3WR2A

Rnase po1 complexed with 3'gmp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
101
structure length
101
Chain Sequence
QTGVRSCNCAGRSFTGTDVTNAIRSARAGGSGNYPHVYNNFEGFSFSCTPTFFEFPVFRGSVYSGGSPGADRVIYDQSGRFCACLTHTGAPSTNGFVECRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanyl-specific ribonuclease Po1
publication title RNase Po1 complexed with 3'GMP
rcsb
source organism Pleurotus ostreatus
molecule tags Hydrolase
total genus 25
structure length 101
sequence length 101
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2014-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 3wr2A00
3AHSA 3HOHA 7GSPA 2F4YA 3D5IA 1JBRA 1BRSA 5GSPA 2RBIA 1GMPA 1BNSA 1T2IA 1ZGXA 4BIRA 1BAOA 1RSNA 1GMQA 5HOHA 3DGYA 1BNGA 1R4YA 1I2FA 7RNTA 1JBTA 2AAEA 1RCKA 4BU4A 1GOVA 1RNBA 1PY3A 2ZA4A 2SARA 1BSBA 1C54A 1BIRA 6RNTA 1B2XA 1CH0A 1TRQA 3BIRA 1I70A 1BSDA 1RGEA 1X1WA 3D5GA 2KF5A 2C4BA 1BSCA 1AY7A 1AQZA 1MGRA 1DETA 1LOYA 1A2PA 3URPA 1IYYA 1LOWA 1TTOA 4HAAA 1HZ1A 3RNTA 1LRAA 1GOYA 1BGSA 3WR2A 2BU4A 2GSPA 1RN4A 1BRGA 4RNTA 1BUJA 5RNTA 1G02A 1BU4A 1RGLA 1JBSA 2F5MA 1B3SA 3KCHA 1B2SA 1BSEA 1RTUA 1BANA 1BNIA 2KF3A 3AGNA 3AGOA 3A5EA 1FZUA 1X1YA 3Q3FA 5BIRA 1B2ZA 1YVSA 1RMSA 4J5KA 1TRPA 1DE3A 1RLSA 1I0VA 1LNIA 1BNJA 6GSPA 2F56A 3D4AA 4GSPA 1GMRA 1RGFA 8RNTA 1RGGA 1I0XA 4J5GA 1BNEA 1FUSA 1RGHA 1X1UA 1UCJA 2KF4A 2KF6A 1BRIA 1I3IA 1BRKA 2KAAA 1RGKA 1LOVA 1RNTA 2RNTA 2BIRA 1BRHA 1RCLA 3DH2A 1RN1A 1YNVX 1GSPA 1YGWA 1B2MA 1I8VA 1FUTA 1BOXA 1I3FA 1T2HA 3AHWA 1B21A 3WHOA 1GOUA 1Q9EA 5BU4A 1BSAA 1BNFA 1MGWA 1BRJA 1B20A 1RDSA 1FW7A 1UCKA 1SARA 1BRNL 2AADA 1UCLA 3SYUA 1I2EA 1BVIA 1B2UA 1RGAA 1RGCA 2F5WA 1PYLA 9RNTA 1X1XA 1I2GA 1UCIA 1B27A 3BU4A 3GSPA 1BNRA 1HYFA 4GHOA 4HOHA 2HOHA 1RHLA 1FYSA
chains in the Genus database with same CATH superfamily
1LNHA 3D5IA 1JBRA 5AIHA 5GSPA 1GMPA 1BNSA 3AMOA 1A67A 1RSNA 3UL5A 1FUWA 1QALA 2IYJA 3DGOA 2UGIA 3G4S3 3JUPA 1BNGA 4HVNA 3G8ZA 4BTYA 7RNTA 2R41A 1JB4A 1YIJ3 1IVUA 5A0OB 1C7HA 2CWTA 1FA3A 3EN1B 4ILFA 1VQM3 1C54A 3N9HA 2H0GA 1CYVA 1O7HB 1YIT3 3IPTA 1JB2A 1KC84 2YFLB 1N5PA 1E3RA 3FSDA 3F40A 2MF7A 5IG0A 3AMOB 4HM6B 1NNVA 1UW1A 4OUQA 1YJW3 3MWZA 2KF5A 1MWUA 2OOVA 5JPPA 1AY7A 2K3DA 1LOYA 1UI8A 1LOWA 1W2ZA 1ZO2A 2ZDJA 4KT3B 5CK6A 1NDOB 3RNTA 2IY2A 1O7WB 2RFRA 2HMLB 2BU4A 1S5AA 3QK9A 3N54B 1DYUA 1RJOA 3NQZA 4HM3B 1BRGA 1FGMA 5AIFA 4XBYA 2XH9A 4IT7A 2MC8A 5IF6A 2WGOA 3U97A 3NV0A 3SOAA 2OQEC 3KCHA 1B2SA 1IV7A 1IT7A 3A5EA 1UDII 3BNEA 3NBJA 4MMXB 1AVKA 4J8TA 1W00A 3SVAA 3CMA3 1GY7A 3DGNA 3Q3FA 5AI1A 2W9QA 4J5KA 2PZVA 4MJDA 1GY5A 2R4IA 1QAKA 5IEOA 4BTXA 2LYXA 5IEPA 3OX9A 5AYRB 3UL6A 3F8XA 1EG9B 1RLSA 1U8CB 3B8LA 1LNIA 1JZOA 1EA2A 1JRQA 2CIUA 2STDA 4O02B 4FMBA 6GSPA 3D4AA 5M18A 8RNTA 1RGFA 3QRDA 3G0KA 4KFEA 5IG5A 1RGGA 1CYUA 3NV0B 4J5GA 1N5HA 2BO9B 1QAFA 3LYGA 1EUIC 2KF4A 1BRIA 3RDEA 3X40A 2PNCA 2XFTA 4AEQA 1SIHA 3DZLA 1EKMA 3LH4A 4JF8A 5STDA 1S723 3X3ZA 1L5GB 1QJGA 1IQXA 3SXXA 1NB5I 4GL6A 3WMDA 4K90B 2OTJ3 1WNHA 1GOUA 1Q9EA 3CPOA 1HU9A 3NBBA 1FGTA 2L4VA 5BU4A 1UGHI 1V74A 3DM8A 2Z77A 3UNLA 3FG1A 4G1MB 1M1K4 1SIIA 3B4PA 3LZAA 1OGXA 1UCLA 2HMMB 3A76A 4XBTA 1B2UA 2E2UA 3FF0A 3PGBA 2OCTA 1RGAA 1ROAA 4KFDA 1RGCA 4EBGA 2H0IA 4NREA 2CG0A 4H61A 3WOFB 3X42A 3MKIA 3DMCA 3HIGA 1A90A 1N9JA 3NUVA 1IV9A 3BU4A 2XF3A 3KIIA 3SEDA 1BNRA 4HBRA 1MOLA 1E97A 2KRTA 4GHOA 3LT9A 2XSHB 1EQKA 1W02A 1RHLA 2FXTA 3SOYA 3AHSA 3HOHA 3NHXA 7GSPA 1PU4A 3JUOA 1N9EA 1FGRA 4RBNA 4BIRA 1BAOA 1JJ22 1YJN3 5FGOA 4I4KA 3J7Yd 1DVDA 3DGYA 4ORLA 1O7PB 3BNBA 1I2FA 4L8PA 1IDPA 2OWPA 5CF2A 1IK3A 5LC7A 1GOVA 2CH9A 1JZDA 2QA43 3NX0A 1N8R4 3IJEB 2CFKA 1NB3I 3I0YA 2HMKB 3SX1A 1BSBA 1MNLA 1YJ93 1BIRA 3LTBA 5JPUA 6RNTA 2JDIH 2I9WA 1CH0A 2CFDA 3BNCA 4FCMA 4HM2B 3H51A 3ZG0A 1BSDA 1HKXA 1D6ZA 1W7CA 3STDA 1X1WA 3FZWA 1NWWA 1JNQA 2ML5A 2CWVA 5DREA 2K54A 2RCDA 5AEWB 1VQ63 2UX0A 1TIJA 4LYLB 1LRAA 1VZZA 3OXAA 2P09A 1J2BA 1BGSA 2P05A 5ELUA 3WR2A 2BMQB 3VGNA 1IQ8A 4EXRA 3CCR3 1O7NB 2B24B 1DMMA 4FMAA 1VQ53 4WWUC 1G02A 2ML6A 1GS3A 2CFLA 4XM4A 3FKAA 1T5YA 4KVHA 2XGLA 1B3SA 4HZBB 1BSEA 2HMOB 1BANA 2CFWA 3AGNA 4H3UA 1SPUA 3EBTA 2Q07A 1FZUA 4XBXA 2GBWB 3LTDA 2OOVC 3S29A 2ZL8A 3FG4A 2GU3A 3LT8A 3F9SA 1TRPA 4L8OA 2IA7A 1VQO3 1OHSA 5I97A 2XRXB 3S67A 3K9MC 7STDA 2XR8B 1DE3A 1I0VA 1WMPA 3M8CA 3KSED 3VF1A 1K9M4 3I563 2HMJB 2IMJA 1Z1SA 4N6LA 4R4KA 5CXOA 3CCM3 1BNEA 1PFPA 1UI7A 3JUQA 4CJNA 1TUHA 1UCJA 1DMNA 1X1UA 3O8YA 4LMIA 2KF6A 2BT3A 4FCJA 2KAAA 1RGKA 1V57A 2W2CA 2Z7AA 1LOVA 2RNTA 4MMYB 5D83A 1O7GB 2FGTA 2KXGA 3B7CA 4IPBA 1SQWA 1W6YA 3KKGA 3PXMA 1YNVX 1GSPA 3K63A 2WGQA 1B2MA 3AHWA 1FUTA 1I3FA 1LOXA 1T2HA 4N6MA 3WHOA 2C11A 4DKIA 2WOFA 2CX1A 1MGWA 3LXUX 1B20A 3X3XA 3HK4A 3MPHA 3ROBA 4BL2A 1W2B2 1BRNL 1W6GA 4EV5A 1ISKA 1TFKA 1NU3A 4U13A 3OWSA 1KQS2 1I2EA 3HZPA 4BL3A 2ZHXB 4R1KA 2Z6BA 3B4OA 1TJDA 3Q1CA 5AYSC 2F5WA 2H0HA 1M9GA 4N6UA 3HI7A 5M1AA 2OTL3 1VQN3 3T0UA 9RNTA 4RNZA 1X1XA 4R80A 4NHFA 1AV4A 3Q2PA 3FF2A 3CME3 4N6V0 4FR9A 1IVWA 2GEXA 4EW5A 3TDGA 3D9RA 1DMQA 1X1YA 2CW9A 2O3OA 5TGNA 1VQL3 1UUVB 2SBLA 5M19A 4XDWA 1BRSA 1Q7Y4 2RBIA 2W0QA 4WHAA 1T2IA 1UUWB 1ZGXA 2IUKA 1A2KA 1O7MB 1ZX2A 3LOYA 3LMLA 1WMOA 1VQ73 1GMQA 1FGQA 3LTAA 2IUJA 1OH0A 3N8BA 5HOHA 1K8A4 5HGRA 1R4YA 1K41A 2GXFA 4BU4A 1OUNA 3CNMA 3GWRA 3S5CA 3CD63 5AIIA 2ZA4A 2SARA 1LQMB 3FCSB 3X3YA 1K734 2BMRB 1W4NA 4LGQA 1B2XA 5KP1A 3EE1A 3RGRA 1TRQA 2CKFB 4FCZA 4QWTA 5EQLA 3UB1A 1YHQ3 2RSXA 3D5GA 1STDA 4RNYA 3PCRA 1AQZA 1DETA 1IYYA 1A2PA 1F8NA 3F14A 3EQQB 1CEWI 5G1LA 4L7KA 1ULIB 1GOYA 4HM1B 1IT8A 5EEOA 1DVCA 5JBSA 3L0RA 4K1VA 1RN4A 2F99A 3CU3A 3V98A 5IG4A 1QVF2 4EYCA 3FLJA 3WA3A 1BUJA 1R4CA 1VQ43 1US1A 3NM2A 5RNTA 3OW22 3MG3A 1BU4A 3DUKA 3EX9A 4OK0A 1QMAA 1JBSA 2GEYA 3F7SA 1D6YA 1SJWA 3WOEB 2Y74A 2KF3A 1TFOA 3WDGB 3EB8A 2Y73A 3UJMA 1NJI4 2GBXB 2YFJB 3CNXA 2YFIB 1RKYA 3CC43 1BUQA 2V1LA 3HX8A 5BIRA 2P0MA 1MWRA 5FW5A 1YVSA 1JN5A 5AEUB 8CHOA 5KP3A 3CCE3 3JVCA 1FGOA 3NQYA 1IQYA 4X2HA 4O3VA 1UUGB 2F56A 3KN4A 3GZBA 4GSPA 4HKVB 3DXOA 3EC9A 1IVVA 4HM0B 4LEHA 4MEIA 4BTWA 3CCL3 1A2VA 1MWTA 4I5QA 3OWYA 5G1KA 1VQ93 3H3HA 1OHOA 3EF8A 4LZIA 4Q53A 4N3VA 4CCVA 1BRKA 1Q42A 3EJVA 3V92A 5EVHA 2BMOB 4FMDA 5CLKA 1RNTA 4WYKA 4N6OB 1JN5B 1RCLA 3OWUA 1RN1A 4LSOA 3T8NA 5BVBA 3BLZA 1MWSA 1BOXA 1QVG2 2A15A 1B21A 2CFGA 5D82A 1NO3A 2YX9A 4HM4B 4OVMA 1BSAA 3CCJ3 3KSPA 3MSOA 1Q40A 2F86B 2KCDA 1UCKA 1VQQA 1SARA 3PS8A 3EN8A 4JRFA 1W01A 3SYUA 2W56B 4HZ9B 1BVIA 4K1UA 2XSOB 4K61A 5LC6A 2INXA 1JKGA 4WYKB 1ZS7A 1RN7A 1WMNA 2JQ5A 3G713 4HM5B 1OF5A 1G96A 4PEJA 3HIIA 1ROVA 3JUNA 1OHPA 5IW9A 2Z76A 3DGLA 3JUMA 1YI23 4O8SA 3GSPA 3ZG5A 2W03A 1Q40B 1FYSA 3F8HA 4IIAA 1Q7HA 5G2GA 1TU5A 1YGEA 1VQK3 3GZXB 2F4YA 3MYTA 4R9LA 1IU7A 2CG1A 2LQVA 4AKYA 2E2VA 5DRVA 3GZRA 1JKGB 4R9KA 1Y4KA 3CC23 1WTHA 4CPKA 3G6E3 2XFSA 2J8XB 4STDA 1OF5B 3GZYB 2C10A 1K28A 1N8QA 2HMNB 3GAXA 5IG3A 1IVXA 1JBTA 1D6UA 1RCKA 2AAEA 1RNBA 3CCQ3 2CHCA 1KWIA 1PY3A 3ER7A 2XEPA 4FMCA 2WO0A 3NXJA 1Q814 3BB9A 2CWUA 4KZ1A 2OQEA 3NBRA 3S27A 3BIRA 1I70A 2UUGC 4WFOA 3CCU3 1RGEA 3MHEA 2F98A 1RRHA 3K0ZA 2C4BA 1BSCA 3ALAA 1MGRA 1Q824 1CQSA 3URPA 3KZTA 1TTOA 4HAAA 4CDLA 1HZ1A 1OPYA 1STFI 1E3VA 3D79A 1OGZA 4KFFA 4TX4A 4XB5A 3MG1A 3RGAA 2D1WA 2GSPA 1U5OA 3CC73 5ELJA 4RNTA 1V58A 3KFQC 2FNQA 4X2OA 1KD14 3CXC2 2RGQA 1GY6A 3EHCA 1Q864 4HM7B 1M1XB 1RGLA 3EBYA 3K7CA 1OCVA 2B1XB 2F5MA 3ECFA 3ZFZA 2D42A 1OACA 1RTUA 1BNIA 5AIGA 2W9PA 3AGOA 4ZM8A 2W6JH 3WA2X 3NM7A 5IENA 4AKZA 3I553 4EC6A 2E2TA 4RZMA 3CCS3 1B2ZA 3DY5A 1RMSA 3FG3A 3U1WA 1VQ83 3D3LA 4EV2A 1VQP3 1LQGC 3S28A 3LTCA 4NPBA 3PZWA 2P38A 1BNJA 1TP6A 3CPW2 1GD4A 1W5ZA 4XDVA 2XGNA 1GMRA 5BXQA 2O9UX 3E99A 3PCSA 1ASKA 1I0XA 1FUSA 4GB5A 5IERA 6STDA 1RGHA 5KP4A 1W6CA 3FH1A 3WODG 4J9AA 3DGMA 2CK3H 1I3IA 4MMZB 3CCV3 3G16A 5CF1A 3BNDA 2BNGA 4HM8B 4HJLB 2BIRA 1AR0A 1BRHA 3DH2A 3KE7A 1YGWA 1EEJA 3F7XA 3OV4A 5D81A 1I8VA 1LXEA 1YVBI 3SLUA 2CC3A 3V99A 2GU1A 1LVNA 2QIYA 3K5TA 3IMAB 3Q90A 1ULJB 2M7OA 1BNFA 1BRJA 1RDSA 2P0XA 1FW7A 1GYBA 2L1SA 3T8UA 2BHMA 2AADA 3VSYA 3MG2A 1AVLA 4HYZA 3GRDA 1M904 2W04A 4WP5A 1GD3A 1UGIA 3FGYA 1PYLA 4O2HA 2QEX3 2K0MA 1T3BA 1I2GA 2W56A 1UCIA 1G0TA 4N6TA 1B27A 2WOHA 2QGUA 2CX0A 1JV2B 1HYFA 1WQLB 3PYJA 4N6NB 4HOHA 1JB5A 2HOHA 1KSIA 3X41A 1RRLA
chains in the Genus database with same CATH topology
3AHSA 3HOHA 7GSPA 2F4YA 3D5IA 1JBRA 1BRSA 5GSPA 2RBIA 1GMPA 1BNSA 1T2IA 1ZGXA 4BIRA 1BAOA 1RSNA 1GMQA 5HOHA 3DGYA 1BNGA 1R4YA 1I2FA 7RNTA 1JBTA 2AAEA 1RCKA 4BU4A 1GOVA 1RNBA 1PY3A 2ZA4A 2SARA 1BSBA 1C54A 1BIRA 6RNTA 1B2XA 1CH0A 1TRQA 3BIRA 1I70A 1BSDA 1RGEA 1X1WA 3D5GA 2KF5A 2C4BA 1BSCA 1AY7A 1AQZA 1MGRA 1DETA 1LOYA 1A2PA 3URPA 1IYYA 1LOWA 1TTOA 4HAAA 1HZ1A 3RNTA 1LRAA 1GOYA 1BGSA 3WR2A 2BU4A 2GSPA 1RN4A 1BRGA 4RNTA 1BUJA 5RNTA 1G02A 1BU4A 1RGLA 1JBSA 2F5MA 1B3SA 3KCHA 1B2SA 1BSEA 1RTUA 1BANA 1BNIA 2KF3A 3AGNA 3AGOA 3A5EA 1FZUA 1X1YA 3Q3FA 5BIRA 1B2ZA 1YVSA 1RMSA 4J5KA 1TRPA 1DE3A 1RLSA 1I0VA 1LNIA 1BNJA 6GSPA 2F56A 3D4AA 4GSPA 1GMRA 1RGFA 8RNTA 1RGGA 1I0XA 4J5GA 1BNEA 1FUSA 1RGHA 1X1UA 1UCJA 2KF4A 2KF6A 1BRIA 1I3IA 1BRKA 2KAAA 1RGKA 1LOVA 1RNTA 2RNTA 2BIRA 1BRHA 1RCLA 3DH2A 1RN1A 1YNVX 1GSPA 1YGWA 1B2MA 1I8VA 1FUTA 1BOXA 1I3FA 1T2HA 3AHWA 1B21A 3WHOA 1GOUA 1Q9EA 5BU4A 1BSAA 1BNFA 1MGWA 1BRJA 1B20A 1RDSA 1FW7A 1UCKA 1SARA 1BRNL 2AADA 1UCLA 3SYUA 1I2EA 1BVIA 1B2UA 1RGAA 1RGCA 2F5WA 1PYLA 9RNTA 1X1XA 1I2GA 1UCIA 1B27A 3BU4A 3GSPA 1BNRA 1HYFA 4GHOA 4HOHA 2HOHA 1RHLA 1FYSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AHS A;  3HOH A;  7GSP A;  2F4Y A;  3D5I A;  1JBR A;  1BRS A;  5GSP A;  2RBI A;  1GMP A;  1BNS A;  1T2I A;  1ZGX A;  4BIR A;  1BAO A;  1RSN A;  1GMQ A;  5HOH A;  3DGY A;  1BNG A;  1R4Y A;  1I2F A;  7RNT A;  1JBT A;  2AAE A;  1RCK A;  4BU4 A;  1GOV A;  1RNB A;  1PY3 A;  2ZA4 A;  2SAR A;  1BSB A;  1C54 A;  1BIR A;  6RNT A;  1B2X A;  1CH0 A;  1TRQ A;  3BIR A;  1I70 A;  1BSD A;  1RGE A;  1X1W A;  3D5G A;  2KF5 A;  2C4B A;  1BSC A;  1AY7 A;  1AQZ A;  1MGR A;  1DET A;  1LOY A;  1A2P A;  3URP A;  1IYY A;  1LOW A;  1TTO A;  4HAA A;  1HZ1 A;  3RNT A;  1LRA A;  1GOY A;  1BGS A;  3WR2 A;  2BU4 A;  2GSP A;  1RN4 A;  1BRG A;  4RNT A;  1BUJ A;  5RNT A;  1G02 A;  1BU4 A;  1RGL A;  1JBS A;  2F5M A;  1B3S A;  3KCH A;  1B2S A;  1BSE A;  1RTU A;  1BAN A;  1BNI A;  2KF3 A;  3AGN A;  3AGO A;  3A5E A;  1FZU A;  1X1Y A;  3Q3F A;  5BIR A;  1B2Z A;  1YVS A;  1RMS A;  4J5K A;  1TRP A;  1DE3 A;  1RLS A;  1I0V A;  1LNI A;  1BNJ A;  6GSP A;  2F56 A;  3D4A A;  4GSP A;  1GMR A;  1RGF A;  8RNT A;  1RGG A;  1I0X A;  4J5G A;  1BNE A;  1FUS A;  1RGH A;  1X1U A;  1UCJ A;  2KF4 A;  2KF6 A;  1BRI A;  1I3I A;  1BRK A;  2KAA A;  1RGK A;  1LOV A;  1RNT A;  2RNT A;  2BIR A;  1BRH A;  1RCL A;  3DH2 A;  1RN1 A;  1YNV X;  1GSP A;  1YGW A;  1B2M A;  1I8V A;  1FUT A;  1BOX A;  1I3F A;  1T2H A;  3AHW A;  1B21 A;  3WHO A;  1GOU A;  1Q9E A;  5BU4 A;  1BSA A;  1BNF A;  1MGW A;  1BRJ A;  1B20 A;  1RDS A;  1FW7 A;  1UCK A;  1SAR A;  1BRN L;  2AAD A;  1UCL A;  3SYU A;  1I2E A;  1BVI A;  1B2U A;  1RGA A;  1RGC A;  2F5W A;  1PYL A;  9RNT A;  1X1X A;  1I2G A;  1UCI A;  1B27 A;  3BU4 A;  3GSP A;  1BNR A;  1HYF A;  4GHO A;  4HOH A;  2HOH A;  1RHL A;  1FYS A; 
#chains in the Genus database with same CATH topology
 1LNH A;  3D5I A;  1JBR A;  5AIH A;  5GSP A;  1GMP A;  1BNS A;  3AMO A;  1A67 A;  1RSN A;  3UL5 A;  1FUW A;  1QAL A;  2IYJ A;  3DGO A;  2UGI A;  3G4S 3;  3JUP A;  1BNG A;  4HVN A;  3G8Z A;  4BTY A;  7RNT A;  2R41 A;  1JB4 A;  1YIJ 3;  1IVU A;  5A0O B;  1C7H A;  2CWT A;  1FA3 A;  3EN1 B;  4ILF A;  1VQM 3;  1C54 A;  3N9H A;  2H0G A;  1CYV A;  1O7H B;  1YIT 3;  3IPT A;  1JB2 A;  1KC8 4;  2YFL B;  1N5P A;  1E3R A;  3FSD A;  3F40 A;  2MF7 A;  5IG0 A;  3AMO B;  4HM6 B;  1NNV A;  1UW1 A;  4OUQ A;  1YJW 3;  3MWZ A;  2KF5 A;  1MWU A;  2OOV A;  5JPP A;  1AY7 A;  2K3D A;  1LOY A;  1UI8 A;  1LOW A;  1W2Z A;  1ZO2 A;  2ZDJ A;  4KT3 B;  5CK6 A;  1NDO B;  3RNT A;  2IY2 A;  1O7W B;  2RFR A;  2HML B;  2BU4 A;  1S5A A;  3QK9 A;  3N54 B;  1DYU A;  1RJO A;  3NQZ A;  4HM3 B;  1BRG A;  1FGM A;  5AIF A;  4XBY A;  2XH9 A;  4IT7 A;  2MC8 A;  5IF6 A;  2WGO A;  3U97 A;  3NV0 A;  3SOA A;  2OQE C;  3KCH A;  1B2S A;  1IV7 A;  1IT7 A;  3A5E A;  1UDI I;  3BNE A;  3NBJ A;  4MMX B;  1AVK A;  4J8T A;  1W00 A;  3SVA A;  3CMA 3;  1GY7 A;  3DGN A;  3Q3F A;  5AI1 A;  2W9Q A;  4J5K A;  2PZV A;  4MJD A;  1GY5 A;  2R4I A;  1QAK A;  5IEO A;  4BTX A;  2LYX A;  5IEP A;  3OX9 A;  5AYR B;  3UL6 A;  3F8X A;  1EG9 B;  1RLS A;  1U8C B;  3B8L A;  1LNI A;  1JZO A;  1EA2 A;  1JRQ A;  2CIU A;  2STD A;  4O02 B;  4FMB A;  6GSP A;  3D4A A;  5M18 A;  8RNT A;  1RGF A;  3QRD A;  3G0K A;  4KFE A;  5IG5 A;  1RGG A;  1CYU A;  3NV0 B;  4J5G A;  1N5H A;  2BO9 B;  1QAF A;  3LYG A;  1EUI C;  2KF4 A;  1BRI A;  3RDE A;  3X40 A;  2PNC A;  2XFT A;  4AEQ A;  1SIH A;  3DZL A;  1EKM A;  3LH4 A;  4JF8 A;  5STD A;  1S72 3;  3X3Z A;  1L5G B;  1QJG A;  1IQX A;  3SXX A;  1NB5 I;  4GL6 A;  3WMD A;  4K90 B;  2OTJ 3;  1WNH A;  1GOU A;  1Q9E A;  3CPO A;  1HU9 A;  3NBB A;  1FGT A;  2L4V A;  5BU4 A;  1UGH I;  1V74 A;  3DM8 A;  2Z77 A;  3UNL A;  3FG1 A;  4G1M B;  1M1K 4;  1SII A;  3B4P A;  3LZA A;  1OGX A;  1UCL A;  2HMM B;  3A76 A;  4XBT A;  1B2U A;  2E2U A;  3FF0 A;  3PGB A;  2OCT A;  1RGA A;  1ROA A;  4KFD A;  1RGC A;  4EBG A;  2H0I A;  4NRE A;  2CG0 A;  4H61 A;  3WOF B;  3X42 A;  3MKI A;  3DMC A;  3HIG A;  1A90 A;  1N9J A;  3NUV A;  1IV9 A;  3BU4 A;  2XF3 A;  3KII A;  3SED A;  1BNR A;  4HBR A;  1MOL A;  1E97 A;  2KRT A;  4GHO A;  3LT9 A;  2XSH B;  1EQK A;  1W02 A;  1RHL A;  2FXT A;  3SOY A;  3AHS A;  3HOH A;  3NHX A;  7GSP A;  1PU4 A;  3JUO A;  1N9E A;  1FGR A;  4RBN A;  4BIR A;  1BAO A;  1JJ2 2;  1YJN 3;  5FGO A;  4I4K A;  3J7Y d;  1DVD A;  3DGY A;  4ORL A;  1O7P B;  3BNB A;  1I2F A;  4L8P A;  1IDP A;  2OWP A;  5CF2 A;  1IK3 A;  5LC7 A;  1GOV A;  2CH9 A;  1JZD A;  2QA4 3;  3NX0 A;  1N8R 4;  3IJE B;  2CFK A;  1NB3 I;  3I0Y A;  2HMK B;  3SX1 A;  1BSB A;  1MNL A;  1YJ9 3;  1BIR A;  3LTB A;  5JPU A;  6RNT A;  2JDI H;  2I9W A;  1CH0 A;  2CFD A;  3BNC A;  4FCM A;  4HM2 B;  3H51 A;  3ZG0 A;  1BSD A;  1HKX A;  1D6Z A;  1W7C A;  3STD A;  1X1W A;  3FZW A;  1NWW A;  1JNQ A;  2ML5 A;  2CWV A;  5DRE A;  2K54 A;  2RCD A;  5AEW B;  1VQ6 3;  2UX0 A;  1TIJ A;  4LYL B;  1LRA A;  1VZZ A;  3OXA A;  2P09 A;  1J2B A;  1BGS A;  2P05 A;  5ELU A;  3WR2 A;  2BMQ B;  3VGN A;  1IQ8 A;  4EXR A;  3CCR 3;  1O7N B;  2B24 B;  1DMM A;  4FMA A;  1VQ5 3;  4WWU C;  1G02 A;  2ML6 A;  1GS3 A;  2CFL A;  4XM4 A;  3FKA A;  1T5Y A;  4KVH A;  2XGL A;  1B3S A;  4HZB B;  1BSE A;  2HMO B;  1BAN A;  2CFW A;  3AGN A;  4H3U A;  1SPU A;  3EBT A;  2Q07 A;  1FZU A;  4XBX A;  2GBW B;  3LTD A;  2OOV C;  3S29 A;  2ZL8 A;  3FG4 A;  2GU3 A;  3LT8 A;  3F9S A;  1TRP A;  4L8O A;  2IA7 A;  1VQO 3;  1OHS A;  5I97 A;  2XRX B;  3S67 A;  3K9M C;  7STD A;  2XR8 B;  1DE3 A;  1I0V A;  1WMP A;  3M8C A;  3KSE D;  3VF1 A;  1K9M 4;  3I56 3;  2HMJ B;  2IMJ A;  1Z1S A;  4N6L A;  4R4K A;  5CXO A;  3CCM 3;  1BNE A;  1PFP A;  1UI7 A;  3JUQ A;  4CJN A;  1TUH A;  1UCJ A;  1DMN A;  1X1U A;  3O8Y A;  4LMI A;  2KF6 A;  2BT3 A;  4FCJ A;  2KAA A;  1RGK A;  1V57 A;  2W2C A;  2Z7A A;  1LOV A;  2RNT A;  4MMY B;  5D83 A;  1O7G B;  2FGT A;  2KXG A;  3B7C A;  4IPB A;  1SQW A;  1W6Y A;  3KKG A;  3PXM A;  1YNV X;  1GSP A;  3K63 A;  2WGQ A;  1B2M A;  3AHW A;  1FUT A;  1I3F A;  1LOX A;  1T2H A;  4N6M A;  3WHO A;  2C11 A;  4DKI A;  2WOF A;  2CX1 A;  1MGW A;  3LXU X;  1B20 A;  3X3X A;  3HK4 A;  3MPH A;  3ROB A;  4BL2 A;  1W2B 2;  1BRN L;  1W6G A;  4EV5 A;  1ISK A;  1TFK A;  1NU3 A;  4U13 A;  3OWS A;  1KQS 2;  1I2E A;  3HZP A;  4BL3 A;  2ZHX B;  4R1K A;  2Z6B A;  3B4O A;  1TJD A;  3Q1C A;  5AYS C;  2F5W A;  2H0H A;  1M9G A;  4N6U A;  3HI7 A;  5M1A A;  2OTL 3;  1VQN 3;  3T0U A;  9RNT A;  4RNZ A;  1X1X A;  4R80 A;  4NHF A;  1AV4 A;  3Q2P A;  3FF2 A;  3CME 3;  4N6V 0;  4FR9 A;  1IVW A;  2GEX A;  4EW5 A;  3TDG A;  3D9R A;  1DMQ A;  1X1Y A;  2CW9 A;  2O3O A;  5TGN A;  1VQL 3;  1UUV B;  2SBL A;  5M19 A;  4XDW A;  1BRS A;  1Q7Y 4;  2RBI A;  2W0Q A;  4WHA A;  1T2I A;  1UUW B;  1ZGX A;  2IUK A;  1A2K A;  1O7M B;  1ZX2 A;  3LOY A;  3LML A;  1WMO A;  1VQ7 3;  1GMQ A;  1FGQ A;  3LTA A;  2IUJ A;  1OH0 A;  3N8B A;  5HOH A;  1K8A 4;  5HGR A;  1R4Y A;  1K41 A;  2GXF A;  4BU4 A;  1OUN A;  3CNM A;  3GWR A;  3S5C A;  3CD6 3;  5AII A;  2ZA4 A;  2SAR A;  1LQM B;  3FCS B;  3X3Y A;  1K73 4;  2BMR B;  1W4N A;  4LGQ A;  1B2X A;  5KP1 A;  3EE1 A;  3RGR A;  1TRQ A;  2CKF B;  4FCZ A;  4QWT A;  5EQL A;  3UB1 A;  1YHQ 3;  2RSX A;  3D5G A;  1STD A;  4RNY A;  3PCR A;  1AQZ A;  1DET A;  1IYY A;  1A2P A;  1F8N A;  3F14 A;  3EQQ B;  1CEW I;  5G1L A;  4L7K A;  1ULI B;  1GOY A;  4HM1 B;  1IT8 A;  5EEO A;  1DVC A;  5JBS A;  3L0R A;  4K1V A;  1RN4 A;  2F99 A;  3CU3 A;  3V98 A;  5IG4 A;  1QVF 2;  4EYC A;  3FLJ A;  3WA3 A;  1BUJ A;  1R4C A;  1VQ4 3;  1US1 A;  3NM2 A;  5RNT A;  3OW2 2;  3MG3 A;  1BU4 A;  3DUK A;  3EX9 A;  4OK0 A;  1QMA A;  1JBS A;  2GEY A;  3F7S A;  1D6Y A;  1SJW A;  3WOE B;  2Y74 A;  2KF3 A;  1TFO A;  3WDG B;  3EB8 A;  2Y73 A;  3UJM A;  1NJI 4;  2GBX B;  2YFJ B;  3CNX A;  2YFI B;  1RKY A;  3CC4 3;  1BUQ A;  2V1L A;  3HX8 A;  5BIR A;  2P0M A;  1MWR A;  5FW5 A;  1YVS A;  1JN5 A;  5AEU B;  8CHO A;  5KP3 A;  3CCE 3;  3JVC A;  1FGO A;  3NQY A;  1IQY A;  4X2H A;  4O3V A;  1UUG B;  2F56 A;  3KN4 A;  3GZB A;  4GSP A;  4HKV B;  3DXO A;  3EC9 A;  1IVV A;  4HM0 B;  4LEH A;  4MEI A;  4BTW A;  3CCL 3;  1A2V A;  1MWT A;  4I5Q A;  3OWY A;  5G1K A;  1VQ9 3;  3H3H A;  1OHO A;  3EF8 A;  4LZI A;  4Q53 A;  4N3V A;  4CCV A;  1BRK A;  1Q42 A;  3EJV A;  3V92 A;  5EVH A;  2BMO B;  4FMD A;  5CLK A;  1RNT A;  4WYK A;  4N6O B;  1JN5 B;  1RCL A;  3OWU A;  1RN1 A;  4LSO A;  3T8N A;  5BVB A;  3BLZ A;  1MWS A;  1BOX A;  1QVG 2;  2A15 A;  1B21 A;  2CFG A;  5D82 A;  1NO3 A;  2YX9 A;  4HM4 B;  4OVM A;  1BSA A;  3CCJ 3;  3KSP A;  3MSO A;  1Q40 A;  2F86 B;  2KCD A;  1UCK A;  1VQQ A;  1SAR A;  3PS8 A;  3EN8 A;  4JRF A;  1W01 A;  3SYU A;  2W56 B;  4HZ9 B;  1BVI A;  4K1U A;  2XSO B;  4K61 A;  5LC6 A;  2INX A;  1JKG A;  4WYK B;  1ZS7 A;  1RN7 A;  1WMN A;  2JQ5 A;  3G71 3;  4HM5 B;  1OF5 A;  1G96 A;  4PEJ A;  3HII A;  1ROV A;  3JUN A;  1OHP A;  5IW9 A;  2Z76 A;  3DGL A;  3JUM A;  1YI2 3;  4O8S A;  3GSP A;  3ZG5 A;  2W03 A;  1Q40 B;  1FYS A;  3F8H A;  4IIA A;  1Q7H A;  5G2G A;  1TU5 A;  1YGE A;  1VQK 3;  3GZX B;  2F4Y A;  3MYT A;  4R9L A;  1IU7 A;  2CG1 A;  2LQV A;  4AKY A;  2E2V A;  5DRV A;  3GZR A;  1JKG B;  4R9K A;  1Y4K A;  3CC2 3;  1WTH A;  4CPK A;  3G6E 3;  2XFS A;  2J8X B;  4STD A;  1OF5 B;  3GZY B;  2C10 A;  1K28 A;  1N8Q A;  2HMN B;  3GAX A;  5IG3 A;  1IVX A;  1JBT A;  1D6U A;  1RCK A;  2AAE A;  1RNB A;  3CCQ 3;  2CHC A;  1KWI A;  1PY3 A;  3ER7 A;  2XEP A;  4FMC A;  2WO0 A;  3NXJ A;  1Q81 4;  3BB9 A;  2CWU A;  4KZ1 A;  2OQE A;  3NBR A;  3S27 A;  3BIR A;  1I70 A;  2UUG C;  4WFO A;  3CCU 3;  1RGE A;  3MHE A;  2F98 A;  1RRH A;  3K0Z A;  2C4B A;  1BSC A;  3ALA A;  1MGR A;  1Q82 4;  1CQS A;  3URP A;  3KZT A;  1TTO A;  4HAA A;  4CDL A;  1HZ1 A;  1OPY A;  1STF I;  1E3V A;  3D79 A;  1OGZ A;  4KFF A;  4TX4 A;  4XB5 A;  3MG1 A;  3RGA A;  2D1W A;  2GSP A;  1U5O A;  3CC7 3;  5ELJ A;  4RNT A;  1V58 A;  3KFQ C;  2FNQ A;  4X2O A;  1KD1 4;  3CXC 2;  2RGQ A;  1GY6 A;  3EHC A;  1Q86 4;  4HM7 B;  1M1X B;  1RGL A;  3EBY A;  3K7C A;  1OCV A;  2B1X B;  2F5M A;  3ECF A;  3ZFZ A;  2D42 A;  1OAC A;  1RTU A;  1BNI A;  5AIG A;  2W9P A;  3AGO A;  4ZM8 A;  2W6J H;  3WA2 X;  3NM7 A;  5IEN A;  4AKZ A;  3I55 3;  4EC6 A;  2E2T A;  4RZM A;  3CCS 3;  1B2Z A;  3DY5 A;  1RMS A;  3FG3 A;  3U1W A;  1VQ8 3;  3D3L A;  4EV2 A;  1VQP 3;  1LQG C;  3S28 A;  3LTC A;  4NPB A;  3PZW A;  2P38 A;  1BNJ A;  1TP6 A;  3CPW 2;  1GD4 A;  1W5Z A;  4XDV A;  2XGN A;  1GMR A;  5BXQ A;  2O9U X;  3E99 A;  3PCS A;  1ASK A;  1I0X A;  1FUS A;  4GB5 A;  5IER A;  6STD A;  1RGH A;  5KP4 A;  1W6C A;  3FH1 A;  3WOD G;  4J9A A;  3DGM A;  2CK3 H;  1I3I A;  4MMZ B;  3CCV 3;  3G16 A;  5CF1 A;  3BND A;  2BNG A;  4HM8 B;  4HJL B;  2BIR A;  1AR0 A;  1BRH A;  3DH2 A;  3KE7 A;  1YGW A;  1EEJ A;  3F7X A;  3OV4 A;  5D81 A;  1I8V A;  1LXE A;  1YVB I;  3SLU A;  2CC3 A;  3V99 A;  2GU1 A;  1LVN A;  2QIY A;  3K5T A;  3IMA B;  3Q90 A;  1ULJ B;  2M7O A;  1BNF A;  1BRJ A;  1RDS A;  2P0X A;  1FW7 A;  1GYB A;  2L1S A;  3T8U A;  2BHM A;  2AAD A;  3VSY A;  3MG2 A;  1AVL A;  4HYZ A;  3GRD A;  1M90 4;  2W04 A;  4WP5 A;  1GD3 A;  1UGI A;  3FGY A;  1PYL A;  4O2H A;  2QEX 3;  2K0M A;  1T3B A;  1I2G A;  2W56 A;  1UCI A;  1G0T A;  4N6T A;  1B27 A;  2WOH A;  2QGU A;  2CX0 A;  1JV2 B;  1HYF A;  1WQL B;  3PYJ A;  4N6N B;  4HOH A;  1JB5 A;  2HOH A;  1KSI A;  3X41 A;  1RRL A; 
#chains in the Genus database with same CATH homology
 3AHS A;  3HOH A;  7GSP A;  2F4Y A;  3D5I A;  1JBR A;  1BRS A;  5GSP A;  2RBI A;  1GMP A;  1BNS A;  1T2I A;  1ZGX A;  4BIR A;  1BAO A;  1RSN A;  1GMQ A;  5HOH A;  3DGY A;  1BNG A;  1R4Y A;  1I2F A;  7RNT A;  1JBT A;  2AAE A;  1RCK A;  4BU4 A;  1GOV A;  1RNB A;  1PY3 A;  2ZA4 A;  2SAR A;  1BSB A;  1C54 A;  1BIR A;  6RNT A;  1B2X A;  1CH0 A;  1TRQ A;  3BIR A;  1I70 A;  1BSD A;  1RGE A;  1X1W A;  3D5G A;  2KF5 A;  2C4B A;  1BSC A;  1AY7 A;  1AQZ A;  1MGR A;  1DET A;  1LOY A;  1A2P A;  3URP A;  1IYY A;  1LOW A;  1TTO A;  4HAA A;  1HZ1 A;  3RNT A;  1LRA A;  1GOY A;  1BGS A;  3WR2 A;  2BU4 A;  2GSP A;  1RN4 A;  1BRG A;  4RNT A;  1BUJ A;  5RNT A;  1G02 A;  1BU4 A;  1RGL A;  1JBS A;  2F5M A;  1B3S A;  3KCH A;  1B2S A;  1BSE A;  1RTU A;  1BAN A;  1BNI A;  2KF3 A;  3AGN A;  3AGO A;  3A5E A;  1FZU A;  1X1Y A;  3Q3F A;  5BIR A;  1B2Z A;  1YVS A;  1RMS A;  4J5K A;  1TRP A;  1DE3 A;  1RLS A;  1I0V A;  1LNI A;  1BNJ A;  6GSP A;  2F56 A;  3D4A A;  4GSP A;  1GMR A;  1RGF A;  8RNT A;  1RGG A;  1I0X A;  4J5G A;  1BNE A;  1FUS A;  1RGH A;  1X1U A;  1UCJ A;  2KF4 A;  2KF6 A;  1BRI A;  1I3I A;  1BRK A;  2KAA A;  1RGK A;  1LOV A;  1RNT A;  2RNT A;  2BIR A;  1BRH A;  1RCL A;  3DH2 A;  1RN1 A;  1YNV X;  1GSP A;  1YGW A;  1B2M A;  1I8V A;  1FUT A;  1BOX A;  1I3F A;  1T2H A;  3AHW A;  1B21 A;  3WHO A;  1GOU A;  1Q9E A;  5BU4 A;  1BSA A;  1BNF A;  1MGW A;  1BRJ A;  1B20 A;  1RDS A;  1FW7 A;  1UCK A;  1SAR A;  1BRN L;  2AAD A;  1UCL A;  3SYU A;  1I2E A;  1BVI A;  1B2U A;  1RGA A;  1RGC A;  2F5W A;  1PYL A;  9RNT A;  1X1X A;  1I2G A;  1UCI A;  1B27 A;  3BU4 A;  3GSP A;  1BNR A;  1HYF A;  4GHO A;  4HOH A;  2HOH A;  1RHL A;  1FYS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...