1YIT3 1A90A 1RRHA 4X2HA 2GEYA 3LH4A 2BMOB 1W02A 4FMCA 1BNRA 3WHOA 3FZWA 1G96A 1CH0A 1OF5A 2J8XB 1RHLA 1MWTA 3VGNA 4EXRA 1M1XB 1R4CA 4IIAA 1DYUA 1JV2B 1U5OA 1GMPA 3HI7A 5JBSA 4CDLA 4WYKB 3NQZA 1Z1SA 1D6YA 3DGMA 1E3VA 2LYXA 3CCJ3 4X2OA 1V58A 3EBTA 5IENA 1WTHA 4K61A 2XRXB 1SPUA 2KF4A 1IYYA 1BNJA 1EA2A 3CCE3 3EBYA 2IMJA 3WA2X 2UUGC 1RGEA 2CFDA 2WOHA 1BNFA 4JRFA 3EQQB 1U8CB 1RRLA 1SQWA 2L4VA 3F7SA 1FGQA 2F5WA 1TRPA 2F56A 3GZBA 4NHFA 4NREA 4LEHA 1STDA 4RZMA 3RDEA 3WODG 4EV2A 1VQ63 1SIHA 3JUNA 1Q7HA 5JPPA 1WMOA 4RNZA 1LOYA 3Q2PA 4J5GA 3WOEB 2HMJB 4WWUC 2Y74A 1VQP3 1AQZA 1K41A 2BU4A 1O7WB 1PU4A 2KCDA 3Q1CA 3V92A 4LMIA 2Q07A 4BU4A 5IG5A 4HM5B 1GOUA 2FGTA 4MMXB 5D82A 3UL5A 3I553 3SYUA 5AIHA 3CC23 3CU3A 1GY7A 2R4IA 7RNTA 2D1WA 1E3RA 1OPYA 2OTL3 2C4BA 3CCS3 1US1A 1TJDA 2I9WA 1WMPA 5IW9A 2B24B 1DVCA 1UCKA 3SOYA 1RGLA 1RN7A 1B2ZA 3OX9A 5KP4A 5HGRA 3LTAA 4N6V0 1JN5A 3AHWA 5IERA 1KQS2 1VZZA 4XBYA 3S28A 3X42A 1EKMA 1BRIA 2JDIH 2ZA4A 1QVG2 3NQYA 3ROBA 3IMAB 3HK4A 1O7NB 1TRQA 3JUOA 2CX1A 3VF1A 4AEQA 3OWSA 1LOXA 4AKYA 1MGWA 2XGNA 5AI1A 3MPHA 1K28A 1OHOA 3FCSB 1JB2A 4HZBB 3STDA 3SEDA 3D79A 5BVBA 1Q824 3BLZA 1UUGB 1GS3A 1T2HA 3Q90A 3ZFZA 3GWRA 1DE3A 3KKGA 3F8HA 4CPKA 1KSIA 1MWSA 3IPTA 1Q9EA 4WHAA 1Y4KA 2JQ5A 2F5MA 5D81A 2KAAA 6GSPA 2AADA 1B2UA 1B20A 1I0XA 2ML5A 3BB9A 3NBBA 5EEOA 2P09A 4HYZA 2LQVA 4FCJA 5M19A 1B2XA 3ECFA 3DUKA 1NWWA 4FMBA 3CCL3 1EUIC 2FXTA 1FW7A 2H0HA 1DMQA 3LMLA 7STDA 1OGZA 1W7CA 3F9SA 3A76A 1ROVA 3FGYA 1I2FA 1ROAA 1ULIB 5AEUB 1VQ73 3EN1B 2O3OA 1BUQA 1YVSA 4BTXA 2CWTA 1CYVA 1GMQA 3AGNA 3NBJA 2D42A 3CCM3 1UCJA 2Z7AA 1T5YA 2W56A 2MF7A 3CCQ3 3FH1A 3CCU3 1KC84 1VQ53 4J5KA 1FUWA 1SARA 1I8VA 3G16A 5IEOA 3QK9A 1RGAA 2XEPA 2IUJA 1OF5B 1HYFA 1ISKA 5AIGA 3CME3 1T3BA 3ZG5A 3D4AA 3G8ZA 3MG3A 1ASKA 1YJ93 1QAFA 2SARA 2KF6A 3CC73 3KSED 4KT3B 1RMSA 4N6TA 3Q3FA 4K1UA 4HM1B 5G1LA 1CEWI 4HM0B 1IVVA 2CIUA 2IUKA 2XFTA 3KN4A 3PS8A 3T8UA 5G1KA 1W6YA 4J8TA 3AGOA 1ZS7A
chains in the Genus database with same CATH topology
3WR2A 1BRHA 1BRGA 1BAOA 1RGKA 1LOYA 4J5GA 2GSPA 5BU4A 1AQZA 1GMRA 2BU4A 1MGRA 1X1UA 4BU4A 1RGCA 1GOUA 2HOHA 1FZUA 1RGGA 1B21A 1BSAA 1BRNL 1JBRA 3SYUA 1FYSA 7RNTA 3BIRA 4RNTA 1X1XA 1BANA 2C4BA 1ZGXA 1BU4A 1I3FA 1UCLA 3GSPA 1DETA 1UCKA 3D5IA 1C54A 9RNTA 5BIRA 1RGLA 6RNTA 1B2ZA 2F4YA 1A2PA 2RBIA 2KF3A 2RNTA 3AHWA 1PYLA 1I2EA 1BRJA 2ZA4A 1BRIA 1RN1A 1GOVA 1I70A 1TRQA 1BSBA 1BUJA 2BIRA 1MGWA 1BSDA 5HOHA 1BRSA 1PY3A 2KF5A 1RCLA 3KCHA 5GSPA 3BU4A 3AHSA 1JBTA 1RN4A 1RNBA 3DGYA 1B27A 1BNSA 1T2HA 4HAAA 1LOWA 8RNTA 1DE3A 1BIRA 1Q9EA 1GSPA 1LRAA 1RGFA 1FUTA 1BVIA 2F5MA 6GSPA 2KAAA 2AADA 1B2UA 1B20A 1I0XA 1HZ1A 1R4YA 3HOHA 1I2GA 1X1WA 1BNEA 1BSCA 1B3SA 1RTUA 1TTOA 4GHOA 1B2XA 5RNTA 1BRKA 1JBSA 3A5EA 1FW7A 1LNIA 1RCKA 1BGSA 1BOXA 1RDSA 1RNTA 1B2MA 1AY7A 1I2FA 1I3IA 1I0VA 1G02A 1BNGA 1YVSA 1GMQA 3AGNA 3RNTA 7GSPA 1BNRA 3WHOA 1UCIA 1UCJA 1RLSA 1CH0A 1GOYA 1RHLA 1B2SA 4J5KA 1SARA 4HOHA 1I8VA 1GMPA 1RGAA 1BNIA 1HYFA 1BSEA 3URPA 3D4AA 3D5GA 2KF4A 1IYYA 1BNJA 2SARA 2KF6A 4BIRA 1RGEA 1YNVX 1RMSA 1T2IA 1BNFA 1FUSA 3Q3FA 1RSNA 3DH2A 1YGWA 2AAEA 4GSPA 2F5WA 1TRPA 1X1YA 2F56A 1RGHA 3AGOA 1LOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WR2 A;  1BRH A;  1BRG A;  1BAO A;  1RGK A;  1LOY A;  4J5G A;  2GSP A;  5BU4 A;  1AQZ A;  1GMR A;  2BU4 A;  1MGR A;  1X1U A;  4BU4 A;  1RGC A;  1GOU A;  2HOH A;  1FZU A;  1RGG A;  1B21 A;  1BSA A;  1BRN L;  1JBR A;  3SYU A;  1FYS A;  7RNT A;  3BIR A;  4RNT A;  1X1X A;  1BAN A;  2C4B A;  1ZGX A;  1BU4 A;  1I3F A;  1UCL A;  3GSP A;  1DET A;  1UCK A;  3D5I A;  1C54 A;  9RNT A;  5BIR A;  1RGL A;  6RNT A;  1B2Z A;  2F4Y A;  1A2P A;  2RBI A;  2KF3 A;  2RNT A;  3AHW A;  1PYL A;  1I2E A;  1BRJ A;  2ZA4 A;  1BRI A;  1RN1 A;  1GOV A;  1I70 A;  1TRQ A;  1BSB A;  1BUJ A;  2BIR A;  1MGW A;  1BSD A;  5HOH A;  1BRS A;  1PY3 A;  2KF5 A;  1RCL A;  3KCH A;  5GSP A;  3BU4 A;  3AHS A;  1JBT A;  1RN4 A;  1RNB A;  3DGY A;  1B27 A;  1BNS A;  1T2H A;  4HAA A;  1LOW A;  8RNT A;  1DE3 A;  1BIR A;  1Q9E A;  1GSP A;  1LRA A;  1RGF A;  1FUT A;  1BVI A;  2F5M A;  6GSP A;  2KAA A;  2AAD A;  1B2U A;  1B20 A;  1I0X A;  1HZ1 A;  1R4Y A;  3HOH A;  1I2G A;  1X1W A;  1BNE A;  1BSC A;  1B3S A;  1RTU A;  1TTO A;  4GHO A;  1B2X A;  5RNT A;  1BRK A;  1JBS A;  3A5E A;  1FW7 A;  1LNI A;  1RCK A;  1BGS A;  1BOX A;  1RDS A;  1RNT A;  1B2M A;  1AY7 A;  1I2F A;  1I3I A;  1I0V A;  1G02 A;  1BNG A;  1YVS A;  1GMQ A;  3AGN A;  3RNT A;  7GSP A;  1BNR A;  3WHO A;  1UCI A;  1UCJ A;  1RLS A;  1CH0 A;  1GOY A;  1RHL A;  1B2S A;  4J5K A;  1SAR A;  4HOH A;  1I8V A;  1GMP A;  1RGA A;  1BNI A;  1HYF A;  1BSE A;  3URP A;  3D4A A;  3D5G A;  2KF4 A;  1IYY A;  1BNJ A;  2SAR A;  2KF6 A;  4BIR A;  1RGE A;  1YNV X;  1RMS A;  1T2I A;  1BNF A;  1FUS A;  3Q3F A;  1RSN A;  3DH2 A;  1YGW A;  2AAE A;  4GSP A;  2F5W A;  1TRP A;  1X1Y A;  2F56 A;  1RGH A;  3AGO A;  1LOV A; 
#chains in the Genus database with same CATH topology
 1A2V A;  2OWP A;  5DRV A;  2W03 A;  4R1K A;  3LYG A;  3EC9 A;  2CG0 A;  3F40 A;  5EVH A;  5LC6 A;  1TUH A;  5IG0 A;  1YIJ 3;  3NV0 A;  2GSP A;  1C7H A;  1IV7 A;  2XSH B;  4WP5 A;  1X1U A;  1LQG C;  2YFI B;  3MYT A;  3S5C A;  1GD3 A;  3F14 A;  4HM6 B;  1RGG A;  3O8Y A;  2W2C A;  1BRN L;  1JZD A;  2HMO B;  1K73 4;  2BMQ B;  3EJV A;  1FYS A;  4OVM A;  4EV5 A;  1M90 4;  4STD A;  5BXQ A;  4R4K A;  1ZGX A;  3NBR A;  1AV4 A;  1K9M 4;  4LZI A;  4CJN A;  3GSP A;  1DET A;  3D5I A;  5IG4 A;  3GRD A;  5BIR A;  1O7P B;  1N9J A;  2IA7 A;  2WGQ A;  2OCT A;  2W9P A;  4J9A A;  1D6Z A;  1K8A 4;  3ALA A;  3LXU X;  4FMD A;  3K9M C;  2PNC A;  1IVX A;  1I2E A;  4IPB A;  2R41 A;  5A0O B;  1FGM A;  2Z76 A;  1N8R 4;  4FCM A;  1IK3 A;  1RN1 A;  3CCV 3;  1LNH A;  5AIF A;  1JN5 B;  2XFS A;  3HX8 A;  3WMD A;  3OV4 A;  1Q42 A;  1BUJ A;  1S5A A;  5FW5 A;  4XBX A;  1E97 A;  4H61 A;  3T8N A;  1QAK A;  2WO0 A;  4O3V A;  1WMN A;  5AYS C;  4N6M A;  5HOH A;  3V99 A;  1NJI 4;  2KF5 A;  2OQE A;  1JRQ A;  1OHS A;  1RCL A;  1JB5 A;  2ZL8 A;  3BU4 A;  5G2G A;  2W6J H;  1VQ8 3;  3F8X A;  3DGY A;  1BNS A;  4EYC A;  2CW9 A;  4JF8 A;  4K1V A;  1JJ2 2;  3EB8 A;  1LRA A;  3DGN A;  4O8S A;  3S27 A;  3CPW 2;  1SJW A;  1DMN A;  4XBT A;  3EHC A;  2QA4 3;  5AEW B;  4O2H A;  4H3U A;  2HMN B;  1HZ1 A;  1R4Y A;  2F86 B;  3B8L A;  3E99 A;  3N54 B;  3PCS A;  2HML B;  1IQ8 A;  1BSC A;  2F99 A;  2GEX A;  3NHX A;  1NNV A;  1DVD A;  4GHO A;  1O7M B;  3F7X A;  1VQ4 3;  1UI8 A;  1JNQ A;  2OOV A;  1QVF 2;  2CHC A;  3PCR A;  1LNI A;  3L0R A;  2KRT A;  5CK6 A;  3DY5 A;  3FLJ A;  1N9E A;  1RDS A;  3S67 A;  1DMM A;  2V1L A;  1AY7 A;  4EW5 A;  1HKX A;  2QGU A;  4N6U A;  4R9L A;  3OWY A;  7GSP A;  2W0Q A;  2XR8 B;  3KE7 A;  1UGI A;  4KFD A;  1RLS A;  3NM2 A;  2XH9 A;  3NUV A;  4BTY A;  1OGX A;  3JUQ A;  3I56 3;  1B2S A;  5EQL A;  3CCR 3;  4HOH A;  3FSD A;  1LVN A;  1N5P A;  2W56 B;  1V57 A;  1ZO2 A;  1UUV B;  4FR9 A;  4LYL B;  5LC7 A;  2CWV A;  3G6E 3;  1MNL A;  2Z77 A;  2ZHX B;  3EE1 A;  1O7G B;  1BSE A;  4N6N B;  5JPU A;  2H0G A;  3D5G A;  3DGL A;  1KD1 4;  2W04 A;  2P0M A;  4ILF A;  1AR0 A;  3PYJ A;  3DH2 A;  1YGW A;  3BNE A;  3G71 3;  3EN8 A;  4GSP A;  3MG2 A;  1EQK A;  3SXX A;  3FG4 A;  3K5T A;  2K3D A;  4GB5 A;  3KFQ C;  1LOV A;  1NB3 I;  3V98 A;  1W6C A;  3GZR A;  1BRG A;  5KP1 A;  4HVN A;  3KSP A;  1RGK A;  3LTC A;  2Y73 A;  2QEX 3;  4OUQ A;  2ZDJ A;  4MMZ B;  1VQ9 3;  4HM4 B;  3LOY A;  2HMK B;  3NV0 B;  3I0Y A;  5IEP A;  1EEJ A;  1RJO A;  2CFW A;  2B1X B;  2HOH A;  3FG1 A;  3S29 A;  2MC8 A;  2GU3 A;  4NPB A;  1BSA A;  2CG1 A;  4BTW A;  1NB5 I;  3LT9 A;  2XF3 A;  3FF0 A;  1Q81 4;  1UGH I;  3BIR A;  3LT8 A;  2H0I A;  2E2U A;  3B7C A;  3N8B A;  4HKV B;  4IT7 A;  2BHM A;  3NX0 A;  1BAN A;  1NU3 A;  4RNT A;  3MWZ A;  3J7Y d;  1IU7 A;  5AII A;  1I3F A;  3DGO A;  5CF2 A;  5IG3 A;  1TP6 A;  1VQQ A;  4KVH A;  3U1W A;  1JKG A;  2GXF A;  2KXG A;  4RNY A;  1OCV A;  3GAX A;  4L7K A;  6RNT A;  1V74 A;  1TU5 A;  1IQX A;  3N9H A;  1A2P A;  1N5H A;  2RNT A;  4QWT A;  4EBG A;  1MWR A;  2P05 A;  1TIJ A;  1OUN A;  2GU1 A;  3KZT A;  4LGQ A;  4MJD A;  2XSO B;  1BRJ A;  2IY2 A;  2RCD A;  3NXJ A;  3PZW A;  3LZA A;  1EG9 B;  1OH0 A;  4MMY B;  1GOV A;  4R9K A;  3U97 A;  1WQL B;  4RBN A;  1JB4 A;  1YVB I;  1FA3 A;  2C10 A;  4FMA A;  4EC6 A;  2OTJ 3;  1BSD A;  1QAL A;  5STD A;  4LSO A;  1PY3 A;  3FG3 A;  1W00 A;  4BL3 A;  1IT8 A;  1FGR A;  2O9U X;  1HU9 A;  1AVK A;  3AHS A;  1JBT A;  1OHP A;  1Q40 A;  1B27 A;  1IQY A;  3BND A;  3CC4 3;  2YFJ B;  8RNT A;  2Z6B A;  5AYR B;  3BNB A;  3MKI A;  3UL6 A;  1RGF A;  3CD6 3;  3AMO A;  1FUT A;  2UGI A;  3MHE A;  3LTD A;  3X3X A;  3ZG0 A;  5IF6 A;  1GY6 A;  2CKF B;  3QRD A;  3HZP A;  4HJL B;  1IVU A;  4WFO A;  4L8P A;  4N6L A;  2HMM B;  4K90 B;  2RGQ A;  3SX1 A;  3HOH A;  1I2G A;  5CF1 A;  1X1W A;  1Q86 4;  3B4P A;  3FKA A;  2INX A;  2K0M A;  1RTU A;  1TTO A;  4KFF A;  3OW2 2;  2GBW B;  2CFL A;  3ER7 A;  3K0Z A;  3T0U A;  3A5E A;  1SII A;  3D9R A;  1VQO 3;  8CHO A;  4U13 A;  3DXO A;  1VQK 3;  3UNL A;  1RCK A;  1BGS A;  1BOX A;  4KFE A;  3WA3 A;  1RKY A;  1B2M A;  4CCV A;  1G02 A;  1BNG A;  3GZX B;  3K7C A;  2RFR A;  3PGB A;  2F98 A;  4N6O B;  1AVL A;  4HZ9 B;  1STF I;  3RNT A;  1GYB A;  1UCI A;  3OWU A;  4HM7 B;  2XGL A;  2QIY A;  4WYK A;  3X41 A;  1QMA A;  1GOY A;  1J2B A;  1TFO A;  3DM8 A;  1Q7Y 4;  3JVC A;  4R80 A;  5CXO A;  5D83 A;  1BNI A;  4L8O A;  3G4S 3;  5ELJ A;  2CFK A;  3URP A;  4PEJ A;  4Q53 A;  3EF8 A;  1IV9 A;  4BIR A;  2W9Q A;  4HM8 B;  1YNV X;  1CQS A;  1T2I A;  1IVW A;  1N8Q A;  4DKI A;  1FUS A;  1YI2 3;  1RSN A;  3G0K A;  1TFK A;  2AAE A;  2A15 A;  1YHQ 3;  1A67 A;  1X1Y A;  4ORL A;  1RGH A;  4TX4 A;  3WR2 A;  1QJG A;  1BRH A;  2IYJ A;  5KP3 A;  3BNC A;  1BAO A;  2PZV A;  1YGE A;  2L1S A;  2M7O A;  4AKZ A;  5BU4 A;  6STD A;  1GMR A;  1MGR A;  2CC3 A;  1GD4 A;  5I97 A;  3GZY B;  4HM3 B;  4XB5 A;  4BL2 A;  1W2B 2;  5DRE A;  1RGC A;  1VQL 3;  1G0T A;  2CFG A;  2FNQ A;  3TDG A;  1FZU A;  1B21 A;  2YX9 A;  3WDG B;  1M1K 4;  3VSY A;  1JBR A;  3K63 A;  5CLK A;  3UJM A;  2P38 A;  1VQN 3;  1D6U A;  2OQE C;  1ULJ B;  4KZ1 A;  4XDW A;  1X1X A;  1PFP A;  1YJN 3;  5FGO A;  1BU4 A;  1LXE A;  1O7H B;  2WOF A;  5ELU A;  1S72 3;  1UCL A;  2BO9 B;  1C54 A;  3UB1 A;  4I4K A;  2YFL B;  3H51 A;  9RNT A;  4XDV A;  4XM4 A;  2F4Y A;  1UDI I;  2RBI A;  3JUP A;  2KF3 A;  1W2Z A;  3JUM A;  3HIG A;  1PYL A;  3X3Y A;  1JKG B;  1W6G A;  5TGN A;  4GL6 A;  4MEI A;  2SBL A;  1W4N A;  1JZO A;  1UW1 A;  1W5Z A;  1I70 A;  1WNH A;  3MG1 A;  1BSB A;  2E2T A;  3SVA A;  2BIR A;  3CNM A;  5M18 A;  1IT7 A;  2ML6 A;  2OOV C;  4HBR A;  2RSX A;  2CWU A;  3CPO A;  1ZX2 A;  3SLU A;  1BRS A;  3H3H A;  1CYU A;  3HII A;  3EX9 A;  3KCH A;  3NM7 A;  4N3V A;  5GSP A;  1YJW 3;  1RN4 A;  3FF2 A;  4G1M B;  3DMC A;  4FCZ A;  1IDP A;  1LQM B;  3MSO A;  4HAA A;  1LOW A;  4I5Q A;  1OAC A;  1KWI A;  2C11 A;  1BIR A;  2GBX B;  1GSP A;  1GY5 A;  2BT3 A;  3IJE B;  3RGR A;  1BVI A;  1Q40 B;  1NO3 A;  1FGT A;  2E2V A;  2P0X A;  2STD A;  1MWU A;  1W01 A;  3M8C A;  2CK3 H;  2CX0 A;  4O02 B;  1VQM 3;  2WGO A;  3AMO B;  3PXM A;  3OXA A;  3CNX A;  1MOL A;  2BMR B;  3X3Z A;  1BNE A;  2K54 A;  3LTB A;  1B3S A;  5RNT A;  4HM2 B;  1BRK A;  2BNG A;  3WOF B;  3CXC 2;  1JBS A;  1NDO B;  2UX0 A;  1A2K A;  3RGA A;  1M9G A;  3KII A;  1F8N A;  1L5G B;  2CH9 A;  3CMA 3;  5M1A A;  1RNB A;  3DZL A;  1UI7 A;  1UUW B;  3D3L A;  3X40 A;  1RNT A;  4ZM8 A;  3SOA A;  1FGO A;  1I3I A;  1I0V A;  3B4O A;  4OK0 A;  1YIT 3;  1A90 A;  1RRH A;  4X2H A;  2GEY A;  3LH4 A;  2BMO B;  1W02 A;  4FMC A;  1BNR A;  3WHO A;  3FZW A;  1G96 A;  1CH0 A;  1OF5 A;  2J8X B;  1RHL A;  1MWT A;  3VGN A;  4EXR A;  1M1X B;  1R4C A;  4IIA A;  1DYU A;  1JV2 B;  1U5O A;  1GMP A;  3HI7 A;  5JBS A;  4CDL A;  4WYK B;  3NQZ A;  1Z1S A;  1D6Y A;  3DGM A;  1E3V A;  2LYX A;  3CCJ 3;  4X2O A;  1V58 A;  3EBT A;  5IEN A;  1WTH A;  4K61 A;  2XRX B;  1SPU A;  2KF4 A;  1IYY A;  1BNJ A;  1EA2 A;  3CCE 3;  3EBY A;  2IMJ A;  3WA2 X;  2UUG C;  1RGE A;  2CFD A;  2WOH A;  1BNF A;  4JRF A;  3EQQ B;  1U8C B;  1RRL A;  1SQW A;  2L4V A;  3F7S A;  1FGQ A;  2F5W A;  1TRP A;  2F56 A;  3GZB A;  4NHF A;  4NRE A;  4LEH A;  1STD A;  4RZM A;  3RDE A;  3WOD G;  4EV2 A;  1VQ6 3;  1SIH A;  3JUN A;  1Q7H A;  5JPP A;  1WMO A;  4RNZ A;  1LOY A;  3Q2P A;  4J5G A;  3WOE B;  2HMJ B;  4WWU C;  2Y74 A;  1VQP 3;  1AQZ A;  1K41 A;  2BU4 A;  1O7W B;  1PU4 A;  2KCD A;  3Q1C A;  3V92 A;  4LMI A;  2Q07 A;  4BU4 A;  5IG5 A;  4HM5 B;  1GOU A;  2FGT A;  4MMX B;  5D82 A;  3UL5 A;  3I55 3;  3SYU A;  5AIH A;  3CC2 3;  3CU3 A;  1GY7 A;  2R4I A;  7RNT A;  2D1W A;  1E3R A;  1OPY A;  2OTL 3;  2C4B A;  3CCS 3;  1US1 A;  1TJD A;  2I9W A;  1WMP A;  5IW9 A;  2B24 B;  1DVC A;  1UCK A;  3SOY A;  1RGL A;  1RN7 A;  1B2Z A;  3OX9 A;  5KP4 A;  5HGR A;  3LTA A;  4N6V 0;  1JN5 A;  3AHW A;  5IER A;  1KQS 2;  1VZZ A;  4XBY A;  3S28 A;  3X42 A;  1EKM A;  1BRI A;  2JDI H;  2ZA4 A;  1QVG 2;  3NQY A;  3ROB A;  3IMA B;  3HK4 A;  1O7N B;  1TRQ A;  3JUO A;  2CX1 A;  3VF1 A;  4AEQ A;  3OWS A;  1LOX A;  4AKY A;  1MGW A;  2XGN A;  5AI1 A;  3MPH A;  1K28 A;  1OHO A;  3FCS B;  1JB2 A;  4HZB B;  3STD A;  3SED A;  3D79 A;  5BVB A;  1Q82 4;  3BLZ A;  1UUG B;  1GS3 A;  1T2H A;  3Q90 A;  3ZFZ A;  3GWR A;  1DE3 A;  3KKG A;  3F8H A;  4CPK A;  1KSI A;  1MWS A;  3IPT A;  1Q9E A;  4WHA A;  1Y4K A;  2JQ5 A;  2F5M A;  5D81 A;  2KAA A;  6GSP A;  2AAD A;  1B2U A;  1B20 A;  1I0X A;  2ML5 A;  3BB9 A;  3NBB A;  5EEO A;  2P09 A;  4HYZ A;  2LQV A;  4FCJ A;  5M19 A;  1B2X A;  3ECF A;  3DUK A;  1NWW A;  4FMB A;  3CCL 3;  1EUI C;  2FXT A;  1FW7 A;  2H0H A;  1DMQ A;  3LML A;  7STD A;  1OGZ A;  1W7C A;  3F9S A;  3A76 A;  1ROV A;  3FGY A;  1I2F A;  1ROA A;  1ULI B;  5AEU B;  1VQ7 3;  3EN1 B;  2O3O A;  1BUQ A;  1YVS A;  4BTX A;  2CWT A;  1CYV A;  1GMQ A;  3AGN A;  3NBJ A;  2D42 A;  3CCM 3;  1UCJ A;  2Z7A A;  1T5Y A;  2W56 A;  2MF7 A;  3CCQ 3;  3FH1 A;  3CCU 3;  1KC8 4;  1VQ5 3;  4J5K A;  1FUW A;  1SAR A;  1I8V A;  3G16 A;  5IEO A;  3QK9 A;  1RGA A;  2XEP A;  2IUJ A;  1OF5 B;  1HYF A;  1ISK A;  5AIG A;  3CME 3;  1T3B A;  3ZG5 A;  3D4A A;  3G8Z A;  3MG3 A;  1ASK A;  1YJ9 3;  1QAF A;  2SAR A;  2KF6 A;  3CC7 3;  3KSE D;  4KT3 B;  1RMS A;  4N6T A;  3Q3F A;  4K1U A;  4HM1 B;  5G1L A;  1CEW I;  4HM0 B;  1IVV A;  2CIU A;  2IUK A;  2XFT A;  3KN4 A;  3PS8 A;  3T8U A;  5G1K A;  1W6Y A;  4J8T A;  3AGO A;  1ZS7 A; 
#chains in the Genus database with same CATH homology
 3WR2 A;  1BRH A;  1BRG A;  1BAO A;  1RGK A;  1LOY A;  4J5G A;  2GSP A;  5BU4 A;  1AQZ A;  1GMR A;  2BU4 A;  1MGR A;  1X1U A;  4BU4 A;  1RGC A;  1GOU A;  2HOH A;  1FZU A;  1RGG A;  1B21 A;  1BSA A;  1BRN L;  1JBR A;  3SYU A;  1FYS A;  7RNT A;  3BIR A;  4RNT A;  1X1X A;  1BAN A;  2C4B A;  1ZGX A;  1BU4 A;  1I3F A;  1UCL A;  3GSP A;  1DET A;  1UCK A;  3D5I A;  1C54 A;  9RNT A;  5BIR A;  1RGL A;  6RNT A;  1B2Z A;  2F4Y A;  1A2P A;  2RBI A;  2KF3 A;  2RNT A;  3AHW A;  1PYL A;  1I2E A;  1BRJ A;  2ZA4 A;  1BRI A;  1RN1 A;  1GOV A;  1I70 A;  1TRQ A;  1BSB A;  1BUJ A;  2BIR A;  1MGW A;  1BSD A;  5HOH A;  1BRS A;  1PY3 A;  2KF5 A;  1RCL A;  3KCH A;  5GSP A;  3BU4 A;  3AHS A;  1JBT A;  1RN4 A;  1RNB A;  3DGY A;  1B27 A;  1BNS A;  1T2H A;  4HAA A;  1LOW A;  8RNT A;  1DE3 A;  1BIR A;  1Q9E A;  1GSP A;  1LRA A;  1RGF A;  1FUT A;  1BVI A;  2F5M A;  6GSP A;  2KAA A;  2AAD A;  1B2U A;  1B20 A;  1I0X A;  1HZ1 A;  1R4Y A;  3HOH A;  1I2G A;  1X1W A;  1BNE A;  1BSC A;  1B3S A;  1RTU A;  1TTO A;  4GHO A;  1B2X A;  5RNT A;  1BRK A;  1JBS A;  3A5E A;  1FW7 A;  1LNI A;  1RCK A;  1BGS A;  1BOX A;  1RDS A;  1RNT A;  1B2M A;  1AY7 A;  1I2F A;  1I3I A;  1I0V A;  1G02 A;  1BNG A;  1YVS A;  1GMQ A;  3AGN A;  3RNT A;  7GSP A;  1BNR A;  3WHO A;  1UCI A;  1UCJ A;  1RLS A;  1CH0 A;  1GOY A;  1RHL A;  1B2S A;  4J5K A;  1SAR A;  4HOH A;  1I8V A;  1GMP A;  1RGA A;  1BNI A;  1HYF A;  1BSE A;  3URP A;  3D4A A;  3D5G A;  2KF4 A;  1IYY A;  1BNJ A;  2SAR A;  2KF6 A;  4BIR A;  1RGE A;  1YNV X;  1RMS A;  1T2I A;  1BNF A;  1FUS A;  3Q3F A;  1RSN A;  3DH2 A;  1YGW A;  2AAE A;  4GSP A;  2F5W A;  1TRP A;  1X1Y A;  2F56 A;  1RGH A;  3AGO A;  1LOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...