5IG0A

Crystal structure of s. rosetta camkii hub
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
131
structure length
131
Chain Sequence
VPAGPAKAVLEVNDELLKAVASGDWDAYTTMVDPNVTCFEPEAAGVLAKGLAFHKFFFDNRSPNADKMKTTLHDPAVQMFGDTAIVTALRVVQFVADDGPKTTRYEETRVWVKDAAFKFGWKLVHFHRSGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords CAMK/CAMK2 protein kinase
publication title Molecular mechanism of activation-triggered subunit exchange in Ca(2+)/calmodulin-dependent protein kinase II.
pubmed doi rcsb
source organism Salpingoeca rosetta (strain atcc 50818 / bsb-021)
total genus 27
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2016-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08332 CaMKII_AD Calcium/calmodulin dependent protein kinase II association domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5ig0A00
1UUWB 4HZ9B 3GZRA 2CKFB 3F40A 3FF2A 3T8UA 1Z1SA 1DMMA 5IF6A 1HKXA 4OVMA 6STDA 3OXAA 3MSOA 3F7XA 4XB5A 3NHXA 5IG4A 4XDVA 5JPUA 3NM2A 3GRDA 3MKIA 2BMOB 5IG3A 1QJGA 2K54A 1O7NB 3FSDA 3RGRA 3EBYA 3D9RA 3STDA 5AI1A 1OHSA 2XR8B 4U13A 3OWSA 3EBTA 2HMNB 3SOAA 3T8NA 3JUQA 2F99A 4RZMA 3MG2A 5AEUB 1OGZA 2BMQB 3IPTA 5AIIA 3MG3A 2QIYA 3F8HA 4CDLA 3WMDA 4STDA 3GZYB 1E97A 4MJDA 3KZTA 1ULJB 3F9SA 2XRXB 2HMLB 1OCVA 2HMJB 4HM6B 1OGXA 3E99A 4XBTA 1E3VA 3FH1A 5IEOA 2GEYA 1OPYA 4H3UA 2A15A 4WYKA 4HM3B 2STDA 3VSYA 4LGQA 3LYGA 1JN5A 4HM0B 4HM2B 3CNXA 4X2OA 3G8ZA 4K1VA 2GEXA 3B8LA 1JB5A 1NU3A 3ER7A 4K1UA 5TGNA 5CF2A 2YFIB 1W02A 4WYKB 5CK6A 1BUQA 5KP3A 2HMKB 1JN5B 3F14A 4X2HA 4N3VA 2BMRB 3K7CA 1JB4A 4HM7B 2Z76A 5CLKA 1JKGA 1QMAA 1DMNA 4HM5B 1ASKA 2GBXB 5KP1A 5AIGA 2F86B 5HGRA 2XSOB 1IDPA 4XBYA 1OF5A 2RGQA 3EJVA 1JKGB 1NDOB 1TUHA 5BVBA 3JUOA 3OX9A 4HZBB 1GY7A 2YFJB 4HM1B 1OF5B 3EN8A 3B4PA 5FW5A 3ROBA 3A76A 3FGYA 2JQ5A 3EF8A 3BB9A 3CPOA 5CF1A 4XM4A 3VGNA 5CXOA 1JB2A 4J9AA 2RCDA 3NBRA 3KKGA 2OWPA 3HX8A 5D83A 5AIFA 3SOYA 5DREA 3NV0A 5AEWB 2GBWB 2PZVA 3Q90A 4HM8B 1UUVB 3K0ZA 1U5OA 5IG5A 8CHOA 4ORLA 1GY5A 5IEPA 3KE7A 1ZO2A 2XSHB 3FZWA 5D81A 2GXFA 1GY6A 1O7HB 3NV0B 1OH0A 3NXJA 5AIHA 1VZZA 1OHOA 3JUPA 4HJLB 2W2CA 1NWWA 3GWRA 3F7SA 4XBXA 2YFLB 1WQLB 1TP6A 2QGUA 4HM4B 3EQQB 2IMJA 1ULIB 3LZAA 3HZPA 4I4KA 1O7PB 3G16A 4R1KA 1A2KA 4L8PA 3EC9A 1DMQA 5EVHA 1Q40A 3DXOA 3MG1A 4PEJA 4Q53A 4L7KA 5JPPA 3RGAA 4R9LA 1K41A 2R4IA 3DMCA 3OWUA 1SJWA 3UJMA 3B4OA 4FCMA 1O7GB 1EA2A 5BXQA 1Q40B 3H3HA 3GZBA 3G0KA 2F98A 1S5AA 1STDA 4WP5A 1W01A 5IG0A 2B24B 4L8OA 4LEHA 3HK4A 4WWUC 5STDA 3H51A 2Z77A 5DRVA 3F8XA 1W00A 2INXA 1OHPA 1CQSA 3CNMA 4GB5A 3FF0A 3GZXB 3MYTA 2HMMB 3M8CA 4IIAA 1AR0A 1O7MB 3ECFA 3OV4A 5IENA 1OUNA 1C7HA 3FKAA 1ISKA 3FLJA 5G2GA 3B7CA 3NUVA 3EHCA 3JUMA 3EN1B 1EG9B 5KP4A 1O7WB 2RFRA 3OWYA 2CHCA 5D82A 3DUKA 3JUNA 1Q42A 3KSPA 4KVHA 3UNLA 1ZX2A 4LMIA 3MHEA 1GYBA 1GS3A 3SEDA 2BNGA 4FCJA 2HMOB 3I0YA 3DM8A 3BLZA 4HKVB 3S5CA 1W6YA 3DZLA 4R9KA 4J8TA 4XDWA 3EX9A 5IERA 4OUQA 7STDA 2UX0A 2B1XB 2Z7AA 2I9WA 3CU3A 4HVNA 1E3RA
chains in the Genus database with same CATH superfamily
1K9M4 1LXEA 1LOXA 3PXMA 1UUWB 2V1LA 2RNTA 2UGIA 2ML5A 5RNTA 3SVAA 1BNRA 4BIRA 4HZ9B 7RNTA 3GZRA 2CKFB 1N8R4 1B2XA 3F40A 1M1XB 4EYCA 4FMAA 2P0XA 3FF2A 2CFKA 5A0OB 1EUIC 3DGMA 2CFDA 3T8UA 1BSBA 1B2UA 1US1A 1Z1SA 5IW9A 2W9PA 1DMMA 5IF6A 1UI8A 1TTOA 3U1WA 1HKXA 1IVWA 1Q9EA 4OVMA 6STDA 3OXAA 3MSOA 3F7XA 4XB5A 4KFDA 3NHXA 3WR2A 3FG1A 4XDVA 3X41A 1RN7A 3O8YA 5IG4A 5JPUA 1FW7A 2MC8A 2ZDJA 3D5IA 3NM2A 1Q7HA 1TU5A 3CME3 1GSPA 1V74A 3GRDA 3CCV3 1ROAA 3AMOA 2CG1A 3MKIA 3DGNA 2BMOB 5IG3A 1VQP3 1UUGB 2AAEA 2ZHXB 3S27A 1QJGA 1UW1A 2K54A 1O7NB 3FSDA 4LYLB 3RGRA 2CFWA 1VQ53 4RBNA 3EBYA 1W4NA 3D9RA 3CCQ3 3LTDA 3OW22 3G4S3 1FGOA 1BVIA 3STDA 1YHQ3 3WOFB 5AI1A 2K3DA 2GU1A 1Q824 3CC73 1OHSA 1NNVA 4N6TA 4FMDA 3V98A 1A2PA 2XR8B 3NQZA 1EQKA 1I3FA 4U13A 3OWSA 4BTYA 2XEPA 2WOHA 3EBTA 1FGQA 2HMNB 2Z6BA 3SOAA 3CMA3 3S28A 2XGNA 3JUQA 3AMOB 3PCSA 3T8NA 3WODG 2F99A 4RZMA 3MG2A 5AEUB 1DETA 1MOLA 3K9MC 4BTXA 1OGZA 2BMQB 3IPTA 3K5TA 1RGKA 2SARA 3UL6A 3I563 1A2VA 2O9UX 5AIIA 5LC7A 3MG3A 2QIYA 3EE1A 3F8HA 3URPA 2F5MA 3WMDA 4CDLA 1RTUA 4I5QA 5AYRB 1RMSA 4BL3A 2KCDA 3AHWA 4HOHA 3GZYB 1E97A 4STDA 5BU4A 4MJDA 3GAXA 2WOFA 3KZTA 1TRPA 3LTAA 4HBRA 1ULJB 2CIUA 3F9SA 3G6E3 2XRXB 2HMLB 1OCVA 5EQLA 5HOHA 1FUSA 1RGCA 2HMJB 4HM6B 2SBLA 1QALA 1W5ZA 1OGXA 1TFKA 4FMBA 4FR9A 4NPBA 4KZ1A 4AEQA 1LVNA 3E99A 4XBTA 1G96A 1HZ1A 4LZIA 1E3VA 3FH1A 5IEOA 1B27A 2GEYA 1OPYA 2M7OA 1GMPA 1RN4A 1T2IA 1BRKA 2IY2A 4H3UA 3KSED 1BRIA 2A15A 4WYKA 1W6GA 4HM3B 1FGMA 1RDSA 2STDA 1LOWA 3VSYA 3CCS3 3LTBA 1V58A 3LYGA 4LGQA 4CJNA 1JJ22 1DVDA 1YJ93 1JN5A 2ML6A 4HM0B 1BNEA 1S723 1RGAA 1UGHI 2W6JH 5AYSC 1KWIA 4HM2B 3CNXA 4X2OA 3G8ZA 3SYUA 3LH4A 1R4CA 4K1VA 2GEXA 3B8LA 1VQO3 3Q2PA 3D5GA 1W2B2 1YGEA 3SX1A 1JB5A 2UUGC 3VF1A 3S29A 1NU3A 1N5PA 3ER7A 3X3ZA 1BNFA 1GD4A 4K1UA 1B20A 5TGNA 5CF2A 3WHOA 1K28A 1LOYA 2YFIB 2CW9A 1IQYA 1MNLA 1RLSA 1LNIA 1W02A 4WYKB 5CK6A 1BUQA 5KP3A 2HMKB 1EEJA 2KF5A 4MEIA 1JN5B 3F14A 1BUJA 1BRNL 4X2HA 4N3VA 2BMRB 8RNTA 1V57A 4K61A 3K7CA 1JB4A 1NB3I 1RNTA 4HM7B 1RRHA 3HIIA 2RSXA 2Z76A 4K90B 2XFTA 5CLKA 1JKGA 1QMAA 1DMNA 2KF4A 1VQQA 1JRQA 2F4YA 1QVG2 1Q7Y4 4KFEA 4HM5B 1ASKA 3ALAA 2WO0A 2GBXB 3LOYA 5LC6A 1BRJA 5KP1A 5AIGA 5EEOA 3X40A 1I2FA 1MWRA 2F86B 3HIGA 1N9JA 3ZG0A 5HGRA 3NBJA 3S67A 2XSOB 1VQ43 4N6NB 4NREA 1G02A 2ZL8A 1IDPA 1W7CA 4RNTA 1IK3A 1M1K4 4XBYA 1Q814 3SLUA 2KAAA 5GSPA 1VQM3 1JNQA 1OF5A 4KT3B 1LOVA 1PU4A 1BAOA 2RGQA 3EJVA 1JKGB 1HU9A 4GHOA 1AQZA 5JBSA 1NDOB 3BNCA 1TUHA 2E2VA 1L5GB 3KFQC 2XFSA 1ZGXA 1SARA 3QK9A 4J5GA 2FNQA 1IV7A 5BVBA 3PGBA 3U97A 1Q864 1T3BA 2CWTA 3ZG5A 3JUOA 1U8CB 3LT8A 1MGWA 1GOYA 3Q3FA 1UCKA 4IT7A 3OX9A 4JRFA 4N6UA 4RNZA 1B2MA 2H0IA 1W6CA 3DGOA 4WHAA 4ZM8A 4HZBB 2RBIA 1GY7A 2YFJB 3HI7A 4HM1B 1T2HA 3D3LA 1OF5B 1JBSA 2E2TA 1A67A 3EN8A 4LSOA 1I0XA 3B4PA 5G1LA 5FW5A 3ROBA 1WNHA 1RNBA 1DVCA 3A76A 3FGYA 2LYXA 2JQ5A 4BTWA 1RN1A 3EF8A 3BB9A 3WA3A 4NHFA 1FGRA 3BU4A 1KD14 3CPOA 1FYSA 3V99A 3CXC2 2FGTA 5CF1A 4XM4A 2OQEC 3VGNA 2CH9A 1NO3A 5CXOA 1BU4A 1JB2A 2XH9A 4MMYB 2K0MA 2BHMA 2E2UA 3FG3A 1GD3A 3SXXA 4N6MA 5ELJA 2FXTA 3BNBA 1M904 2PNCA 4J9AA 2CFLA 4IPBA 2AADA 1BNJA 2RCDA 3NBRA 4H61A 3DGLA 3ZFZA 4CCVA 1VQN3 3KKGA 2OWPA 4N6LA 1A90A 1CYVA 4QWTA 1BSAA 3HX8A 5D83A 3LT9A 3TDGA 1BNGA 2IYJA 3DH2A 1UCJA 1DE3A 1IQ8A 1WMNA 5AIFA 1UDII 2JDIH 3SOYA 5DREA 1BNIA 1BSCA 1YJN3 2OTL3 2C4BA 1JBRA 1N9EA 3NV0A 2L1SA 5AEWB 2GBWB 2OOVA 1TFOA 2P05A 4BL2A 2PZVA 3Q90A 1RJOA 3QRDA 4HM8B 1UUVB 1CH0A 3K0ZA 1U5OA 1GOUA 2CG0A 3Q1CA 4R80A 2R41A 3T0UA 2XGLA 3X3XA 5IG5A 1N5HA 3IJEB 3MWZA 8CHOA 3X42A 1STFI 3FCSB 1WTHA 1IT8A 4ORLA 1GY5A 3NX0A 3WDGB 2YX9A 5IEPA 2H0HA 3KE7A 4DKIA 1ZO2A 1LRAA 1UGIA 1W2ZA 2XSHB 3FZWA 2Y74A 5D81A 2GXFA 1GY6A 1O7HB 3NV0B 3RNTA 2OQEA 1OH0A 3NXJA 5AIHA 3EB8A 1VZZA 1OHOA 3JUPA 4HJLB 1OACA 4G1MB 3I553 1C54A 2BIRA 2W2CA 1NWWA 3GWRA 3F7SA 4XBXA 2OTJ3 2YFLB 4HYZA 2W56A 1WQLB 1TP6A 2QGUA 1LQGC 4N6OB 4HM4B 3EQQB 2IMJA 1X1XA 3CCL3 3PCRA 2KXGA 1ULIB 1X1UA 1YVBI 1PYLA 3LZAA 1MWTA 1JZOA 1SPUA 3HZPA 1BSEA 4I4KA 1UCLA 1RGEA 1O7PB 3G16A 1SQWA 4RNYA 2D1WA 1M9GA 1VQL3 2W04A 1KC84 1IVXA 1YIT3 1RCKA 1IV9A 4R1KA 2C11A 1LQMB 4EV5A 1A2KA 4ILFA 1VQ93 1X1WA 4L8PA 2KF6A 2CC3A 1BIRA 2L4VA 1T5YA 3EC9A 3LMLA 4HAAA 1DMQA 5EVHA 1Q40A 2W56B 3DXOA 1B3SA 3MG1A 3N8BA 3FG4A 4PEJA 2W0QA 4Q53A 4EW5A 4O02B 1RGFA 2KRTA 3AGOA 4L7KA 1K734 5JPPA 5M19A 2W03A 1GOVA 1I70A 3WA2X 2O3OA 2ZA4A 3RGAA 1RHLA 1B2SA 1VQ83 4R9LA 2Y73A 4GSPA 1BGSA 2CX0A 3GSPA 1K41A 2R4IA 3DMCA 4J5KA 4EBGA 3OWUA 4MMXB 1SJWA 3KCHA 4EXRA 1QVF2 2GU3A 4OK0A 3UJMA 3CCJ3 1D6YA 3B4OA 4FCMA 1O7GB 1EA2A 1BRSA 4JF8A 5BXQA 1RKYA 1Q40B 2F5WA 1FGTA 2OOVC 3H3HA 3GZBA 3NQYA 3CD63 1IVVA 3UB1A 1LNHA 2WGQA 3LTCA 1NB5I 1SIIA 4WFOA 2BU4A 1UCIA 2CWUA 3G0KA 1BRGA 2F98A 4O3VA 3RDEA 1GMQA 1S5AA 3NBBA 1STDA 1TIJA 2W9QA 1K8A4 3IMAB 1TJDA 1YIJ3 1RCLA 4O8SA 4WP5A 2D42A 1W01A 1B21A 1PY3A 3CC43 5IG0A 2B24B 3V92A 2Q07A 3AHSA 1KQS2 4L8OA 1G0TA 4LEHA 3X3YA 3HK4A 5FGOA 2OCTA 4WWUC 2IUKA 5STDA 3H51A 1VQK3 2GSPA 3BIRA 2Z77A 5DRVA 2CFGA 3F8XA 1CEWI 1W00A 1R4YA 4AKZA 1YJW3 1JV2B 1Y4KA 2INXA 3A5EA 3L0RA 4FMCA 1OHPA 1FUTA 3CPW2 2IA7A 1CQSA 2P38A 3NM7A 1ROVA 5M1AA 1I0VA 3CNMA 1J2BA 3CCR3 4GB5A 1AY7A 1VQ63 2XF3A 3PS8A 2IUJA 3AGNA 3FF0A 3GZXB 3D4AA 1TRQA 4BU4A 1BNSA 2C10A 3MYTA 1D6ZA 1CYUA 2HMMB 7GSPA 3M8CA 4IIAA 1KSIA 1AR0A 2WGOA 1O7MB 3WOEB 2BT3A 1AVKA 3ECFA 3OV4A 1FZUA 1OUNA 5IENA 1C7HA 1RGGA 3FKAA 4KFFA 4R4KA 3BNDA 3JVCA 4O2HA 1JBTA 1ISKA 2BO9B 1I3IA 1B2ZA 4TX4A 1X1YA 4EV2A 1D6UA 2KF3A 1IQXA 1IYYA 3FLJA 3KN4A 3LXUX 1I2EA 5G2GA 2P09A 3HOHA 2LQVA 2QEX3 1RRLA 1BANA 3B7CA 3NUVA 6RNTA 3CC23 3EHCA 1DYUA 3JUMA 1WMPA 2CX1A 3EN1B 1EG9B 1FUWA 5M18A 1HYFA 6GSPA 1IVUA 5KP4A 3PYJA 3K63A 1O7WB 2RFRA 1I2GA 3OWYA 3J7Yd 5I97A 2CHCA 1EKMA 5D82A 1GMRA 1YNVX 3D79A 5ELUA 3BNEA 1AVLA 1MWSA 3DUKA 3JUNA 1Q42A 2P0MA 3DY5A 3KSPA 4KVHA 3UNLA 1FA3A 1QAKA 1ZX2A 4LMIA 3MHEA 1GYBA 4CPKA 3DGYA 1GS3A 3SEDA 1PFPA 3CCE3 4N6V0 2H0GA 2BNGA 2J8XB 4EC6A 1WMOA 2CWVA 1QAFA 4FCJA 2HMOB 1I8VA 3I0YA 1VQ73 1BSDA 1IT7A 3DM8A 3MPHA 2CK3H 3BLZA 1YVSA 5G1KA 1F8NA 3CCU3 1BOXA 4HKVB 4GL6A 3S5CA 1SIHA 1ZS7A 3CCM3 1W6YA 1RGHA 3DZLA 4R9KA 1YI23 3UL5A 1AV4A 1IU7A 2F56A 1BRHA 4J8TA 4XDWA 5BIRA 3G713 3PZWA 4FCZA 3EX9A 3KIIA 1JZDA 5IERA 1MWUA 1UI7A 2MF7A 3N54B 3N9HA 1RGLA 2QA43 4OUQA 1NJI4 1YGWA 7STDA 1RSNA 2UX0A 2B1XB 9RNTA 4AKYA 2HOHA 2Z7AA 2I9WA 3CU3A 4MMZB 1MGRA 4HVNA 1N8QA 1E3RA
chains in the Genus database with same CATH topology
1K9M4 1LXEA 1LOXA 3PXMA 1UUWB 2V1LA 2ML5A 3SVAA 4HZ9B 3GZRA 2CKFB 1N8R4 3F40A 1M1XB 4EYCA 4FMAA 2P0XA 3FF2A 2CFKA 5A0OB 3DGMA 2CFDA 3T8UA 1US1A 1Z1SA 5IW9A 2W9PA 1DMMA 5IF6A 1UI8A 3U1WA 1HKXA 1IVWA 4OVMA 6STDA 3OXAA 3MSOA 3F7XA 4XB5A 4KFDA 3NHXA 3X41A 3FG1A 4XDVA 5IG4A 1RN7A 3O8YA 5JPUA 2MC8A 2ZDJA 3NM2A 1TU5A 3CME3 1V74A 3CCV3 3GRDA 1ROAA 3AMOA 2CG1A 3MKIA 3DGNA 2BMOB 5IG3A 1VQP3 3S27A 1QJGA 1UW1A 2K54A 1O7NB 3FSDA 3RGRA 1VQ53 2CFWA 4RBNA 3EBYA 1W4NA 3D9RA 3CCQ3 3LTDA 3OW22 3G4S3 1FGOA 3STDA 1YHQ3 3WOFB 5AI1A 2GU1A 1Q824 3CC73 1OHSA 4N6TA 4FMDA 3V98A 2XR8B 3NQZA 1EQKA 4U13A 3OWSA 4BTYA 2XEPA 2WOHA 3EBTA 2Z6BA 1FGQA 2HMNB 3SOAA 3CMA3 3S28A 2XGNA 3JUQA 3AMOB 3PCSA 3T8NA 3WODG 2F99A 4RZMA 3MG2A 5AEUB 1MOLA 3K9MC 4BTXA 1OGZA 2BMQB 3IPTA 3K5TA 3UL6A 3I563 1A2VA 2O9UX 5AIIA 5LC7A 3MG3A 2QIYA 3EE1A 3F8HA 4CDLA 3WMDA 5AYRB 2KCDA 4STDA 3GZYB 1E97A 4MJDA 3GAXA 2WOFA 3KZTA 3LTAA 4HBRA 1ULJB 2CIUA 3F9SA 3G6E3 2XRXB 2HMLB 1OCVA 5EQLA 2HMJB 4HM6B 2SBLA 1QALA 1W5ZA 1OGXA 1TFKA 4FMBA 4FR9A 4AEQA 4KZ1A 1LVNA 3E99A 4XBTA 1G96A 4LZIA 1E3VA 3FH1A 5IEOA 2GEYA 1OPYA 2M7OA 4H3UA 3KSED 2A15A 4WYKA 1W6GA 4HM3B 1FGMA 2STDA 3VSYA 3CCS3 3LTBA 4LGQA 3LYGA 1JJ22 1DVDA 1YJ93 1JN5A 2ML6A 4HM0B 1S723 2W6JH 5AYSC 1KWIA 4HM2B 3CNXA 4X2OA 3G8ZA 3LH4A 1R4CA 4K1VA 2GEXA 3B8LA 1VQO3 3Q2PA 1W2B2 1YGEA 3SX1A 1JB5A 3VF1A 3S29A 1NU3A 1N5PA 3ER7A 3X3ZA 1GD4A 4K1UA 5TGNA 5CF2A 1K28A 2YFIB 2CW9A 1IQYA 1MNLA 1W02A 4WYKB 5CK6A 1BUQA 5KP3A 2HMKB 4MEIA 1JN5B 3F14A 4X2HA 4N3VA 2BMRB 4K61A 3K7CA 1JB4A 1NB3I 4HM7B 1RRHA 3HIIA 2RSXA 2Z76A 4K90B 2XFTA 5CLKA 1JKGA 1QMAA 1DMNA 1JRQA 1QVG2 1Q7Y4 4KFEA 4HM5B 1ASKA 3ALAA 2WO0A 2GBXB 3LOYA 5LC6A 5KP1A 5AIGA 5EEOA 3X40A 2F86B 3HIGA 1N9JA 5HGRA 3NBJA 3S67A 2XSOB 1VQ43 4N6NB 4NREA 2ZL8A 1IDPA 1W7CA 1IK3A 1M1K4 4XBYA 1Q814 3SLUA 1VQM3 1JNQA 1OF5A 1PU4A 2RGQA 3EJVA 1JKGB 1HU9A 5JBSA 1NDOB 3BNCA 1TUHA 2E2VA 1L5GB 3KFQC 2XFSA 3QK9A 2FNQA 1IV7A 5BVBA 3PGBA 3U97A 1Q864 2CWTA 3JUOA 1U8CB 3LT8A 4IT7A 4JRFA 4RNZA 1RKYA 3OX9A 4N6UA 1W6CA 3DGOA 4WHAA 4ZM8A 4HZBB 1GY7A 2YFJB 3HI7A 4HM1B 3D3LA 1OF5B 2E2TA 1A67A 3EN8A 4LSOA 3B4PA 5FW5A 3ROBA 1WNHA 1DVCA 3A76A 3FGYA 2LYXA 2JQ5A 4BTWA 3EF8A 3BB9A 3WA3A 4NHFA 1FGRA 1KD14 3CPOA 3V99A 3CXC2 2FGTA 5CF1A 4XM4A 2OQEC 3VGNA 2CH9A 1NO3A 5CXOA 1JB2A 2XH9A 4MMYB 2K0MA 2BHMA 2E2UA 3FG3A 1GD3A 3SXXA 4N6MA 5ELJA 2FXTA 3BNBA 1M904 2PNCA 4J9AA 2CFLA 4IPBA 2RCDA 3NBRA 4H61A 3DGLA 4CCVA 1VQN3 3KKGA 2OWPA 4N6LA 1A90A 1CYVA 4QWTA 3HX8A 5D83A 3LT9A 3TDGA 1IQ8A 1WMNA 5AIFA 2JDIH 3SOYA 1YJN3 5DREA 2OTL3 1N9EA 3NV0A 5AEWB 2GBWB 2OOVA 1TFOA 2P05A 2PZVA 3Q90A 1RJOA 3QRDA 4HM8B 1UUVB 3K0ZA 3Q1CA 1U5OA 2CG0A 4R80A 3T0UA 2XGLA 3X3XA 5IG5A 1N5HA 3IJEB 3MWZA 8CHOA 3X42A 1STFI 3FCSB 1WTHA 1IT8A 4ORLA 1GY5A 3NX0A 3WDGB 2YX9A 5IEPA 3KE7A 1ZO2A 1W2ZA 2XSHB 3FZWA 2Y74A 5D81A 2GXFA 1GY6A 1O7HB 3NV0B 2OQEA 1OH0A 3NXJA 5AIHA 3EB8A 1VZZA 1OHOA 3JUPA 4HJLB 1OACA 4G1MB 3I553 2W2CA 1NWWA 3GWRA 3F7SA 4XBXA 2OTJ3 2YFLB 4HYZA 2W56A 1WQLB 1TP6A 2QGUA 4N6OB 4HM4B 3EQQB 2IMJA 3CCL3 3PCRA 2KXGA 1ULIB 1YVBI 3LZAA 1SPUA 3HZPA 4I4KA 1O7PB 3G16A 1SQWA 4RNYA 2D1WA 1M9GA 1VQL3 2W04A 1KC84 1IVXA 1YIT3 1IV9A 4R1KA 2C11A 4EV5A 1A2KA 1VQ93 4L8PA 2CC3A 2L4VA 1T5YA 3EC9A 3LMLA 1DMQA 5EVHA 1Q40A 2W56B 3DXOA 3MG1A 3N8BA 3FG4A 4PEJA 2W0QA 4Q53A 4O02B 4L7KA 2KRTA 1K734 5JPPA 2W03A 3WA2X 2O3OA 3RGAA 1VQ83 4R9LA 2Y73A 1K41A 2R4IA 3DMCA 4EBGA 3OWUA 4MMXB 1SJWA 4EXRA 1QVF2 2GU3A 4OK0A 3UJMA 3CCJ3 1D6YA 3B4OA 4FCMA 1O7GB 1EA2A 5BXQA 4JF8A 1Q40B 1FGTA 2OOVC 3H3HA 3GZBA 3NQYA 3CD63 1IVVA 3UB1A 1LNHA 2WGQA 3LTCA 1NB5I 1SIIA 4WFOA 2CWUA 3G0KA 2F98A 4O3VA 3RDEA 1S5AA 3NBBA 1STDA 1TIJA 2W9QA 1K8A4 3IMAB 1YIJ3 4O8SA 4WP5A 3CC43 2D42A 1W01A 5IG0A 2B24B 3V92A 2Q07A 1KQS2 4L8OA 4LEHA 3X3YA 3HK4A 5FGOA 2OCTA 4WWUC 2IUKA 5STDA 3H51A 1VQK3 2Z77A 5DRVA 2CFGA 3F8XA 1CEWI 1W00A 4AKZA 1YJW3 1JV2B 1Y4KA 2INXA 3L0RA 4FMCA 1OHPA 3CPW2 2IA7A 1CQSA 2P38A 3NM7A 1ROVA 1J2BA 3CNMA 3CCR3 4GB5A 1VQ63 2XF3A 3PS8A 2IUJA 3FF0A 1NJI4 3GZXB 2C10A 3MYTA 1D6ZA 1CYUA 2HMMB 3M8CA 4IIAA 1KSIA 1AR0A 2WGOA 1O7MB 3WOEB 2BT3A 1AVKA 3ECFA 3OV4A 5IENA 1OUNA 1C7HA 3FKAA 4KFFA 4R4KA 3BNDA 3JVCA 4O2HA 1ISKA 2BO9B 4TX4A 4EV2A 1D6UA 1IQXA 3FLJA 3KN4A 3LXUX 5G2GA 2P09A 2LQVA 2QEX3 1RRLA 3B7CA 3NUVA 3CC23 3EHCA 1DYUA 3JUMA 1WMPA 3EN1B 1EG9B 1FUWA 1IVUA 5KP4A 3PYJA 3K63A 1O7WB 2RFRA 3OWYA 3J7Yd 5I97A 2CHCA 1EKMA 5D82A 5ELUA 3BNEA 1AVLA 3DUKA 3JUNA 1Q42A 2P0MA 3DY5A 3KSPA 4KVHA 3UNLA 1FA3A 1QAKA 1ZX2A 4LMIA 3MHEA 1GYBA 1GS3A 3SEDA 1PFPA 3CCE3 4N6V0 2BNGA 4EC6A 1WMOA 2CWVA 1QAFA 4FCJA 2HMOB 3I0YA 1VQ73 1IT7A 3DM8A 3MPHA 2CK3H 3BLZA 3CCU3 1F8NA 4HKVB 4GL6A 3S5CA 1SIHA 3CCM3 1W6YA 3DZLA 4R9KA 1YI23 3UL5A 1AV4A 1IU7A 4J8TA 4XDWA 3G713 3PZWA 4FCZA 3EX9A 3KIIA 5IERA 1UI7A 2MF7A 3N54B 3N9HA 2QA43 4OUQA 7STDA 2UX0A 2B1XB 4AKYA 2Z7AA 2I9WA 3CU3A 4MMZB 4HVNA 1N8QA 1E3RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UUW B;  4HZ9 B;  3GZR A;  2CKF B;  3F40 A;  3FF2 A;  3T8U A;  1Z1S A;  1DMM A;  5IF6 A;  1HKX A;  4OVM A;  6STD A;  3OXA A;  3MSO A;  3F7X A;  4XB5 A;  3NHX A;  5IG4 A;  4XDV A;  5JPU A;  3NM2 A;  3GRD A;  3MKI A;  2BMO B;  5IG3 A;  1QJG A;  2K54 A;  1O7N B;  3FSD A;  3RGR A;  3EBY A;  3D9R A;  3STD A;  5AI1 A;  1OHS A;  2XR8 B;  4U13 A;  3OWS A;  3EBT A;  2HMN B;  3SOA A;  3T8N A;  3JUQ A;  2F99 A;  4RZM A;  3MG2 A;  5AEU B;  1OGZ A;  2BMQ B;  3IPT A;  5AII A;  3MG3 A;  2QIY A;  3F8H A;  4CDL A;  3WMD A;  4STD A;  3GZY B;  1E97 A;  4MJD A;  3KZT A;  1ULJ B;  3F9S A;  2XRX B;  2HML B;  1OCV A;  2HMJ B;  4HM6 B;  1OGX A;  3E99 A;  4XBT A;  1E3V A;  3FH1 A;  5IEO A;  2GEY A;  1OPY A;  4H3U A;  2A15 A;  4WYK A;  4HM3 B;  2STD A;  3VSY A;  4LGQ A;  3LYG A;  1JN5 A;  4HM0 B;  4HM2 B;  3CNX A;  4X2O A;  3G8Z A;  4K1V A;  2GEX A;  3B8L A;  1JB5 A;  1NU3 A;  3ER7 A;  4K1U A;  5TGN A;  5CF2 A;  2YFI B;  1W02 A;  4WYK B;  5CK6 A;  1BUQ A;  5KP3 A;  2HMK B;  1JN5 B;  3F14 A;  4X2H A;  4N3V A;  2BMR B;  3K7C A;  1JB4 A;  4HM7 B;  2Z76 A;  5CLK A;  1JKG A;  1QMA A;  1DMN A;  4HM5 B;  1ASK A;  2GBX B;  5KP1 A;  5AIG A;  2F86 B;  5HGR A;  2XSO B;  1IDP A;  4XBY A;  1OF5 A;  2RGQ A;  3EJV A;  1JKG B;  1NDO B;  1TUH A;  5BVB A;  3JUO A;  3OX9 A;  4HZB B;  1GY7 A;  2YFJ B;  4HM1 B;  1OF5 B;  3EN8 A;  3B4P A;  5FW5 A;  3ROB A;  3A76 A;  3FGY A;  2JQ5 A;  3EF8 A;  3BB9 A;  3CPO A;  5CF1 A;  4XM4 A;  3VGN A;  5CXO A;  1JB2 A;  4J9A A;  2RCD A;  3NBR A;  3KKG A;  2OWP A;  3HX8 A;  5D83 A;  5AIF A;  3SOY A;  5DRE A;  3NV0 A;  5AEW B;  2GBW B;  2PZV A;  3Q90 A;  4HM8 B;  1UUV B;  3K0Z A;  1U5O A;  5IG5 A;  8CHO A;  4ORL A;  1GY5 A;  5IEP A;  3KE7 A;  1ZO2 A;  2XSH B;  3FZW A;  5D81 A;  2GXF A;  1GY6 A;  1O7H B;  3NV0 B;  1OH0 A;  3NXJ A;  5AIH A;  1VZZ A;  1OHO A;  3JUP A;  4HJL B;  2W2C A;  1NWW A;  3GWR A;  3F7S A;  4XBX A;  2YFL B;  1WQL B;  1TP6 A;  2QGU A;  4HM4 B;  3EQQ B;  2IMJ A;  1ULI B;  3LZA A;  3HZP A;  4I4K A;  1O7P B;  3G16 A;  4R1K A;  1A2K A;  4L8P A;  3EC9 A;  1DMQ A;  5EVH A;  1Q40 A;  3DXO A;  3MG1 A;  4PEJ A;  4Q53 A;  4L7K A;  5JPP A;  3RGA A;  4R9L A;  1K41 A;  2R4I A;  3DMC A;  3OWU A;  1SJW A;  3UJM A;  3B4O A;  4FCM A;  1O7G B;  1EA2 A;  5BXQ A;  1Q40 B;  3H3H A;  3GZB A;  3G0K A;  2F98 A;  1S5A A;  1STD A;  4WP5 A;  1W01 A;  5IG0 A;  2B24 B;  4L8O A;  4LEH A;  3HK4 A;  4WWU C;  5STD A;  3H51 A;  2Z77 A;  5DRV A;  3F8X A;  1W00 A;  2INX A;  1OHP A;  1CQS A;  3CNM A;  4GB5 A;  3FF0 A;  3GZX B;  3MYT A;  2HMM B;  3M8C A;  4IIA A;  1AR0 A;  1O7M B;  3ECF A;  3OV4 A;  5IEN A;  1OUN A;  1C7H A;  3FKA A;  1ISK A;  3FLJ A;  5G2G A;  3B7C A;  3NUV A;  3EHC A;  3JUM A;  3EN1 B;  1EG9 B;  5KP4 A;  1O7W B;  2RFR A;  3OWY A;  2CHC A;  5D82 A;  3DUK A;  3JUN A;  1Q42 A;  3KSP A;  4KVH A;  3UNL A;  1ZX2 A;  4LMI A;  3MHE A;  1GYB A;  1GS3 A;  3SED A;  2BNG A;  4FCJ A;  2HMO B;  3I0Y A;  3DM8 A;  3BLZ A;  4HKV B;  3S5C A;  1W6Y A;  3DZL A;  4R9K A;  4J8T A;  4XDW A;  3EX9 A;  5IER A;  4OUQ A;  7STD A;  2UX0 A;  2B1X B;  2Z7A A;  2I9W A;  3CU3 A;  4HVN A;  1E3R A; 
#chains in the Genus database with same CATH topology
 1K9M 4;  1LXE A;  1LOX A;  3PXM A;  1UUW B;  2V1L A;  2RNT A;  2UGI A;  2ML5 A;  5RNT A;  3SVA A;  1BNR A;  4BIR A;  4HZ9 B;  7RNT A;  3GZR A;  2CKF B;  1N8R 4;  1B2X A;  3F40 A;  1M1X B;  4EYC A;  4FMA A;  2P0X A;  3FF2 A;  2CFK A;  5A0O B;  1EUI C;  3DGM A;  2CFD A;  3T8U A;  1BSB A;  1B2U A;  1US1 A;  1Z1S A;  5IW9 A;  2W9P A;  1DMM A;  5IF6 A;  1UI8 A;  1TTO A;  3U1W A;  1HKX A;  1IVW A;  1Q9E A;  4OVM A;  6STD A;  3OXA A;  3MSO A;  3F7X A;  4XB5 A;  4KFD A;  3NHX A;  3WR2 A;  3FG1 A;  4XDV A;  3X41 A;  1RN7 A;  3O8Y A;  5IG4 A;  5JPU A;  1FW7 A;  2MC8 A;  2ZDJ A;  3D5I A;  3NM2 A;  1Q7H A;  1TU5 A;  3CME 3;  1GSP A;  1V74 A;  3GRD A;  3CCV 3;  1ROA A;  3AMO A;  2CG1 A;  3MKI A;  3DGN A;  2BMO B;  5IG3 A;  1VQP 3;  1UUG B;  2AAE A;  2ZHX B;  3S27 A;  1QJG A;  1UW1 A;  2K54 A;  1O7N B;  3FSD A;  4LYL B;  3RGR A;  2CFW A;  1VQ5 3;  4RBN A;  3EBY A;  1W4N A;  3D9R A;  3CCQ 3;  3LTD A;  3OW2 2;  3G4S 3;  1FGO A;  1BVI A;  3STD A;  1YHQ 3;  3WOF B;  5AI1 A;  2K3D A;  2GU1 A;  1Q82 4;  3CC7 3;  1OHS A;  1NNV A;  4N6T A;  4FMD A;  3V98 A;  1A2P A;  2XR8 B;  3NQZ A;  1EQK A;  1I3F A;  4U13 A;  3OWS A;  4BTY A;  2XEP A;  2WOH A;  3EBT A;  1FGQ A;  2HMN B;  2Z6B A;  3SOA A;  3CMA 3;  3S28 A;  2XGN A;  3JUQ A;  3AMO B;  3PCS A;  3T8N A;  3WOD G;  2F99 A;  4RZM A;  3MG2 A;  5AEU B;  1DET A;  1MOL A;  3K9M C;  4BTX A;  1OGZ A;  2BMQ B;  3IPT A;  3K5T A;  1RGK A;  2SAR A;  3UL6 A;  3I56 3;  1A2V A;  2O9U X;  5AII A;  5LC7 A;  3MG3 A;  2QIY A;  3EE1 A;  3F8H A;  3URP A;  2F5M A;  3WMD A;  4CDL A;  1RTU A;  4I5Q A;  5AYR B;  1RMS A;  4BL3 A;  2KCD A;  3AHW A;  4HOH A;  3GZY B;  1E97 A;  4STD A;  5BU4 A;  4MJD A;  3GAX A;  2WOF A;  3KZT A;  1TRP A;  3LTA A;  4HBR A;  1ULJ B;  2CIU A;  3F9S A;  3G6E 3;  2XRX B;  2HML B;  1OCV A;  5EQL A;  5HOH A;  1FUS A;  1RGC A;  2HMJ B;  4HM6 B;  2SBL A;  1QAL A;  1W5Z A;  1OGX A;  1TFK A;  4FMB A;  4FR9 A;  4NPB A;  4KZ1 A;  4AEQ A;  1LVN A;  3E99 A;  4XBT A;  1G96 A;  1HZ1 A;  4LZI A;  1E3V A;  3FH1 A;  5IEO A;  1B27 A;  2GEY A;  1OPY A;  2M7O A;  1GMP A;  1RN4 A;  1T2I A;  1BRK A;  2IY2 A;  4H3U A;  3KSE D;  1BRI A;  2A15 A;  4WYK A;  1W6G A;  4HM3 B;  1FGM A;  1RDS A;  2STD A;  1LOW A;  3VSY A;  3CCS 3;  3LTB A;  1V58 A;  3LYG A;  4LGQ A;  4CJN A;  1JJ2 2;  1DVD A;  1YJ9 3;  1JN5 A;  2ML6 A;  4HM0 B;  1BNE A;  1S72 3;  1RGA A;  1UGH I;  2W6J H;  5AYS C;  1KWI A;  4HM2 B;  3CNX A;  4X2O A;  3G8Z A;  3SYU A;  3LH4 A;  1R4C A;  4K1V A;  2GEX A;  3B8L A;  1VQO 3;  3Q2P A;  3D5G A;  1W2B 2;  1YGE A;  3SX1 A;  1JB5 A;  2UUG C;  3VF1 A;  3S29 A;  1NU3 A;  1N5P A;  3ER7 A;  3X3Z A;  1BNF A;  1GD4 A;  4K1U A;  1B20 A;  5TGN A;  5CF2 A;  3WHO A;  1K28 A;  1LOY A;  2YFI B;  2CW9 A;  1IQY A;  1MNL A;  1RLS A;  1LNI A;  1W02 A;  4WYK B;  5CK6 A;  1BUQ A;  5KP3 A;  2HMK B;  1EEJ A;  2KF5 A;  4MEI A;  1JN5 B;  3F14 A;  1BUJ A;  1BRN L;  4X2H A;  4N3V A;  2BMR B;  8RNT A;  1V57 A;  4K61 A;  3K7C A;  1JB4 A;  1NB3 I;  1RNT A;  4HM7 B;  1RRH A;  3HII A;  2RSX A;  2Z76 A;  4K90 B;  2XFT A;  5CLK A;  1JKG A;  1QMA A;  1DMN A;  2KF4 A;  1VQQ A;  1JRQ A;  2F4Y A;  1QVG 2;  1Q7Y 4;  4KFE A;  4HM5 B;  1ASK A;  3ALA A;  2WO0 A;  2GBX B;  3LOY A;  5LC6 A;  1BRJ A;  5KP1 A;  5AIG A;  5EEO A;  3X40 A;  1I2F A;  1MWR A;  2F86 B;  3HIG A;  1N9J A;  3ZG0 A;  5HGR A;  3NBJ A;  3S67 A;  2XSO B;  1VQ4 3;  4N6N B;  4NRE A;  1G02 A;  2ZL8 A;  1IDP A;  1W7C A;  4RNT A;  1IK3 A;  1M1K 4;  4XBY A;  1Q81 4;  3SLU A;  2KAA A;  5GSP A;  1VQM 3;  1JNQ A;  1OF5 A;  4KT3 B;  1LOV A;  1PU4 A;  1BAO A;  2RGQ A;  3EJV A;  1JKG B;  1HU9 A;  4GHO A;  1AQZ A;  5JBS A;  1NDO B;  3BNC A;  1TUH A;  2E2V A;  1L5G B;  3KFQ C;  2XFS A;  1ZGX A;  1SAR A;  3QK9 A;  4J5G A;  2FNQ A;  1IV7 A;  5BVB A;  3PGB A;  3U97 A;  1Q86 4;  1T3B A;  2CWT A;  3ZG5 A;  3JUO A;  1U8C B;  3LT8 A;  1MGW A;  1GOY A;  3Q3F A;  1UCK A;  4IT7 A;  3OX9 A;  4JRF A;  4N6U A;  4RNZ A;  1B2M A;  2H0I A;  1W6C A;  3DGO A;  4WHA A;  4ZM8 A;  4HZB B;  2RBI A;  1GY7 A;  2YFJ B;  3HI7 A;  4HM1 B;  1T2H A;  3D3L A;  1OF5 B;  1JBS A;  2E2T A;  1A67 A;  3EN8 A;  4LSO A;  1I0X A;  3B4P A;  5G1L A;  5FW5 A;  3ROB A;  1WNH A;  1RNB A;  1DVC A;  3A76 A;  3FGY A;  2LYX A;  2JQ5 A;  4BTW A;  1RN1 A;  3EF8 A;  3BB9 A;  3WA3 A;  4NHF A;  1FGR A;  3BU4 A;  1KD1 4;  3CPO A;  1FYS A;  3V99 A;  3CXC 2;  2FGT A;  5CF1 A;  4XM4 A;  2OQE C;  3VGN A;  2CH9 A;  1NO3 A;  5CXO A;  1BU4 A;  1JB2 A;  2XH9 A;  4MMY B;  2K0M A;  2BHM A;  2E2U A;  3FG3 A;  1GD3 A;  3SXX A;  4N6M A;  5ELJ A;  2FXT A;  3BNB A;  1M90 4;  2PNC A;  4J9A A;  2CFL A;  4IPB A;  2AAD A;  1BNJ A;  2RCD A;  3NBR A;  4H61 A;  3DGL A;  3ZFZ A;  4CCV A;  1VQN 3;  3KKG A;  2OWP A;  4N6L A;  1A90 A;  1CYV A;  4QWT A;  1BSA A;  3HX8 A;  5D83 A;  3LT9 A;  3TDG A;  1BNG A;  2IYJ A;  3DH2 A;  1UCJ A;  1DE3 A;  1IQ8 A;  1WMN A;  5AIF A;  1UDI I;  2JDI H;  3SOY A;  5DRE A;  1BNI A;  1BSC A;  1YJN 3;  2OTL 3;  2C4B A;  1JBR A;  1N9E A;  3NV0 A;  2L1S A;  5AEW B;  2GBW B;  2OOV A;  1TFO A;  2P05 A;  4BL2 A;  2PZV A;  3Q90 A;  1RJO A;  3QRD A;  4HM8 B;  1UUV B;  1CH0 A;  3K0Z A;  1U5O A;  1GOU A;  2CG0 A;  3Q1C A;  4R80 A;  2R41 A;  3T0U A;  2XGL A;  3X3X A;  5IG5 A;  1N5H A;  3IJE B;  3MWZ A;  8CHO A;  3X42 A;  1STF I;  3FCS B;  1WTH A;  1IT8 A;  4ORL A;  1GY5 A;  3NX0 A;  3WDG B;  2YX9 A;  5IEP A;  2H0H A;  3KE7 A;  4DKI A;  1ZO2 A;  1LRA A;  1UGI A;  1W2Z A;  2XSH B;  3FZW A;  2Y74 A;  5D81 A;  2GXF A;  1GY6 A;  1O7H B;  3NV0 B;  3RNT A;  2OQE A;  1OH0 A;  3NXJ A;  5AIH A;  3EB8 A;  1VZZ A;  1OHO A;  3JUP A;  4HJL B;  1OAC A;  4G1M B;  3I55 3;  1C54 A;  2BIR A;  2W2C A;  1NWW A;  3GWR A;  3F7S A;  4XBX A;  2OTJ 3;  2YFL B;  4HYZ A;  2W56 A;  1WQL B;  1TP6 A;  2QGU A;  1LQG C;  4N6O B;  4HM4 B;  3EQQ B;  2IMJ A;  1X1X A;  3CCL 3;  3PCR A;  2KXG A;  1ULI B;  1X1U A;  1YVB I;  1PYL A;  3LZA A;  1MWT A;  1JZO A;  1SPU A;  3HZP A;  1BSE A;  4I4K A;  1UCL A;  1RGE A;  1O7P B;  3G16 A;  1SQW A;  4RNY A;  2D1W A;  1M9G A;  1VQL 3;  2W04 A;  1KC8 4;  1IVX A;  1YIT 3;  1RCK A;  1IV9 A;  4R1K A;  2C11 A;  1LQM B;  4EV5 A;  1A2K A;  4ILF A;  1VQ9 3;  1X1W A;  4L8P A;  2KF6 A;  2CC3 A;  1BIR A;  2L4V A;  1T5Y A;  3EC9 A;  3LML A;  4HAA A;  1DMQ A;  5EVH A;  1Q40 A;  2W56 B;  3DXO A;  1B3S A;  3MG1 A;  3N8B A;  3FG4 A;  4PEJ A;  2W0Q A;  4Q53 A;  4EW5 A;  4O02 B;  1RGF A;  2KRT A;  3AGO A;  4L7K A;  1K73 4;  5JPP A;  5M19 A;  2W03 A;  1GOV A;  1I70 A;  3WA2 X;  2O3O A;  2ZA4 A;  3RGA A;  1RHL A;  1B2S A;  1VQ8 3;  4R9L A;  2Y73 A;  4GSP A;  1BGS A;  2CX0 A;  3GSP A;  1K41 A;  2R4I A;  3DMC A;  4J5K A;  4EBG A;  3OWU A;  4MMX B;  1SJW A;  3KCH A;  4EXR A;  1QVF 2;  2GU3 A;  4OK0 A;  3UJM A;  3CCJ 3;  1D6Y A;  3B4O A;  4FCM A;  1O7G B;  1EA2 A;  1BRS A;  4JF8 A;  5BXQ A;  1RKY A;  1Q40 B;  2F5W A;  1FGT A;  2OOV C;  3H3H A;  3GZB A;  3NQY A;  3CD6 3;  1IVV A;  3UB1 A;  1LNH A;  2WGQ A;  3LTC A;  1NB5 I;  1SII A;  4WFO A;  2BU4 A;  1UCI A;  2CWU A;  3G0K A;  1BRG A;  2F98 A;  4O3V A;  3RDE A;  1GMQ A;  1S5A A;  3NBB A;  1STD A;  1TIJ A;  2W9Q A;  1K8A 4;  3IMA B;  1TJD A;  1YIJ 3;  1RCL A;  4O8S A;  4WP5 A;  2D42 A;  1W01 A;  1B21 A;  1PY3 A;  3CC4 3;  5IG0 A;  2B24 B;  3V92 A;  2Q07 A;  3AHS A;  1KQS 2;  4L8O A;  1G0T A;  4LEH A;  3X3Y A;  3HK4 A;  5FGO A;  2OCT A;  4WWU C;  2IUK A;  5STD A;  3H51 A;  1VQK 3;  2GSP A;  3BIR A;  2Z77 A;  5DRV A;  2CFG A;  3F8X A;  1CEW I;  1W00 A;  1R4Y A;  4AKZ A;  1YJW 3;  1JV2 B;  1Y4K A;  2INX A;  3A5E A;  3L0R A;  4FMC A;  1OHP A;  1FUT A;  3CPW 2;  2IA7 A;  1CQS A;  2P38 A;  3NM7 A;  1ROV A;  5M1A A;  1I0V A;  3CNM A;  1J2B A;  3CCR 3;  4GB5 A;  1AY7 A;  1VQ6 3;  2XF3 A;  3PS8 A;  2IUJ A;  3AGN A;  3FF0 A;  3GZX B;  3D4A A;  1TRQ A;  4BU4 A;  1BNS A;  2C10 A;  3MYT A;  1D6Z A;  1CYU A;  2HMM B;  7GSP A;  3M8C A;  4IIA A;  1KSI A;  1AR0 A;  2WGO A;  1O7M B;  3WOE B;  2BT3 A;  1AVK A;  3ECF A;  3OV4 A;  1FZU A;  1OUN A;  5IEN A;  1C7H A;  1RGG A;  3FKA A;  4KFF A;  4R4K A;  3BND A;  3JVC A;  4O2H A;  1JBT A;  1ISK A;  2BO9 B;  1I3I A;  1B2Z A;  4TX4 A;  1X1Y A;  4EV2 A;  1D6U A;  2KF3 A;  1IQX A;  1IYY A;  3FLJ A;  3KN4 A;  3LXU X;  1I2E A;  5G2G A;  2P09 A;  3HOH A;  2LQV A;  2QEX 3;  1RRL A;  1BAN A;  3B7C A;  3NUV A;  6RNT A;  3CC2 3;  3EHC A;  1DYU A;  3JUM A;  1WMP A;  2CX1 A;  3EN1 B;  1EG9 B;  1FUW A;  5M18 A;  1HYF A;  6GSP A;  1IVU A;  5KP4 A;  3PYJ A;  3K63 A;  1O7W B;  2RFR A;  1I2G A;  3OWY A;  3J7Y d;  5I97 A;  2CHC A;  1EKM A;  5D82 A;  1GMR A;  1YNV X;  3D79 A;  5ELU A;  3BNE A;  1AVL A;  1MWS A;  3DUK A;  3JUN A;  1Q42 A;  2P0M A;  3DY5 A;  3KSP A;  4KVH A;  3UNL A;  1FA3 A;  1QAK A;  1ZX2 A;  4LMI A;  3MHE A;  1GYB A;  4CPK A;  3DGY A;  1GS3 A;  3SED A;  1PFP A;  3CCE 3;  4N6V 0;  2H0G A;  2BNG A;  2J8X B;  4EC6 A;  1WMO A;  2CWV A;  1QAF A;  4FCJ A;  2HMO B;  1I8V A;  3I0Y A;  1VQ7 3;  1BSD A;  1IT7 A;  3DM8 A;  3MPH A;  2CK3 H;  3BLZ A;  1YVS A;  5G1K A;  1F8N A;  3CCU 3;  1BOX A;  4HKV B;  4GL6 A;  3S5C A;  1SIH A;  1ZS7 A;  3CCM 3;  1W6Y A;  1RGH A;  3DZL A;  4R9K A;  1YI2 3;  3UL5 A;  1AV4 A;  1IU7 A;  2F56 A;  1BRH A;  4J8T A;  4XDW A;  5BIR A;  3G71 3;  3PZW A;  4FCZ A;  3EX9 A;  3KII A;  1JZD A;  5IER A;  1MWU A;  1UI7 A;  2MF7 A;  3N54 B;  3N9H A;  1RGL A;  2QA4 3;  4OUQ A;  1NJI 4;  1YGW A;  7STD A;  1RSN A;  2UX0 A;  2B1X B;  9RNT A;  4AKY A;  2HOH A;  2Z7A A;  2I9W A;  3CU3 A;  4MMZ B;  1MGR A;  4HVN A;  1N8Q A;  1E3R A; 
#chains in the Genus database with same CATH homology
 1K9M 4;  1LXE A;  1LOX A;  3PXM A;  1UUW B;  2V1L A;  2ML5 A;  3SVA A;  4HZ9 B;  3GZR A;  2CKF B;  1N8R 4;  3F40 A;  1M1X B;  4EYC A;  4FMA A;  2P0X A;  3FF2 A;  2CFK A;  5A0O B;  3DGM A;  2CFD A;  3T8U A;  1US1 A;  1Z1S A;  5IW9 A;  2W9P A;  1DMM A;  5IF6 A;  1UI8 A;  3U1W A;  1HKX A;  1IVW A;  4OVM A;  6STD A;  3OXA A;  3MSO A;  3F7X A;  4XB5 A;  4KFD A;  3NHX A;  3X41 A;  3FG1 A;  4XDV A;  5IG4 A;  1RN7 A;  3O8Y A;  5JPU A;  2MC8 A;  2ZDJ A;  3NM2 A;  1TU5 A;  3CME 3;  1V74 A;  3CCV 3;  3GRD A;  1ROA A;  3AMO A;  2CG1 A;  3MKI A;  3DGN A;  2BMO B;  5IG3 A;  1VQP 3;  3S27 A;  1QJG A;  1UW1 A;  2K54 A;  1O7N B;  3FSD A;  3RGR A;  1VQ5 3;  2CFW A;  4RBN A;  3EBY A;  1W4N A;  3D9R A;  3CCQ 3;  3LTD A;  3OW2 2;  3G4S 3;  1FGO A;  3STD A;  1YHQ 3;  3WOF B;  5AI1 A;  2GU1 A;  1Q82 4;  3CC7 3;  1OHS A;  4N6T A;  4FMD A;  3V98 A;  2XR8 B;  3NQZ A;  1EQK A;  4U13 A;  3OWS A;  4BTY A;  2XEP A;  2WOH A;  3EBT A;  2Z6B A;  1FGQ A;  2HMN B;  3SOA A;  3CMA 3;  3S28 A;  2XGN A;  3JUQ A;  3AMO B;  3PCS A;  3T8N A;  3WOD G;  2F99 A;  4RZM A;  3MG2 A;  5AEU B;  1MOL A;  3K9M C;  4BTX A;  1OGZ A;  2BMQ B;  3IPT A;  3K5T A;  3UL6 A;  3I56 3;  1A2V A;  2O9U X;  5AII A;  5LC7 A;  3MG3 A;  2QIY A;  3EE1 A;  3F8H A;  4CDL A;  3WMD A;  5AYR B;  2KCD A;  4STD A;  3GZY B;  1E97 A;  4MJD A;  3GAX A;  2WOF A;  3KZT A;  3LTA A;  4HBR A;  1ULJ B;  2CIU A;  3F9S A;  3G6E 3;  2XRX B;  2HML B;  1OCV A;  5EQL A;  2HMJ B;  4HM6 B;  2SBL A;  1QAL A;  1W5Z A;  1OGX A;  1TFK A;  4FMB A;  4FR9 A;  4AEQ A;  4KZ1 A;  1LVN A;  3E99 A;  4XBT A;  1G96 A;  4LZI A;  1E3V A;  3FH1 A;  5IEO A;  2GEY A;  1OPY A;  2M7O A;  4H3U A;  3KSE D;  2A15 A;  4WYK A;  1W6G A;  4HM3 B;  1FGM A;  2STD A;  3VSY A;  3CCS 3;  3LTB A;  4LGQ A;  3LYG A;  1JJ2 2;  1DVD A;  1YJ9 3;  1JN5 A;  2ML6 A;  4HM0 B;  1S72 3;  2W6J H;  5AYS C;  1KWI A;  4HM2 B;  3CNX A;  4X2O A;  3G8Z A;  3LH4 A;  1R4C A;  4K1V A;  2GEX A;  3B8L A;  1VQO 3;  3Q2P A;  1W2B 2;  1YGE A;  3SX1 A;  1JB5 A;  3VF1 A;  3S29 A;  1NU3 A;  1N5P A;  3ER7 A;  3X3Z A;  1GD4 A;  4K1U A;  5TGN A;  5CF2 A;  1K28 A;  2YFI B;  2CW9 A;  1IQY A;  1MNL A;  1W02 A;  4WYK B;  5CK6 A;  1BUQ A;  5KP3 A;  2HMK B;  4MEI A;  1JN5 B;  3F14 A;  4X2H A;  4N3V A;  2BMR B;  4K61 A;  3K7C A;  1JB4 A;  1NB3 I;  4HM7 B;  1RRH A;  3HII A;  2RSX A;  2Z76 A;  4K90 B;  2XFT A;  5CLK A;  1JKG A;  1QMA A;  1DMN A;  1JRQ A;  1QVG 2;  1Q7Y 4;  4KFE A;  4HM5 B;  1ASK A;  3ALA A;  2WO0 A;  2GBX B;  3LOY A;  5LC6 A;  5KP1 A;  5AIG A;  5EEO A;  3X40 A;  2F86 B;  3HIG A;  1N9J A;  5HGR A;  3NBJ A;  3S67 A;  2XSO B;  1VQ4 3;  4N6N B;  4NRE A;  2ZL8 A;  1IDP A;  1W7C A;  1IK3 A;  1M1K 4;  4XBY A;  1Q81 4;  3SLU A;  1VQM 3;  1JNQ A;  1OF5 A;  1PU4 A;  2RGQ A;  3EJV A;  1JKG B;  1HU9 A;  5JBS A;  1NDO B;  3BNC A;  1TUH A;  2E2V A;  1L5G B;  3KFQ C;  2XFS A;  3QK9 A;  2FNQ A;  1IV7 A;  5BVB A;  3PGB A;  3U97 A;  1Q86 4;  2CWT A;  3JUO A;  1U8C B;  3LT8 A;  4IT7 A;  4JRF A;  4RNZ A;  1RKY A;  3OX9 A;  4N6U A;  1W6C A;  3DGO A;  4WHA A;  4ZM8 A;  4HZB B;  1GY7 A;  2YFJ B;  3HI7 A;  4HM1 B;  3D3L A;  1OF5 B;  2E2T A;  1A67 A;  3EN8 A;  4LSO A;  3B4P A;  5FW5 A;  3ROB A;  1WNH A;  1DVC A;  3A76 A;  3FGY A;  2LYX A;  2JQ5 A;  4BTW A;  3EF8 A;  3BB9 A;  3WA3 A;  4NHF A;  1FGR A;  1KD1 4;  3CPO A;  3V99 A;  3CXC 2;  2FGT A;  5CF1 A;  4XM4 A;  2OQE C;  3VGN A;  2CH9 A;  1NO3 A;  5CXO A;  1JB2 A;  2XH9 A;  4MMY B;  2K0M A;  2BHM A;  2E2U A;  3FG3 A;  1GD3 A;  3SXX A;  4N6M A;  5ELJ A;  2FXT A;  3BNB A;  1M90 4;  2PNC A;  4J9A A;  2CFL A;  4IPB A;  2RCD A;  3NBR A;  4H61 A;  3DGL A;  4CCV A;  1VQN 3;  3KKG A;  2OWP A;  4N6L A;  1A90 A;  1CYV A;  4QWT A;  3HX8 A;  5D83 A;  3LT9 A;  3TDG A;  1IQ8 A;  1WMN A;  5AIF A;  2JDI H;  3SOY A;  1YJN 3;  5DRE A;  2OTL 3;  1N9E A;  3NV0 A;  5AEW B;  2GBW B;  2OOV A;  1TFO A;  2P05 A;  2PZV A;  3Q90 A;  1RJO A;  3QRD A;  4HM8 B;  1UUV B;  3K0Z A;  3Q1C A;  1U5O A;  2CG0 A;  4R80 A;  3T0U A;  2XGL A;  3X3X A;  5IG5 A;  1N5H A;  3IJE B;  3MWZ A;  8CHO A;  3X42 A;  1STF I;  3FCS B;  1WTH A;  1IT8 A;  4ORL A;  1GY5 A;  3NX0 A;  3WDG B;  2YX9 A;  5IEP A;  3KE7 A;  1ZO2 A;  1W2Z A;  2XSH B;  3FZW A;  2Y74 A;  5D81 A;  2GXF A;  1GY6 A;  1O7H B;  3NV0 B;  2OQE A;  1OH0 A;  3NXJ A;  5AIH A;  3EB8 A;  1VZZ A;  1OHO A;  3JUP A;  4HJL B;  1OAC A;  4G1M B;  3I55 3;  2W2C A;  1NWW A;  3GWR A;  3F7S A;  4XBX A;  2OTJ 3;  2YFL B;  4HYZ A;  2W56 A;  1WQL B;  1TP6 A;  2QGU A;  4N6O B;  4HM4 B;  3EQQ B;  2IMJ A;  3CCL 3;  3PCR A;  2KXG A;  1ULI B;  1YVB I;  3LZA A;  1SPU A;  3HZP A;  4I4K A;  1O7P B;  3G16 A;  1SQW A;  4RNY A;  2D1W A;  1M9G A;  1VQL 3;  2W04 A;  1KC8 4;  1IVX A;  1YIT 3;  1IV9 A;  4R1K A;  2C11 A;  4EV5 A;  1A2K A;  1VQ9 3;  4L8P A;  2CC3 A;  2L4V A;  1T5Y A;  3EC9 A;  3LML A;  1DMQ A;  5EVH A;  1Q40 A;  2W56 B;  3DXO A;  3MG1 A;  3N8B A;  3FG4 A;  4PEJ A;  2W0Q A;  4Q53 A;  4O02 B;  4L7K A;  2KRT A;  1K73 4;  5JPP A;  2W03 A;  3WA2 X;  2O3O A;  3RGA A;  1VQ8 3;  4R9L A;  2Y73 A;  1K41 A;  2R4I A;  3DMC A;  4EBG A;  3OWU A;  4MMX B;  1SJW A;  4EXR A;  1QVF 2;  2GU3 A;  4OK0 A;  3UJM A;  3CCJ 3;  1D6Y A;  3B4O A;  4FCM A;  1O7G B;  1EA2 A;  5BXQ A;  4JF8 A;  1Q40 B;  1FGT A;  2OOV C;  3H3H A;  3GZB A;  3NQY A;  3CD6 3;  1IVV A;  3UB1 A;  1LNH A;  2WGQ A;  3LTC A;  1NB5 I;  1SII A;  4WFO A;  2CWU A;  3G0K A;  2F98 A;  4O3V A;  3RDE A;  1S5A A;  3NBB A;  1STD A;  1TIJ A;  2W9Q A;  1K8A 4;  3IMA B;  1YIJ 3;  4O8S A;  4WP5 A;  3CC4 3;  2D42 A;  1W01 A;  5IG0 A;  2B24 B;  3V92 A;  2Q07 A;  1KQS 2;  4L8O A;  4LEH A;  3X3Y A;  3HK4 A;  5FGO A;  2OCT A;  4WWU C;  2IUK A;  5STD A;  3H51 A;  1VQK 3;  2Z77 A;  5DRV A;  2CFG A;  3F8X A;  1CEW I;  1W00 A;  4AKZ A;  1YJW 3;  1JV2 B;  1Y4K A;  2INX A;  3L0R A;  4FMC A;  1OHP A;  3CPW 2;  2IA7 A;  1CQS A;  2P38 A;  3NM7 A;  1ROV A;  1J2B A;  3CNM A;  3CCR 3;  4GB5 A;  1VQ6 3;  2XF3 A;  3PS8 A;  2IUJ A;  3FF0 A;  1NJI 4;  3GZX B;  2C10 A;  3MYT A;  1D6Z A;  1CYU A;  2HMM B;  3M8C A;  4IIA A;  1KSI A;  1AR0 A;  2WGO A;  1O7M B;  3WOE B;  2BT3 A;  1AVK A;  3ECF A;  3OV4 A;  5IEN A;  1OUN A;  1C7H A;  3FKA A;  4KFF A;  4R4K A;  3BND A;  3JVC A;  4O2H A;  1ISK A;  2BO9 B;  4TX4 A;  4EV2 A;  1D6U A;  1IQX A;  3FLJ A;  3KN4 A;  3LXU X;  5G2G A;  2P09 A;  2LQV A;  2QEX 3;  1RRL A;  3B7C A;  3NUV A;  3CC2 3;  3EHC A;  1DYU A;  3JUM A;  1WMP A;  3EN1 B;  1EG9 B;  1FUW A;  1IVU A;  5KP4 A;  3PYJ A;  3K63 A;  1O7W B;  2RFR A;  3OWY A;  3J7Y d;  5I97 A;  2CHC A;  1EKM A;  5D82 A;  5ELU A;  3BNE A;  1AVL A;  3DUK A;  3JUN A;  1Q42 A;  2P0M A;  3DY5 A;  3KSP A;  4KVH A;  3UNL A;  1FA3 A;  1QAK A;  1ZX2 A;  4LMI A;  3MHE A;  1GYB A;  1GS3 A;  3SED A;  1PFP A;  3CCE 3;  4N6V 0;  2BNG A;  4EC6 A;  1WMO A;  2CWV A;  1QAF A;  4FCJ A;  2HMO B;  3I0Y A;  1VQ7 3;  1IT7 A;  3DM8 A;  3MPH A;  2CK3 H;  3BLZ A;  3CCU 3;  1F8N A;  4HKV B;  4GL6 A;  3S5C A;  1SIH A;  3CCM 3;  1W6Y A;  3DZL A;  4R9K A;  1YI2 3;  3UL5 A;  1AV4 A;  1IU7 A;  4J8T A;  4XDW A;  3G71 3;  3PZW A;  4FCZ A;  3EX9 A;  3KII A;  5IER A;  1UI7 A;  2MF7 A;  3N54 B;  3N9H A;  2QA4 3;  4OUQ A;  7STD A;  2UX0 A;  2B1X B;  4AKY A;  2Z7A A;  2I9W A;  3CU3 A;  4MMZ B;  4HVN A;  1N8Q A;  1E3R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...