3RNTA

Crystal structure of guanosine-free ribonuclease t1, complexed with vanadate(v), suggests conformational change upon substrate binding
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE T1
publication title Crystal structure of guanosine-free ribonuclease T1, complexed with vanadate (V), suggests conformational change upon substrate binding.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase(endoribonuclease)
total genus 23
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1989-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 3rntA00
4J5KA 1RN4A 1B3SA 1B2MA 1BNGA 1RGLA 1TRPA 1X1YA 1B2ZA 1X1UA 1RMSA 1BSAA 1GMRA 3AHSA 1RNBA 1A2PA 3BIRA 1RCLA 4GSPA 3BU4A 1BSBA 1I2GA 1RHLA 1RGFA 2AADA 1B2XA 1I3IA 4J5GA 2KF5A 1AQZA 2F4YA 3WHOA 1JBSA 1BRIA 1FUSA 1HYFA 1RGAA 9RNTA 1GOYA 1RGGA 1UCLA 2BU4A 4GHOA 1C54A 1BNEA 1BNSA 7RNTA 2HOHA 1LNIA 6RNTA 5GSPA 1PYLA 1GMQA 1UCJA 3DGYA 1YVSA 1LOWA 1RGKA 2ZA4A 1I0VA 1BNRA 1T2IA 1BSEA 1BRNL 4RNTA 1AY7A 1BANA 5RNTA 1B21A 1SARA 2BIRA 1LRAA 3URPA 1BIRA 1BSCA 1BSDA 1LOVA 1UCIA 1LOYA 1BAOA 1X1WA 1BOXA 2C4BA 1UCKA 1HZ1A 2F5WA 1R4YA 1X1XA 1IYYA 3D4AA 4BIRA 1BRJA 1I3FA 1RGHA 4HAAA 2F56A 1BNIA 1TRQA 8RNTA 1MGRA 1YNVX 1FW7A 1RGCA 6GSPA 1B2SA 3GSPA 1BRKA 2KAAA 1GSPA 3SYUA 1B20A 1RSNA 1BNFA 1YGWA 3KCHA 1FYSA 1PY3A 1BUJA 3D5GA 1RDSA 2KF4A 1JBRA 1BVIA 1BGSA 1RGEA 5HOHA 1MGWA 1RNTA 1FZUA 1ZGXA 5BIRA 1BRSA 1GMPA 1JBTA 3AGOA 1DE3A 2F5MA 1I2FA 1I2EA 3RNTA 3AGNA 3WR2A 1Q9EA 1TTOA 1RN1A 1B2UA 3D5IA 1RTUA 2KF6A 3A5EA 1RCKA 2AAEA 1I70A 2RBIA 1BRHA 7GSPA 1G02A 1I8VA 4HOHA 5BU4A 1BNJA 1T2HA 1BRGA 1I0XA 1GOUA 1RLSA 3DH2A 1GOVA 1FUTA 3HOHA 1BU4A 3AHWA 2SARA 1B27A 1CH0A 2GSPA 2KF3A 3Q3FA 2RNTA 1DETA 4BU4A
chains in the Genus database with same CATH superfamily
3HIIA 3T8NA 1RN4A 2JQ5A 3JUQA 3S29A 4OK0A 4WP5A 1VQL3 4MMXB 1X1YA 3HZPA 3NM2A 1RMSA 3KN4A 1KC84 1G0TA 2CKFB 3K7CA 3BIRA 1IVUA 3BU4A 1IV7A 1MNLA 1OHSA 2LYXA 3KSPA 4N6LA 3I553 4HM2B 2CH9A 3JUNA 1S5AA 2AADA 2CK3H 3M8CA 5KP1A 4HZBB 3KFQC 4J5GA 2XSHB 2OOVC 3JVCA 3WA3A 2KF5A 2C11A 3K9MC 3EC9A 4LSOA 1Q824 2PZVA 1QALA 3RGRA 1BRIA 2K0MA 1D6UA 5M1AA 3EB8A 3VGNA 3EN1B 1UCLA 4GHOA 1NNVA 1RN7A 3X41A 3KZTA 1YHQ3 3DGMA 3OW22 2KXGA 3V92A 3FG4A 5IG3A 3T0UA 2OQEC 1VQ73 2C10A 4AKZA 3FSDA 4STDA 1MWTA 1OCVA 3DGYA 1YVSA 2O9UX 1VQK3 3CCU3 1BNRA 1RJOA 2XGNA 2ZHXB 3I0YA 4FCMA 2GU3A 4RNTA 3G6E3 1DMNA 1ROVA 3B7CA 3EHCA 2Z76A 3UL6A 3CC43 1IDPA 3J7Yd 5G1LA 1LOVA 3LTDA 4HM8B 1N9JA 1HZ1A 5AEUB 1OPYA 4BIRA 1BRJA 3IMAB 1E3VA 1I3FA 3BB9A 3NM7A 2K3DA 1GY5A 1JKGB 3DZLA 1SIHA 1K9M4 2P0MA 3CC73 1VQ43 2LQVA 3LH4A 1M904 1O7GB 1IVXA 4L7KA 4LYLB 3X40A 1W02A 1ASKA 1A2KA 5CF2A 1Z1SA 3EJVA 6GSPA 5JBSA 3G0KA 3JUPA 3CCL3 1BRKA 5STDA 2BMOB 3EX9A 3GZRA 3OWSA 3CPW2 3FH1A 1Q7HA 3CCS3 1U5OA 2BMQB 1FGMA 2IY2A 2CX1A 5CF1A 1DYUA 1PY3A 1BUJA 2HMKB 1JNQA 1RDSA 3X3ZA 4EBGA 5FW5A 1JRQA 3N54B 1YJN3 4K90B 1BGSA 1RGEA 2P09A 3FG3A 5IENA 1W2B2 1OH0A 1JN5A 3WOEB 4NPBA 1FZUA 3B8LA 1JB2A 4MMZB 3KE7A 1N5HA 4HM5B 1BRSA 3U1WA 4BL2A 1GMPA 1NB5I 2W04A 4HJLB 3AGOA 4N6OB 2RSXA 2XFTA 1E3RA 2OOVA 4WYKB 1OUNA 2F5MA 3FKAA 3KSED 1BUQA 5AIIA 4KFEA 2KCDA 3RNTA 5IERA 3ECFA 2J8XB 3Q2PA 3CCR3 3Q1CA 3WR2A 1RRLA 2CX0A 1N5PA 4H61A 4HM4B 2K54A 5AEWB 3PYJA 1VQ83 4KFFA 5AIHA 3D5IA 1ROAA 1FGTA 5JPUA 3BNBA 1UGIA 3A5EA 3GRDA 3SEDA 2MC8A 1I70A 1M1K4 5D81A 2OQEA 1CQSA 1OHPA 1STDA 1OGZA 3T8UA 1UI8A 2BNGA 2E2VA 4FCJA 5DREA 3MPHA 1Q40B 4HOHA 1AVLA 4RBNA 1T2HA 1BRGA 4R80A 1LOXA 3DH2A 2QA43 3HIGA 3ALAA 3EQQB 1B27A 1CH0A 4OVMA 2GSPA 3F8HA 2RNTA 4BU4A 3FCSB 4J5KA 1W2ZA 1JZOA 3CCQ3 1QAKA 1O7NB 2UX0A 4N6V0 3G713 1GMRA 1W00A 1WMNA 3G8ZA 1A2PA 3GZBA 1T3BA 1SJWA 5KP3A 1LXEA 1IQYA 4R4KA 5IG5A 1VQO3 4LMIA 5A0OB 5KP4A 1O7PB 4EXRA 3EBTA 1U8CB 3F8XA 4FR9A 2XSOB 1EG9B 5CXOA 5FGOA 3WA2X 1V58A 1WQLB 4O2HA 3WHOA 2Z7AA 2CFKA 3ZG5A 3S28A 3PS8A 1YJW3 1G96A 1RGAA 3NQZA 4KFDA 3LT9A 2BU4A 1RGGA 4MMYB 3SVAA 4ORLA 3HI7A 1BNEA 2WGOA 3G16A 4FMBA 3STDA 4U13A 4CCVA 7RNTA 4IPBA 1JKGA 1WMPA 3VF1A 1Q814 3CNMA 4GB5A 3ZFZA 2OTJ3 2W03A 3K63A 3NBRA 2BHMA 2ZDJA 4JF8A 3OV4A 1GY7A 1DVDA 2YX9A 1OGXA 3L0RA 4CPKA 2CHCA 1T2IA 3LT8A 1BRNL 2CFWA 3F7SA 1VQ93 3JUMA 3O8YA 5BVBA 1FGOA 2E2UA 1LRAA 1A2VA 3URPA 1UUGB 1D6ZA 2CC3A 1BSDA 2C4BA 1UUVB 2F5WA 2GEYA 1R4YA 1IYYA 3AMOA 2KRTA 1PFPA 4FMCA 4HM0B 1IQXA 1RGHA 1KQS2 1GD3A 3KKGA 2RGQA 2F56A 1VQM3 1BNIA 3DM8A 5G1KA 1TRQA 8RNTA 1MGRA 4XBYA 3SXXA 1MWRA 3LYGA 3RDEA 1UW1A 1CYUA 1DMMA 3NUVA 1B2SA 3GSPA 2F99A 1GY6A 1W01A 1N9EA 1M9GA 1MWSA 2KAAA 4XM4A 1YGWA 2ML6A 2O3OA 1UI7A 3PCRA 3UJMA 1TFKA 4R9KA 4BTYA 3BLZA 1KWIA 1HU9A 1IV9A 2MF7A 1BVIA 1MOLA 3WDGB 3MYTA 4BTWA 1SPUA 3CXC2 3DY5A 1RKYA 1EUIC 4L8OA 5AYSC 1KD14 5AIFA 5IG0A 2IYJA 4R9LA 7STDA 3WMDA 1ISKA 1F8NA 5HGRA 2FNQA 1Q40A 1NJI4 4XBTA 3X3YA 1IQ8A 3D3LA 3EE1A 1K28A 1Q42A 1M1XB 2FGTA 1OHOA 2R4IA 5LC7A 2W56B 3AGNA 3H51A 3TDGA 3WOFB 1Q9EA 1RN1A 4GL6A 2RCDA 1IT8A 2KF6A 3MG2A 1YGEA 1N8R4 2AAEA 2FXTA 4HZ9B 3FGYA 1JV2B 3NV0A 4PEJA 1G02A 1O7HB 1W6GA 2HMJB 1NDOB 2V1LA 1IK3A 1TP6A 2PNCA 4K1VA 2OTL3 1LNHA 4ILFA 1FUWA 3BNCA 1FGRA 1SIIA 3SLUA 3AHWA 3F40A 2XR8B 1ZO2A 5IG4A 2D1WA 1FGQA 2W0QA 4CDLA 1B3SA 3JUOA 1B2MA 1QJGA 4KVHA 1BNGA 3OWYA 3EF8A 3A76A 1X1UA 1JJ22 1QAFA 4ZM8A 1STFI 1V74A 2ZL8A 3ER7A 3N8BA 5IW9A 1RNBA 2IMJA 2CG0A 4EV2A 1I2GA 4EW5A 1RHLA 1AVKA 1RGFA 1AR0A 1JB5A 2UUGC 2STDA 4HM1B 1D6YA 3FF2A 3CPOA 1AQZA 4EC6A 3DGLA 4FMDA 1L5GB 1HYFA 2IA7A 3ZG0A 9RNTA 2GEXA 1A90A 1GOYA 4DKIA 1NB3I 4I5QA 1JB4A 3B4PA 1YVBI 1VQN3 1ZS7A 1LNIA 5GSPA 3CCM3 3MHEA 1GMQA 1UCJA 2P05A 3BNEA 3G4S3 1GS3A 2GBXB 2P0XA 3SOYA 1LOWA 1RGKA 2ZA4A 3NX0A 3PCSA 5I97A 3CU3A 4HM3B 3CCV3 4FCZA 3DUKA 1SQWA 2CWUA 2R41A 1AY7A 4O8SA 4MJDA 2BIRA 3LZAA 1OF5B 1TIJA 3OWUA 1BIRA 1BSCA 1E97A 3S5CA 1PU4A 1UCIA 1BAOA 1X1WA 2Q07A 4LEHA 1UCKA 4O02B 3SX1A 4AKYA 3D4AA 4X2HA 1W6CA 4RNYA 4FMAA 4KT3B 3GZYB 2H0GA 3BNDA 3NBJA 2E2TA 1JZDA 3LMLA 5ELUA 5M18A 1RGCA 1US1A 3LTBA 2QGUA 4AEQA 3LTCA 1MWUA 4XBXA 4JRFA 3F9SA 4I4KA 3D79A 4LGQA 1GSPA 4WFOA 3HK4A 1WNHA 1UUWB 3KCHA 4XDWA 2W56A 5AIGA 5IEOA 3D9RA 1FYSA 3E99A 4RNZA 3D5GA 2KF4A 4G1MB 3QK9A 3X42A 3PZWA 1JBRA 4HM6B 1AV4A 2YFIB 1Y4KA 3WODG 3MWZA 5CK6A 1YI23 1A67A 2RFRA 1JBTA 5IF6A 1R4CA 1DE3A 3DXOA 2CWTA 1W4NA 3F7XA 1I2FA 4OUQA 4BL3A 2L1SA 2L4VA 2B1XB 1YIT3 1W5ZA 3GZXB 4WYKA 1Q864 1B2UA 3LXUX 1RTUA 3Q90A 1T5YA 2OWPA 3H3HA 4BTXA 4IT7A 2CFDA 1IU7A 2XGLA 1BRHA 3FZWA 3MG3A 3MSOA 7GSPA 3K5TA 3X3XA 5M19A 4HYZA 1I8VA 3RGAA 3OXAA 3NHXA 4K61A 1TUHA 1I0XA 1GOUA 1RLSA 2Y74A 1GOVA 1HKXA 2F86B 2YFJB 2D42A 3I563 2SARA 1TU5A 3EN8A 1S723 1EQKA 2CWVA 1DETA 1V57A 4NHFA 1RGLA 1TRPA 1B2ZA 3V98A 1BSAA 2WO0A 3AHSA 3FF0A 5LC6A 2BMRB 4L8PA 2H0HA 3LOYA 1RCLA 4GSPA 1KSIA 4N3VA 1BSBA 4N6TA 3EBYA 3CCE3 3NBBA 1LQMB 1B2XA 1GYBA 1WTHA 1I3IA 1YIJ3 1NO3A 1CYVA 3PXMA 2HMMB 2JDIH 2ML5A 3MG1A 4R1KA 1UDII 1DVCA 2F4YA 4N6MA 1OF5A 1JBSA 1CEWI 1FUSA 3CC23 2HMOB 1LQGC 1W7CA 2INXA 2WGQA 3PGBA 1C54A 2IUJA 3CME3 3GAXA 1WMOA 1BNSA 3FG1A 4KZ1A 3MKIA 1FA3A 4Q53A 2F98A 1EKMA 1VZZA 1NU3A 2HOHA 2W9PA 5EQLA 2GU1A 2Z77A 5D83A 4IIAA 6RNTA 1K734 1PYLA 2QEX3 2W6JH 1VQ53 3CMA3 3DGOA 5D82A 2H0IA 2GXFA 1I0VA 4J9AA 2YFLB 1BSEA 3UNLA 2HMLB 2BT3A 3ROBA 1BANA 5RNTA 4J8TA 1B21A 1SARA 1QVF2 3UB1A 4XB5A 3K0ZA 3AMOB 3OX9A 1LOYA 3VSYA 4X2OA 1BOXA 1GD4A 1J2BA 3FLJA 1X1XA 3S27A 2W9QA 1OACA 2Z6BA 2W2CA 4HAAA 2CFLA 1K41A 1VQQA 2UGIA 1ULIB 2WOFA 3NXJA 4HKVB 2CG1A 1YNVX 3U97A 2HMNB 1FW7A 1O7WB 5TGNA 3N9HA 2IUKA 3IJEB 4MEIA 2B24B 4WHAA 4EV5A 2XH9A 1EEJA 2WOHA 3CD63 4O3VA 5G2GA 1B20A 3SYUA 1RSNA 1BNFA 5ELJA 1C7HA 2A15A 1QVG2 1IVWA 2CW9A 4HM7B 4HVNA 2XF3A 1TJDA 4K1UA 2BO9B 4WWUC 4N6UA 2SBLA 3KIIA 2I9WA 5HOHA 1VQ63 3QRDA 4RZMA 1MGWA 5BXQA 1DMQA 1RNTA 1ZGXA 3F14A 5BIRA 1IT7A 2XEPA 5EVHA 1O7MB 4HBRA 1Q7Y4 3DGNA 1EA2A 2M7OA 5EEOA 1K8A4 1VQP3 4N6NB 5AI1A 5AYRB 1I2EA 1N8QA 1W6YA 1NWWA 5JPPA 1QMAA 3B4OA 4CJNA 4QWTA 1IVVA 1TFOA 3HX8A 3IPTA 1LVNA 4LZIA 1TTOA 3UL5A 3NQYA 1ULJB 5DRVA 3V99A 1RCKA 3GWRA 6STDA 3LTAA 3NV0B 4XDVA 3CCJ3 1YJ93 5IEPA 2RBIA 1JN5B 3SOAA 2CFGA 3CNXA 8CHOA 4NREA 2Y73A 2GBWB 3DMCA 4H3UA 5BU4A 1BNJA 4TX4A 5CLKA 2QIYA 1FUTA 3HOHA 3S67A 1BU4A 1RRHA 1ZX2A 2CIUA 2XFSA 2XRXB 2KF3A 2P38A 3Q3FA 1UGHI 2OCTA 4EYCA
chains in the Genus database with same CATH topology
4J5KA 1RN4A 1B3SA 1B2MA 1BNGA 1RGLA 1TRPA 1X1YA 1B2ZA 1X1UA 1RMSA 1BSAA 1GMRA 3AHSA 1RNBA 1A2PA 3BIRA 1RCLA 4GSPA 3BU4A 1BSBA 1I2GA 1RHLA 1RGFA 2AADA 1B2XA 1I3IA 4J5GA 2KF5A 1AQZA 2F4YA 3WHOA 1JBSA 1BRIA 1FUSA 1HYFA 1RGAA 9RNTA 1GOYA 1RGGA 1UCLA 2BU4A 4GHOA 1C54A 1BNEA 1BNSA 7RNTA 2HOHA 1LNIA 6RNTA 5GSPA 1PYLA 1GMQA 1UCJA 3DGYA 1YVSA 1LOWA 1RGKA 2ZA4A 1I0VA 1BNRA 1T2IA 1BSEA 1BRNL 4RNTA 1AY7A 1BANA 5RNTA 1B21A 1SARA 2BIRA 1LRAA 3URPA 1BIRA 1BSCA 1BSDA 1LOVA 1UCIA 1LOYA 1BAOA 1X1WA 1BOXA 2C4BA 1UCKA 1HZ1A 2F5WA 1R4YA 1X1XA 1IYYA 3D4AA 4BIRA 1BRJA 1I3FA 1RGHA 4HAAA 2F56A 1BNIA 1TRQA 8RNTA 1MGRA 1YNVX 1FW7A 1RGCA 6GSPA 1B2SA 3GSPA 1BRKA 2KAAA 1GSPA 3SYUA 1B20A 1RSNA 1BNFA 1YGWA 3KCHA 1FYSA 1PY3A 1BUJA 3D5GA 1RDSA 2KF4A 1JBRA 1BVIA 1BGSA 1RGEA 5HOHA 1MGWA 1RNTA 1FZUA 1ZGXA 5BIRA 1BRSA 1GMPA 1JBTA 3AGOA 1DE3A 2F5MA 1I2FA 1I2EA 3RNTA 3AGNA 3WR2A 1Q9EA 1TTOA 1RN1A 1B2UA 3D5IA 1RTUA 2KF6A 3A5EA 1RCKA 2AAEA 1I70A 2RBIA 1BRHA 7GSPA 1G02A 1I8VA 4HOHA 5BU4A 1BNJA 1T2HA 1BRGA 1I0XA 1GOUA 1RLSA 3DH2A 1GOVA 1FUTA 3HOHA 1BU4A 3AHWA 2SARA 1B27A 1CH0A 2GSPA 2KF3A 3Q3FA 2RNTA 1DETA 4BU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J5K A;  1RN4 A;  1B3S A;  1B2M A;  1BNG A;  1RGL A;  1TRP A;  1X1Y A;  1B2Z A;  1X1U A;  1RMS A;  1BSA A;  1GMR A;  3AHS A;  1RNB A;  1A2P A;  3BIR A;  1RCL A;  4GSP A;  3BU4 A;  1BSB A;  1I2G A;  1RHL A;  1RGF A;  2AAD A;  1B2X A;  1I3I A;  4J5G A;  2KF5 A;  1AQZ A;  2F4Y A;  3WHO A;  1JBS A;  1BRI A;  1FUS A;  1HYF A;  1RGA A;  9RNT A;  1GOY A;  1RGG A;  1UCL A;  2BU4 A;  4GHO A;  1C54 A;  1BNE A;  1BNS A;  7RNT A;  2HOH A;  1LNI A;  6RNT A;  5GSP A;  1PYL A;  1GMQ A;  1UCJ A;  3DGY A;  1YVS A;  1LOW A;  1RGK A;  2ZA4 A;  1I0V A;  1BNR A;  1T2I A;  1BSE A;  1BRN L;  4RNT A;  1AY7 A;  1BAN A;  5RNT A;  1B21 A;  1SAR A;  2BIR A;  1LRA A;  3URP A;  1BIR A;  1BSC A;  1BSD A;  1LOV A;  1UCI A;  1LOY A;  1BAO A;  1X1W A;  1BOX A;  2C4B A;  1UCK A;  1HZ1 A;  2F5W A;  1R4Y A;  1X1X A;  1IYY A;  3D4A A;  4BIR A;  1BRJ A;  1I3F A;  1RGH A;  4HAA A;  2F56 A;  1BNI A;  1TRQ A;  8RNT A;  1MGR A;  1YNV X;  1FW7 A;  1RGC A;  6GSP A;  1B2S A;  3GSP A;  1BRK A;  2KAA A;  1GSP A;  3SYU A;  1B20 A;  1RSN A;  1BNF A;  1YGW A;  3KCH A;  1FYS A;  1PY3 A;  1BUJ A;  3D5G A;  1RDS A;  2KF4 A;  1JBR A;  1BVI A;  1BGS A;  1RGE A;  5HOH A;  1MGW A;  1RNT A;  1FZU A;  1ZGX A;  5BIR A;  1BRS A;  1GMP A;  1JBT A;  3AGO A;  1DE3 A;  2F5M A;  1I2F A;  1I2E A;  3RNT A;  3AGN A;  3WR2 A;  1Q9E A;  1TTO A;  1RN1 A;  1B2U A;  3D5I A;  1RTU A;  2KF6 A;  3A5E A;  1RCK A;  2AAE A;  1I70 A;  2RBI A;  1BRH A;  7GSP A;  1G02 A;  1I8V A;  4HOH A;  5BU4 A;  1BNJ A;  1T2H A;  1BRG A;  1I0X A;  1GOU A;  1RLS A;  3DH2 A;  1GOV A;  1FUT A;  3HOH A;  1BU4 A;  3AHW A;  2SAR A;  1B27 A;  1CH0 A;  2GSP A;  2KF3 A;  3Q3F A;  2RNT A;  1DET A;  4BU4 A; 
#chains in the Genus database with same CATH topology
 3HII A;  3T8N A;  1RN4 A;  2JQ5 A;  3JUQ A;  3S29 A;  4OK0 A;  4WP5 A;  1VQL 3;  4MMX B;  1X1Y A;  3HZP A;  3NM2 A;  1RMS A;  3KN4 A;  1KC8 4;  1G0T A;  2CKF B;  3K7C A;  3BIR A;  1IVU A;  3BU4 A;  1IV7 A;  1MNL A;  1OHS A;  2LYX A;  3KSP A;  4N6L A;  3I55 3;  4HM2 B;  2CH9 A;  3JUN A;  1S5A A;  2AAD A;  2CK3 H;  3M8C A;  5KP1 A;  4HZB B;  3KFQ C;  4J5G A;  2XSH B;  2OOV C;  3JVC A;  3WA3 A;  2KF5 A;  2C11 A;  3K9M C;  3EC9 A;  4LSO A;  1Q82 4;  2PZV A;  1QAL A;  3RGR A;  1BRI A;  2K0M A;  1D6U A;  5M1A A;  3EB8 A;  3VGN A;  3EN1 B;  1UCL A;  4GHO A;  1NNV A;  1RN7 A;  3X41 A;  3KZT A;  1YHQ 3;  3DGM A;  3OW2 2;  2KXG A;  3V92 A;  3FG4 A;  5IG3 A;  3T0U A;  2OQE C;  1VQ7 3;  2C10 A;  4AKZ A;  3FSD A;  4STD A;  1MWT A;  1OCV A;  3DGY A;  1YVS A;  2O9U X;  1VQK 3;  3CCU 3;  1BNR A;  1RJO A;  2XGN A;  2ZHX B;  3I0Y A;  4FCM A;  2GU3 A;  4RNT A;  3G6E 3;  1DMN A;  1ROV A;  3B7C A;  3EHC A;  2Z76 A;  3UL6 A;  3CC4 3;  1IDP A;  3J7Y d;  5G1L A;  1LOV A;  3LTD A;  4HM8 B;  1N9J A;  1HZ1 A;  5AEU B;  1OPY A;  4BIR A;  1BRJ A;  3IMA B;  1E3V A;  1I3F A;  3BB9 A;  3NM7 A;  2K3D A;  1GY5 A;  1JKG B;  3DZL A;  1SIH A;  1K9M 4;  2P0M A;  3CC7 3;  1VQ4 3;  2LQV A;  3LH4 A;  1M90 4;  1O7G B;  1IVX A;  4L7K A;  4LYL B;  3X40 A;  1W02 A;  1ASK A;  1A2K A;  5CF2 A;  1Z1S A;  3EJV A;  6GSP A;  5JBS A;  3G0K A;  3JUP A;  3CCL 3;  1BRK A;  5STD A;  2BMO B;  3EX9 A;  3GZR A;  3OWS A;  3CPW 2;  3FH1 A;  1Q7H A;  3CCS 3;  1U5O A;  2BMQ B;  1FGM A;  2IY2 A;  2CX1 A;  5CF1 A;  1DYU A;  1PY3 A;  1BUJ A;  2HMK B;  1JNQ A;  1RDS A;  3X3Z A;  4EBG A;  5FW5 A;  1JRQ A;  3N54 B;  1YJN 3;  4K90 B;  1BGS A;  1RGE A;  2P09 A;  3FG3 A;  5IEN A;  1W2B 2;  1OH0 A;  1JN5 A;  3WOE B;  4NPB A;  1FZU A;  3B8L A;  1JB2 A;  4MMZ B;  3KE7 A;  1N5H A;  4HM5 B;  1BRS A;  3U1W A;  4BL2 A;  1GMP A;  1NB5 I;  2W04 A;  4HJL B;  3AGO A;  4N6O B;  2RSX A;  2XFT A;  1E3R A;  2OOV A;  4WYK B;  1OUN A;  2F5M A;  3FKA A;  3KSE D;  1BUQ A;  5AII A;  4KFE A;  2KCD A;  3RNT A;  5IER A;  3ECF A;  2J8X B;  3Q2P A;  3CCR 3;  3Q1C A;  3WR2 A;  1RRL A;  2CX0 A;  1N5P A;  4H61 A;  4HM4 B;  2K54 A;  5AEW B;  3PYJ A;  1VQ8 3;  4KFF A;  5AIH A;  3D5I A;  1ROA A;  1FGT A;  5JPU A;  3BNB A;  1UGI A;  3A5E A;  3GRD A;  3SED A;  2MC8 A;  1I70 A;  1M1K 4;  5D81 A;  2OQE A;  1CQS A;  1OHP A;  1STD A;  1OGZ A;  3T8U A;  1UI8 A;  2BNG A;  2E2V A;  4FCJ A;  5DRE A;  3MPH A;  1Q40 B;  4HOH A;  1AVL A;  4RBN A;  1T2H A;  1BRG A;  4R80 A;  1LOX A;  3DH2 A;  2QA4 3;  3HIG A;  3ALA A;  3EQQ B;  1B27 A;  1CH0 A;  4OVM A;  2GSP A;  3F8H A;  2RNT A;  4BU4 A;  3FCS B;  4J5K A;  1W2Z A;  1JZO A;  3CCQ 3;  1QAK A;  1O7N B;  2UX0 A;  4N6V 0;  3G71 3;  1GMR A;  1W00 A;  1WMN A;  3G8Z A;  1A2P A;  3GZB A;  1T3B A;  1SJW A;  5KP3 A;  1LXE A;  1IQY A;  4R4K A;  5IG5 A;  1VQO 3;  4LMI A;  5A0O B;  5KP4 A;  1O7P B;  4EXR A;  3EBT A;  1U8C B;  3F8X A;  4FR9 A;  2XSO B;  1EG9 B;  5CXO A;  5FGO A;  3WA2 X;  1V58 A;  1WQL B;  4O2H A;  3WHO A;  2Z7A A;  2CFK A;  3ZG5 A;  3S28 A;  3PS8 A;  1YJW 3;  1G96 A;  1RGA A;  3NQZ A;  4KFD A;  3LT9 A;  2BU4 A;  1RGG A;  4MMY B;  3SVA A;  4ORL A;  3HI7 A;  1BNE A;  2WGO A;  3G16 A;  4FMB A;  3STD A;  4U13 A;  4CCV A;  7RNT A;  4IPB A;  1JKG A;  1WMP A;  3VF1 A;  1Q81 4;  3CNM A;  4GB5 A;  3ZFZ A;  2OTJ 3;  2W03 A;  3K63 A;  3NBR A;  2BHM A;  2ZDJ A;  4JF8 A;  3OV4 A;  1GY7 A;  1DVD A;  2YX9 A;  1OGX A;  3L0R A;  4CPK A;  2CHC A;  1T2I A;  3LT8 A;  1BRN L;  2CFW A;  3F7S A;  1VQ9 3;  3JUM A;  3O8Y A;  5BVB A;  1FGO A;  2E2U A;  1LRA A;  1A2V A;  3URP A;  1UUG B;  1D6Z A;  2CC3 A;  1BSD A;  2C4B A;  1UUV B;  2F5W A;  2GEY A;  1R4Y A;  1IYY A;  3AMO A;  2KRT A;  1PFP A;  4FMC A;  4HM0 B;  1IQX A;  1RGH A;  1KQS 2;  1GD3 A;  3KKG A;  2RGQ A;  2F56 A;  1VQM 3;  1BNI A;  3DM8 A;  5G1K A;  1TRQ A;  8RNT A;  1MGR A;  4XBY A;  3SXX A;  1MWR A;  3LYG A;  3RDE A;  1UW1 A;  1CYU A;  1DMM A;  3NUV A;  1B2S A;  3GSP A;  2F99 A;  1GY6 A;  1W01 A;  1N9E A;  1M9G A;  1MWS A;  2KAA A;  4XM4 A;  1YGW A;  2ML6 A;  2O3O A;  1UI7 A;  3PCR A;  3UJM A;  1TFK A;  4R9K A;  4BTY A;  3BLZ A;  1KWI A;  1HU9 A;  1IV9 A;  2MF7 A;  1BVI A;  1MOL A;  3WDG B;  3MYT A;  4BTW A;  1SPU A;  3CXC 2;  3DY5 A;  1RKY A;  1EUI C;  4L8O A;  5AYS C;  1KD1 4;  5AIF A;  5IG0 A;  2IYJ A;  4R9L A;  7STD A;  3WMD A;  1ISK A;  1F8N A;  5HGR A;  2FNQ A;  1Q40 A;  1NJI 4;  4XBT A;  3X3Y A;  1IQ8 A;  3D3L A;  3EE1 A;  1K28 A;  1Q42 A;  1M1X B;  2FGT A;  1OHO A;  2R4I A;  5LC7 A;  2W56 B;  3AGN A;  3H51 A;  3TDG A;  3WOF B;  1Q9E A;  1RN1 A;  4GL6 A;  2RCD A;  1IT8 A;  2KF6 A;  3MG2 A;  1YGE A;  1N8R 4;  2AAE A;  2FXT A;  4HZ9 B;  3FGY A;  1JV2 B;  3NV0 A;  4PEJ A;  1G02 A;  1O7H B;  1W6G A;  2HMJ B;  1NDO B;  2V1L A;  1IK3 A;  1TP6 A;  2PNC A;  4K1V A;  2OTL 3;  1LNH A;  4ILF A;  1FUW A;  3BNC A;  1FGR A;  1SII A;  3SLU A;  3AHW A;  3F40 A;  2XR8 B;  1ZO2 A;  5IG4 A;  2D1W A;  1FGQ A;  2W0Q A;  4CDL A;  1B3S A;  3JUO A;  1B2M A;  1QJG A;  4KVH A;  1BNG A;  3OWY A;  3EF8 A;  3A76 A;  1X1U A;  1JJ2 2;  1QAF A;  4ZM8 A;  1STF I;  1V74 A;  2ZL8 A;  3ER7 A;  3N8B A;  5IW9 A;  1RNB A;  2IMJ A;  2CG0 A;  4EV2 A;  1I2G A;  4EW5 A;  1RHL A;  1AVK A;  1RGF A;  1AR0 A;  1JB5 A;  2UUG C;  2STD A;  4HM1 B;  1D6Y A;  3FF2 A;  3CPO A;  1AQZ A;  4EC6 A;  3DGL A;  4FMD A;  1L5G B;  1HYF A;  2IA7 A;  3ZG0 A;  9RNT A;  2GEX A;  1A90 A;  1GOY A;  4DKI A;  1NB3 I;  4I5Q A;  1JB4 A;  3B4P A;  1YVB I;  1VQN 3;  1ZS7 A;  1LNI A;  5GSP A;  3CCM 3;  3MHE A;  1GMQ A;  1UCJ A;  2P05 A;  3BNE A;  3G4S 3;  1GS3 A;  2GBX B;  2P0X A;  3SOY A;  1LOW A;  1RGK A;  2ZA4 A;  3NX0 A;  3PCS A;  5I97 A;  3CU3 A;  4HM3 B;  3CCV 3;  4FCZ A;  3DUK A;  1SQW A;  2CWU A;  2R41 A;  1AY7 A;  4O8S A;  4MJD A;  2BIR A;  3LZA A;  1OF5 B;  1TIJ A;  3OWU A;  1BIR A;  1BSC A;  1E97 A;  3S5C A;  1PU4 A;  1UCI A;  1BAO A;  1X1W A;  2Q07 A;  4LEH A;  1UCK A;  4O02 B;  3SX1 A;  4AKY A;  3D4A A;  4X2H A;  1W6C A;  4RNY A;  4FMA A;  4KT3 B;  3GZY B;  2H0G A;  3BND A;  3NBJ A;  2E2T A;  1JZD A;  3LML A;  5ELU A;  5M18 A;  1RGC A;  1US1 A;  3LTB A;  2QGU A;  4AEQ A;  3LTC A;  1MWU A;  4XBX A;  4JRF A;  3F9S A;  4I4K A;  3D79 A;  4LGQ A;  1GSP A;  4WFO A;  3HK4 A;  1WNH A;  1UUW B;  3KCH A;  4XDW A;  2W56 A;  5AIG A;  5IEO A;  3D9R A;  1FYS A;  3E99 A;  4RNZ A;  3D5G A;  2KF4 A;  4G1M B;  3QK9 A;  3X42 A;  3PZW A;  1JBR A;  4HM6 B;  1AV4 A;  2YFI B;  1Y4K A;  3WOD G;  3MWZ A;  5CK6 A;  1YI2 3;  1A67 A;  2RFR A;  1JBT A;  5IF6 A;  1R4C A;  1DE3 A;  3DXO A;  2CWT A;  1W4N A;  3F7X A;  1I2F A;  4OUQ A;  4BL3 A;  2L1S A;  2L4V A;  2B1X B;  1YIT 3;  1W5Z A;  3GZX B;  4WYK A;  1Q86 4;  1B2U A;  3LXU X;  1RTU A;  3Q90 A;  1T5Y A;  2OWP A;  3H3H A;  4BTX A;  4IT7 A;  2CFD A;  1IU7 A;  2XGL A;  1BRH A;  3FZW A;  3MG3 A;  3MSO A;  7GSP A;  3K5T A;  3X3X A;  5M19 A;  4HYZ A;  1I8V A;  3RGA A;  3OXA A;  3NHX A;  4K61 A;  1TUH A;  1I0X A;  1GOU A;  1RLS A;  2Y74 A;  1GOV A;  1HKX A;  2F86 B;  2YFJ B;  2D42 A;  3I56 3;  2SAR A;  1TU5 A;  3EN8 A;  1S72 3;  1EQK A;  2CWV A;  1DET A;  1V57 A;  4NHF A;  1RGL A;  1TRP A;  1B2Z A;  3V98 A;  1BSA A;  2WO0 A;  3AHS A;  3FF0 A;  5LC6 A;  2BMR B;  4L8P A;  2H0H A;  3LOY A;  1RCL A;  4GSP A;  1KSI A;  4N3V A;  1BSB A;  4N6T A;  3EBY A;  3CCE 3;  3NBB A;  1LQM B;  1B2X A;  1GYB A;  1WTH A;  1I3I A;  1YIJ 3;  1NO3 A;  1CYV A;  3PXM A;  2HMM B;  2JDI H;  2ML5 A;  3MG1 A;  4R1K A;  1UDI I;  1DVC A;  2F4Y A;  4N6M A;  1OF5 A;  1JBS A;  1CEW I;  1FUS A;  3CC2 3;  2HMO B;  1LQG C;  1W7C A;  2INX A;  2WGQ A;  3PGB A;  1C54 A;  2IUJ A;  3CME 3;  3GAX A;  1WMO A;  1BNS A;  3FG1 A;  4KZ1 A;  3MKI A;  1FA3 A;  4Q53 A;  2F98 A;  1EKM A;  1VZZ A;  1NU3 A;  2HOH A;  2W9P A;  5EQL A;  2GU1 A;  2Z77 A;  5D83 A;  4IIA A;  6RNT A;  1K73 4;  1PYL A;  2QEX 3;  2W6J H;  1VQ5 3;  3CMA 3;  3DGO A;  5D82 A;  2H0I A;  2GXF A;  1I0V A;  4J9A A;  2YFL B;  1BSE A;  3UNL A;  2HML B;  2BT3 A;  3ROB A;  1BAN A;  5RNT A;  4J8T A;  1B21 A;  1SAR A;  1QVF 2;  3UB1 A;  4XB5 A;  3K0Z A;  3AMO B;  3OX9 A;  1LOY A;  3VSY A;  4X2O A;  1BOX A;  1GD4 A;  1J2B A;  3FLJ A;  1X1X A;  3S27 A;  2W9Q A;  1OAC A;  2Z6B A;  2W2C A;  4HAA A;  2CFL A;  1K41 A;  1VQQ A;  2UGI A;  1ULI B;  2WOF A;  3NXJ A;  4HKV B;  2CG1 A;  1YNV X;  3U97 A;  2HMN B;  1FW7 A;  1O7W B;  5TGN A;  3N9H A;  2IUK A;  3IJE B;  4MEI A;  2B24 B;  4WHA A;  4EV5 A;  2XH9 A;  1EEJ A;  2WOH A;  3CD6 3;  4O3V A;  5G2G A;  1B20 A;  3SYU A;  1RSN A;  1BNF A;  5ELJ A;  1C7H A;  2A15 A;  1QVG 2;  1IVW A;  2CW9 A;  4HM7 B;  4HVN A;  2XF3 A;  1TJD A;  4K1U A;  2BO9 B;  4WWU C;  4N6U A;  2SBL A;  3KII A;  2I9W A;  5HOH A;  1VQ6 3;  3QRD A;  4RZM A;  1MGW A;  5BXQ A;  1DMQ A;  1RNT A;  1ZGX A;  3F14 A;  5BIR A;  1IT7 A;  2XEP A;  5EVH A;  1O7M B;  4HBR A;  1Q7Y 4;  3DGN A;  1EA2 A;  2M7O A;  5EEO A;  1K8A 4;  1VQP 3;  4N6N B;  5AI1 A;  5AYR B;  1I2E A;  1N8Q A;  1W6Y A;  1NWW A;  5JPP A;  1QMA A;  3B4O A;  4CJN A;  4QWT A;  1IVV A;  1TFO A;  3HX8 A;  3IPT A;  1LVN A;  4LZI A;  1TTO A;  3UL5 A;  3NQY A;  1ULJ B;  5DRV A;  3V99 A;  1RCK A;  3GWR A;  6STD A;  3LTA A;  3NV0 B;  4XDV A;  3CCJ 3;  1YJ9 3;  5IEP A;  2RBI A;  1JN5 B;  3SOA A;  2CFG A;  3CNX A;  8CHO A;  4NRE A;  2Y73 A;  2GBW B;  3DMC A;  4H3U A;  5BU4 A;  1BNJ A;  4TX4 A;  5CLK A;  2QIY A;  1FUT A;  3HOH A;  3S67 A;  1BU4 A;  1RRH A;  1ZX2 A;  2CIU A;  2XFS A;  2XRX B;  2KF3 A;  2P38 A;  3Q3F A;  1UGH I;  2OCT A;  4EYC A; 
#chains in the Genus database with same CATH homology
 4J5K A;  1RN4 A;  1B3S A;  1B2M A;  1BNG A;  1RGL A;  1TRP A;  1X1Y A;  1B2Z A;  1X1U A;  1RMS A;  1BSA A;  1GMR A;  3AHS A;  1RNB A;  1A2P A;  3BIR A;  1RCL A;  4GSP A;  3BU4 A;  1BSB A;  1I2G A;  1RHL A;  1RGF A;  2AAD A;  1B2X A;  1I3I A;  4J5G A;  2KF5 A;  1AQZ A;  2F4Y A;  3WHO A;  1JBS A;  1BRI A;  1FUS A;  1HYF A;  1RGA A;  9RNT A;  1GOY A;  1RGG A;  1UCL A;  2BU4 A;  4GHO A;  1C54 A;  1BNE A;  1BNS A;  7RNT A;  2HOH A;  1LNI A;  6RNT A;  5GSP A;  1PYL A;  1GMQ A;  1UCJ A;  3DGY A;  1YVS A;  1LOW A;  1RGK A;  2ZA4 A;  1I0V A;  1BNR A;  1T2I A;  1BSE A;  1BRN L;  4RNT A;  1AY7 A;  1BAN A;  5RNT A;  1B21 A;  1SAR A;  2BIR A;  1LRA A;  3URP A;  1BIR A;  1BSC A;  1BSD A;  1LOV A;  1UCI A;  1LOY A;  1BAO A;  1X1W A;  1BOX A;  2C4B A;  1UCK A;  1HZ1 A;  2F5W A;  1R4Y A;  1X1X A;  1IYY A;  3D4A A;  4BIR A;  1BRJ A;  1I3F A;  1RGH A;  4HAA A;  2F56 A;  1BNI A;  1TRQ A;  8RNT A;  1MGR A;  1YNV X;  1FW7 A;  1RGC A;  6GSP A;  1B2S A;  3GSP A;  1BRK A;  2KAA A;  1GSP A;  3SYU A;  1B20 A;  1RSN A;  1BNF A;  1YGW A;  3KCH A;  1FYS A;  1PY3 A;  1BUJ A;  3D5G A;  1RDS A;  2KF4 A;  1JBR A;  1BVI A;  1BGS A;  1RGE A;  5HOH A;  1MGW A;  1RNT A;  1FZU A;  1ZGX A;  5BIR A;  1BRS A;  1GMP A;  1JBT A;  3AGO A;  1DE3 A;  2F5M A;  1I2F A;  1I2E A;  3RNT A;  3AGN A;  3WR2 A;  1Q9E A;  1TTO A;  1RN1 A;  1B2U A;  3D5I A;  1RTU A;  2KF6 A;  3A5E A;  1RCK A;  2AAE A;  1I70 A;  2RBI A;  1BRH A;  7GSP A;  1G02 A;  1I8V A;  4HOH A;  5BU4 A;  1BNJ A;  1T2H A;  1BRG A;  1I0X A;  1GOU A;  1RLS A;  3DH2 A;  1GOV A;  1FUT A;  3HOH A;  1BU4 A;  3AHW A;  2SAR A;  1B27 A;  1CH0 A;  2GSP A;  2KF3 A;  3Q3F A;  2RNT A;  1DET A;  4BU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...