3WR2A

Rnase po1 complexed with 3'gmp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
101
structure length
101
Chain Sequence
QTGVRSCNCAGRSFTGTDVTNAIRSARAGGSGNYPHVYNNFEGFSFSCTPTFFEFPVFRGSVYSGGSPGADRVIYDQSGRFCACLTHTGAPSTNGFVECRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanyl-specific ribonuclease Po1
publication title RNase Po1 complexed with 3'GMP
rcsb
source organism Pleurotus ostreatus
molecule tags Hydrolase
total genus 25
structure length 101
sequence length 101
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2014-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 3wr2A00
1JBTA 1RN1A 1BNSA 2F5MA 1B27A 1ZGXA 1BAOA 1TRPA 1FW7A 2F4YA 1LNIA 1BSEA 1GMQA 2BIRA 3DGYA 3AHWA 1FYSA 2KF4A 1RNBA 3DH2A 4BIRA 1B3SA 1B2ZA 1T2IA 2BU4A 1BNJA 1BRNL 3BU4A 1G02A 1C54A 1BRJA 1BNGA 1RTUA 1UCJA 4GSPA 1BIRA 1BNFA 4GHOA 2AAEA 1RGGA 3WHOA 1BRGA 2F56A 3D5GA 9RNTA 1RCLA 1FUTA 1UCLA 1I2GA 5BIRA 1GMPA 2KAAA 1RGHA 3Q3FA 1X1WA 2RBIA 2RNTA 2HOHA 1I8VA 1GOUA 1GSPA 7RNTA 1BSDA 2SARA 3D4AA 1RGFA 1HYFA 1YGWA 1LRAA 3HOHA 4J5KA 2C4BA 2KF6A 3URPA 1BUJA 1JBRA 1BNRA 1I0VA 1RGKA 1B21A 1GOVA 1RHLA 1LOYA 3RNTA 1I2FA 1BANA 1B2XA 1DETA 4BU4A 2ZA4A 1AY7A 1RDSA 1HZ1A 6GSPA 1T2HA 1PYLA 1A2PA 5RNTA 3AGOA 1YVSA 5BU4A 1RNTA 3BIRA 1IYYA 1RGAA 3SYUA 1BSCA 2F5WA 1MGWA 8RNTA 1RLSA 1RSNA 1RN4A 1TRQA 1BRHA 1BSBA 3AHSA 1I2EA 1BGSA 1LOVA 1I3IA 4RNTA 1DE3A 1RMSA 1FZUA 1I0XA 1B2UA 2GSPA 1Q9EA 1JBSA 1BNIA 5GSPA 1GOYA 1TTOA 1RGEA 1BRKA 3KCHA 1B20A 1BU4A 4HAAA 1BVIA 1X1UA 2KF5A 1I3FA 3GSPA 1YNVX 3D5IA 1PY3A 1X1YA 1GMRA 7GSPA 3A5EA 1MGRA 1UCIA 1FUSA 1SARA 4J5GA 1X1XA 1RCKA 1BNEA 1BRIA 2KF3A 1B2SA 6RNTA 1CH0A 2AADA 3WR2A 1BSAA 1B2MA 1AQZA 1RGLA 1BRSA 1LOWA 1RGCA 1UCKA 3AGNA 5HOHA 1R4YA 1BOXA 4HOHA 1I70A
chains in the Genus database with same CATH superfamily
1M904 1QJGA 1MNLA 1WMNA 3OXAA 1W4NA 5EVHA 5BXQA 3HI7A 5I97A 5IG3A 3MHEA 3I553 3CMA3 2L1SA 3NX0A 1M1XB 3SOAA 3E99A 5M1AA 4KVHA 2RCDA 2CG1A 3SLUA 3QK9A 3O8YA 3BNBA 5JBSA 3HIGA 3N54B 2XEPA 3DH2A 1N9EA 1B2ZA 1T2IA 1A67A 1GY5A 2W9QA 3H3HA 3ZG5A 4BTXA 4EV5A 3WA3A 4HBRA 2P38A 1G02A 2IY2A 2GU3A 4HM4B 4O8SA 2GU1A 3CCM3 1BRJA 1UUWB 2F86B 3FSDA 3RDEA 1K734 2WOHA 1UCJA 3S27A 1BIRA 4FMAA 4GHOA 1GS3A 3RGRA 3V92A 3WHOA 3U1WA 4TX4A 3UNLA 2P05A 4FCZA 9RNTA 2IMJA 1R4CA 1WQLB 3EN8A 2LQVA 3X3YA 4HM0B 3T0UA 1I2GA 3DMCA 1GMPA 4MMZB 4CJNA 1Q7HA 5TGNA 1TIJA 1AVKA 4HKVB 1OH0A 1NB5I 1VQL3 2E2VA 2IA7A 4FMBA 4BTYA 1V57A 1K9M4 8CHOA 2O9UX 3NXJA 2K54A 2INXA 3EC9A 3G6E3 3D9RA 1QVF2 4I5QA 4ZM8A 5DREA 1W5ZA 1TJDA 2KF6A 3Q90A 2WGOA 3FKAA 4J8TA 3NQZA 1DMMA 1MWUA 1B21A 1OUNA 5CLKA 1Q814 2XSHB 4NPBA 1I2FA 1B2XA 1IV9A 2Z77A 4KFEA 2ZA4A 3CPW2 5AI1A 5IW9A 1ISKA 1RDSA 1UGHI 2ZDJA 6GSPA 1PYLA 1T5YA 4R9LA 1G0TA 3NBBA 3S29A 1NNVA 4BTWA 4X2HA 3Q1CA 5AEUB 1OHPA 3PCRA 4GB5A 4ILFA 1MGWA 2P0XA 3PYJA 2OQEA 1RSNA 1BRHA 1OPYA 3WA2X 1VQ63 2I9WA 3Q2PA 3EB8A 1I3IA 2CKFB 3EE1A 3K63A 1FGRA 5KP4A 5BVBA 1I0XA 3DGOA 1Q9EA 2RSXA 1GYBA 2W04A 4KFDA 1GOYA 5CXOA 3B4OA 2OWPA 3KCHA 4N6TA 3FG3A 1BU4A 1B20A 5ELJA 1QAFA 1WNHA 1YJN3 4HM8B 1L5GB 1VQO3 4XBTA 1IDPA 5AYRB 4DKIA 4XBXA 3S67A 1DYUA 3WMDA 1NJI4 4U13A 3LTCA 1YNVX 1VQN3 1PY3A 2LYXA 3F8HA 3GZRA 3PXMA 4HZ9B 5M19A 1EA2A 1ULJB 1UW1A 5AYSC 3CC43 2CFKA 2A15A 1WMOA 3V99A 2K0MA 2XFSA 1YIT3 1ASKA 2YX9A 3N9HA 1Q40B 4AKYA 2OCTA 1NO3A 1JB2A 2CX0A 3QRDA 4K90B 1CH0A 3NQYA 1TFKA 1B2MA 1IK3A 3AGNA 1UCKA 2JQ5A 1LOWA 3MPHA 1G96A 5HOHA 3F7XA 1EUIC 3LZAA 1GD3A 3ALAA 1Q40A 1I70A 2F56A 1GY7A 2CG0A 1DMQA 2K3DA 1KSIA 3DGMA 1JBTA 1OGXA 1BNSA 1RN1A 1SIHA 4FMDA 2CWTA 1ZGXA 2GBXB 4K1VA 3ZG0A 2F4YA 3K9MC 1BSEA 1NDOB 1UI8A 1YI23 4XDWA 2BIRA 3DGYA 2HMJB 1A2KA 4KZ1A 2QGUA 1RNBA 2BMQB 1RKYA 1JNQA 1MWRA 3X40A 2GEYA 4EXRA 1N9JA 3GAXA 3BU4A 3B4PA 1N8QA 2OQEC 5STDA 3WOFB 3G16A 1C54A 2HMLB 3KSPA 4WFOA 5IG5A 1DVDA 4FCJA 4FCMA 3H51A 1RTUA 1IT7A 4EW5A 5JPUA 2ML6A 1BNFA 1VQP3 3S28A 3LT8A 4RNZA 4WYKB 1RGGA 2OTJ3 2ZHXB 5IEPA 3CCQ3 5AIGA 2OTL3 1ROVA 1AV4A 1VQ43 4N6NB 5AIIA 2GEXA 3LH4A 3BNEA 5IF6A 1QMAA 1UCLA 5G1LA 5D81A 4XBYA 5BIRA 1GD4A 1MOLA 3F14A 2XH9A 1CEWI 4HM2B 4EV2A 1X1WA 2XFTA 1AR0A 3FH1A 4WYKA 1VQ83 3CC23 2C11A 2HOHA 3BNCA 5JPPA 3HZPA 4EC6A 5D83A 7RNTA 1BUQA 4STDA 2IUJA 1STDA 2PZVA 4OUQA 3DM8A 1LRAA 1W6GA 3NM2A 3OWUA 3D79A 1LVNA 4J5KA 5G2GA 2E2TA 2CFGA 2L4VA 4CPKA 1JBRA 1MWSA 1EKMA 1I0VA 2BHMA 2O3OA 3ER7A 1IVWA 1IU7A 1DETA 3KIIA 2BO9B 3GWRA 1VQM3 3T8UA 3K7CA 1A2PA 1SPUA 2BMOB 1JB4A 1W02A 1YGEA 3RGAA 2P0MA 2HMMB 3MG2A 2KRTA 3SYUA 3X3ZA 1KWIA 1JN5B 4LMIA 3AMOB 5KP3A 2UUGC 8RNTA 3JUQA 1VQ53 2BMRB 5AIHA 1RN4A 2V1LA 1BGSA 2STDA 2HMNB 1FZUA 3IMAB 2Z7AA 1A90A 1B2UA 1JN5A 4IPBA 3AMOA 5IG4A 3KKGA 1D6ZA 3FGYA 2R41A 1VQK3 1Z1SA 4L7KA 4O02B 4LYLB 3S5CA 2D1WA 1KC84 3L0RA 2FNQA 4JF8A 5CF2A 1O7MB 2MF7A 5CF1A 1N5HA 3FF2A 1M1K4 1BVIA 4HM3B 3EHCA 1FGTA 1HKXA 3LMLA 1I3FA 1VQ93 1LQMB 2W0QA 1EG9B 1E3VA 4JRFA 1FUSA 1U8CB 1FGQA 4J5GA 2W6JH 3JUPA 3FLJA 1RCKA 2UGIA 3EBTA 3B7CA 2KF3A 1YJW3 1ZS7A 4K61A 3NV0B 2AADA 1AVLA 4RNYA 1YJ93 1IVXA 1RGLA 1CQSA 1O7HB 3EF8A 3FG4A 3PCSA 1IQXA 1K41A 3CCR3 4LGQA 2W03A 3BLZA 4N6UA 3NV0A 1OCVA 4L8OA 1A2VA 2HMKB 3GZXB 4FMCA 3EJVA 1GMQA 3FZWA 1QAKA 3AHWA 1WTHA 3NUVA 5LC6A 2Z6BA 2F99A 1FYSA 3CNXA 1DVCA 1YHQ3 3NM7A 3F9SA 7STDA 4WP5A 3JUMA 1ZO2A 1B3SA 1O7GB 1W7CA 1ZX2A 4HM6B 2OOVA 4CCVA 1IQ8A 3CXC2 1BNJA 4J9AA 2H0HA 3CC73 1S5AA 2E2UA 3HK4A 4N6OB 1LXEA 3FF0A 1QVG2 3K0ZA 1S723 1M9GA 1E3RA 3FCSB 2AAEA 4FR9A 3CD63 1IT8A 2ML5A 4X2OA 3DGLA 3X41A 1VQQA 2RGQA 5AIFA 3UL5A 3D5GA 2Y74A 1NWWA 6STDA 1LQGC 2CW9A 2CWUA 1U5OA 2B1XB 1RGHA 4RZMA 5EQLA 3CCV3 2XGLA 4L8PA 2RBIA 1JB5A 4N6V0 1Y4KA 2PNCA 1W01A 1I8VA 1GOUA 1BSDA 2SARA 4LZIA 3VGNA 3X3XA 3F7SA 1Q824 1HYFA 1YGWA 2CX1A 2BT3A 4OK0A 3LXUX 5AEWB 1VZZA 3HOHA 3MG3A 3URPA 3OWYA 1BUJA 4HM7B 1YVBI 3DUKA 3STDA 5IENA 1RGKA 3DY5A 4NHFA 1RHLA 1LOYA 3RNTA 2C10A 3K5TA 1W6YA 1E97A 4HM5B 1V74A 3ROBA 2CFWA 1JJ22 1HZ1A 3CCJ3 1O7PB 1T2HA 3VSYA 1Q7Y4 1YVSA 3SEDA 3BB9A 5BU4A 1RNTA 3BIRA 3N8BA 5KP1A 1IYYA 4RBNA 2F5WA 3GZYB 1RLSA 3OX9A 3UB1A 1BSBA 4PEJA 4R9KA 5CK6A 1LOVA 1PU4A 3IJEB 1CYVA 4RNTA 1DE3A 3GRDA 2XR8B 3OV4A 4QWTA 1W2ZA 4O3VA 1LNHA 2WO0A 4MJDA 1PFPA 3EBYA 3OW22 3JUOA 2OOVC 3MYTA 2IYJA 1UUVB 3CPOA 3U97A 1RGEA 2GXFA 2SBLA 2QIYA 1RRLA 1LOXA 1TUHA 2FXTA 3JUNA 4HVNA 4HZBB 4OVMA 1JZOA 2XGNA 4I4KA 3LOYA 3VF1A 3GSPA 3NBRA 2WGQA 1X1YA 3IPTA 3X42A 2F98A 1VQ73 1UDII 1FGMA 3F40A 5ELUA 5IERA 3DGNA 3UL6A 1SARA 3CCE3 1KQS2 5HGRA 3HX8A 2YFLB 5G1KA 1D6UA 2CFLA 3J7Yd 1KD14 1JKGB 4NREA 3MSOA 3PS8A 3DZLA 1EQKA 5FW5A 2RFRA 3OWSA 3NBJA 2CC3A 1BRIA 6RNTA 1B2SA 1OF5B 2CK3H 1OACA 3LT9A 4ORLA 3WR2A 1BSAA 2JDIH 3KE7A 4BL3A 1J2BA 3LTAA 2R4IA 1OHOA 4HYZA 3A76A 1JKGA 2Z76A 4R1KA 1CYUA 1BOXA 3KN4A 3PZWA 4HOHA 1YIJ3 1EEJA 4K1UA 1O7NB 3EQQB 2F5MA 1FA3A 3B8LA 1OF5A 1B27A 2W2CA 5A0OB 3EX9A 4MMXB 1BAOA 1TRPA 1FW7A 1LNIA 2WOFA 1ULIB 3FG1A 1IQYA 3DXOA 3F8XA 5LC7A 1IV7A 1WMPA 2KF4A 3T8NA 1T3BA 4BIRA 2KCDA 2CFDA 1TFOA 2BU4A 1RRHA 2FGTA 2B24B 5EEOA 1BRNL 3CU3A 1UUGB 1SJWA 2IUKA 4LSOA 3LTDA 1W2B2 1STFI 1BNGA 3HIIA 1Q864 4GSPA 5IG0A 1O7WB 2H0GA 4O2HA 5FGOA 3JVCA 3PGBA 1BRGA 1UGIA 2XSOB 3SX1A 1RCLA 3BNDA 2UX0A 1FUTA 1V58A 4HM1B 4XB5A 3G4S3 1UI7A 1TU5A 1OGZA 5M18A 2KAAA 3Q3FA 4IIAA 2YFJB 2RNTA 5IEOA 3MKIA 3WODG 3CME3 3LTBA 4G1MB 1GSPA 1SIIA 1GY6A 4XM4A 3D4AA 3D3LA 1RGFA 3ECFA 2MC8A 4AKZA 1K8A4 1JRQA 1TP6A 2CHCA 3SOYA 2D42A 3SXXA 4Q53A 2C4BA 1Q42A 2XRXB 1NB3I 2Y73A 1BNRA 3CNMA 3MWZA 4H3UA 1GOVA 4AEQA 3KSED 1BANA 3MG1A 4EBGA 1FGOA 4EYCA 2J8XB 4IT7A 4BU4A 2P09A 1AY7A 2KXGA 2XF3A 1IVUA 1IVVA 2CWVA 2H0IA 3AGOA 5RNTA 1ROAA 5D82A 1FUWA 1OHSA 1RGAA 4XDVA 2W56B 1BSCA 4N6MA 4CDLA 1TRQA 3AHSA 3M8CA 1I2EA 4N6LA 2QEX3 3I0YA 4HJLB 1RMSA 2GBWB 1HU9A 1W00A 3NHXA 3WOEB 2W56A 3TDGA 2GSPA 1JBSA 1BNIA 4H61A 4KFFA 3KZTA 1QALA 5GSPA 3CCS3 3ZFZA 2BNGA 2Q07A 1TTOA 1BRKA 1SQWA 2HMOB 3LYGA 4HAAA 4WWUC 4MEIA 2W9PA 3CCL3 5DRVA 4BL2A 1X1UA 2KF5A 2CH9A 3D5IA 3CCU3 4N3VA 1GMRA 7GSPA 3A5EA 1MWTA 1MGRA 1UCIA 2M7OA 2YFIB 4KT3B 1JV2B 2CIUA 1JZDA 1NU3A 2ZL8A 1X1XA 3UJMA 1DMNA 3EN1B 1RN7A 1N8R4 1US1A 3KFQC 1BNEA 4R4KA 3WDGB 1N5PA 1F8NA 3GZBA 4WHAA 3G713 1C7HA 4MMYB 3SVAA 3I563 1RJOA 1AQZA 1RGCA 1BRSA 3G0KA 4GL6A 1D6YA 1W6CA 3V98A 4LEHA 2QA43 4R80A 3G8ZA 1R4YA 1K28A
chains in the Genus database with same CATH topology
1JBTA 1RN1A 1BNSA 2F5MA 1B27A 1ZGXA 1BAOA 1TRPA 1FW7A 2F4YA 1LNIA 1BSEA 1GMQA 2BIRA 3DGYA 3AHWA 1FYSA 2KF4A 1RNBA 3DH2A 4BIRA 1B3SA 1B2ZA 1T2IA 2BU4A 1BNJA 1BRNL 3BU4A 1G02A 1C54A 1BRJA 1BNGA 1RTUA 1UCJA 4GSPA 1BIRA 1BNFA 4GHOA 2AAEA 1RGGA 3WHOA 1BRGA 2F56A 3D5GA 9RNTA 1RCLA 1FUTA 1UCLA 1I2GA 5BIRA 1GMPA 2KAAA 1RGHA 3Q3FA 1X1WA 2RBIA 2RNTA 2HOHA 1I8VA 1GOUA 1GSPA 7RNTA 1BSDA 2SARA 3D4AA 1RGFA 1HYFA 1YGWA 1LRAA 3HOHA 4J5KA 2C4BA 2KF6A 3URPA 1BUJA 1JBRA 1BNRA 1I0VA 1RGKA 1B21A 1GOVA 1RHLA 1LOYA 3RNTA 1I2FA 1BANA 1B2XA 1DETA 4BU4A 2ZA4A 1AY7A 1RDSA 1HZ1A 6GSPA 1T2HA 1PYLA 1A2PA 5RNTA 3AGOA 1YVSA 5BU4A 1RNTA 3BIRA 1IYYA 1RGAA 3SYUA 1BSCA 2F5WA 1MGWA 8RNTA 1RLSA 1RSNA 1RN4A 1TRQA 1BRHA 1BSBA 3AHSA 1I2EA 1BGSA 1LOVA 1I3IA 4RNTA 1DE3A 1RMSA 1FZUA 1I0XA 1B2UA 2GSPA 1Q9EA 1JBSA 1BNIA 5GSPA 1GOYA 1TTOA 1RGEA 1BRKA 3KCHA 1B20A 1BU4A 4HAAA 1BVIA 1X1UA 2KF5A 1I3FA 3GSPA 1YNVX 3D5IA 1PY3A 1X1YA 1GMRA 7GSPA 3A5EA 1MGRA 1UCIA 1FUSA 1SARA 4J5GA 1X1XA 1RCKA 1BNEA 1BRIA 2KF3A 1B2SA 6RNTA 1CH0A 2AADA 3WR2A 1BSAA 1B2MA 1AQZA 1RGLA 1BRSA 1LOWA 1RGCA 1UCKA 3AGNA 5HOHA 1R4YA 1BOXA 4HOHA 1I70A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JBT A;  1RN1 A;  1BNS A;  2F5M A;  1B27 A;  1ZGX A;  1BAO A;  1TRP A;  1FW7 A;  2F4Y A;  1LNI A;  1BSE A;  1GMQ A;  2BIR A;  3DGY A;  3AHW A;  1FYS A;  2KF4 A;  1RNB A;  3DH2 A;  4BIR A;  1B3S A;  1B2Z A;  1T2I A;  2BU4 A;  1BNJ A;  1BRN L;  3BU4 A;  1G02 A;  1C54 A;  1BRJ A;  1BNG A;  1RTU A;  1UCJ A;  4GSP A;  1BIR A;  1BNF A;  4GHO A;  2AAE A;  1RGG A;  3WHO A;  1BRG A;  2F56 A;  3D5G A;  9RNT A;  1RCL A;  1FUT A;  1UCL A;  1I2G A;  5BIR A;  1GMP A;  2KAA A;  1RGH A;  3Q3F A;  1X1W A;  2RBI A;  2RNT A;  2HOH A;  1I8V A;  1GOU A;  1GSP A;  7RNT A;  1BSD A;  2SAR A;  3D4A A;  1RGF A;  1HYF A;  1YGW A;  1LRA A;  3HOH A;  4J5K A;  2C4B A;  2KF6 A;  3URP A;  1BUJ A;  1JBR A;  1BNR A;  1I0V A;  1RGK A;  1B21 A;  1GOV A;  1RHL A;  1LOY A;  3RNT A;  1I2F A;  1BAN A;  1B2X A;  1DET A;  4BU4 A;  2ZA4 A;  1AY7 A;  1RDS A;  1HZ1 A;  6GSP A;  1T2H A;  1PYL A;  1A2P A;  5RNT A;  3AGO A;  1YVS A;  5BU4 A;  1RNT A;  3BIR A;  1IYY A;  1RGA A;  3SYU A;  1BSC A;  2F5W A;  1MGW A;  8RNT A;  1RLS A;  1RSN A;  1RN4 A;  1TRQ A;  1BRH A;  1BSB A;  3AHS A;  1I2E A;  1BGS A;  1LOV A;  1I3I A;  4RNT A;  1DE3 A;  1RMS A;  1FZU A;  1I0X A;  1B2U A;  2GSP A;  1Q9E A;  1JBS A;  1BNI A;  5GSP A;  1GOY A;  1TTO A;  1RGE A;  1BRK A;  3KCH A;  1B20 A;  1BU4 A;  4HAA A;  1BVI A;  1X1U A;  2KF5 A;  1I3F A;  3GSP A;  1YNV X;  3D5I A;  1PY3 A;  1X1Y A;  1GMR A;  7GSP A;  3A5E A;  1MGR A;  1UCI A;  1FUS A;  1SAR A;  4J5G A;  1X1X A;  1RCK A;  1BNE A;  1BRI A;  2KF3 A;  1B2S A;  6RNT A;  1CH0 A;  2AAD A;  3WR2 A;  1BSA A;  1B2M A;  1AQZ A;  1RGL A;  1BRS A;  1LOW A;  1RGC A;  1UCK A;  3AGN A;  5HOH A;  1R4Y A;  1BOX A;  4HOH A;  1I70 A; 
#chains in the Genus database with same CATH topology
 1M90 4;  1QJG A;  1MNL A;  1WMN A;  3OXA A;  1W4N A;  5EVH A;  5BXQ A;  3HI7 A;  5I97 A;  5IG3 A;  3MHE A;  3I55 3;  3CMA 3;  2L1S A;  3NX0 A;  1M1X B;  3SOA A;  3E99 A;  5M1A A;  4KVH A;  2RCD A;  2CG1 A;  3SLU A;  3QK9 A;  3O8Y A;  3BNB A;  5JBS A;  3HIG A;  3N54 B;  2XEP A;  3DH2 A;  1N9E A;  1B2Z A;  1T2I A;  1A67 A;  1GY5 A;  2W9Q A;  3H3H A;  3ZG5 A;  4BTX A;  4EV5 A;  3WA3 A;  4HBR A;  2P38 A;  1G02 A;  2IY2 A;  2GU3 A;  4HM4 B;  4O8S A;  2GU1 A;  3CCM 3;  1BRJ A;  1UUW B;  2F86 B;  3FSD A;  3RDE A;  1K73 4;  2WOH A;  1UCJ A;  3S27 A;  1BIR A;  4FMA A;  4GHO A;  1GS3 A;  3RGR A;  3V92 A;  3WHO A;  3U1W A;  4TX4 A;  3UNL A;  2P05 A;  4FCZ A;  9RNT A;  2IMJ A;  1R4C A;  1WQL B;  3EN8 A;  2LQV A;  3X3Y A;  4HM0 B;  3T0U A;  1I2G A;  3DMC A;  1GMP A;  4MMZ B;  4CJN A;  1Q7H A;  5TGN A;  1TIJ A;  1AVK A;  4HKV B;  1OH0 A;  1NB5 I;  1VQL 3;  2E2V A;  2IA7 A;  4FMB A;  4BTY A;  1V57 A;  1K9M 4;  8CHO A;  2O9U X;  3NXJ A;  2K54 A;  2INX A;  3EC9 A;  3G6E 3;  3D9R A;  1QVF 2;  4I5Q A;  4ZM8 A;  5DRE A;  1W5Z A;  1TJD A;  2KF6 A;  3Q90 A;  2WGO A;  3FKA A;  4J8T A;  3NQZ A;  1DMM A;  1MWU A;  1B21 A;  1OUN A;  5CLK A;  1Q81 4;  2XSH B;  4NPB A;  1I2F A;  1B2X A;  1IV9 A;  2Z77 A;  4KFE A;  2ZA4 A;  3CPW 2;  5AI1 A;  5IW9 A;  1ISK A;  1RDS A;  1UGH I;  2ZDJ A;  6GSP A;  1PYL A;  1T5Y A;  4R9L A;  1G0T A;  3NBB A;  3S29 A;  1NNV A;  4BTW A;  4X2H A;  3Q1C A;  5AEU B;  1OHP A;  3PCR A;  4GB5 A;  4ILF A;  1MGW A;  2P0X A;  3PYJ A;  2OQE A;  1RSN A;  1BRH A;  1OPY A;  3WA2 X;  1VQ6 3;  2I9W A;  3Q2P A;  3EB8 A;  1I3I A;  2CKF B;  3EE1 A;  3K63 A;  1FGR A;  5KP4 A;  5BVB A;  1I0X A;  3DGO A;  1Q9E A;  2RSX A;  1GYB A;  2W04 A;  4KFD A;  1GOY A;  5CXO A;  3B4O A;  2OWP A;  3KCH A;  4N6T A;  3FG3 A;  1BU4 A;  1B20 A;  5ELJ A;  1QAF A;  1WNH A;  1YJN 3;  4HM8 B;  1L5G B;  1VQO 3;  4XBT A;  1IDP A;  5AYR B;  4DKI A;  4XBX A;  3S67 A;  1DYU A;  3WMD A;  1NJI 4;  4U13 A;  3LTC A;  1YNV X;  1VQN 3;  1PY3 A;  2LYX A;  3F8H A;  3GZR A;  3PXM A;  4HZ9 B;  5M19 A;  1EA2 A;  1ULJ B;  1UW1 A;  5AYS C;  3CC4 3;  2CFK A;  2A15 A;  1WMO A;  3V99 A;  2K0M A;  2XFS A;  1YIT 3;  1ASK A;  2YX9 A;  3N9H A;  1Q40 B;  4AKY A;  2OCT A;  1NO3 A;  1JB2 A;  2CX0 A;  3QRD A;  4K90 B;  1CH0 A;  3NQY A;  1TFK A;  1B2M A;  1IK3 A;  3AGN A;  1UCK A;  2JQ5 A;  1LOW A;  3MPH A;  1G96 A;  5HOH A;  3F7X A;  1EUI C;  3LZA A;  1GD3 A;  3ALA A;  1Q40 A;  1I70 A;  2F56 A;  1GY7 A;  2CG0 A;  1DMQ A;  2K3D A;  1KSI A;  3DGM A;  1JBT A;  1OGX A;  1BNS A;  1RN1 A;  1SIH A;  4FMD A;  2CWT A;  1ZGX A;  2GBX B;  4K1V A;  3ZG0 A;  2F4Y A;  3K9M C;  1BSE A;  1NDO B;  1UI8 A;  1YI2 3;  4XDW A;  2BIR A;  3DGY A;  2HMJ B;  1A2K A;  4KZ1 A;  2QGU A;  1RNB A;  2BMQ B;  1RKY A;  1JNQ A;  1MWR A;  3X40 A;  2GEY A;  4EXR A;  1N9J A;  3GAX A;  3BU4 A;  3B4P A;  1N8Q A;  2OQE C;  5STD A;  3WOF B;  3G16 A;  1C54 A;  2HML B;  3KSP A;  4WFO A;  5IG5 A;  1DVD A;  4FCJ A;  4FCM A;  3H51 A;  1RTU A;  1IT7 A;  4EW5 A;  5JPU A;  2ML6 A;  1BNF A;  1VQP 3;  3S28 A;  3LT8 A;  4RNZ A;  4WYK B;  1RGG A;  2OTJ 3;  2ZHX B;  5IEP A;  3CCQ 3;  5AIG A;  2OTL 3;  1ROV A;  1AV4 A;  1VQ4 3;  4N6N B;  5AII A;  2GEX A;  3LH4 A;  3BNE A;  5IF6 A;  1QMA A;  1UCL A;  5G1L A;  5D81 A;  4XBY A;  5BIR A;  1GD4 A;  1MOL A;  3F14 A;  2XH9 A;  1CEW I;  4HM2 B;  4EV2 A;  1X1W A;  2XFT A;  1AR0 A;  3FH1 A;  4WYK A;  1VQ8 3;  3CC2 3;  2C11 A;  2HOH A;  3BNC A;  5JPP A;  3HZP A;  4EC6 A;  5D83 A;  7RNT A;  1BUQ A;  4STD A;  2IUJ A;  1STD A;  2PZV A;  4OUQ A;  3DM8 A;  1LRA A;  1W6G A;  3NM2 A;  3OWU A;  3D79 A;  1LVN A;  4J5K A;  5G2G A;  2E2T A;  2CFG A;  2L4V A;  4CPK A;  1JBR A;  1MWS A;  1EKM A;  1I0V A;  2BHM A;  2O3O A;  3ER7 A;  1IVW A;  1IU7 A;  1DET A;  3KII A;  2BO9 B;  3GWR A;  1VQM 3;  3T8U A;  3K7C A;  1A2P A;  1SPU A;  2BMO B;  1JB4 A;  1W02 A;  1YGE A;  3RGA A;  2P0M A;  2HMM B;  3MG2 A;  2KRT A;  3SYU A;  3X3Z A;  1KWI A;  1JN5 B;  4LMI A;  3AMO B;  5KP3 A;  2UUG C;  8RNT A;  3JUQ A;  1VQ5 3;  2BMR B;  5AIH A;  1RN4 A;  2V1L A;  1BGS A;  2STD A;  2HMN B;  1FZU A;  3IMA B;  2Z7A A;  1A90 A;  1B2U A;  1JN5 A;  4IPB A;  3AMO A;  5IG4 A;  3KKG A;  1D6Z A;  3FGY A;  2R41 A;  1VQK 3;  1Z1S A;  4L7K A;  4O02 B;  4LYL B;  3S5C A;  2D1W A;  1KC8 4;  3L0R A;  2FNQ A;  4JF8 A;  5CF2 A;  1O7M B;  2MF7 A;  5CF1 A;  1N5H A;  3FF2 A;  1M1K 4;  1BVI A;  4HM3 B;  3EHC A;  1FGT A;  1HKX A;  3LML A;  1I3F A;  1VQ9 3;  1LQM B;  2W0Q A;  1EG9 B;  1E3V A;  4JRF A;  1FUS A;  1U8C B;  1FGQ A;  4J5G A;  2W6J H;  3JUP A;  3FLJ A;  1RCK A;  2UGI A;  3EBT A;  3B7C A;  2KF3 A;  1YJW 3;  1ZS7 A;  4K61 A;  3NV0 B;  2AAD A;  1AVL A;  4RNY A;  1YJ9 3;  1IVX A;  1RGL A;  1CQS A;  1O7H B;  3EF8 A;  3FG4 A;  3PCS A;  1IQX A;  1K41 A;  3CCR 3;  4LGQ A;  2W03 A;  3BLZ A;  4N6U A;  3NV0 A;  1OCV A;  4L8O A;  1A2V A;  2HMK B;  3GZX B;  4FMC A;  3EJV A;  1GMQ A;  3FZW A;  1QAK A;  3AHW A;  1WTH A;  3NUV A;  5LC6 A;  2Z6B A;  2F99 A;  1FYS A;  3CNX A;  1DVC A;  1YHQ 3;  3NM7 A;  3F9S A;  7STD A;  4WP5 A;  3JUM A;  1ZO2 A;  1B3S A;  1O7G B;  1W7C A;  1ZX2 A;  4HM6 B;  2OOV A;  4CCV A;  1IQ8 A;  3CXC 2;  1BNJ A;  4J9A A;  2H0H A;  3CC7 3;  1S5A A;  2E2U A;  3HK4 A;  4N6O B;  1LXE A;  3FF0 A;  1QVG 2;  3K0Z A;  1S72 3;  1M9G A;  1E3R A;  3FCS B;  2AAE A;  4FR9 A;  3CD6 3;  1IT8 A;  2ML5 A;  4X2O A;  3DGL A;  3X41 A;  1VQQ A;  2RGQ A;  5AIF A;  3UL5 A;  3D5G A;  2Y74 A;  1NWW A;  6STD A;  1LQG C;  2CW9 A;  2CWU A;  1U5O A;  2B1X B;  1RGH A;  4RZM A;  5EQL A;  3CCV 3;  2XGL A;  4L8P A;  2RBI A;  1JB5 A;  4N6V 0;  1Y4K A;  2PNC A;  1W01 A;  1I8V A;  1GOU A;  1BSD A;  2SAR A;  4LZI A;  3VGN A;  3X3X A;  3F7S A;  1Q82 4;  1HYF A;  1YGW A;  2CX1 A;  2BT3 A;  4OK0 A;  3LXU X;  5AEW B;  1VZZ A;  3HOH A;  3MG3 A;  3URP A;  3OWY A;  1BUJ A;  4HM7 B;  1YVB I;  3DUK A;  3STD A;  5IEN A;  1RGK A;  3DY5 A;  4NHF A;  1RHL A;  1LOY A;  3RNT A;  2C10 A;  3K5T A;  1W6Y A;  1E97 A;  4HM5 B;  1V74 A;  3ROB A;  2CFW A;  1JJ2 2;  1HZ1 A;  3CCJ 3;  1O7P B;  1T2H A;  3VSY A;  1Q7Y 4;  1YVS A;  3SED A;  3BB9 A;  5BU4 A;  1RNT A;  3BIR A;  3N8B A;  5KP1 A;  1IYY A;  4RBN A;  2F5W A;  3GZY B;  1RLS A;  3OX9 A;  3UB1 A;  1BSB A;  4PEJ A;  4R9K A;  5CK6 A;  1LOV A;  1PU4 A;  3IJE B;  1CYV A;  4RNT A;  1DE3 A;  3GRD A;  2XR8 B;  3OV4 A;  4QWT A;  1W2Z A;  4O3V A;  1LNH A;  2WO0 A;  4MJD A;  1PFP A;  3EBY A;  3OW2 2;  3JUO A;  2OOV C;  3MYT A;  2IYJ A;  1UUV B;  3CPO A;  3U97 A;  1RGE A;  2GXF A;  2SBL A;  2QIY A;  1RRL A;  1LOX A;  1TUH A;  2FXT A;  3JUN A;  4HVN A;  4HZB B;  4OVM A;  1JZO A;  2XGN A;  4I4K A;  3LOY A;  3VF1 A;  3GSP A;  3NBR A;  2WGQ A;  1X1Y A;  3IPT A;  3X42 A;  2F98 A;  1VQ7 3;  1UDI I;  1FGM A;  3F40 A;  5ELU A;  5IER A;  3DGN A;  3UL6 A;  1SAR A;  3CCE 3;  1KQS 2;  5HGR A;  3HX8 A;  2YFL B;  5G1K A;  1D6U A;  2CFL A;  3J7Y d;  1KD1 4;  1JKG B;  4NRE A;  3MSO A;  3PS8 A;  3DZL A;  1EQK A;  5FW5 A;  2RFR A;  3OWS A;  3NBJ A;  2CC3 A;  1BRI A;  6RNT A;  1B2S A;  1OF5 B;  2CK3 H;  1OAC A;  3LT9 A;  4ORL A;  3WR2 A;  1BSA A;  2JDI H;  3KE7 A;  4BL3 A;  1J2B A;  3LTA A;  2R4I A;  1OHO A;  4HYZ A;  3A76 A;  1JKG A;  2Z76 A;  4R1K A;  1CYU A;  1BOX A;  3KN4 A;  3PZW A;  4HOH A;  1YIJ 3;  1EEJ A;  4K1U A;  1O7N B;  3EQQ B;  2F5M A;  1FA3 A;  3B8L A;  1OF5 A;  1B27 A;  2W2C A;  5A0O B;  3EX9 A;  4MMX B;  1BAO A;  1TRP A;  1FW7 A;  1LNI A;  2WOF A;  1ULI B;  3FG1 A;  1IQY A;  3DXO A;  3F8X A;  5LC7 A;  1IV7 A;  1WMP A;  2KF4 A;  3T8N A;  1T3B A;  4BIR A;  2KCD A;  2CFD A;  1TFO A;  2BU4 A;  1RRH A;  2FGT A;  2B24 B;  5EEO A;  1BRN L;  3CU3 A;  1UUG B;  1SJW A;  2IUK A;  4LSO A;  3LTD A;  1W2B 2;  1STF I;  1BNG A;  3HII A;  1Q86 4;  4GSP A;  5IG0 A;  1O7W B;  2H0G A;  4O2H A;  5FGO A;  3JVC A;  3PGB A;  1BRG A;  1UGI A;  2XSO B;  3SX1 A;  1RCL A;  3BND A;  2UX0 A;  1FUT A;  1V58 A;  4HM1 B;  4XB5 A;  3G4S 3;  1UI7 A;  1TU5 A;  1OGZ A;  5M18 A;  2KAA A;  3Q3F A;  4IIA A;  2YFJ B;  2RNT A;  5IEO A;  3MKI A;  3WOD G;  3CME 3;  3LTB A;  4G1M B;  1GSP A;  1SII A;  1GY6 A;  4XM4 A;  3D4A A;  3D3L A;  1RGF A;  3ECF A;  2MC8 A;  4AKZ A;  1K8A 4;  1JRQ A;  1TP6 A;  2CHC A;  3SOY A;  2D42 A;  3SXX A;  4Q53 A;  2C4B A;  1Q42 A;  2XRX B;  1NB3 I;  2Y73 A;  1BNR A;  3CNM A;  3MWZ A;  4H3U A;  1GOV A;  4AEQ A;  3KSE D;  1BAN A;  3MG1 A;  4EBG A;  1FGO A;  4EYC A;  2J8X B;  4IT7 A;  4BU4 A;  2P09 A;  1AY7 A;  2KXG A;  2XF3 A;  1IVU A;  1IVV A;  2CWV A;  2H0I A;  3AGO A;  5RNT A;  1ROA A;  5D82 A;  1FUW A;  1OHS A;  1RGA A;  4XDV A;  2W56 B;  1BSC A;  4N6M A;  4CDL A;  1TRQ A;  3AHS A;  3M8C A;  1I2E A;  4N6L A;  2QEX 3;  3I0Y A;  4HJL B;  1RMS A;  2GBW B;  1HU9 A;  1W00 A;  3NHX A;  3WOE B;  2W56 A;  3TDG A;  2GSP A;  1JBS A;  1BNI A;  4H61 A;  4KFF A;  3KZT A;  1QAL A;  5GSP A;  3CCS 3;  3ZFZ A;  2BNG A;  2Q07 A;  1TTO A;  1BRK A;  1SQW A;  2HMO B;  3LYG A;  4HAA A;  4WWU C;  4MEI A;  2W9P A;  3CCL 3;  5DRV A;  4BL2 A;  1X1U A;  2KF5 A;  2CH9 A;  3D5I A;  3CCU 3;  4N3V A;  1GMR A;  7GSP A;  3A5E A;  1MWT A;  1MGR A;  1UCI A;  2M7O A;  2YFI B;  4KT3 B;  1JV2 B;  2CIU A;  1JZD A;  1NU3 A;  2ZL8 A;  1X1X A;  3UJM A;  1DMN A;  3EN1 B;  1RN7 A;  1N8R 4;  1US1 A;  3KFQ C;  1BNE A;  4R4K A;  3WDG B;  1N5P A;  1F8N A;  3GZB A;  4WHA A;  3G71 3;  1C7H A;  4MMY B;  3SVA A;  3I56 3;  1RJO A;  1AQZ A;  1RGC A;  1BRS A;  3G0K A;  4GL6 A;  1D6Y A;  1W6C A;  3V98 A;  4LEH A;  2QA4 3;  4R80 A;  3G8Z A;  1R4Y A;  1K28 A; 
#chains in the Genus database with same CATH homology
 1JBT A;  1RN1 A;  1BNS A;  2F5M A;  1B27 A;  1ZGX A;  1BAO A;  1TRP A;  1FW7 A;  2F4Y A;  1LNI A;  1BSE A;  1GMQ A;  2BIR A;  3DGY A;  3AHW A;  1FYS A;  2KF4 A;  1RNB A;  3DH2 A;  4BIR A;  1B3S A;  1B2Z A;  1T2I A;  2BU4 A;  1BNJ A;  1BRN L;  3BU4 A;  1G02 A;  1C54 A;  1BRJ A;  1BNG A;  1RTU A;  1UCJ A;  4GSP A;  1BIR A;  1BNF A;  4GHO A;  2AAE A;  1RGG A;  3WHO A;  1BRG A;  2F56 A;  3D5G A;  9RNT A;  1RCL A;  1FUT A;  1UCL A;  1I2G A;  5BIR A;  1GMP A;  2KAA A;  1RGH A;  3Q3F A;  1X1W A;  2RBI A;  2RNT A;  2HOH A;  1I8V A;  1GOU A;  1GSP A;  7RNT A;  1BSD A;  2SAR A;  3D4A A;  1RGF A;  1HYF A;  1YGW A;  1LRA A;  3HOH A;  4J5K A;  2C4B A;  2KF6 A;  3URP A;  1BUJ A;  1JBR A;  1BNR A;  1I0V A;  1RGK A;  1B21 A;  1GOV A;  1RHL A;  1LOY A;  3RNT A;  1I2F A;  1BAN A;  1B2X A;  1DET A;  4BU4 A;  2ZA4 A;  1AY7 A;  1RDS A;  1HZ1 A;  6GSP A;  1T2H A;  1PYL A;  1A2P A;  5RNT A;  3AGO A;  1YVS A;  5BU4 A;  1RNT A;  3BIR A;  1IYY A;  1RGA A;  3SYU A;  1BSC A;  2F5W A;  1MGW A;  8RNT A;  1RLS A;  1RSN A;  1RN4 A;  1TRQ A;  1BRH A;  1BSB A;  3AHS A;  1I2E A;  1BGS A;  1LOV A;  1I3I A;  4RNT A;  1DE3 A;  1RMS A;  1FZU A;  1I0X A;  1B2U A;  2GSP A;  1Q9E A;  1JBS A;  1BNI A;  5GSP A;  1GOY A;  1TTO A;  1RGE A;  1BRK A;  3KCH A;  1B20 A;  1BU4 A;  4HAA A;  1BVI A;  1X1U A;  2KF5 A;  1I3F A;  3GSP A;  1YNV X;  3D5I A;  1PY3 A;  1X1Y A;  1GMR A;  7GSP A;  3A5E A;  1MGR A;  1UCI A;  1FUS A;  1SAR A;  4J5G A;  1X1X A;  1RCK A;  1BNE A;  1BRI A;  2KF3 A;  1B2S A;  6RNT A;  1CH0 A;  2AAD A;  3WR2 A;  1BSA A;  1B2M A;  1AQZ A;  1RGL A;  1BRS A;  1LOW A;  1RGC A;  1UCK A;  3AGN A;  5HOH A;  1R4Y A;  1BOX A;  4HOH A;  1I70 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...