3RNTA

Crystal structure of guanosine-free ribonuclease t1, complexed with vanadate(v), suggests conformational change upon substrate binding
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE T1
publication title Crystal structure of guanosine-free ribonuclease T1, complexed with vanadate (V), suggests conformational change upon substrate binding.
pubmed doi rcsb
source organism Aspergillus oryzae
total genus 23
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1989-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 3rntA00
1X1WA 4GHOA 1UCLA 2F56A 1I8VA 1TRQA 1I2GA 1A2PA 1MGRA 5HOHA 1JBTA 3BU4A 1BGSA 1JBRA 4HOHA 1LRAA 1BAOA 1I0VA 1BRKA 1RGCA 3WR2A 1RGAA 1MGWA 1BUJA 1GMPA 1GSPA 2KAAA 1AQZA 2BU4A 2SARA 3AHSA 3KCHA 2KF3A 3D5GA 7RNTA 1BRJA 3SYUA 1I2FA 1RN4A 2AAEA 2F5MA 2HOHA 3WHOA 1B2ZA 1X1UA 1RGHA 1YGWA 1BVIA 1T2IA 3BIRA 1GMQA 1BNIA 5BIRA 1X1XA 1BNRA 1YVSA 1FUTA 1Q9EA 1I3IA 1LOVA 2F5WA 1PY3A 1FYSA 1TTOA 1RCLA 3AGNA 4RNTA 1RGFA 1RNBA 1HYFA 3URPA 1UCJA 1RGEA 5GSPA 2KF4A 1B27A 1RGKA 3D4AA 9RNTA 1BNSA 1RNTA 1B20A 2RBIA 1T2HA 1BSCA 1FW7A 1I70A 6RNTA 1RDSA 1ZGXA 1BSEA 2ZA4A 1BSBA 1JBSA 1PYLA 1X1YA 1RSNA 1FUSA 1HZ1A 1SARA 4J5KA 1RN1A 4J5GA 2KF6A 1GOUA 1I3FA 1LOYA 1RGLA 3DGYA 1BRHA 2C4BA 5BU4A 4HAAA 3RNTA 1BANA 3AGOA 1BRNL 1BSAA 1B3SA 7GSPA 1RCKA 3HOHA 1DE3A 1B2SA 1UCIA 3Q3FA 1BNEA 1BOXA 1FZUA 1GOYA 1C54A 4BIRA 1BRSA 4BU4A 1BNFA 2AADA 1RHLA 1BIRA 1I0XA 1RGGA 3A5EA 1B2XA 1RTUA 1BNGA 1BU4A 1IYYA 1BRGA 1AY7A 1G02A 2F4YA 1UCKA 2GSPA 4GSPA 1B2MA 1CH0A 1RLSA 5RNTA 1LOWA 3GSPA 3DH2A 1BNJA 6GSPA 1DETA 1BRIA 1BSDA 1B2UA 1TRPA 1GOVA 2RNTA 3AHWA 1GMRA 8RNTA 1B21A 1R4YA 1I2EA 1RMSA 1LNIA 2BIRA 1YNVX 2KF5A 3D5IA
chains in the Genus database with same CATH superfamily
1A2KA 3F40A 3WOEB 1UCLA 2CWVA 1VQM3 3I0YA 1I8VA 4WHAA 2JQ5A 1JBTA 3NX0A 5DRVA 5CF2A 2CHCA 1R4CA 3QRDA 5HOHA 2PNCA 3UL5A 3WA2X 3OX9A 1LRAA 1MWRA 4QWTA 5FGOA 3BNEA 4R4KA 3ZFZA 4HM5B 5CF1A 1VQ63 4N3VA 3X3YA 1RGCA 4X2OA 3WR2A 1ZS7A 2L1SA 1G96A 2INXA 4FCMA 1BUJA 1GMPA 1EKMA 3LH4A 4AEQA 4EV5A 2F99A 3AHSA 3CCU3 2OOVC 5I97A 2W56B 3FH1A 3SLUA 3NM2A 3WMDA 3PXMA 2IMJA 3IPTA 3JUPA 1T3BA 1YGEA 2P09A 3NV0B 1E3RA 1I2FA 2AAEA 4EBGA 2KCDA 5IEPA 1E97A 1JN5A 1O7WB 1UUGB 2RFRA 5ELUA 4XB5A 3L0RA 1T2IA 3MG3A 1V74A 1C7HA 1Q7Y4 1IU7A 5BIRA 2GU1A 4STDA 1X1XA 2BMOB 3NM7A 3SXXA 2SBLA 2STDA 1I3IA 1WMNA 1UGHI 1IVVA 1PY3A 1CYVA 2E2UA 4HZ9B 4L7KA 4Q53A 3DGNA 1QALA 2GEYA 1NB5I 4HYZA 1RCLA 3AGNA 3S29A 3SOAA 4XM4A 1JKGB 3DY5A 3JVCA 3LZAA 1VQQA 1HYFA 3JUQA 1F8NA 5GSPA 4NHFA 2KF4A 2UGIA 3BB9A 9RNTA 1YHQ3 1KC84 1YIT3 1IQXA 4J8TA 2D42A 4O3VA 2FGTA 2F98A 4WYKB 2M7OA 4XDVA 2YFLB 1RDSA 1OPYA 1ZGXA 2WO0A 3DUKA 3PCSA 3CCM3 2F86B 2CG1A 1M1XB 2XRXB 1K8A4 4OUQA 4I5QA 1JBSA 1OF5A 5IG4A 3FF2A 3LTBA 3FLJA 2HMLB 1Z1SA 3DGMA 3WOFB 3S28A 1DVDA 2OQEC 4J5GA 4N6TA 5JPPA 1I3FA 2HMMB 3NBJA 3DGOA 2CC3A 1IT8A 4TX4A 5IERA 4FMBA 3VGNA 2YX9A 1W2B2 2FNQA 3EN8A 1EG9B 1U5OA 1NDOB 3ZG0A 3MYTA 1RCKA 3HOHA 4EV2A 1ULIB 1BNEA 1GYBA 3ZG5A 3K9MC 1C54A 3S67A 5AEUB 3FG4A 3K5TA 1OHSA 3RDEA 4EW5A 2IUKA 2GU3A 3LOYA 3HI7A 3EX9A 1BNFA 3NXJA 1BIRA 2W56A 4HM3B 1MWSA 2W9PA 4RNZA 1QMAA 1AVKA 2CKFB 1JJ22 1MWTA 2OWPA 1BU4A 1CEWI 2ZDJA 3K7CA 3OWSA 1IYYA 5CXOA 3I553 1BRGA 1A2VA 3OW22 3MKIA 1V58A 4WFOA 1GD4A 3SOYA 3DH2A 5G2GA 2YFJB 4JRFA 3NBRA 1GY6A 2HMKB 3H3HA 1BSDA 1M1K4 3MSOA 1GOVA 3BLZA 1SPUA 3MG1A 1QJGA 2BNGA 1DMMA 2CX0A 2IUJA 1OCVA 3AHWA 1BUQA 3PS8A 1B21A 3LXUX 1ZX2A 1FA3A 2W6JH 5AEWB 1RMSA 4HBRA 2BIRA 4MEIA 2KF5A 4HM0B 2I9WA 1UGIA 3NBBA 2RCDA 1KWIA 1TRQA 2MF7A 3J7Yd 1MGRA 1A2PA 2C10A 3EJVA 1U8CB 4IIAA 1VQ43 2MC8A 1BGSA 4ORLA 1W6GA 3F7SA 3CD63 1K28A 1NNVA 1ZO2A 1M9GA 1MWUA 4FR9A 2CK3H 4AKYA 1IDPA 2B1XB 4CDLA 5AIIA 3JUNA 3EBYA 2XGNA 2XEPA 3E99A 1O7NB 4R1KA 3CCR3 1NO3A 1WQLB 1YJN3 1DYUA 3DMCA 2P0XA 1BRJA 3N8BA 4L8PA 1PU4A 4PEJA 5KP4A 3K63A 3NHXA 1WTHA 4O2HA 4BTYA 1GY5A 1YGWA 1Q40B 1D6ZA 1GMQA 3GZRA 2IY2A 4L8OA 5JBSA 2R4IA 3B4OA 3KSPA 1JZOA 1ROVA 3D79A 1TU5A 1Q42A 1LQGC 4CJNA 4EC6A 3MPHA 1LOVA 1Q9EA 1EA2A 3KZTA 4BL2A 3CCQ3 5G1LA 3M8CA 1UUVB 1FYSA 2P38A 1A67A 1RGFA 2OTL3 2IA7A 1VZZA 1RNBA 4AKZA 3D3LA 3EC9A 1VQP3 3HX8A 2CFLA 3D4AA 1N8QA 5M19A 1FGRA 4FMDA 1B20A 3G6E3 3EB8A 5CLKA 3LTAA 2RBIA 5AYSC 1BSCA 3RGAA 1FW7A 1WNHA 1W00A 4K1VA 4XBXA 3V99A 5IG3A 4RZMA 1PYLA 1OHOA 2CWTA 2WOHA 3MHEA 4CPKA 1JB4A 1ULJB 1FUSA 5D83A 3CCL3 3MG2A 3T0UA 3NUVA 2BMQB 3Q90A 1D6YA 1PFPA 1RN1A 3H51A 7RNTA 1RN7A 3V92A 4I4KA 3S27A 3AMOB 1W01A 1GS3A 2C4BA 1SIIA 1JNQA 3DGLA 3JUOA 4HM1B 5FW5A 3RNTA 5BU4A 1S723 3AGOA 2HMJB 3FZWA 2Z6BA 7GSPA 3I563 3DM8A 1M904 1UCIA 1JB2A 4HVNA 1OGXA 2W9QA 3CCJ3 1GY7A 2CFGA 1IK3A 4X2HA 2D1WA 2K0MA 4HM8B 5CK6A 4KFDA 4BIRA 1KD14 1HKXA 2PZVA 2OOVA 4LEHA 4ZM8A 3X40A 2P0MA 1RHLA 1NJI4 1FGTA 1RGGA 2CFKA 1B2XA 3A5EA 4O8SA 5IF6A 1RRHA 4FMAA 4NREA 2QEX3 5IEOA 1BNGA 3GRDA 4XBTA 1AY7A 1G02A 1EUIC 1UCKA 2CFDA 2F4YA 2J8XB 4KFFA 1SJWA 4N6V0 3PGBA 1NWWA 1W4NA 3GSPA 2CG0A 1BNJA 1DMNA 3WDGB 1FGMA 3FG3A 1LVNA 1LNHA 3KKGA 1A90A 1B2UA 1MNLA 3F8XA 3NQYA 3IMAB 4MMZB 4LYLB 1GMRA 8RNTA 3KIIA 3CC43 5BVBA 2XR8B 1R4YA 2GSPA 1QVG2 3D5IA 1IVUA 1HU9A 5G1KA 1NB3I 2F56A 2UX0A 1VQ93 2BO9B 1I2GA 3EBTA 5EVHA 2CX1A 3D9RA 3B7CA 1QAKA 3GAXA 4GB5A 3NV0A 4HOHA 2CH9A 1BAOA 1I0VA 1OUNA 4LZIA 1BRKA 2BT3A 3CNMA 1Q814 1YVBI 1RJOA 3CNXA 1OGZA 3Q1CA 3T8NA 1RGAA 1MGWA 2R41A 3HK4A 2Z76A 1W7CA 1AQZA 1US1A 2BU4A 2K3DA 3DXOA 3KCHA 4HKVB 1VQN3 4HM7B 2KXGA 1Y4KA 1TUHA 2CIUA 1VQ83 2KF3A 3D5GA 3LTDA 4N6OB 2OQEA 3LT9A 1RN4A 2F5MA 3B8LA 3WHOA 4OK0A 3GZBA 2IYJA 3B4PA 1FUWA 1RGHA 3Q2PA 1W6YA 3CME3 1BVIA 1JKGA 3LYGA 1BNIA 3FGYA 3ECFA 3V98A 1BNRA 1YVSA 1FUTA 2F5WA 1UUWB 1GD3A 3HIGA 1CYUA 1AVLA 5AIGA 3BNCA 3O8YA 4WYKA 5D81A 1IVWA 1TTOA 5STDA 4IT7A 4RNTA 3VSYA 1DMQA 4K90B 4LSOA 1Q7HA 3HZPA 1VQK3 2OTJ3 3URPA 3F8HA 2WGOA 3STDA 5IW9A 1UCJA 3N54B 1RGKA 2E2TA 4R80A 2H0GA 1IT7A 5AI1A 3SX1A 2XH9A 3CC73 2A15A 1T2HA 2WOFA 1I70A 2E2VA 2K54A 4HZBB 4FCZA 1L5GB 2Z77A 4BTXA 1D6UA 1O7GB 1X1YA 2GBWB 3G8ZA 1DVCA 1HZ1A 1RSNA 5EQLA 5LC7A 2Y73A 5IENA 3CC23 3NQZA 3KN4A 1SARA 3OXAA 4J5KA 5HGRA 3PCRA 1K734 3EN1B 2W2CA 2KF6A 1IQYA 3X3ZA 4OVMA 2Z7AA 3G4S3 3DGYA 1JRQA 4KVHA 1LQMB 2CFWA 1BANA 2XGLA 1O7MB 1OF5B 4MMXB 1BRNL 1ISKA 1UI8A 1DE3A 3QK9A 3JUMA 4FMCA 1VQ53 2QGUA 2W0QA 1BOXA 1GOYA 3GWRA 1TIJA 3KSED 4BL3A 1BRSA 4ILFA 4FCJA 2BMRB 1I0XA 3GZYB 4KZ1A 5AYRB 1EEJA 3FF0A 2QIYA 5BXQA 3GZXB 3ALAA 2C11A 3BNDA 4RNYA 2GBXB 3CCS3 1JB5A 5RNTA 1LOWA 6GSPA 4HM6B 1DETA 1Q824 2O3OA 1Q864 4H61A 1BRIA 3G16A 3LT8A 3S5CA 5KP3A 2KRTA 5DREA 3G0KA 3WODG 1EQKA 5AIHA 5TGNA 2Q07A 1STFI 3T8UA 6STDA 1YJW3 1O7HB 2W04A 1X1WA 2XF3A 2OCTA 4GHOA 2XFTA 1CQSA 1UDII 3CMA3 3G713 3FG1A 2QA43 3CU3A 1OACA 3BU4A 4BTWA 1K9M4 2RGQA 1JBRA 1MOLA 1STDA 1TJDA 2V1LA 4G1MB 3CPW2 1UW1A 4CCVA 1UI7A 2RSXA 1Q40A 4RBNA 4MJDA 1OHPA 1GSPA 2KAAA 4XBYA 1N9JA 1E3VA 2SARA 3EF8A 1AV4A 2FXTA 2GXFA 4KT3B 1KQS2 3SYUA 2HMNB 2HOHA 3KE7A 1B2ZA 5IG0A 3EE1A 4MMYB 1X1UA 2UUGC 5M18A 3WA3A 1FGQA 3FSDA 7STDA 3BIRA 2BHMA 1WMOA 1ASKA 4R9LA 1N5PA 5LC6A 2H0HA 1TFKA 3UL6A 3TDGA 1QAFA 2P05A 4HM2B 2XSHB 1SQWA 5M1AA 1IVXA 1WMPA 2XFSA 3KFQC 1JZDA 5AIFA 5ELJA 2L4VA 1N8R4 1J2BA 2HMOB 3U1WA 2JDIH 3U97A 1W2ZA 2GEXA 2WGQA 3MWZA 1G0TA 1TFOA 1N5HA 1SIHA 3OV4A 4HM4B 4K61A 1N9EA 1V57A 1LOXA 2ZHXB 1ROAA 4EXRA 1RGEA 2CW9A 3ER7A 1B27A 5IG5A 1BNSA 1RNTA 3HIIA 3F7XA 1YI23 1TP6A 3F14A 3UB1A 3VF1A 1IV9A 4LMIA 5A0OB 3CXC2 6RNTA 3F9SA 1YIJ3 3LTCA 3SVAA 8CHOA 3AMOA 1BSEA 2ZA4A 2ZL8A 4R9KA 1BSBA 4O02B 3X3XA 3PYJA 3ROBA 1OH0A 1VQO3 3UJMA 1IV7A 4EYCA 1JN5B 2B24B 1GOUA 1T5YA 1LOYA 1S5AA 1RGLA 2ML6A 4N6UA 1BRHA 1O7PB 3BNBA 2YFIB 4HAAA 2CWUA 3OWYA 2H0IA 1FGOA 3K0ZA 4HJLB 3RGRA 1BSAA 1B3SA 4K1UA 4DKIA 1B2SA 1NU3A 3Q3FA 1IQ8A 5EEOA 2W03A 1FZUA 2LQVA 3IJEB 3PZWA 4NPBA 5KP1A 3EQQB 1W02A 1W6CA 2LYXA 4LGQA 4BU4A 1K41A 3CCV3 2AADA 3OWUA 3X42A 3EHCA 4IPBA 1LXEA 3A76A 4H3UA 4U13A 1RTUA 3FCSB 3N9HA 3SEDA 3DZLA 2O9UX 1KSIA 4GSPA 1B2MA 4XDWA 2Y74A 1JV2B 4WWUC 1CH0A 1RLSA 5JPUA 4N6NB 4N6LA 1QVF2 4N6MA 5D82A 4GL6A 1TRPA 4J9AA 3X41A 4JF8A 2RNTA 2XSOB 3UNLA 1VQL3 4WP5A 1RKYA 4KFEA 3CCE3 3LMLA 2ML5A 1W5ZA 3FKAA 1YJ93 1I2EA 1AR0A 1LNIA 1VQ73 1RRLA 1YNVX 3CPOA
chains in the Genus database with same CATH topology
1X1WA 4GHOA 1UCLA 2F56A 1I8VA 1TRQA 1I2GA 1A2PA 1MGRA 5HOHA 1JBTA 3BU4A 1BGSA 1JBRA 4HOHA 1LRAA 1BAOA 1I0VA 1BRKA 1RGCA 3WR2A 1RGAA 1MGWA 1BUJA 1GMPA 1GSPA 2KAAA 1AQZA 2BU4A 2SARA 3AHSA 3KCHA 2KF3A 3D5GA 7RNTA 1BRJA 3SYUA 1I2FA 1RN4A 2AAEA 2F5MA 2HOHA 3WHOA 1B2ZA 1X1UA 1RGHA 1YGWA 1BVIA 1T2IA 3BIRA 1GMQA 1BNIA 5BIRA 1X1XA 1BNRA 1YVSA 1FUTA 1Q9EA 1I3IA 1LOVA 2F5WA 1PY3A 1FYSA 1TTOA 1RCLA 3AGNA 4RNTA 1RGFA 1RNBA 1HYFA 3URPA 1UCJA 1RGEA 5GSPA 2KF4A 1B27A 1RGKA 3D4AA 9RNTA 1BNSA 1RNTA 1B20A 2RBIA 1T2HA 1BSCA 1FW7A 1I70A 6RNTA 1RDSA 1ZGXA 1BSEA 2ZA4A 1BSBA 1JBSA 1PYLA 1X1YA 1RSNA 1FUSA 1HZ1A 1SARA 4J5KA 1RN1A 4J5GA 2KF6A 1GOUA 1I3FA 1LOYA 1RGLA 3DGYA 1BRHA 2C4BA 5BU4A 4HAAA 3RNTA 1BANA 3AGOA 1BRNL 1BSAA 1B3SA 7GSPA 1RCKA 3HOHA 1DE3A 1B2SA 1UCIA 3Q3FA 1BNEA 1BOXA 1FZUA 1GOYA 1C54A 4BIRA 1BRSA 4BU4A 1BNFA 2AADA 1RHLA 1BIRA 1I0XA 1RGGA 3A5EA 1B2XA 1RTUA 1BNGA 1BU4A 1IYYA 1BRGA 1AY7A 1G02A 2F4YA 1UCKA 2GSPA 4GSPA 1B2MA 1CH0A 1RLSA 5RNTA 1LOWA 3GSPA 3DH2A 1BNJA 6GSPA 1DETA 1BRIA 1BSDA 1B2UA 1TRPA 1GOVA 2RNTA 3AHWA 1GMRA 8RNTA 1B21A 1R4YA 1I2EA 1RMSA 1LNIA 2BIRA 1YNVX 2KF5A 3D5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X1W A;  4GHO A;  1UCL A;  2F56 A;  1I8V A;  1TRQ A;  1I2G A;  1A2P A;  1MGR A;  5HOH A;  1JBT A;  3BU4 A;  1BGS A;  1JBR A;  4HOH A;  1LRA A;  1BAO A;  1I0V A;  1BRK A;  1RGC A;  3WR2 A;  1RGA A;  1MGW A;  1BUJ A;  1GMP A;  1GSP A;  2KAA A;  1AQZ A;  2BU4 A;  2SAR A;  3AHS A;  3KCH A;  2KF3 A;  3D5G A;  7RNT A;  1BRJ A;  3SYU A;  1I2F A;  1RN4 A;  2AAE A;  2F5M A;  2HOH A;  3WHO A;  1B2Z A;  1X1U A;  1RGH A;  1YGW A;  1BVI A;  1T2I A;  3BIR A;  1GMQ A;  1BNI A;  5BIR A;  1X1X A;  1BNR A;  1YVS A;  1FUT A;  1Q9E A;  1I3I A;  1LOV A;  2F5W A;  1PY3 A;  1FYS A;  1TTO A;  1RCL A;  3AGN A;  4RNT A;  1RGF A;  1RNB A;  1HYF A;  3URP A;  1UCJ A;  1RGE A;  5GSP A;  2KF4 A;  1B27 A;  1RGK A;  3D4A A;  9RNT A;  1BNS A;  1RNT A;  1B20 A;  2RBI A;  1T2H A;  1BSC A;  1FW7 A;  1I70 A;  6RNT A;  1RDS A;  1ZGX A;  1BSE A;  2ZA4 A;  1BSB A;  1JBS A;  1PYL A;  1X1Y A;  1RSN A;  1FUS A;  1HZ1 A;  1SAR A;  4J5K A;  1RN1 A;  4J5G A;  2KF6 A;  1GOU A;  1I3F A;  1LOY A;  1RGL A;  3DGY A;  1BRH A;  2C4B A;  5BU4 A;  4HAA A;  3RNT A;  1BAN A;  3AGO A;  1BRN L;  1BSA A;  1B3S A;  7GSP A;  1RCK A;  3HOH A;  1DE3 A;  1B2S A;  1UCI A;  3Q3F A;  1BNE A;  1BOX A;  1FZU A;  1GOY A;  1C54 A;  4BIR A;  1BRS A;  4BU4 A;  1BNF A;  2AAD A;  1RHL A;  1BIR A;  1I0X A;  1RGG A;  3A5E A;  1B2X A;  1RTU A;  1BNG A;  1BU4 A;  1IYY A;  1BRG A;  1AY7 A;  1G02 A;  2F4Y A;  1UCK A;  2GSP A;  4GSP A;  1B2M A;  1CH0 A;  1RLS A;  5RNT A;  1LOW A;  3GSP A;  3DH2 A;  1BNJ A;  6GSP A;  1DET A;  1BRI A;  1BSD A;  1B2U A;  1TRP A;  1GOV A;  2RNT A;  3AHW A;  1GMR A;  8RNT A;  1B21 A;  1R4Y A;  1I2E A;  1RMS A;  1LNI A;  2BIR A;  1YNV X;  2KF5 A;  3D5I A; 
#chains in the Genus database with same CATH topology
 1A2K A;  3F40 A;  3WOE B;  1UCL A;  2CWV A;  1VQM 3;  3I0Y A;  1I8V A;  4WHA A;  2JQ5 A;  1JBT A;  3NX0 A;  5DRV A;  5CF2 A;  2CHC A;  1R4C A;  3QRD A;  5HOH A;  2PNC A;  3UL5 A;  3WA2 X;  3OX9 A;  1LRA A;  1MWR A;  4QWT A;  5FGO A;  3BNE A;  4R4K A;  3ZFZ A;  4HM5 B;  5CF1 A;  1VQ6 3;  4N3V A;  3X3Y A;  1RGC A;  4X2O A;  3WR2 A;  1ZS7 A;  2L1S A;  1G96 A;  2INX A;  4FCM A;  1BUJ A;  1GMP A;  1EKM A;  3LH4 A;  4AEQ A;  4EV5 A;  2F99 A;  3AHS A;  3CCU 3;  2OOV C;  5I97 A;  2W56 B;  3FH1 A;  3SLU A;  3NM2 A;  3WMD A;  3PXM A;  2IMJ A;  3IPT A;  3JUP A;  1T3B A;  1YGE A;  2P09 A;  3NV0 B;  1E3R A;  1I2F A;  2AAE A;  4EBG A;  2KCD A;  5IEP A;  1E97 A;  1JN5 A;  1O7W B;  1UUG B;  2RFR A;  5ELU A;  4XB5 A;  3L0R A;  1T2I A;  3MG3 A;  1V74 A;  1C7H A;  1Q7Y 4;  1IU7 A;  5BIR A;  2GU1 A;  4STD A;  1X1X A;  2BMO B;  3NM7 A;  3SXX A;  2SBL A;  2STD A;  1I3I A;  1WMN A;  1UGH I;  1IVV A;  1PY3 A;  1CYV A;  2E2U A;  4HZ9 B;  4L7K A;  4Q53 A;  3DGN A;  1QAL A;  2GEY A;  1NB5 I;  4HYZ A;  1RCL A;  3AGN A;  3S29 A;  3SOA A;  4XM4 A;  1JKG B;  3DY5 A;  3JVC A;  3LZA A;  1VQQ A;  1HYF A;  3JUQ A;  1F8N A;  5GSP A;  4NHF A;  2KF4 A;  2UGI A;  3BB9 A;  9RNT A;  1YHQ 3;  1KC8 4;  1YIT 3;  1IQX A;  4J8T A;  2D42 A;  4O3V A;  2FGT A;  2F98 A;  4WYK B;  2M7O A;  4XDV A;  2YFL B;  1RDS A;  1OPY A;  1ZGX A;  2WO0 A;  3DUK A;  3PCS A;  3CCM 3;  2F86 B;  2CG1 A;  1M1X B;  2XRX B;  1K8A 4;  4OUQ A;  4I5Q A;  1JBS A;  1OF5 A;  5IG4 A;  3FF2 A;  3LTB A;  3FLJ A;  2HML B;  1Z1S A;  3DGM A;  3WOF B;  3S28 A;  1DVD A;  2OQE C;  4J5G A;  4N6T A;  5JPP A;  1I3F A;  2HMM B;  3NBJ A;  3DGO A;  2CC3 A;  1IT8 A;  4TX4 A;  5IER A;  4FMB A;  3VGN A;  2YX9 A;  1W2B 2;  2FNQ A;  3EN8 A;  1EG9 B;  1U5O A;  1NDO B;  3ZG0 A;  3MYT A;  1RCK A;  3HOH A;  4EV2 A;  1ULI B;  1BNE A;  1GYB A;  3ZG5 A;  3K9M C;  1C54 A;  3S67 A;  5AEU B;  3FG4 A;  3K5T A;  1OHS A;  3RDE A;  4EW5 A;  2IUK A;  2GU3 A;  3LOY A;  3HI7 A;  3EX9 A;  1BNF A;  3NXJ A;  1BIR A;  2W56 A;  4HM3 B;  1MWS A;  2W9P A;  4RNZ A;  1QMA A;  1AVK A;  2CKF B;  1JJ2 2;  1MWT A;  2OWP A;  1BU4 A;  1CEW I;  2ZDJ A;  3K7C A;  3OWS A;  1IYY A;  5CXO A;  3I55 3;  1BRG A;  1A2V A;  3OW2 2;  3MKI A;  1V58 A;  4WFO A;  1GD4 A;  3SOY A;  3DH2 A;  5G2G A;  2YFJ B;  4JRF A;  3NBR A;  1GY6 A;  2HMK B;  3H3H A;  1BSD A;  1M1K 4;  3MSO A;  1GOV A;  3BLZ A;  1SPU A;  3MG1 A;  1QJG A;  2BNG A;  1DMM A;  2CX0 A;  2IUJ A;  1OCV A;  3AHW A;  1BUQ A;  3PS8 A;  1B21 A;  3LXU X;  1ZX2 A;  1FA3 A;  2W6J H;  5AEW B;  1RMS A;  4HBR A;  2BIR A;  4MEI A;  2KF5 A;  4HM0 B;  2I9W A;  1UGI A;  3NBB A;  2RCD A;  1KWI A;  1TRQ A;  2MF7 A;  3J7Y d;  1MGR A;  1A2P A;  2C10 A;  3EJV A;  1U8C B;  4IIA A;  1VQ4 3;  2MC8 A;  1BGS A;  4ORL A;  1W6G A;  3F7S A;  3CD6 3;  1K28 A;  1NNV A;  1ZO2 A;  1M9G A;  1MWU A;  4FR9 A;  2CK3 H;  4AKY A;  1IDP A;  2B1X B;  4CDL A;  5AII A;  3JUN A;  3EBY A;  2XGN A;  2XEP A;  3E99 A;  1O7N B;  4R1K A;  3CCR 3;  1NO3 A;  1WQL B;  1YJN 3;  1DYU A;  3DMC A;  2P0X A;  1BRJ A;  3N8B A;  4L8P A;  1PU4 A;  4PEJ A;  5KP4 A;  3K63 A;  3NHX A;  1WTH A;  4O2H A;  4BTY A;  1GY5 A;  1YGW A;  1Q40 B;  1D6Z A;  1GMQ A;  3GZR A;  2IY2 A;  4L8O A;  5JBS A;  2R4I A;  3B4O A;  3KSP A;  1JZO A;  1ROV A;  3D79 A;  1TU5 A;  1Q42 A;  1LQG C;  4CJN A;  4EC6 A;  3MPH A;  1LOV A;  1Q9E A;  1EA2 A;  3KZT A;  4BL2 A;  3CCQ 3;  5G1L A;  3M8C A;  1UUV B;  1FYS A;  2P38 A;  1A67 A;  1RGF A;  2OTL 3;  2IA7 A;  1VZZ A;  1RNB A;  4AKZ A;  3D3L A;  3EC9 A;  1VQP 3;  3HX8 A;  2CFL A;  3D4A A;  1N8Q A;  5M19 A;  1FGR A;  4FMD A;  1B20 A;  3G6E 3;  3EB8 A;  5CLK A;  3LTA A;  2RBI A;  5AYS C;  1BSC A;  3RGA A;  1FW7 A;  1WNH A;  1W00 A;  4K1V A;  4XBX A;  3V99 A;  5IG3 A;  4RZM A;  1PYL A;  1OHO A;  2CWT A;  2WOH A;  3MHE A;  4CPK A;  1JB4 A;  1ULJ B;  1FUS A;  5D83 A;  3CCL 3;  3MG2 A;  3T0U A;  3NUV A;  2BMQ B;  3Q90 A;  1D6Y A;  1PFP A;  1RN1 A;  3H51 A;  7RNT A;  1RN7 A;  3V92 A;  4I4K A;  3S27 A;  3AMO B;  1W01 A;  1GS3 A;  2C4B A;  1SII A;  1JNQ A;  3DGL A;  3JUO A;  4HM1 B;  5FW5 A;  3RNT A;  5BU4 A;  1S72 3;  3AGO A;  2HMJ B;  3FZW A;  2Z6B A;  7GSP A;  3I56 3;  3DM8 A;  1M90 4;  1UCI A;  1JB2 A;  4HVN A;  1OGX A;  2W9Q A;  3CCJ 3;  1GY7 A;  2CFG A;  1IK3 A;  4X2H A;  2D1W A;  2K0M A;  4HM8 B;  5CK6 A;  4KFD A;  4BIR A;  1KD1 4;  1HKX A;  2PZV A;  2OOV A;  4LEH A;  4ZM8 A;  3X40 A;  2P0M A;  1RHL A;  1NJI 4;  1FGT A;  1RGG A;  2CFK A;  1B2X A;  3A5E A;  4O8S A;  5IF6 A;  1RRH A;  4FMA A;  4NRE A;  2QEX 3;  5IEO A;  1BNG A;  3GRD A;  4XBT A;  1AY7 A;  1G02 A;  1EUI C;  1UCK A;  2CFD A;  2F4Y A;  2J8X B;  4KFF A;  1SJW A;  4N6V 0;  3PGB A;  1NWW A;  1W4N A;  3GSP A;  2CG0 A;  1BNJ A;  1DMN A;  3WDG B;  1FGM A;  3FG3 A;  1LVN A;  1LNH A;  3KKG A;  1A90 A;  1B2U A;  1MNL A;  3F8X A;  3NQY A;  3IMA B;  4MMZ B;  4LYL B;  1GMR A;  8RNT A;  3KII A;  3CC4 3;  5BVB A;  2XR8 B;  1R4Y A;  2GSP A;  1QVG 2;  3D5I A;  1IVU A;  1HU9 A;  5G1K A;  1NB3 I;  2F56 A;  2UX0 A;  1VQ9 3;  2BO9 B;  1I2G A;  3EBT A;  5EVH A;  2CX1 A;  3D9R A;  3B7C A;  1QAK A;  3GAX A;  4GB5 A;  3NV0 A;  4HOH A;  2CH9 A;  1BAO A;  1I0V A;  1OUN A;  4LZI A;  1BRK A;  2BT3 A;  3CNM A;  1Q81 4;  1YVB I;  1RJO A;  3CNX A;  1OGZ A;  3Q1C A;  3T8N A;  1RGA A;  1MGW A;  2R41 A;  3HK4 A;  2Z76 A;  1W7C A;  1AQZ A;  1US1 A;  2BU4 A;  2K3D A;  3DXO A;  3KCH A;  4HKV B;  1VQN 3;  4HM7 B;  2KXG A;  1Y4K A;  1TUH A;  2CIU A;  1VQ8 3;  2KF3 A;  3D5G A;  3LTD A;  4N6O B;  2OQE A;  3LT9 A;  1RN4 A;  2F5M A;  3B8L A;  3WHO A;  4OK0 A;  3GZB A;  2IYJ A;  3B4P A;  1FUW A;  1RGH A;  3Q2P A;  1W6Y A;  3CME 3;  1BVI A;  1JKG A;  3LYG A;  1BNI A;  3FGY A;  3ECF A;  3V98 A;  1BNR A;  1YVS A;  1FUT A;  2F5W A;  1UUW B;  1GD3 A;  3HIG A;  1CYU A;  1AVL A;  5AIG A;  3BNC A;  3O8Y A;  4WYK A;  5D81 A;  1IVW A;  1TTO A;  5STD A;  4IT7 A;  4RNT A;  3VSY A;  1DMQ A;  4K90 B;  4LSO A;  1Q7H A;  3HZP A;  1VQK 3;  2OTJ 3;  3URP A;  3F8H A;  2WGO A;  3STD A;  5IW9 A;  1UCJ A;  3N54 B;  1RGK A;  2E2T A;  4R80 A;  2H0G A;  1IT7 A;  5AI1 A;  3SX1 A;  2XH9 A;  3CC7 3;  2A15 A;  1T2H A;  2WOF A;  1I70 A;  2E2V A;  2K54 A;  4HZB B;  4FCZ A;  1L5G B;  2Z77 A;  4BTX A;  1D6U A;  1O7G B;  1X1Y A;  2GBW B;  3G8Z A;  1DVC A;  1HZ1 A;  1RSN A;  5EQL A;  5LC7 A;  2Y73 A;  5IEN A;  3CC2 3;  3NQZ A;  3KN4 A;  1SAR A;  3OXA A;  4J5K A;  5HGR A;  3PCR A;  1K73 4;  3EN1 B;  2W2C A;  2KF6 A;  1IQY A;  3X3Z A;  4OVM A;  2Z7A A;  3G4S 3;  3DGY A;  1JRQ A;  4KVH A;  1LQM B;  2CFW A;  1BAN A;  2XGL A;  1O7M B;  1OF5 B;  4MMX B;  1BRN L;  1ISK A;  1UI8 A;  1DE3 A;  3QK9 A;  3JUM A;  4FMC A;  1VQ5 3;  2QGU A;  2W0Q A;  1BOX A;  1GOY A;  3GWR A;  1TIJ A;  3KSE D;  4BL3 A;  1BRS A;  4ILF A;  4FCJ A;  2BMR B;  1I0X A;  3GZY B;  4KZ1 A;  5AYR B;  1EEJ A;  3FF0 A;  2QIY A;  5BXQ A;  3GZX B;  3ALA A;  2C11 A;  3BND A;  4RNY A;  2GBX B;  3CCS 3;  1JB5 A;  5RNT A;  1LOW A;  6GSP A;  4HM6 B;  1DET A;  1Q82 4;  2O3O A;  1Q86 4;  4H61 A;  1BRI A;  3G16 A;  3LT8 A;  3S5C A;  5KP3 A;  2KRT A;  5DRE A;  3G0K A;  3WOD G;  1EQK A;  5AIH A;  5TGN A;  2Q07 A;  1STF I;  3T8U A;  6STD A;  1YJW 3;  1O7H B;  2W04 A;  1X1W A;  2XF3 A;  2OCT A;  4GHO A;  2XFT A;  1CQS A;  1UDI I;  3CMA 3;  3G71 3;  3FG1 A;  2QA4 3;  3CU3 A;  1OAC A;  3BU4 A;  4BTW A;  1K9M 4;  2RGQ A;  1JBR A;  1MOL A;  1STD A;  1TJD A;  2V1L A;  4G1M B;  3CPW 2;  1UW1 A;  4CCV A;  1UI7 A;  2RSX A;  1Q40 A;  4RBN A;  4MJD A;  1OHP A;  1GSP A;  2KAA A;  4XBY A;  1N9J A;  1E3V A;  2SAR A;  3EF8 A;  1AV4 A;  2FXT A;  2GXF A;  4KT3 B;  1KQS 2;  3SYU A;  2HMN B;  2HOH A;  3KE7 A;  1B2Z A;  5IG0 A;  3EE1 A;  4MMY B;  1X1U A;  2UUG C;  5M18 A;  3WA3 A;  1FGQ A;  3FSD A;  7STD A;  3BIR A;  2BHM A;  1WMO A;  1ASK A;  4R9L A;  1N5P A;  5LC6 A;  2H0H A;  1TFK A;  3UL6 A;  3TDG A;  1QAF A;  2P05 A;  4HM2 B;  2XSH B;  1SQW A;  5M1A A;  1IVX A;  1WMP A;  2XFS A;  3KFQ C;  1JZD A;  5AIF A;  5ELJ A;  2L4V A;  1N8R 4;  1J2B A;  2HMO B;  3U1W A;  2JDI H;  3U97 A;  1W2Z A;  2GEX A;  2WGQ A;  3MWZ A;  1G0T A;  1TFO A;  1N5H A;  1SIH A;  3OV4 A;  4HM4 B;  4K61 A;  1N9E A;  1V57 A;  1LOX A;  2ZHX B;  1ROA A;  4EXR A;  1RGE A;  2CW9 A;  3ER7 A;  1B27 A;  5IG5 A;  1BNS A;  1RNT A;  3HII A;  3F7X A;  1YI2 3;  1TP6 A;  3F14 A;  3UB1 A;  3VF1 A;  1IV9 A;  4LMI A;  5A0O B;  3CXC 2;  6RNT A;  3F9S A;  1YIJ 3;  3LTC A;  3SVA A;  8CHO A;  3AMO A;  1BSE A;  2ZA4 A;  2ZL8 A;  4R9K A;  1BSB A;  4O02 B;  3X3X A;  3PYJ A;  3ROB A;  1OH0 A;  1VQO 3;  3UJM A;  1IV7 A;  4EYC A;  1JN5 B;  2B24 B;  1GOU A;  1T5Y A;  1LOY A;  1S5A A;  1RGL A;  2ML6 A;  4N6U A;  1BRH A;  1O7P B;  3BNB A;  2YFI B;  4HAA A;  2CWU A;  3OWY A;  2H0I A;  1FGO A;  3K0Z A;  4HJL B;  3RGR A;  1BSA A;  1B3S A;  4K1U A;  4DKI A;  1B2S A;  1NU3 A;  3Q3F A;  1IQ8 A;  5EEO A;  2W03 A;  1FZU A;  2LQV A;  3IJE B;  3PZW A;  4NPB A;  5KP1 A;  3EQQ B;  1W02 A;  1W6C A;  2LYX A;  4LGQ A;  4BU4 A;  1K41 A;  3CCV 3;  2AAD A;  3OWU A;  3X42 A;  3EHC A;  4IPB A;  1LXE A;  3A76 A;  4H3U A;  4U13 A;  1RTU A;  3FCS B;  3N9H A;  3SED A;  3DZL A;  2O9U X;  1KSI A;  4GSP A;  1B2M A;  4XDW A;  2Y74 A;  1JV2 B;  4WWU C;  1CH0 A;  1RLS A;  5JPU A;  4N6N B;  4N6L A;  1QVF 2;  4N6M A;  5D82 A;  4GL6 A;  1TRP A;  4J9A A;  3X41 A;  4JF8 A;  2RNT A;  2XSO B;  3UNL A;  1VQL 3;  4WP5 A;  1RKY A;  4KFE A;  3CCE 3;  3LML A;  2ML5 A;  1W5Z A;  3FKA A;  1YJ9 3;  1I2E A;  1AR0 A;  1LNI A;  1VQ7 3;  1RRL A;  1YNV X;  3CPO A; 
#chains in the Genus database with same CATH homology
 1X1W A;  4GHO A;  1UCL A;  2F56 A;  1I8V A;  1TRQ A;  1I2G A;  1A2P A;  1MGR A;  5HOH A;  1JBT A;  3BU4 A;  1BGS A;  1JBR A;  4HOH A;  1LRA A;  1BAO A;  1I0V A;  1BRK A;  1RGC A;  3WR2 A;  1RGA A;  1MGW A;  1BUJ A;  1GMP A;  1GSP A;  2KAA A;  1AQZ A;  2BU4 A;  2SAR A;  3AHS A;  3KCH A;  2KF3 A;  3D5G A;  7RNT A;  1BRJ A;  3SYU A;  1I2F A;  1RN4 A;  2AAE A;  2F5M A;  2HOH A;  3WHO A;  1B2Z A;  1X1U A;  1RGH A;  1YGW A;  1BVI A;  1T2I A;  3BIR A;  1GMQ A;  1BNI A;  5BIR A;  1X1X A;  1BNR A;  1YVS A;  1FUT A;  1Q9E A;  1I3I A;  1LOV A;  2F5W A;  1PY3 A;  1FYS A;  1TTO A;  1RCL A;  3AGN A;  4RNT A;  1RGF A;  1RNB A;  1HYF A;  3URP A;  1UCJ A;  1RGE A;  5GSP A;  2KF4 A;  1B27 A;  1RGK A;  3D4A A;  9RNT A;  1BNS A;  1RNT A;  1B20 A;  2RBI A;  1T2H A;  1BSC A;  1FW7 A;  1I70 A;  6RNT A;  1RDS A;  1ZGX A;  1BSE A;  2ZA4 A;  1BSB A;  1JBS A;  1PYL A;  1X1Y A;  1RSN A;  1FUS A;  1HZ1 A;  1SAR A;  4J5K A;  1RN1 A;  4J5G A;  2KF6 A;  1GOU A;  1I3F A;  1LOY A;  1RGL A;  3DGY A;  1BRH A;  2C4B A;  5BU4 A;  4HAA A;  3RNT A;  1BAN A;  3AGO A;  1BRN L;  1BSA A;  1B3S A;  7GSP A;  1RCK A;  3HOH A;  1DE3 A;  1B2S A;  1UCI A;  3Q3F A;  1BNE A;  1BOX A;  1FZU A;  1GOY A;  1C54 A;  4BIR A;  1BRS A;  4BU4 A;  1BNF A;  2AAD A;  1RHL A;  1BIR A;  1I0X A;  1RGG A;  3A5E A;  1B2X A;  1RTU A;  1BNG A;  1BU4 A;  1IYY A;  1BRG A;  1AY7 A;  1G02 A;  2F4Y A;  1UCK A;  2GSP A;  4GSP A;  1B2M A;  1CH0 A;  1RLS A;  5RNT A;  1LOW A;  3GSP A;  3DH2 A;  1BNJ A;  6GSP A;  1DET A;  1BRI A;  1BSD A;  1B2U A;  1TRP A;  1GOV A;  2RNT A;  3AHW A;  1GMR A;  8RNT A;  1B21 A;  1R4Y A;  1I2E A;  1RMS A;  1LNI A;  2BIR A;  1YNV X;  2KF5 A;  3D5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...