3WR2A

Rnase po1 complexed with 3'gmp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
101
structure length
101
Chain Sequence
QTGVRSCNCAGRSFTGTDVTNAIRSARAGGSGNYPHVYNNFEGFSFSCTPTFFEFPVFRGSVYSGGSPGADRVIYDQSGRFCACLTHTGAPSTNGFVECRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RNase Po1 complexed with 3'GMP
rcsb
source organism Pleurotus ostreatus
molecule tags Hydrolase
molecule keywords Guanyl-specific ribonuclease Po1
total genus 25
structure length 101
sequence length 101
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2014-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 3wr2A00
3A5EA 1BSDA 1ZGXA 1BSCA 1R4YA 4HOHA 1DE3A 1LOYA 3WHOA 1CH0A 7RNTA 3BIRA 3HOHA 1I2FA 1RCLA 5BU4A 2KF5A 1B2ZA 1I0XA 3BU4A 1A2PA 3DH2A 3DGYA 4J5KA 1BANA 5RNTA 1FZUA 1X1XA 1DETA 1BOXA 1GMRA 1BRNL 1GMPA 1GOYA 1IYYA 1BNEA 3AGNA 1RHLA 3KCHA 1BVIA 1AQZA 1GOUA 1GOVA 2F5WA 1B2MA 1PYLA 2HOHA 1RGHA 1AY7A 1I2EA 1C54A 2BIRA 1RDSA 1I0VA 1RSNA 1BRGA 1LRAA 1FUTA 2KF3A 3Q3FA 1BSBA 2AADA 3D5GA 1RGAA 1B2UA 7GSPA 1BAOA 1RMSA 1B2SA 1I2GA 1B27A 3D4AA 1I3FA 2KAAA 1LOWA 1BIRA 1B21A 1G02A 1I3IA 1X1WA 1GMQA 2KF6A 1JBSA 4BIRA 1BNFA 4GHOA 1BNSA 1TTOA 2F5MA 1BNRA 1B2XA 1T2IA 1TRPA 2C4BA 4RNTA 1I70A 8RNTA 1BRIA 1X1YA 1BNIA 2RNTA 3GSPA 6GSPA 1BUJA 2RBIA 1BSEA 1HZ1A 1TRQA 1UCJA 1I8VA 1RNTA 3AHWA 3SYUA 1JBRA 1LOVA 2ZA4A 1BGSA 1RGKA 5GSPA 1YVSA 1B20A 2F56A 1RN1A 5HOHA 1RTUA 1RGFA 1RGCA 1B3SA 1RN4A 1RGEA 1T2HA 1RNBA 5BIRA 1JBTA 4HAAA 1BRSA 1UCLA 1PY3A 1YNVX 1HYFA 4BU4A 3WR2A 2AAEA 1RGGA 1BRJA 1LNIA 1GSPA 1BRHA 1MGWA 1SARA 4GSPA 3AHSA 3RNTA 3URPA 9RNTA 1FYSA 1FW7A 1Q9EA 1BSAA 1RCKA 1UCKA 1YGWA 1MGRA 2BU4A 2KF4A 6RNTA 1BU4A 2F4YA 1BRKA 3D5IA 1UCIA 1BNGA 3AGOA 1BNJA 1FUSA 1X1UA 1RGLA 1RLSA 2GSPA 2SARA 4J5GA
chains in the Genus database with same CATH superfamily
4HZ9B 3JVCA 4CPKA 2GU3A 3AMOB 2CX1A 3OX9A 1MNLA 1UI8A 2JDIH 1YJ93 3MPHA 1EG9B 1A67A 2GBWB 3FSDA 3QK9A 3CD63 4N6LA 1EEJA 5EVHA 3MKIA 4KFDA 1VQ53 1S723 1W6CA 2QEX3 1LOYA 3EF8A 1SJWA 3B4OA 5D82A 3BIRA 4EW5A 2FXTA 4XDVA 3KSPA 5BU4A 3IJEB 2CFDA 2KF5A 4KFEA 1IVWA 1B2ZA 5IG5A 1I0XA 2CG1A 1YIJ3 3BU4A 1A2PA 2OQEA 1GS3A 3DGYA 4NPBA 3MHEA 2XGNA 1BANA 5RNTA 1X1XA 5FGOA 3F8HA 2XF3A 1DETA 1NB5I 1O7WB 2UUGC 1GOYA 1OGXA 2V1LA 3DZLA 4QWTA 4HM4B 1QMAA 5KP1A 2L4VA 1ZO2A 2H0IA 2I9WA 1PYLA 2K54A 1RGHA 3EHCA 4H3UA 5CLKA 3EQQB 5STDA 1VQ83 1N5PA 4RNYA 1IVVA 1KD14 1BRGA 3EC9A 4MMZB 1WMNA 1W00A 4OUQA 3Q3FA 5IF6A 2AADA 4XBTA 1VQ63 3T8UA 3CC73 4XBYA 3PCSA 3CCR3 1BUQA 2ML6A 3U1WA 4EXRA 1BAOA 3GRDA 3KN4A 1I2GA 4FMAA 1AR0A 3CCE3 2CK3H 1LVNA 1ROVA 3CMA3 1VQP3 1W6GA 1B21A 1T3BA 3M8CA 3F14A 1GMQA 3BNDA 1BNFA 1JN5A 3CNMA 3I553 1BNRA 1TRPA 1GYBA 2Z7AA 1OF5A 3JUNA 4EV2A 1BNIA 2P0MA 3EB8A 2XFSA 1OHPA 1RNTA 1JBRA 1EQKA 4HM1B 1JV2B 1LOVA 1BGSA 2GU1A 4LEHA 1LOXA 1K28A 1RGKA 1STDA 3F7SA 1NB3I 1O7HB 2FNQA 3LOYA 1S5AA 1B20A 2IMJA 3LZAA 3X41A 5HOHA 1N5HA 3PYJA 4HZBB 4LZIA 2QA43 1VQ93 1K734 1RGFA 2W56B 1AVLA 2BT3A 1T2HA 2HMKB 2W03A 3LT8A 2OTJ3 3ZG0A 4BL3A 4HAAA 1OPYA 1PFPA 4KT3B 3ROBA 2OCTA 1VQ73 3KSED 3SX1A 2XSHB 1Q824 3CCV3 3TDGA 1FGTA 1K8A4 4FCZA 1LNIA 1U8CB 1TFOA 2RSXA 1W6YA 1JB2A 5M1AA 1NU3A 4DKIA 2CH9A 3AHSA 2GEYA 4MEIA 1JNQA 1SPUA 1VQN3 1OGZA 1EKMA 3URPA 3SVAA 3K9MC 4ORLA 4J9AA 5TGNA 1IQ8A 5I97A 3N9HA 3UNLA 3PXMA 1Q7HA 5KP3A 3LH4A 1RCKA 1A2VA 3JUQA 2KF4A 1EA2A 6RNTA 3WA2X 1BU4A 1WQLB 2F4YA 1BRKA 4HBRA 4O3VA 2QGUA 3PS8A 1RJOA 4FR9A 2D42A 2Z76A 3GZBA 3CU3A 1FGRA 2A15A 1RGLA 4HJLB 2CC3A 3CPOA 1K9M4 1DMNA 3FCSB 2OOVA 4KZ1A 4CDLA 2Z77A 3A5EA 2OWPA 5G1KA 1MOLA 2C10A 2E2TA 2FGTA 1TP6A 2BMQB 3GZRA 4HOHA 4FMBA 5CK6A 5CXOA 3WOEB 2JQ5A 1DE3A 2CWUA 1FGQA 2YFJB 4NHFA 7RNTA 5D83A 3D3LA 3G0KA 1UUVB 2CHCA 1I2FA 4O02B 4AKYA 1RN7A 4BTYA 3CPW2 1JB5A 1LXEA 1ZX2A 1M9GA 3UJMA 1RKYA 1YI23 3CC43 3DH2A 1TJDA 2O3OA 2CWVA 4J8TA 2GXFA 4J5KA 2WOHA 5IENA 3CNXA 3NV0B 2STDA 3BNEA 1UI7A 3VF1A 5EQLA 4BL2A 1BOXA 1EUIC 1GMRA 4AKZA 4I5QA 1PU4A 2RFRA 4MMXB 2ZDJA 2INXA 1IYYA 1HKXA 1OHOA 2BMRB 4O8SA 1RHLA 3KCHA 1BVIA 2BNGA 4AEQA 1AQZA 1O7MB 1G96A 2F5WA 4LMIA 3D9RA 4IIAA 3X3YA 5M18A 3CCS3 3F9SA 3LTCA 3G6E3 1E3RA 2BIRA 1RDSA 1I0VA 5A0OB 1RSNA 3DUKA 1NWWA 1LQMB 2XR8B 3D79A 3GZXB 5CF2A 3LMLA 2H0GA 3UL5A 1BSBA 3FF0A 2Y73A 3D5GA 1VQ43 3NBJA 3G4S3 2CFKA 3HIGA 4TX4A 4WHAA 3F8XA 3FZWA 1RMSA 1STFI 2F98A 3SOYA 3LXUX 1B27A 1I3FA 1N9JA 2OTL3 3CCM3 3QRDA 3OXAA 3VSYA 3EBTA 1JBSA 4WP5A 4BIRA 1NO3A 1R4CA 5BVBA 3LTDA 3PCRA 2CFGA 1J2BA 5G1LA 4FCMA 1I70A 4STDA 4N3VA 1X1YA 1YJN3 3FKAA 7STDA 2RBIA 3B7CA 1TRQA 1V58A 1UCJA 3IPTA 3WODG 3MSOA 3AHWA 2CIUA 1G0TA 3S28A 1OF5B 3FGYA 4HYZA 1RRHA 2E2VA 4MMYB 3DGLA 1FGMA 1N8QA 1Y4KA 2F56A 1RN1A 3DY5A 5EEOA 1GY7A 3DMCA 3CCL3 4HVNA 2F99A 3GZYB 3NM7A 3LYGA 4LYLB 1RGCA 3FG1A 3FH1A 1RN4A 1QVG2 1RNBA 2HMLB 1V57A 5ELJA 5BIRA 4HM8B 5AIIA 6STDA 1GY5A 1JKGB 1UCLA 3F40A 1PY3A 1YNVX 1VQO3 2RGQA 3EJVA 3I563 3SLUA 1Q42A 2HMMB 1W02A 3EN1B 5IG4A 2AAEA 1OCVA 2XEPA 1TFKA 3GWRA 1MGWA 3RGAA 3CC23 1QAFA 4N6V0 2P0XA 2W2CA 2Q07A 3KKGA 1FW7A 1Q9EA 4G1MB 1BSAA 1F8NA 1AVKA 2SBLA 4HM0B 4N6MA 2CFWA 1UUWB 4R80A 5IW9A 2M7OA 4L8OA 3FG4A 2BU4A 1VQQA 1M1XB 3CCQ3 1US1A 4K61A 1BNGA 1IU7A 1X1UA 3K63A 3J7Yd 2P38A 1RLSA 5DREA 2GSPA 2UGIA 1MWSA 3BB9A 4WYKB 3KE7A 1T5YA 3SXXA 1SIIA 2CKFB 4PEJA 4XB5A 1BSDA 3AMOA 1BSCA 1DYUA 5CF1A 1KQS2 4HM3B 4XDWA 3VGNA 1GD3A 3BLZA 1VQM3 3JUPA 3DM8A 3LT9A 3WHOA 2BMOB 4ILFA 1FA3A 3NHXA 1O7NB 1NDOB 4R9LA 2E2UA 5IG0A 2IA7A 2F86B 3I0YA 3ECFA 2B24B 2ZHXB 1WMOA 1FZUA 3ALAA 3MG1A 3OWSA 3ZG5A 1W01A 3PZWA 3WMDA 1BRNL 2ZL8A 4N6OB 1BNEA 1DMQA 4IPBA 3NX0A 1C7HA 1GOUA 1B2MA 1GD4A 1AY7A 4I4KA 5JBSA 2K0MA 1YHQ3 4N6NB 2B1XB 1C54A 2OOVC 3NUVA 1UW1A 5AIGA 1UDII 4ZM8A 1M1K4 1FUTA 3JUMA 3X3XA 1JB4A 2KF3A 3UL6A 3N54B 2WO0A 2O9UX 3T8NA 5AEUB 5FW5A 2YFIB 1Q864 3NXJA 1ISKA 4LGQA 2W9PA 5JPUA 1B2UA 7GSPA 4R4KA 1Z1SA 2CWTA 3EN8A 5LC7A 4KFFA 4CCVA 3D4AA 1TUHA 4R9KA 2W0QA 1JKGA 2KAAA 1LOWA 1BIRA 1G02A 1I3IA 1X1WA 3FLJA 4BTWA 3PGBA 3HI7A 5AYRB 4HM2B 1BNSA 4EBGA 4XBXA 1Q40A 3NQZA 4GB5A 4RNTA 2C4BA 1N9EA 3BNCA 2KCDA 1JRQA 2CG0A 3S5CA 2P05A 3OWYA 6GSPA 1YVBI 1BSEA 1BUJA 3OW22 1QVF2 4JRFA 1CEWI 1I8VA 3NV0A 3WDGB 1OHSA 2ZA4A 4JF8A 3OWUA 1DMMA 5GSPA 1YVSA 3X42A 3CCU3 5AIHA 2XSOB 1WNHA 4X2HA 2WOFA 4EV5A 2XGLA 1LQGC 1Q40B 1DVDA 1O7PB 1B3SA 1QALA 5HGRA 1RGEA 4U13A 4FCJA 5IEPA 1JBTA 1BRSA 1A90A 3CXC2 3HIIA 2XFTA 3Q90A 1HYFA 1MWTA 3K0ZA 3U97A 1BRJA 4GL6A 4N6UA 3SOAA 8CHOA 1JN5B 2YFLB 2RCDA 1SARA 4GSPA 1W2B2 3RNTA 3N8BA 3H51A 4H61A 1QAKA 9RNTA 1AV4A 4Q53A 5AI1A 4L7KA 1IT8A 3K7CA 4LSOA 2H0HA 2LQVA 5IERA 1IT7A 2LYXA 1WTHA 3FF2A 1UCKA 1YGWA 1MGRA 3KFQC 5LC6A 1IQYA 3D5IA 4EYCA 1UCIA 2BO9B 3AGOA 5DRVA 2IUJA 2HMOB 1ULJB 1BNJA 3KIIA 4OVMA 4HKVB 3T0UA 2GEXA 3DXOA 3Q1CA 1IDPA 2WGQA 1ZGXA 4FMCA 2CFLA 3V92A 1R4YA 4WYKA 5M19A 2IUKA 1WMPA 2K3DA 1U5OA 3IMAB 2UX0A 4OK0A 3DGMA 4WWUC 1CH0A 2KRTA 3HOHA 1W5ZA 3RDEA 1ASKA 1RCLA 2IYJA 5KP4A 1OUNA 2PZVA 3MG2A 3OV4A 3G713 2YX9A 1VZZA 2W6JH 5D81A 2OQEC 4WFOA 2ML5A 2WGOA 1GY6A 3F7XA 2W04A 3Q2PA 1W7CA 2L1SA 4BTXA 4N6TA 3H3HA 3B8LA 2Y74A 1NJI4 1GMPA 1LNHA 4KVHA 5ELUA 3AGNA 1JJ22 1W2ZA 3MWZA 2XH9A 1GOVA 4K1VA 3CME3 1RRLA 2HOHA 1I2EA 1YJW3 1KC84 2GBXB 2PNCA 1TU5A 2BHMA 1YGEA 3WOFB 1UGIA 1LRAA 3S27A 1SQWA 1O7GB 2D1WA 1NNVA 1QJGA 1W4NA 1D6YA 4RNZA 3L0RA 1RGAA 2HMJB 3ER7A 4RBNA 3B4PA 1B2SA 3HZPA 4IT7A 1L5GB 1UGHI 5BXQA 1D6ZA 2QIYA 3O8YA 3LTAA 3V98A 1MWUA 2MC8A 2Z6BA 2KF6A 3EX9A 3ZFZA 4CJNA 4GHOA 1DVCA 2HMNB 2C11A 5AEWB 1TTOA 2F5MA 3S67A 1V74A 1B2XA 1T2IA 4FMDA 3CCJ3 3S29A 5IG3A 1VQK3 1OH0A 5AIFA 1CYUA 8RNTA 4HM5B 2XRXB 1BRIA 1CYVA 3KZTA 3STDA 2RNTA 3EBYA 3GSPA 1TIJA 3V99A 1FGOA 2CX0A 1HZ1A 3GAXA 3G8ZA 4O2HA 3SYUA 1IQXA 3K5TA 1M904 1YIT3 1KSIA 3FG3A 1JZDA 3RGRA 1ROAA 4L8PA 3SEDA 1RTUA 2CW9A 2R4IA 1JZOA 2MF7A 4NREA 1Q7Y4 1VQL3 4HM7B 4XM4A 2P09A 5G2GA 1K41A 2W9QA 1IV7A 1E3VA 3MG3A 2J8XB 3DGOA 3NBRA 1OACA 4HM6B 3NM2A 3WA3A 1ZS7A 3HX8A 3DGNA 1FUWA 1Q814 3BNBA 4BU4A 3WR2A 1IK3A 2KXGA 1RGGA 4K90B 5AYSC 1GSPA 4MJDA 1E97A 3G16A 3JUOA 3NBBA 4RZMA 4X2OA 1BRHA 4R1KA 3X3ZA 1ULIB 2IY2A 3LTBA 3E99A 1FYSA 1HU9A 3UB1A 2W56A 4K1UA 3NQYA 1SIHA 2R41A 5JPPA 4EC6A 3X40A 1KWIA 1A2KA 5IEOA 3HK4A 1UUGB 3EE1A 1MWRA 1FUSA 1IV9A 1IVUA 3MYTA 1N8R4 3A76A 1CQSA 1D6UA 1IVXA 2SARA 4J5GA
chains in the Genus database with same CATH topology
3A5EA 1BSDA 1ZGXA 1BSCA 1R4YA 4HOHA 1DE3A 1LOYA 3WHOA 1CH0A 7RNTA 3BIRA 3HOHA 1I2FA 1RCLA 5BU4A 2KF5A 1B2ZA 1I0XA 3BU4A 1A2PA 3DH2A 3DGYA 4J5KA 1BANA 5RNTA 1FZUA 1X1XA 1DETA 1BOXA 1GMRA 1BRNL 1GMPA 1GOYA 1IYYA 1BNEA 3AGNA 1RHLA 3KCHA 1BVIA 1AQZA 1GOUA 1GOVA 2F5WA 1B2MA 1PYLA 2HOHA 1RGHA 1AY7A 1I2EA 1C54A 2BIRA 1RDSA 1I0VA 1RSNA 1BRGA 1LRAA 1FUTA 2KF3A 3Q3FA 1BSBA 2AADA 3D5GA 1RGAA 1B2UA 7GSPA 1BAOA 1RMSA 1B2SA 1I2GA 1B27A 3D4AA 1I3FA 2KAAA 1LOWA 1BIRA 1B21A 1G02A 1I3IA 1X1WA 1GMQA 2KF6A 1JBSA 4BIRA 1BNFA 4GHOA 1BNSA 1TTOA 2F5MA 1BNRA 1B2XA 1T2IA 1TRPA 2C4BA 4RNTA 1I70A 8RNTA 1BRIA 1X1YA 1BNIA 2RNTA 3GSPA 6GSPA 1BUJA 2RBIA 1BSEA 1HZ1A 1TRQA 1UCJA 1I8VA 1RNTA 3AHWA 3SYUA 1JBRA 1LOVA 2ZA4A 1BGSA 1RGKA 5GSPA 1YVSA 1B20A 2F56A 1RN1A 5HOHA 1RTUA 1RGFA 1RGCA 1B3SA 1RN4A 1RGEA 1T2HA 1RNBA 5BIRA 1JBTA 4HAAA 1BRSA 1UCLA 1PY3A 1YNVX 1HYFA 4BU4A 3WR2A 2AAEA 1RGGA 1BRJA 1LNIA 1GSPA 1BRHA 1MGWA 1SARA 4GSPA 3AHSA 3RNTA 3URPA 9RNTA 1FYSA 1FW7A 1Q9EA 1BSAA 1RCKA 1UCKA 1YGWA 1MGRA 2BU4A 2KF4A 6RNTA 1BU4A 2F4YA 1BRKA 3D5IA 1UCIA 1BNGA 3AGOA 1BNJA 1FUSA 1X1UA 1RGLA 1RLSA 2GSPA 2SARA 4J5GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A5E A;  1BSD A;  1ZGX A;  1BSC A;  1R4Y A;  4HOH A;  1DE3 A;  1LOY A;  3WHO A;  1CH0 A;  7RNT A;  3BIR A;  3HOH A;  1I2F A;  1RCL A;  5BU4 A;  2KF5 A;  1B2Z A;  1I0X A;  3BU4 A;  1A2P A;  3DH2 A;  3DGY A;  4J5K A;  1BAN A;  5RNT A;  1FZU A;  1X1X A;  1DET A;  1BOX A;  1GMR A;  1BRN L;  1GMP A;  1GOY A;  1IYY A;  1BNE A;  3AGN A;  1RHL A;  3KCH A;  1BVI A;  1AQZ A;  1GOU A;  1GOV A;  2F5W A;  1B2M A;  1PYL A;  2HOH A;  1RGH A;  1AY7 A;  1I2E A;  1C54 A;  2BIR A;  1RDS A;  1I0V A;  1RSN A;  1BRG A;  1LRA A;  1FUT A;  2KF3 A;  3Q3F A;  1BSB A;  2AAD A;  3D5G A;  1RGA A;  1B2U A;  7GSP A;  1BAO A;  1RMS A;  1B2S A;  1I2G A;  1B27 A;  3D4A A;  1I3F A;  2KAA A;  1LOW A;  1BIR A;  1B21 A;  1G02 A;  1I3I A;  1X1W A;  1GMQ A;  2KF6 A;  1JBS A;  4BIR A;  1BNF A;  4GHO A;  1BNS A;  1TTO A;  2F5M A;  1BNR A;  1B2X A;  1T2I A;  1TRP A;  2C4B A;  4RNT A;  1I70 A;  8RNT A;  1BRI A;  1X1Y A;  1BNI A;  2RNT A;  3GSP A;  6GSP A;  1BUJ A;  2RBI A;  1BSE A;  1HZ1 A;  1TRQ A;  1UCJ A;  1I8V A;  1RNT A;  3AHW A;  3SYU A;  1JBR A;  1LOV A;  2ZA4 A;  1BGS A;  1RGK A;  5GSP A;  1YVS A;  1B20 A;  2F56 A;  1RN1 A;  5HOH A;  1RTU A;  1RGF A;  1RGC A;  1B3S A;  1RN4 A;  1RGE A;  1T2H A;  1RNB A;  5BIR A;  1JBT A;  4HAA A;  1BRS A;  1UCL A;  1PY3 A;  1YNV X;  1HYF A;  4BU4 A;  3WR2 A;  2AAE A;  1RGG A;  1BRJ A;  1LNI A;  1GSP A;  1BRH A;  1MGW A;  1SAR A;  4GSP A;  3AHS A;  3RNT A;  3URP A;  9RNT A;  1FYS A;  1FW7 A;  1Q9E A;  1BSA A;  1RCK A;  1UCK A;  1YGW A;  1MGR A;  2BU4 A;  2KF4 A;  6RNT A;  1BU4 A;  2F4Y A;  1BRK A;  3D5I A;  1UCI A;  1BNG A;  3AGO A;  1BNJ A;  1FUS A;  1X1U A;  1RGL A;  1RLS A;  2GSP A;  2SAR A;  4J5G A; 
#chains in the Genus database with same CATH topology
 4HZ9 B;  3JVC A;  4CPK A;  2GU3 A;  3AMO B;  2CX1 A;  3OX9 A;  1MNL A;  1UI8 A;  2JDI H;  1YJ9 3;  3MPH A;  1EG9 B;  1A67 A;  2GBW B;  3FSD A;  3QK9 A;  3CD6 3;  4N6L A;  1EEJ A;  5EVH A;  3MKI A;  4KFD A;  1VQ5 3;  1S72 3;  1W6C A;  2QEX 3;  1LOY A;  3EF8 A;  1SJW A;  3B4O A;  5D82 A;  3BIR A;  4EW5 A;  2FXT A;  4XDV A;  3KSP A;  5BU4 A;  3IJE B;  2CFD A;  2KF5 A;  4KFE A;  1IVW A;  1B2Z A;  5IG5 A;  1I0X A;  2CG1 A;  1YIJ 3;  3BU4 A;  1A2P A;  2OQE A;  1GS3 A;  3DGY A;  4NPB A;  3MHE A;  2XGN A;  1BAN A;  5RNT A;  1X1X A;  5FGO A;  3F8H A;  2XF3 A;  1DET A;  1NB5 I;  1O7W B;  2UUG C;  1GOY A;  1OGX A;  2V1L A;  3DZL A;  4QWT A;  4HM4 B;  1QMA A;  5KP1 A;  2L4V A;  1ZO2 A;  2H0I A;  2I9W A;  1PYL A;  2K54 A;  1RGH A;  3EHC A;  4H3U A;  5CLK A;  3EQQ B;  5STD A;  1VQ8 3;  1N5P A;  4RNY A;  1IVV A;  1KD1 4;  1BRG A;  3EC9 A;  4MMZ B;  1WMN A;  1W00 A;  4OUQ A;  3Q3F A;  5IF6 A;  2AAD A;  4XBT A;  1VQ6 3;  3T8U A;  3CC7 3;  4XBY A;  3PCS A;  3CCR 3;  1BUQ A;  2ML6 A;  3U1W A;  4EXR A;  1BAO A;  3GRD A;  3KN4 A;  1I2G A;  4FMA A;  1AR0 A;  3CCE 3;  2CK3 H;  1LVN A;  1ROV A;  3CMA 3;  1VQP 3;  1W6G A;  1B21 A;  1T3B A;  3M8C A;  3F14 A;  1GMQ A;  3BND A;  1BNF A;  1JN5 A;  3CNM A;  3I55 3;  1BNR A;  1TRP A;  1GYB A;  2Z7A A;  1OF5 A;  3JUN A;  4EV2 A;  1BNI A;  2P0M A;  3EB8 A;  2XFS A;  1OHP A;  1RNT A;  1JBR A;  1EQK A;  4HM1 B;  1JV2 B;  1LOV A;  1BGS A;  2GU1 A;  4LEH A;  1LOX A;  1K28 A;  1RGK A;  1STD A;  3F7S A;  1NB3 I;  1O7H B;  2FNQ A;  3LOY A;  1S5A A;  1B20 A;  2IMJ A;  3LZA A;  3X41 A;  5HOH A;  1N5H A;  3PYJ A;  4HZB B;  4LZI A;  2QA4 3;  1VQ9 3;  1K73 4;  1RGF A;  2W56 B;  1AVL A;  2BT3 A;  1T2H A;  2HMK B;  2W03 A;  3LT8 A;  2OTJ 3;  3ZG0 A;  4BL3 A;  4HAA A;  1OPY A;  1PFP A;  4KT3 B;  3ROB A;  2OCT A;  1VQ7 3;  3KSE D;  3SX1 A;  2XSH B;  1Q82 4;  3CCV 3;  3TDG A;  1FGT A;  1K8A 4;  4FCZ A;  1LNI A;  1U8C B;  1TFO A;  2RSX A;  1W6Y A;  1JB2 A;  5M1A A;  1NU3 A;  4DKI A;  2CH9 A;  3AHS A;  2GEY A;  4MEI A;  1JNQ A;  1SPU A;  1VQN 3;  1OGZ A;  1EKM A;  3URP A;  3SVA A;  3K9M C;  4ORL A;  4J9A A;  5TGN A;  1IQ8 A;  5I97 A;  3N9H A;  3UNL A;  3PXM A;  1Q7H A;  5KP3 A;  3LH4 A;  1RCK A;  1A2V A;  3JUQ A;  2KF4 A;  1EA2 A;  6RNT A;  3WA2 X;  1BU4 A;  1WQL B;  2F4Y A;  1BRK A;  4HBR A;  4O3V A;  2QGU A;  3PS8 A;  1RJO A;  4FR9 A;  2D42 A;  2Z76 A;  3GZB A;  3CU3 A;  1FGR A;  2A15 A;  1RGL A;  4HJL B;  2CC3 A;  3CPO A;  1K9M 4;  1DMN A;  3FCS B;  2OOV A;  4KZ1 A;  4CDL A;  2Z77 A;  3A5E A;  2OWP A;  5G1K A;  1MOL A;  2C10 A;  2E2T A;  2FGT A;  1TP6 A;  2BMQ B;  3GZR A;  4HOH A;  4FMB A;  5CK6 A;  5CXO A;  3WOE B;  2JQ5 A;  1DE3 A;  2CWU A;  1FGQ A;  2YFJ B;  4NHF A;  7RNT A;  5D83 A;  3D3L A;  3G0K A;  1UUV B;  2CHC A;  1I2F A;  4O02 B;  4AKY A;  1RN7 A;  4BTY A;  3CPW 2;  1JB5 A;  1LXE A;  1ZX2 A;  1M9G A;  3UJM A;  1RKY A;  1YI2 3;  3CC4 3;  3DH2 A;  1TJD A;  2O3O A;  2CWV A;  4J8T A;  2GXF A;  4J5K A;  2WOH A;  5IEN A;  3CNX A;  3NV0 B;  2STD A;  3BNE A;  1UI7 A;  3VF1 A;  5EQL A;  4BL2 A;  1BOX A;  1EUI C;  1GMR A;  4AKZ A;  4I5Q A;  1PU4 A;  2RFR A;  4MMX B;  2ZDJ A;  2INX A;  1IYY A;  1HKX A;  1OHO A;  2BMR B;  4O8S A;  1RHL A;  3KCH A;  1BVI A;  2BNG A;  4AEQ A;  1AQZ A;  1O7M B;  1G96 A;  2F5W A;  4LMI A;  3D9R A;  4IIA A;  3X3Y A;  5M18 A;  3CCS 3;  3F9S A;  3LTC A;  3G6E 3;  1E3R A;  2BIR A;  1RDS A;  1I0V A;  5A0O B;  1RSN A;  3DUK A;  1NWW A;  1LQM B;  2XR8 B;  3D79 A;  3GZX B;  5CF2 A;  3LML A;  2H0G A;  3UL5 A;  1BSB A;  3FF0 A;  2Y73 A;  3D5G A;  1VQ4 3;  3NBJ A;  3G4S 3;  2CFK A;  3HIG A;  4TX4 A;  4WHA A;  3F8X A;  3FZW A;  1RMS A;  1STF I;  2F98 A;  3SOY A;  3LXU X;  1B27 A;  1I3F A;  1N9J A;  2OTL 3;  3CCM 3;  3QRD A;  3OXA A;  3VSY A;  3EBT A;  1JBS A;  4WP5 A;  4BIR A;  1NO3 A;  1R4C A;  5BVB A;  3LTD A;  3PCR A;  2CFG A;  1J2B A;  5G1L A;  4FCM A;  1I70 A;  4STD A;  4N3V A;  1X1Y A;  1YJN 3;  3FKA A;  7STD A;  2RBI A;  3B7C A;  1TRQ A;  1V58 A;  1UCJ A;  3IPT A;  3WOD G;  3MSO A;  3AHW A;  2CIU A;  1G0T A;  3S28 A;  1OF5 B;  3FGY A;  4HYZ A;  1RRH A;  2E2V A;  4MMY B;  3DGL A;  1FGM A;  1N8Q A;  1Y4K A;  2F56 A;  1RN1 A;  3DY5 A;  5EEO A;  1GY7 A;  3DMC A;  3CCL 3;  4HVN A;  2F99 A;  3GZY B;  3NM7 A;  3LYG A;  4LYL B;  1RGC A;  3FG1 A;  3FH1 A;  1RN4 A;  1QVG 2;  1RNB A;  2HML B;  1V57 A;  5ELJ A;  5BIR A;  4HM8 B;  5AII A;  6STD A;  1GY5 A;  1JKG B;  1UCL A;  3F40 A;  1PY3 A;  1YNV X;  1VQO 3;  2RGQ A;  3EJV A;  3I56 3;  3SLU A;  1Q42 A;  2HMM B;  1W02 A;  3EN1 B;  5IG4 A;  2AAE A;  1OCV A;  2XEP A;  1TFK A;  3GWR A;  1MGW A;  3RGA A;  3CC2 3;  1QAF A;  4N6V 0;  2P0X A;  2W2C A;  2Q07 A;  3KKG A;  1FW7 A;  1Q9E A;  4G1M B;  1BSA A;  1F8N A;  1AVK A;  2SBL A;  4HM0 B;  4N6M A;  2CFW A;  1UUW B;  4R80 A;  5IW9 A;  2M7O A;  4L8O A;  3FG4 A;  2BU4 A;  1VQQ A;  1M1X B;  3CCQ 3;  1US1 A;  4K61 A;  1BNG A;  1IU7 A;  1X1U A;  3K63 A;  3J7Y d;  2P38 A;  1RLS A;  5DRE A;  2GSP A;  2UGI A;  1MWS A;  3BB9 A;  4WYK B;  3KE7 A;  1T5Y A;  3SXX A;  1SII A;  2CKF B;  4PEJ A;  4XB5 A;  1BSD A;  3AMO A;  1BSC A;  1DYU A;  5CF1 A;  1KQS 2;  4HM3 B;  4XDW A;  3VGN A;  1GD3 A;  3BLZ A;  1VQM 3;  3JUP A;  3DM8 A;  3LT9 A;  3WHO A;  2BMO B;  4ILF A;  1FA3 A;  3NHX A;  1O7N B;  1NDO B;  4R9L A;  2E2U A;  5IG0 A;  2IA7 A;  2F86 B;  3I0Y A;  3ECF A;  2B24 B;  2ZHX B;  1WMO A;  1FZU A;  3ALA A;  3MG1 A;  3OWS A;  3ZG5 A;  1W01 A;  3PZW A;  3WMD A;  1BRN L;  2ZL8 A;  4N6O B;  1BNE A;  1DMQ A;  4IPB A;  3NX0 A;  1C7H A;  1GOU A;  1B2M A;  1GD4 A;  1AY7 A;  4I4K A;  5JBS A;  2K0M A;  1YHQ 3;  4N6N B;  2B1X B;  1C54 A;  2OOV C;  3NUV A;  1UW1 A;  5AIG A;  1UDI I;  4ZM8 A;  1M1K 4;  1FUT A;  3JUM A;  3X3X A;  1JB4 A;  2KF3 A;  3UL6 A;  3N54 B;  2WO0 A;  2O9U X;  3T8N A;  5AEU B;  5FW5 A;  2YFI B;  1Q86 4;  3NXJ A;  1ISK A;  4LGQ A;  2W9P A;  5JPU A;  1B2U A;  7GSP A;  4R4K A;  1Z1S A;  2CWT A;  3EN8 A;  5LC7 A;  4KFF A;  4CCV A;  3D4A A;  1TUH A;  4R9K A;  2W0Q A;  1JKG A;  2KAA A;  1LOW A;  1BIR A;  1G02 A;  1I3I A;  1X1W A;  3FLJ A;  4BTW A;  3PGB A;  3HI7 A;  5AYR B;  4HM2 B;  1BNS A;  4EBG A;  4XBX A;  1Q40 A;  3NQZ A;  4GB5 A;  4RNT A;  2C4B A;  1N9E A;  3BNC A;  2KCD A;  1JRQ A;  2CG0 A;  3S5C A;  2P05 A;  3OWY A;  6GSP A;  1YVB I;  1BSE A;  1BUJ A;  3OW2 2;  1QVF 2;  4JRF A;  1CEW I;  1I8V A;  3NV0 A;  3WDG B;  1OHS A;  2ZA4 A;  4JF8 A;  3OWU A;  1DMM A;  5GSP A;  1YVS A;  3X42 A;  3CCU 3;  5AIH A;  2XSO B;  1WNH A;  4X2H A;  2WOF A;  4EV5 A;  2XGL A;  1LQG C;  1Q40 B;  1DVD A;  1O7P B;  1B3S A;  1QAL A;  5HGR A;  1RGE A;  4U13 A;  4FCJ A;  5IEP A;  1JBT A;  1BRS A;  1A90 A;  3CXC 2;  3HII A;  2XFT A;  3Q90 A;  1HYF A;  1MWT A;  3K0Z A;  3U97 A;  1BRJ A;  4GL6 A;  4N6U A;  3SOA A;  8CHO A;  1JN5 B;  2YFL B;  2RCD A;  1SAR A;  4GSP A;  1W2B 2;  3RNT A;  3N8B A;  3H51 A;  4H61 A;  1QAK A;  9RNT A;  1AV4 A;  4Q53 A;  5AI1 A;  4L7K A;  1IT8 A;  3K7C A;  4LSO A;  2H0H A;  2LQV A;  5IER A;  1IT7 A;  2LYX A;  1WTH A;  3FF2 A;  1UCK A;  1YGW A;  1MGR A;  3KFQ C;  5LC6 A;  1IQY A;  3D5I A;  4EYC A;  1UCI A;  2BO9 B;  3AGO A;  5DRV A;  2IUJ A;  2HMO B;  1ULJ B;  1BNJ A;  3KII A;  4OVM A;  4HKV B;  3T0U A;  2GEX A;  3DXO A;  3Q1C A;  1IDP A;  2WGQ A;  1ZGX A;  4FMC A;  2CFL A;  3V92 A;  1R4Y A;  4WYK A;  5M19 A;  2IUK A;  1WMP A;  2K3D A;  1U5O A;  3IMA B;  2UX0 A;  4OK0 A;  3DGM A;  4WWU C;  1CH0 A;  2KRT A;  3HOH A;  1W5Z A;  3RDE A;  1ASK A;  1RCL A;  2IYJ A;  5KP4 A;  1OUN A;  2PZV A;  3MG2 A;  3OV4 A;  3G71 3;  2YX9 A;  1VZZ A;  2W6J H;  5D81 A;  2OQE C;  4WFO A;  2ML5 A;  2WGO A;  1GY6 A;  3F7X A;  2W04 A;  3Q2P A;  1W7C A;  2L1S A;  4BTX A;  4N6T A;  3H3H A;  3B8L A;  2Y74 A;  1NJI 4;  1GMP A;  1LNH A;  4KVH A;  5ELU A;  3AGN A;  1JJ2 2;  1W2Z A;  3MWZ A;  2XH9 A;  1GOV A;  4K1V A;  3CME 3;  1RRL A;  2HOH A;  1I2E A;  1YJW 3;  1KC8 4;  2GBX B;  2PNC A;  1TU5 A;  2BHM A;  1YGE A;  3WOF B;  1UGI A;  1LRA A;  3S27 A;  1SQW A;  1O7G B;  2D1W A;  1NNV A;  1QJG A;  1W4N A;  1D6Y A;  4RNZ A;  3L0R A;  1RGA A;  2HMJ B;  3ER7 A;  4RBN A;  3B4P A;  1B2S A;  3HZP A;  4IT7 A;  1L5G B;  1UGH I;  5BXQ A;  1D6Z A;  2QIY A;  3O8Y A;  3LTA A;  3V98 A;  1MWU A;  2MC8 A;  2Z6B A;  2KF6 A;  3EX9 A;  3ZFZ A;  4CJN A;  4GHO A;  1DVC A;  2HMN B;  2C11 A;  5AEW B;  1TTO A;  2F5M A;  3S67 A;  1V74 A;  1B2X A;  1T2I A;  4FMD A;  3CCJ 3;  3S29 A;  5IG3 A;  1VQK 3;  1OH0 A;  5AIF A;  1CYU A;  8RNT A;  4HM5 B;  2XRX B;  1BRI A;  1CYV A;  3KZT A;  3STD A;  2RNT A;  3EBY A;  3GSP A;  1TIJ A;  3V99 A;  1FGO A;  2CX0 A;  1HZ1 A;  3GAX A;  3G8Z A;  4O2H A;  3SYU A;  1IQX A;  3K5T A;  1M90 4;  1YIT 3;  1KSI A;  3FG3 A;  1JZD A;  3RGR A;  1ROA A;  4L8P A;  3SED A;  1RTU A;  2CW9 A;  2R4I A;  1JZO A;  2MF7 A;  4NRE A;  1Q7Y 4;  1VQL 3;  4HM7 B;  4XM4 A;  2P09 A;  5G2G A;  1K41 A;  2W9Q A;  1IV7 A;  1E3V A;  3MG3 A;  2J8X B;  3DGO A;  3NBR A;  1OAC A;  4HM6 B;  3NM2 A;  3WA3 A;  1ZS7 A;  3HX8 A;  3DGN A;  1FUW A;  1Q81 4;  3BNB A;  4BU4 A;  3WR2 A;  1IK3 A;  2KXG A;  1RGG A;  4K90 B;  5AYS C;  1GSP A;  4MJD A;  1E97 A;  3G16 A;  3JUO A;  3NBB A;  4RZM A;  4X2O A;  1BRH A;  4R1K A;  3X3Z A;  1ULI B;  2IY2 A;  3LTB A;  3E99 A;  1FYS A;  1HU9 A;  3UB1 A;  2W56 A;  4K1U A;  3NQY A;  1SIH A;  2R41 A;  5JPP A;  4EC6 A;  3X40 A;  1KWI A;  1A2K A;  5IEO A;  3HK4 A;  1UUG B;  3EE1 A;  1MWR A;  1FUS A;  1IV9 A;  1IVU A;  3MYT A;  1N8R 4;  3A76 A;  1CQS A;  1D6U A;  1IVX A;  2SAR A;  4J5G A; 
#chains in the Genus database with same CATH homology
 3A5E A;  1BSD A;  1ZGX A;  1BSC A;  1R4Y A;  4HOH A;  1DE3 A;  1LOY A;  3WHO A;  1CH0 A;  7RNT A;  3BIR A;  3HOH A;  1I2F A;  1RCL A;  5BU4 A;  2KF5 A;  1B2Z A;  1I0X A;  3BU4 A;  1A2P A;  3DH2 A;  3DGY A;  4J5K A;  1BAN A;  5RNT A;  1FZU A;  1X1X A;  1DET A;  1BOX A;  1GMR A;  1BRN L;  1GMP A;  1GOY A;  1IYY A;  1BNE A;  3AGN A;  1RHL A;  3KCH A;  1BVI A;  1AQZ A;  1GOU A;  1GOV A;  2F5W A;  1B2M A;  1PYL A;  2HOH A;  1RGH A;  1AY7 A;  1I2E A;  1C54 A;  2BIR A;  1RDS A;  1I0V A;  1RSN A;  1BRG A;  1LRA A;  1FUT A;  2KF3 A;  3Q3F A;  1BSB A;  2AAD A;  3D5G A;  1RGA A;  1B2U A;  7GSP A;  1BAO A;  1RMS A;  1B2S A;  1I2G A;  1B27 A;  3D4A A;  1I3F A;  2KAA A;  1LOW A;  1BIR A;  1B21 A;  1G02 A;  1I3I A;  1X1W A;  1GMQ A;  2KF6 A;  1JBS A;  4BIR A;  1BNF A;  4GHO A;  1BNS A;  1TTO A;  2F5M A;  1BNR A;  1B2X A;  1T2I A;  1TRP A;  2C4B A;  4RNT A;  1I70 A;  8RNT A;  1BRI A;  1X1Y A;  1BNI A;  2RNT A;  3GSP A;  6GSP A;  1BUJ A;  2RBI A;  1BSE A;  1HZ1 A;  1TRQ A;  1UCJ A;  1I8V A;  1RNT A;  3AHW A;  3SYU A;  1JBR A;  1LOV A;  2ZA4 A;  1BGS A;  1RGK A;  5GSP A;  1YVS A;  1B20 A;  2F56 A;  1RN1 A;  5HOH A;  1RTU A;  1RGF A;  1RGC A;  1B3S A;  1RN4 A;  1RGE A;  1T2H A;  1RNB A;  5BIR A;  1JBT A;  4HAA A;  1BRS A;  1UCL A;  1PY3 A;  1YNV X;  1HYF A;  4BU4 A;  3WR2 A;  2AAE A;  1RGG A;  1BRJ A;  1LNI A;  1GSP A;  1BRH A;  1MGW A;  1SAR A;  4GSP A;  3AHS A;  3RNT A;  3URP A;  9RNT A;  1FYS A;  1FW7 A;  1Q9E A;  1BSA A;  1RCK A;  1UCK A;  1YGW A;  1MGR A;  2BU4 A;  2KF4 A;  6RNT A;  1BU4 A;  2F4Y A;  1BRK A;  3D5I A;  1UCI A;  1BNG A;  3AGO A;  1BNJ A;  1FUS A;  1X1U A;  1RGL A;  1RLS A;  2GSP A;  2SAR A;  4J5G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...