5IG0A

Crystal structure of s. rosetta camkii hub
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
131
structure length
131
Chain Sequence
VPAGPAKAVLEVNDELLKAVASGDWDAYTTMVDPNVTCFEPEAAGVLAKGLAFHKFFFDNRSPNADKMKTTLHDPAVQMFGDTAIVTALRVVQFVADDGPKTTRYEETRVWVKDAAFKFGWKLVHFHRSGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CAMK/CAMK2 protein kinase
publication title Molecular mechanism of activation-triggered subunit exchange in Ca(2+)/calmodulin-dependent protein kinase II.
pubmed doi rcsb
source organism Salpingoeca rosetta (strain atcc 50818 / bsb-021)
molecule tags Transferase
total genus 27
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2016-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08332 CaMKII_AD Calcium/calmodulin dependent protein kinase II association domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5ig0A00
3OX9A 5EVHA 1JN5A 3F14A 3OWUA 3SOYA 1E97A 2PZVA 2R4IA 2YFIB 5KP1A 1OF5A 3I0YA 5STDA 3EN1B 3F9SA 4PEJA 2GBXB 2Z76A 3MYTA 3LYGA 3MG2A 3E99A 3CPOA 2RCDA 2HMKB 1TP6A 3DZLA 2UX0A 4ORLA 2HMLB 3OV4A 1GY6A 3GWRA 3FZWA 5AIFA 3A76A 2HMJB 3KSPA 4HM1B 2BMQB 2BMRB 2RFRA 5AIGA 1GS3A 4KVHA 3LZAA 5AEWB 1VZZA 1S5AA 2K54A 3B4PA 1OUNA 3OXAA 4I4KA 1BUQA 3ECFA 1O7NB 2I9WA 4HM7B 5AIIA 1DMMA 3NV0B 2GEXA 3CNXA 4XBYA 1E3RA 4GB5A 1C7HA 3DUKA 3F7XA 1O7GB 4R9LA 4WYKA 3GZRA 3JUPA 3FKAA 5BXQA 3Q90A 1OHPA 5JPUA 4HKVB 5AI1A 2YFJB 5FW5A 3HK4A 1WQLB 2RGQA 2Z77A 1ZX2A 2GEYA 3EQQB 1U5OA 4WP5A 1Q42A 4WWUC 5D82A 3NBRA 3GZBA 1O7MB 2B1XB 2IMJA 2B24B 3B8LA 1O7WB 4H3UA 2HMNB 2W2CA 5DREA 4XDWA 3B4OA 3MHEA 6STDA 3KKGA 4J9AA 1E3VA 5KP4A 4RZMA 4X2HA 3DMCA 3G16A 3EF8A 5IF6A 2HMMB 5IEPA 2F86B 1OHSA 1W00A 3MKIA 2HMOB 3NHXA 3NV0A 5CF2A 3VGNA 1W02A 4R9KA 3FF0A 4HZ9B 5AEUB 4XB5A 3MG1A 3KZTA 1ULIB 3F7SA 4N3VA 4L8PA 3EN8A 4HJLB 1CQSA 1JB5A 3EJVA 5CK6A 3FSDA 2F99A 3ROBA 4HM8B 4FCJA 3EC9A 2OWPA 3T8UA 3GZYB 1OPYA 3NUVA 3EBTA 4U13A 1W6YA 3HX8A 5TGNA 4K1VA 1W01A 1Q40B 1NWWA 4HM5B 3EHCA 4Q53A 1HKXA 7STDA 3HZPA 4HZBB 1JB2A 5IEOA 1OGXA 2A15A 3B7CA 3NXJA 4HM0B 1EG9B 2XR8B 3JUOA 3OWSA 4IIAA 3JUNA 3JUQA 1OH0A 2STDA 3BB9A 3H3HA 1UUVB 4MJDA 1JKGB 1TUHA 4HM6B 4XBXA 4CDLA 4X2OA 3EBYA 4XM4A 4J8TA 1A2KA 5IERA 1ASKA 5G2GA 3JUMA 3KE7A 2GBWB 5BVBA 3F40A 1OHOA 1K41A 3GRDA 4L8OA 1ULJB 1EA2A 2BMOB 1Q40A 1STDA 1ZO2A 3H51A 4HVNA 3MG3A 5AIHA 1GY5A 4XBTA 5D83A 2Z7AA 8CHOA 4HM4B 1UUWB 3IPTA 3FH1A 3T8NA 3EX9A 3K0ZA 3NM2A 4LMIA 4K1UA 4LGQA 1NDOB 3SEDA 1QJGA 3D9RA 1IDPA 3M8CA 1O7HB 2XRXB 5DRVA 3VSYA 2QGUA 2CKFB 1NU3A 3UNLA 1OCVA 5IG5A 1JN5B 4XDVA 1OGZA 3G0KA 5CF1A 4R1KA 5D81A 1JKGA 2F98A 5CLKA 1OF5B 3F8XA 4HM2B 2BNGA 5IG4A 3MSOA 1AR0A 3RGRA 3OWYA 3SOAA 5CXOA 2CHCA 4LEHA 3F8HA 3RGAA 2XSOB 3GZXB 3G8ZA 3DXOA 1QMAA 3S5CA 5KP3A 3K7CA 5IENA 3CNMA 1DMQA 5HGRA 2YFLB 4OVMA 3ER7A 1DMNA 1JB4A 3STDA 3FGYA 2GXFA 1O7PB 2XSHB 4HM3B 5JPPA 3BLZA 3WMDA 3DM8A 3FF2A 2INXA 1SJWA 1GY7A 4L7KA 2QIYA 2JQ5A 1Z1SA 4WYKB 3CU3A 4OUQA 3UJMA 4STDA 5IG0A 3FLJA 1ISKA 5IG3A 4FCMA 1GYBA
chains in the Genus database with same CATH superfamily
1CYUA 1W7CA 3OX9A 5EVHA 1FA3A 1JN5A 1G02A 1UCLA 3BNEA 1UCJA 3F14A 2BIRA 1E97A 1FUTA 1Y4KA 2PZVA 1GYBA 2R4IA 1Q9EA 3DGYA 2YFIB 1OACA 3I563 2CW9A 2FGTA 1RNTA 5KP1A 2ZHXB 4JF8A 1OF5A 3I0YA 3NX0A 3EN1B 5AYRB 5STDA 4EBGA 3CCE3 3CC43 1B2XA 2W03A 3F9SA 1HU9A 2ML6A 2P05A 2OCTA 4PEJA 3K5TA 1I2GA 1QAKA 2GBXB 2XGNA 4BU4A 1VQ53 2CFGA 2Z76A 1B20A 1BNIA 2ZA4A 3MYTA 3LYGA 4R80A 3X3YA 2BO9B 3MG2A 5ELJA 3CCU3 3IJEB 2IY2A 3CPOA 3E99A 2RCDA 4FMDA 1BSDA 2CWVA 1WMNA 4CPKA 1YJ93 1YJW3 2HMKB 1NNVA 1MWRA 1TP6A 1R4YA 3AMOA 3DZLA 2UX0A 3LXUX 4FMCA 4ORLA 1YGWA 1JRQA 2HMLB 1KQS2 3OV4A 2W9PA 1RGHA 1GY6A 2CG0A 1LNHA 1AY7A 1VQ73 1DVDA 1YIT3 3GWRA 2H0IA 3KN4A 3FZWA 5AIFA 3A76A 2HMJB 4N6LA 1IV7A 1X1UA 1SARA 3KSPA 2KF6A 4HM1B 2BMQB 4EYCA 1LNIA 1VQM3 4IT7A 2BMRB 2CFKA 1LRAA 2WO0A 2RFRA 5AIGA 2Y74A 1T2IA 1GS3A 4KVHA 3WA3A 3LZAA 5AEWB 3G6E3 1VZZA 1S5AA 2SBLA 3GAXA 2P09A 1K28A 1FGOA 1TJDA 2K54A 4FMAA 3B4PA 4EW5A 2PNCA 3PCSA 1BNGA 1L5GB 3ALAA 3FG4A 1GSPA 1OUNA 2BT3A 3DGOA 3D3LA 3OXAA 4I4KA 4IPBA 3WODG 1N8R4 3ECFA 1BUQA 1JZDA 1I3IA 2CH9A 3BNBA 1O7NB 1IQYA 1V57A 2I9WA 4HBRA 4HM7B 5AIIA 2D1WA 1DMMA 1TRQA 3NV0B 2GEXA 3CNXA 4XBYA 4WHAA 2XH9A 1D6UA 4KFEA 1VQ43 1E3RA 4GB5A 1C7HA 1YIJ3 3DUKA 1BSCA 3A5EA 1O7GB 2WOFA 3F7XA 2CFDA 4R9LA 3K9MC 4WYKA 3GZRA 3AGOA 3JUPA 3FKAA 2K3DA 5BXQA 1B2SA 2W9QA 4RNYA 3IMAB 1QVG2 3Q90A 3K63A 1NB5I 1OHPA 2ML5A 5JPUA 1ROVA 1RJOA 4HKVB 2CWUA 4CJNA 5AI1A 1DETA 1KWIA 1B3SA 2YFJB 1RCLA 5EQLA 5FW5A 1VQ83 3HK4A 2RSXA 1YVBI 1EEJA 1WQLB 4FR9A 1I2EA 2RGQA 4O2HA 1B2ZA 3L0RA 1BGSA 1RGGA 3X41A 2Z77A 3I553 4WFOA 2CK3H 1JNQA 1ZX2A 1UGIA 2GEYA 3EQQB 4K90B 1KSIA 1U5OA 4WP5A 1Q42A 3BU4A 4WWUC 5D82A 1M1K4 4I5QA 3NBRA 2P38A 1FGQA 2KXGA 3JVCA 2Q07A 3Q3FA 4TX4A 4LYLB 3GZBA 1O7MB 2D42A 1RMSA 2B1XB 2IMJA 1IQXA 1PY3A 2B24B 1GMQA 1Q7HA 3B8LA 3O8YA 4FCZA 1O7WB 4LSOA 2KF5A 4H3UA 1MNLA 2E2TA 2HMNB 2W2CA 2OTL3 5JBSA 5DREA 1AVLA 4RNZA 3MWZA 1UW1A 3HIGA 4ILFA 2M7OA 1YHQ3 4XDWA 2P0XA 2F5WA 3B4OA 1GD4A 1MOLA 3HIIA 1RRLA 3ZG5A 3MHEA 6STDA 4O02B 3N9HA 1GMPA 3MPHA 3N8BA 1QALA 2R41A 4MMYB 1FGRA 3KKGA 4J9AA 1E3VA 1BANA 2CFLA 2L1SA 5KP4A 2OTJ3 1UUGB 4RZMA 1M9GA 3X40A 4X2HA 3CMA3 4O8SA 2XFTA 2J8XB 1RSNA 1FUSA 3DMCA 3DGMA 3EF8A 3G16A 1US1A 4J5GA 4NPBA 1I3FA 2HMMB 3WOFB 1RDSA 3X3ZA 1JZOA 3LT8A 1MGRA 3ZFZA 4EV5A 1JBRA 1IVVA 1BUJA 2CWTA 3S67A 1A2VA 3LTDA 3DY5A 3U97A 5IEPA 1SIIA 4N6OB 2F86B 2W04A 3CC23 2KF3A 1LOXA 1RGAA 1OHSA 1W00A 3KIIA 1BIRA 1UCIA 4RNTA 3MKIA 2HMOB 1RRHA 1LXEA 3NHXA 1CEWI 2UUGC 1V58A 3UL6A 1EUIC 3KCHA 1GMRA 4NREA 2W56B 3S28A 3NV0A 3CCS3 1RHLA 3HOHA 5CF2A 1UI8A 1BRGA 1B21A 1RTUA 3VGNA 1X1XA 1W02A 4JRFA 2AADA 3FF0A 4R9KA 3U1WA 4BL2A 4H61A 1CH0A 1W2ZA 4HZ9B 2WOHA 1YNVX 3N54B 1KC84 1RGEA 5AEUB 2W0QA 3VF1A 1QVF2 1N8QA 4XB5A 1T2HA 3MG1A 2OQEA 1JBSA 3KZTA 3BNCA 1B2MA 3NBJA 1ZGXA 2H0HA 1ULIB 4BTXA 2MC8A 1LVNA 3D79A 3F7SA 4DKIA 5BU4A 4N3VA 4L8PA 3EN8A 3NBBA 2JDIH 2QA43 1JBTA 4HJLB 1G0TA 1RN4A 5LC7A 1CQSA 1GOUA 1JB5A 3NQYA 1U8CB 1BVIA 1BOXA 1RGCA 3EJVA 5CK6A 1I0XA 5GSPA 1WTHA 3FSDA 3Q1CA 2F99A 3ROBA 4HM8B 4FCJA 1IK3A 1W5ZA 2XEPA 4MMXB 3LH4A 1R4CA 1UGHI 3EC9A 1RKYA 3PZWA 2OWPA 3GZYB 3T8UA 1OPYA 1HZ1A 3KSED 3LTBA 1VQL3 3NUVA 1Q7Y4 3CXC2 1F8NA 3AGNA 3EBTA 4U13A 1W6YA 2E2VA 2WGOA 3HX8A 1NO3A 1VQQA 5TGNA 4K1VA 1IT7A 3SXXA 2O3OA 3G713 3SVAA 1D6YA 2CIUA 1W01A 4KT3B 3G4S3 3WR2A 1RN1A 3KFQC 1WMOA 1PFPA 1I2FA 1UCKA 4R4KA 4BTWA 5M19A 1FGTA 1Q40B 1NB3I 1NWWA 2H0GA 1VQN3 4N6V0 1IT8A 1JV2B 1N5PA 4J5KA 1A2PA 1QAFA 4ZM8A 1W2B2 1G96A 4N6MA 2V1LA 3CD63 4HM5B 2WGQA 3EHCA 1D6ZA 1GD3A 2GU1A 4KZ1A 1TU5A 4Q53A 1HKXA 1AQZA 2OOVA 1JJ22 7STDA 3S27A 3V92A 3HZPA 5LC6A 2CC3A 4HZBB 4N6NB 1JB2A 3HI7A 4HYZA 2RBIA 1DYUA 5IEOA 1OGXA 2KCDA 2P0MA 2A15A 1ROAA 2CX1A 2O9UX 3B7CA 3NXJA 4HM0B 2W6JH 7RNTA 2W56A 1EG9B 2XR8B 3JUOA 3PCRA 3UB1A 2XF3A 1BU4A 2YX9A 3NQZA 3OWSA 4IIAA 1IYYA 1BRSA 1RGLA 3WDGB 2AAEA 3JUNA 2LQVA 9RNTA 5M1AA 3JUQA 1M1XB 1OH0A 3TDGA 3T0UA 2STDA 3PS8A 3BB9A 3H3HA 5BIRA 1UUVB 2Z6BA 4GHOA 4MJDA 1JKGB 4AKZA 1LQGC 1TUHA 2GSPA 3LTCA 1Q864 1KD14 2FXTA 1B27A 4HM6B 4GSPA 5G1KA 1A90A 4MMZB 2XFSA 4XBXA 1FYSA 5AYSC 3CCM3 4CDLA 4FMBA 4X2OA 3CCR3 2F56A 4LZIA 5A0OB 2HOHA 4N6TA 3EBYA 2OQEC 1EQKA 1B2UA 3AHSA 3GSPA 4J8TA 4XM4A 3LOYA 4EV2A 1BSEA 1A2KA 1T5YA 1ASKA 5IERA 3CCL3 3CPW2 3EB8A 1YI23 3JUMA 3KE7A 5G2GA 3SOYA 2IUJA 2CX0A 4AEQA 4HOHA 3BIRA 5HOHA 1STFI 3UL5A 2GBWB 1BAOA 1GOVA 4BIRA 5BVBA 3F40A 3LTAA 1BRNL 1RCKA 4OK0A 1C54A 3RDEA 2LYXA 1OHOA 1K41A 1M904 3FCSB 1N9EA 2BHMA 3GRDA 3URPA 4K61A 1BNJA 4L8OA 4EXRA 1RGFA 5EEOA 5RNTA 1AV4A 1CYVA 1ULJB 1DVCA 1EA2A 2BMOB 1RN7A 4G1MB 1IU7A 1J2BA 1Q40A 1LQMB 1STDA 1ZO2A 3H51A 4HVNA 3MG3A 3QRDA 1W6GA 1PYLA 1BNFA 3V99A 5AIHA 1GY5A 4XBTA 1VQP3 4QWTA 2Z7AA 5D83A 8CHOA 1UUWB 1TRPA 2F4YA 4HM4B 1VQO3 3IPTA 3FH1A 4O3VA 3PXMA 5FGOA 8RNTA 1BRHA 3SYUA 1X1YA 1AVKA 2FNQA 3T8NA 1IQ8A 3FG3A 3X42A 3EX9A 3K0ZA 3NM2A 4LMIA 3DGNA 4K1UA 4MEIA 2C10A 4LGQA 1I70A 1Q814 1WNHA 1I0VA 1NDOB 3SEDA 1QJGA 3D9RA 3BNDA 1WMPA 1IDPA 3LMLA 3M8CA 1V74A 5G1LA 1O7HB 2XRXB 5DRVA 3VSYA 2QGUA 2CKFB 4GL6A 1NU3A 2IYJA 3UNLA 2OOVC 3SLUA 1W4NA 1OCVA 3PGBA 5IG5A 1K8A4 1IVUA 1JN5B 4XDVA 2UGIA 1OGZA 3V98A 1LOYA 1SQWA 5I97A 1FUWA 2F5MA 1ZS7A 3G0KA 3SX1A 5CF1A 1PU4A 1EKMA 1SIHA 4R1KA 5D81A 1BNRA 3D5GA 1BNSA 1JKGA 2MF7A 3D5IA 2F98A 5CLKA 1OF5B 1FZUA 1MWSA 3F8XA 4CCVA 4HM2B 2ZL8A 3OW22 2BNGA 1UI7A 5IG4A 1YJN3 1IV9A 2K0MA 2E2UA 1YGEA 3DH2A 3MSOA 3WA2X 1RLSA 1RNBA 1AR0A 3RGRA 1W6CA 3OWYA 1LOVA 3SOAA 4N6UA 6RNTA 2KAAA 1MWTA 5CXOA 3PYJA 2CHCA 3RNTA 4LEHA 2KRTA 2CG1A 1GOYA 3CCV3 3F8HA 3RGAA 2XSOB 2ZDJA 1BRJA 3GZXB 3G8ZA 3AMOB 1X1WA 2RNTA 2IUKA 3DXOA 1QMAA 3S5CA 1LOWA 3X3XA 1BSBA 5KP3A 1A67A 3K7CA 3D4AA 1N9JA 2CFWA 1K734 3AHWA 5IENA 1RGKA 3OWUA 2XGLA 1TFKA 3CNMA 2C11A 1NJI4 2BU4A 5IW9A 1MGWA 1DMQA 1YVSA 5HGRA 4KFDA 1DE3A 1N5HA 2QEX3 4KFFA 1VQK3 1TFOA 1IVWA 2YFLB 4OVMA 3ER7A 1DMNA 1JB4A 2GU3A 3STDA 4EC6A 3WOEB 3EE1A 3FGYA 3FG1A 5IF6A 4RBNA 1VQ93 2GXFA 1O7PB 1SPUA 6GSPA 2XSHB 4HM3B 3J7Yd 3QK9A 1I8VA 3WHOA 2L4VA 5JPPA 3BLZA 5ELUA 3CC73 2Y73A 1BRIA 3WMDA 3DM8A 3FF2A 2INXA 1IVXA 1SJWA 3ZG0A 2SARA 3CME3 1GY7A 4L7KA 1Q824 1BSAA 1TIJA 3S29A 4BTYA 3DGLA 3LT9A 2QIYA 2JQ5A 1Z1SA 4WYKB 3CU3A 1BNEA 2KF4A 1FGMA 3NM7A 4AKYA 7GSPA 1FW7A 4OUQA 3UJMA 1MWUA 4STDA 4BL3A 5IG0A 1S723 3FLJA 1T3BA 1BRKA 1ISKA 1K9M4 4HAAA 5M18A 3CCQ3 2IA7A 3CCJ3 1HYFA 5IG3A 1TTOA 2C4BA 4FCMA 1VQ63 3Q2PA 1UDII 4NHFA
chains in the Genus database with same CATH topology
1CYUA 1W7CA 3OX9A 5EVHA 1FA3A 1JN5A 3BNEA 3F14A 3OWUA 3SOYA 1E97A 1Y4KA 2PZVA 2R4IA 2YFIB 1OACA 3I563 2CW9A 2FGTA 5KP1A 4JF8A 1OF5A 3I0YA 3NX0A 3EN1B 5AYRB 5STDA 4EBGA 3CCE3 3CC43 2W03A 3F9SA 1HU9A 2ML6A 2P05A 2OCTA 4PEJA 3K5TA 1QAKA 2GBXB 2XGNA 1VQ53 2CFGA 2Z76A 3MYTA 3LYGA 4R80A 3X3YA 2BO9B 3MG2A 5ELJA 3CCU3 3IJEB 3E99A 3CPOA 4FMDA 2RCDA 2CWVA 1WMNA 1YJ93 1YJW3 2HMKB 1TP6A 3AMOA 3DZLA 2UX0A 3LXUX 4FMCA 4ORLA 1JRQA 2HMLB 1KQS2 3OV4A 2W9PA 1GY6A 2CG0A 1LNHA 1VQ73 1DVDA 1YIT3 3GWRA 3KN4A 3FZWA 5AIFA 3A76A 2HMJB 4N6LA 1IV7A 3KSPA 4EYCA 4HM1B 2BMQB 1VQM3 4IT7A 2BMRB 2CFKA 2WO0A 2RFRA 5AIGA 2Y74A 1GS3A 4KVHA 3WA3A 3LZAA 5AEWB 3G6E3 1VZZA 1S5AA 2SBLA 3GAXA 2P09A 1K28A 1FGOA 2K54A 4FMAA 3B4PA 2PNCA 3PCSA 1L5GB 3ALAA 3FG4A 1OUNA 2BT3A 3DGOA 3OXAA 3D3LA 4I4KA 4IPBA 3WODG 1N8R4 1BUQA 3ECFA 3BNBA 2CH9A 4HBRA 1O7NB 1IQYA 2I9WA 4HM7B 5AIIA 2D1WA 1DMMA 3NV0B 2GEXA 3CNXA 4XBYA 4WHAA 2XH9A 1D6UA 4KFEA 1VQ43 1E3RA 4GB5A 1C7HA 1YIJ3 3DUKA 3F7XA 1O7GB 2WOFA 4R9LA 2CFDA 3K9MC 4WYKA 3GZRA 3JUPA 3FKAA 5BXQA 4RNYA 2W9QA 3IMAB 1QVG2 3Q90A 3K63A 1NB5I 1OHPA 2ML5A 5JPUA 1ROVA 1RJOA 4HKVB 2CWUA 5AI1A 1KWIA 2YFJB 5EQLA 5FW5A 1VQ83 3HK4A 2RSXA 1YVBI 1WQLB 4FR9A 2RGQA 4O2HA 3L0RA 3X41A 2Z77A 3I553 4WFOA 2CK3H 1JNQA 1ZX2A 2GEYA 4K90B 3EQQB 1KSIA 1U5OA 4WP5A 1Q42A 4WWUC 5D82A 1M1K4 3NBRA 2P38A 1FGQA 2KXGA 3JVCA 2Q07A 4TX4A 3GZBA 1O7MB 2D42A 2B1XB 2IMJA 1IQXA 2B24B 3B8LA 3O8YA 4FCZA 4LSOA 1O7WB 4H3UA 1MNLA 2E2TA 2HMNB 2W2CA 2OTL3 5JBSA 5DREA 1AVLA 4RNZA 3MWZA 1UW1A 3HIGA 2M7OA 1YHQ3 4XDWA 2P0XA 3B4OA 1GD4A 1MOLA 3HIIA 1RRLA 3MHEA 6STDA 4O02B 3N9HA 3MPHA 3N8BA 1QALA 4MMYB 1FGRA 3KKGA 4J9AA 1E3VA 2CFLA 5KP4A 2OTJ3 4RZMA 1M9GA 3X40A 4X2HA 3CMA3 4O8SA 2XFTA 3DMCA 3G16A 3DGMA 3EF8A 1US1A 5IF6A 2HMMB 4EV5A 3WOFB 3X3ZA 3LT8A 1IVVA 2CWTA 3S67A 1A2VA 3LTDA 3DY5A 3U97A 5IEPA 1SIIA 4N6OB 2F86B 2W04A 3CC23 1LOXA 1OHSA 1W00A 3KIIA 3MKIA 2HMOB 1RRHA 1LXEA 3NHXA 1CEWI 3UL6A 4NREA 2W56B 3S28A 3NV0A 3CCS3 5CF2A 1UI8A 3VGNA 1W02A 4JRFA 4R9KA 3FF0A 3U1WA 4H61A 1W2ZA 4HZ9B 2WOHA 3N54B 1KC84 5AEUB 2W0QA 3VF1A 1QVF2 1N8QA 4XB5A 3MG1A 2OQEA 3KZTA 3BNCA 3NBJA 1ULIB 4BTXA 2MC8A 1LVNA 3F7SA 4N3VA 4L8PA 3EN8A 3NBBA 2JDIH 2QA43 4HJLB 5LC7A 1CQSA 1JB5A 3NQYA 1U8CB 3EJVA 5CK6A 1WTHA 3FSDA 3Q1CA 2F99A 3ROBA 4HM8B 4FCJA 1IK3A 1W5ZA 2XEPA 4MMXB 3LH4A 1R4CA 3EC9A 1RKYA 3PZWA 2OWPA 3GZYB 3T8UA 1OPYA 3KSED 3LTBA 1VQL3 3NUVA 1Q7Y4 3CXC2 1F8NA 3EBTA 4U13A 1W6YA 2E2VA 2WGOA 3HX8A 1NO3A 5TGNA 4K1VA 1IT7A 2O3OA 3G713 3SVAA 1D6YA 2CIUA 1W01A 3G4S3 3KFQC 1WMOA 1PFPA 4R4KA 4BTWA 1FGTA 1Q40B 1NB3I 1NWWA 1VQN3 4N6V0 1IT8A 1JV2B 1N5PA 1QAFA 4ZM8A 1W2B2 1G96A 4N6MA 2V1LA 3CD63 4HM5B 2WGQA 3EHCA 1D6ZA 1GD3A 2GU1A 4KZ1A 1TU5A 4Q53A 1HKXA 2OOVA 1JJ22 7STDA 3S27A 3V92A 3HZPA 5LC6A 2CC3A 4HZBB 4N6NB 1JB2A 3HI7A 4HYZA 1DYUA 5IEOA 1OGXA 2KCDA 2P0MA 2A15A 1ROAA 2O9UX 3B7CA 3NXJA 4HM0B 3SXXA 2W6JH 2W56A 1EG9B 2XR8B 3JUOA 3PCRA 3UB1A 2XF3A 2YX9A 3NQZA 3OWSA 4IIAA 3WDGB 3JUNA 2LQVA 3JUQA 1M1XB 1OH0A 3TDGA 3T0UA 2STDA 3PS8A 3BB9A 3H3HA 1UUVB 2Z6BA 4MJDA 1JKGB 4AKZA 1TUHA 3LTCA 1Q864 1KD14 2FXTA 4HM6B 1A90A 4MMZB 2XFSA 4XBXA 5AYSC 3CCM3 4CDLA 4FMBA 4X2OA 3CCR3 4LZIA 5A0OB 4N6TA 3EBYA 2OQEC 1EQKA 4XM4A 4J8TA 4EV2A 3LOYA 1A2KA 1T5YA 1ASKA 5IERA 3CCL3 3CPW2 3EB8A 1YI23 3JUMA 3KE7A 5G2GA 2IUJA 4AEQA 1STFI 3UL5A 2GBWB 5BVBA 3F40A 3LTAA 4OK0A 3RDEA 2LYXA 1OHOA 1K41A 1M904 3FCSB 1N9EA 2BHMA 3GRDA 4K61A 4L8OA 4EXRA 5EEOA 1AV4A 1CYVA 1ULJB 1DVCA 1EA2A 2BMOB 1RN7A 4G1MB 1IU7A 1J2BA 1Q40A 1STDA 1ZO2A 3H51A 4HVNA 3MG3A 3QRDA 1W6GA 3V99A 5AIHA 1GY5A 4XBTA 1VQP3 4QWTA 2Z7AA 5D83A 8CHOA 1UUWB 4HM4B 1VQO3 3IPTA 3FH1A 4O3VA 3PXMA 5FGOA 2FNQA 1AVKA 3T8NA 1IQ8A 3FG3A 3X42A 3EX9A 3K0ZA 3NM2A 4LMIA 3DGNA 4K1UA 4MEIA 2C10A 4LGQA 1Q814 1WNHA 1NDOB 3SEDA 1QJGA 3D9RA 3BNDA 1WMPA 1IDPA 3LMLA 3M8CA 1V74A 1O7HB 2XRXB 5DRVA 3VSYA 2QGUA 2CKFB 4GL6A 1NU3A 3UNLA 2OOVC 3SLUA 1W4NA 1OCVA 3PGBA 5IG5A 1K8A4 1IVUA 1JN5B 4XDVA 1OGZA 3V98A 1SQWA 5I97A 1FUWA 3G0KA 3SX1A 5CF1A 1PU4A 1EKMA 1SIHA 4R1KA 5D81A 1JKGA 2MF7A 2F98A 5CLKA 1OF5B 3F8XA 4CCVA 4HM2B 2ZL8A 3OW22 2BNGA 1UI7A 5IG4A 1YJN3 1IV9A 2K0MA 2E2UA 1YGEA 3MSOA 3WA2X 1AR0A 3RGRA 1W6CA 3OWYA 3SOAA 4N6UA 5CXOA 3PYJA 2CHCA 4LEHA 2KRTA 2CG1A 3CCV3 3F8HA 3RGAA 2XSOB 2ZDJA 3GZXB 3G8ZA 3AMOB 2IUKA 3DXOA 1QMAA 3S5CA 3X3XA 5KP3A 1A67A 3K7CA 1N9JA 2CFWA 1K734 5IENA 2XGLA 1TFKA 3CNMA 2C11A 1NJI4 5IW9A 1DMQA 5HGRA 4KFDA 1N5HA 2QEX3 4KFFA 1VQK3 1TFOA 1IVWA 2YFLB 4OVMA 3ER7A 1DMNA 1JB4A 2GU3A 3STDA 4EC6A 3WOEB 3EE1A 3FGYA 3FG1A 4RBNA 1VQ93 2GXFA 1O7PB 1SPUA 2XSHB 4HM3B 3J7Yd 3QK9A 2L4VA 5JPPA 3BLZA 5ELUA 3CC73 2Y73A 3WMDA 3DM8A 3FF2A 2INXA 1IVXA 1SJWA 3CME3 1GY7A 4L7KA 1Q824 1TIJA 3S29A 4BTYA 3DGLA 3LT9A 2QIYA 2JQ5A 1Z1SA 4WYKB 3CU3A 4AKYA 1FGMA 3NM7A 4OUQA 3UJMA 4STDA 5IG0A 1S723 3FLJA 1ISKA 1K9M4 3CCQ3 2IA7A 3CCJ3 5IG3A 4FCMA 1VQ63 3Q2PA 1GYBA 4NHFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OX9 A;  5EVH A;  1JN5 A;  3F14 A;  3OWU A;  3SOY A;  1E97 A;  2PZV A;  2R4I A;  2YFI B;  5KP1 A;  1OF5 A;  3I0Y A;  5STD A;  3EN1 B;  3F9S A;  4PEJ A;  2GBX B;  2Z76 A;  3MYT A;  3LYG A;  3MG2 A;  3E99 A;  3CPO A;  2RCD A;  2HMK B;  1TP6 A;  3DZL A;  2UX0 A;  4ORL A;  2HML B;  3OV4 A;  1GY6 A;  3GWR A;  3FZW A;  5AIF A;  3A76 A;  2HMJ B;  3KSP A;  4HM1 B;  2BMQ B;  2BMR B;  2RFR A;  5AIG A;  1GS3 A;  4KVH A;  3LZA A;  5AEW B;  1VZZ A;  1S5A A;  2K54 A;  3B4P A;  1OUN A;  3OXA A;  4I4K A;  1BUQ A;  3ECF A;  1O7N B;  2I9W A;  4HM7 B;  5AII A;  1DMM A;  3NV0 B;  2GEX A;  3CNX A;  4XBY A;  1E3R A;  4GB5 A;  1C7H A;  3DUK A;  3F7X A;  1O7G B;  4R9L A;  4WYK A;  3GZR A;  3JUP A;  3FKA A;  5BXQ A;  3Q90 A;  1OHP A;  5JPU A;  4HKV B;  5AI1 A;  2YFJ B;  5FW5 A;  3HK4 A;  1WQL B;  2RGQ A;  2Z77 A;  1ZX2 A;  2GEY A;  3EQQ B;  1U5O A;  4WP5 A;  1Q42 A;  4WWU C;  5D82 A;  3NBR A;  3GZB A;  1O7M B;  2B1X B;  2IMJ A;  2B24 B;  3B8L A;  1O7W B;  4H3U A;  2HMN B;  2W2C A;  5DRE A;  4XDW A;  3B4O A;  3MHE A;  6STD A;  3KKG A;  4J9A A;  1E3V A;  5KP4 A;  4RZM A;  4X2H A;  3DMC A;  3G16 A;  3EF8 A;  5IF6 A;  2HMM B;  5IEP A;  2F86 B;  1OHS A;  1W00 A;  3MKI A;  2HMO B;  3NHX A;  3NV0 A;  5CF2 A;  3VGN A;  1W02 A;  4R9K A;  3FF0 A;  4HZ9 B;  5AEU B;  4XB5 A;  3MG1 A;  3KZT A;  1ULI B;  3F7S A;  4N3V A;  4L8P A;  3EN8 A;  4HJL B;  1CQS A;  1JB5 A;  3EJV A;  5CK6 A;  3FSD A;  2F99 A;  3ROB A;  4HM8 B;  4FCJ A;  3EC9 A;  2OWP A;  3T8U A;  3GZY B;  1OPY A;  3NUV A;  3EBT A;  4U13 A;  1W6Y A;  3HX8 A;  5TGN A;  4K1V A;  1W01 A;  1Q40 B;  1NWW A;  4HM5 B;  3EHC A;  4Q53 A;  1HKX A;  7STD A;  3HZP A;  4HZB B;  1JB2 A;  5IEO A;  1OGX A;  2A15 A;  3B7C A;  3NXJ A;  4HM0 B;  1EG9 B;  2XR8 B;  3JUO A;  3OWS A;  4IIA A;  3JUN A;  3JUQ A;  1OH0 A;  2STD A;  3BB9 A;  3H3H A;  1UUV B;  4MJD A;  1JKG B;  1TUH A;  4HM6 B;  4XBX A;  4CDL A;  4X2O A;  3EBY A;  4XM4 A;  4J8T A;  1A2K A;  5IER A;  1ASK A;  5G2G A;  3JUM A;  3KE7 A;  2GBW B;  5BVB A;  3F40 A;  1OHO A;  1K41 A;  3GRD A;  4L8O A;  1ULJ B;  1EA2 A;  2BMO B;  1Q40 A;  1STD A;  1ZO2 A;  3H51 A;  4HVN A;  3MG3 A;  5AIH A;  1GY5 A;  4XBT A;  5D83 A;  2Z7A A;  8CHO A;  4HM4 B;  1UUW B;  3IPT A;  3FH1 A;  3T8N A;  3EX9 A;  3K0Z A;  3NM2 A;  4LMI A;  4K1U A;  4LGQ A;  1NDO B;  3SED A;  1QJG A;  3D9R A;  1IDP A;  3M8C A;  1O7H B;  2XRX B;  5DRV A;  3VSY A;  2QGU A;  2CKF B;  1NU3 A;  3UNL A;  1OCV A;  5IG5 A;  1JN5 B;  4XDV A;  1OGZ A;  3G0K A;  5CF1 A;  4R1K A;  5D81 A;  1JKG A;  2F98 A;  5CLK A;  1OF5 B;  3F8X A;  4HM2 B;  2BNG A;  5IG4 A;  3MSO A;  1AR0 A;  3RGR A;  3OWY A;  3SOA A;  5CXO A;  2CHC A;  4LEH A;  3F8H A;  3RGA A;  2XSO B;  3GZX B;  3G8Z A;  3DXO A;  1QMA A;  3S5C A;  5KP3 A;  3K7C A;  5IEN A;  3CNM A;  1DMQ A;  5HGR A;  2YFL B;  4OVM A;  3ER7 A;  1DMN A;  1JB4 A;  3STD A;  3FGY A;  2GXF A;  1O7P B;  2XSH B;  4HM3 B;  5JPP A;  3BLZ A;  3WMD A;  3DM8 A;  3FF2 A;  2INX A;  1SJW A;  1GY7 A;  4L7K A;  2QIY A;  2JQ5 A;  1Z1S A;  4WYK B;  3CU3 A;  4OUQ A;  3UJM A;  4STD A;  5IG0 A;  3FLJ A;  1ISK A;  5IG3 A;  4FCM A;  1GYB A; 
#chains in the Genus database with same CATH topology
 1CYU A;  1W7C A;  3OX9 A;  5EVH A;  1FA3 A;  1JN5 A;  1G02 A;  1UCL A;  3BNE A;  1UCJ A;  3F14 A;  2BIR A;  1E97 A;  1FUT A;  1Y4K A;  2PZV A;  1GYB A;  2R4I A;  1Q9E A;  3DGY A;  2YFI B;  1OAC A;  3I56 3;  2CW9 A;  2FGT A;  1RNT A;  5KP1 A;  2ZHX B;  4JF8 A;  1OF5 A;  3I0Y A;  3NX0 A;  3EN1 B;  5AYR B;  5STD A;  4EBG A;  3CCE 3;  3CC4 3;  1B2X A;  2W03 A;  3F9S A;  1HU9 A;  2ML6 A;  2P05 A;  2OCT A;  4PEJ A;  3K5T A;  1I2G A;  1QAK A;  2GBX B;  2XGN A;  4BU4 A;  1VQ5 3;  2CFG A;  2Z76 A;  1B20 A;  1BNI A;  2ZA4 A;  3MYT A;  3LYG A;  4R80 A;  3X3Y A;  2BO9 B;  3MG2 A;  5ELJ A;  3CCU 3;  3IJE B;  2IY2 A;  3CPO A;  3E99 A;  2RCD A;  4FMD A;  1BSD A;  2CWV A;  1WMN A;  4CPK A;  1YJ9 3;  1YJW 3;  2HMK B;  1NNV A;  1MWR A;  1TP6 A;  1R4Y A;  3AMO A;  3DZL A;  2UX0 A;  3LXU X;  4FMC A;  4ORL A;  1YGW A;  1JRQ A;  2HML B;  1KQS 2;  3OV4 A;  2W9P A;  1RGH A;  1GY6 A;  2CG0 A;  1LNH A;  1AY7 A;  1VQ7 3;  1DVD A;  1YIT 3;  3GWR A;  2H0I A;  3KN4 A;  3FZW A;  5AIF A;  3A76 A;  2HMJ B;  4N6L A;  1IV7 A;  1X1U A;  1SAR A;  3KSP A;  2KF6 A;  4HM1 B;  2BMQ B;  4EYC A;  1LNI A;  1VQM 3;  4IT7 A;  2BMR B;  2CFK A;  1LRA A;  2WO0 A;  2RFR A;  5AIG A;  2Y74 A;  1T2I A;  1GS3 A;  4KVH A;  3WA3 A;  3LZA A;  5AEW B;  3G6E 3;  1VZZ A;  1S5A A;  2SBL A;  3GAX A;  2P09 A;  1K28 A;  1FGO A;  1TJD A;  2K54 A;  4FMA A;  3B4P A;  4EW5 A;  2PNC A;  3PCS A;  1BNG A;  1L5G B;  3ALA A;  3FG4 A;  1GSP A;  1OUN A;  2BT3 A;  3DGO A;  3D3L A;  3OXA A;  4I4K A;  4IPB A;  3WOD G;  1N8R 4;  3ECF A;  1BUQ A;  1JZD A;  1I3I A;  2CH9 A;  3BNB A;  1O7N B;  1IQY A;  1V57 A;  2I9W A;  4HBR A;  4HM7 B;  5AII A;  2D1W A;  1DMM A;  1TRQ A;  3NV0 B;  2GEX A;  3CNX A;  4XBY A;  4WHA A;  2XH9 A;  1D6U A;  4KFE A;  1VQ4 3;  1E3R A;  4GB5 A;  1C7H A;  1YIJ 3;  3DUK A;  1BSC A;  3A5E A;  1O7G B;  2WOF A;  3F7X A;  2CFD A;  4R9L A;  3K9M C;  4WYK A;  3GZR A;  3AGO A;  3JUP A;  3FKA A;  2K3D A;  5BXQ A;  1B2S A;  2W9Q A;  4RNY A;  3IMA B;  1QVG 2;  3Q90 A;  3K63 A;  1NB5 I;  1OHP A;  2ML5 A;  5JPU A;  1ROV A;  1RJO A;  4HKV B;  2CWU A;  4CJN A;  5AI1 A;  1DET A;  1KWI A;  1B3S A;  2YFJ B;  1RCL A;  5EQL A;  5FW5 A;  1VQ8 3;  3HK4 A;  2RSX A;  1YVB I;  1EEJ A;  1WQL B;  4FR9 A;  1I2E A;  2RGQ A;  4O2H A;  1B2Z A;  3L0R A;  1BGS A;  1RGG A;  3X41 A;  2Z77 A;  3I55 3;  4WFO A;  2CK3 H;  1JNQ A;  1ZX2 A;  1UGI A;  2GEY A;  3EQQ B;  4K90 B;  1KSI A;  1U5O A;  4WP5 A;  1Q42 A;  3BU4 A;  4WWU C;  5D82 A;  1M1K 4;  4I5Q A;  3NBR A;  2P38 A;  1FGQ A;  2KXG A;  3JVC A;  2Q07 A;  3Q3F A;  4TX4 A;  4LYL B;  3GZB A;  1O7M B;  2D42 A;  1RMS A;  2B1X B;  2IMJ A;  1IQX A;  1PY3 A;  2B24 B;  1GMQ A;  1Q7H A;  3B8L A;  3O8Y A;  4FCZ A;  1O7W B;  4LSO A;  2KF5 A;  4H3U A;  1MNL A;  2E2T A;  2HMN B;  2W2C A;  2OTL 3;  5JBS A;  5DRE A;  1AVL A;  4RNZ A;  3MWZ A;  1UW1 A;  3HIG A;  4ILF A;  2M7O A;  1YHQ 3;  4XDW A;  2P0X A;  2F5W A;  3B4O A;  1GD4 A;  1MOL A;  3HII A;  1RRL A;  3ZG5 A;  3MHE A;  6STD A;  4O02 B;  3N9H A;  1GMP A;  3MPH A;  3N8B A;  1QAL A;  2R41 A;  4MMY B;  1FGR A;  3KKG A;  4J9A A;  1E3V A;  1BAN A;  2CFL A;  2L1S A;  5KP4 A;  2OTJ 3;  1UUG B;  4RZM A;  1M9G A;  3X40 A;  4X2H A;  3CMA 3;  4O8S A;  2XFT A;  2J8X B;  1RSN A;  1FUS A;  3DMC A;  3DGM A;  3EF8 A;  3G16 A;  1US1 A;  4J5G A;  4NPB A;  1I3F A;  2HMM B;  3WOF B;  1RDS A;  3X3Z A;  1JZO A;  3LT8 A;  1MGR A;  3ZFZ A;  4EV5 A;  1JBR A;  1IVV A;  1BUJ A;  2CWT A;  3S67 A;  1A2V A;  3LTD A;  3DY5 A;  3U97 A;  5IEP A;  1SII A;  4N6O B;  2F86 B;  2W04 A;  3CC2 3;  2KF3 A;  1LOX A;  1RGA A;  1OHS A;  1W00 A;  3KII A;  1BIR A;  1UCI A;  4RNT A;  3MKI A;  2HMO B;  1RRH A;  1LXE A;  3NHX A;  1CEW I;  2UUG C;  1V58 A;  3UL6 A;  1EUI C;  3KCH A;  1GMR A;  4NRE A;  2W56 B;  3S28 A;  3NV0 A;  3CCS 3;  1RHL A;  3HOH A;  5CF2 A;  1UI8 A;  1BRG A;  1B21 A;  1RTU A;  3VGN A;  1X1X A;  1W02 A;  4JRF A;  2AAD A;  3FF0 A;  4R9K A;  3U1W A;  4BL2 A;  4H61 A;  1CH0 A;  1W2Z A;  4HZ9 B;  2WOH A;  1YNV X;  3N54 B;  1KC8 4;  1RGE A;  5AEU B;  2W0Q A;  3VF1 A;  1QVF 2;  1N8Q A;  4XB5 A;  1T2H A;  3MG1 A;  2OQE A;  1JBS A;  3KZT A;  3BNC A;  1B2M A;  3NBJ A;  1ZGX A;  2H0H A;  1ULI B;  4BTX A;  2MC8 A;  1LVN A;  3D79 A;  3F7S A;  4DKI A;  5BU4 A;  4N3V A;  4L8P A;  3EN8 A;  3NBB A;  2JDI H;  2QA4 3;  1JBT A;  4HJL B;  1G0T A;  1RN4 A;  5LC7 A;  1CQS A;  1GOU A;  1JB5 A;  3NQY A;  1U8C B;  1BVI A;  1BOX A;  1RGC A;  3EJV A;  5CK6 A;  1I0X A;  5GSP A;  1WTH A;  3FSD A;  3Q1C A;  2F99 A;  3ROB A;  4HM8 B;  4FCJ A;  1IK3 A;  1W5Z A;  2XEP A;  4MMX B;  3LH4 A;  1R4C A;  1UGH I;  3EC9 A;  1RKY A;  3PZW A;  2OWP A;  3GZY B;  3T8U A;  1OPY A;  1HZ1 A;  3KSE D;  3LTB A;  1VQL 3;  3NUV A;  1Q7Y 4;  3CXC 2;  1F8N A;  3AGN A;  3EBT A;  4U13 A;  1W6Y A;  2E2V A;  2WGO A;  3HX8 A;  1NO3 A;  1VQQ A;  5TGN A;  4K1V A;  1IT7 A;  3SXX A;  2O3O A;  3G71 3;  3SVA A;  1D6Y A;  2CIU A;  1W01 A;  4KT3 B;  3G4S 3;  3WR2 A;  1RN1 A;  3KFQ C;  1WMO A;  1PFP A;  1I2F A;  1UCK A;  4R4K A;  4BTW A;  5M19 A;  1FGT A;  1Q40 B;  1NB3 I;  1NWW A;  2H0G A;  1VQN 3;  4N6V 0;  1IT8 A;  1JV2 B;  1N5P A;  4J5K A;  1A2P A;  1QAF A;  4ZM8 A;  1W2B 2;  1G96 A;  4N6M A;  2V1L A;  3CD6 3;  4HM5 B;  2WGQ A;  3EHC A;  1D6Z A;  1GD3 A;  2GU1 A;  4KZ1 A;  1TU5 A;  4Q53 A;  1HKX A;  1AQZ A;  2OOV A;  1JJ2 2;  7STD A;  3S27 A;  3V92 A;  3HZP A;  5LC6 A;  2CC3 A;  4HZB B;  4N6N B;  1JB2 A;  3HI7 A;  4HYZ A;  2RBI A;  1DYU A;  5IEO A;  1OGX A;  2KCD A;  2P0M A;  2A15 A;  1ROA A;  2CX1 A;  2O9U X;  3B7C A;  3NXJ A;  4HM0 B;  2W6J H;  7RNT A;  2W56 A;  1EG9 B;  2XR8 B;  3JUO A;  3PCR A;  3UB1 A;  2XF3 A;  1BU4 A;  2YX9 A;  3NQZ A;  3OWS A;  4IIA A;  1IYY A;  1BRS A;  1RGL A;  3WDG B;  2AAE A;  3JUN A;  2LQV A;  9RNT A;  5M1A A;  3JUQ A;  1M1X B;  1OH0 A;  3TDG A;  3T0U A;  2STD A;  3PS8 A;  3BB9 A;  3H3H A;  5BIR A;  1UUV B;  2Z6B A;  4GHO A;  4MJD A;  1JKG B;  4AKZ A;  1LQG C;  1TUH A;  2GSP A;  3LTC A;  1Q86 4;  1KD1 4;  2FXT A;  1B27 A;  4HM6 B;  4GSP A;  5G1K A;  1A90 A;  4MMZ B;  2XFS A;  4XBX A;  1FYS A;  5AYS C;  3CCM 3;  4CDL A;  4FMB A;  4X2O A;  3CCR 3;  2F56 A;  4LZI A;  5A0O B;  2HOH A;  4N6T A;  3EBY A;  2OQE C;  1EQK A;  1B2U A;  3AHS A;  3GSP A;  4J8T A;  4XM4 A;  3LOY A;  4EV2 A;  1BSE A;  1A2K A;  1T5Y A;  1ASK A;  5IER A;  3CCL 3;  3CPW 2;  3EB8 A;  1YI2 3;  3JUM A;  3KE7 A;  5G2G A;  3SOY A;  2IUJ A;  2CX0 A;  4AEQ A;  4HOH A;  3BIR A;  5HOH A;  1STF I;  3UL5 A;  2GBW B;  1BAO A;  1GOV A;  4BIR A;  5BVB A;  3F40 A;  3LTA A;  1BRN L;  1RCK A;  4OK0 A;  1C54 A;  3RDE A;  2LYX A;  1OHO A;  1K41 A;  1M90 4;  3FCS B;  1N9E A;  2BHM A;  3GRD A;  3URP A;  4K61 A;  1BNJ A;  4L8O A;  4EXR A;  1RGF A;  5EEO A;  5RNT A;  1AV4 A;  1CYV A;  1ULJ B;  1DVC A;  1EA2 A;  2BMO B;  1RN7 A;  4G1M B;  1IU7 A;  1J2B A;  1Q40 A;  1LQM B;  1STD A;  1ZO2 A;  3H51 A;  4HVN A;  3MG3 A;  3QRD A;  1W6G A;  1PYL A;  1BNF A;  3V99 A;  5AIH A;  1GY5 A;  4XBT A;  1VQP 3;  4QWT A;  2Z7A A;  5D83 A;  8CHO A;  1UUW B;  1TRP A;  2F4Y A;  4HM4 B;  1VQO 3;  3IPT A;  3FH1 A;  4O3V A;  3PXM A;  5FGO A;  8RNT A;  1BRH A;  3SYU A;  1X1Y A;  1AVK A;  2FNQ A;  3T8N A;  1IQ8 A;  3FG3 A;  3X42 A;  3EX9 A;  3K0Z A;  3NM2 A;  4LMI A;  3DGN A;  4K1U A;  4MEI A;  2C10 A;  4LGQ A;  1I70 A;  1Q81 4;  1WNH A;  1I0V A;  1NDO B;  3SED A;  1QJG A;  3D9R A;  3BND A;  1WMP A;  1IDP A;  3LML A;  3M8C A;  1V74 A;  5G1L A;  1O7H B;  2XRX B;  5DRV A;  3VSY A;  2QGU A;  2CKF B;  4GL6 A;  1NU3 A;  2IYJ A;  3UNL A;  2OOV C;  3SLU A;  1W4N A;  1OCV A;  3PGB A;  5IG5 A;  1K8A 4;  1IVU A;  1JN5 B;  4XDV A;  2UGI A;  1OGZ A;  3V98 A;  1LOY A;  1SQW A;  5I97 A;  1FUW A;  2F5M A;  1ZS7 A;  3G0K A;  3SX1 A;  5CF1 A;  1PU4 A;  1EKM A;  1SIH A;  4R1K A;  5D81 A;  1BNR A;  3D5G A;  1BNS A;  1JKG A;  2MF7 A;  3D5I A;  2F98 A;  5CLK A;  1OF5 B;  1FZU A;  1MWS A;  3F8X A;  4CCV A;  4HM2 B;  2ZL8 A;  3OW2 2;  2BNG A;  1UI7 A;  5IG4 A;  1YJN 3;  1IV9 A;  2K0M A;  2E2U A;  1YGE A;  3DH2 A;  3MSO A;  3WA2 X;  1RLS A;  1RNB A;  1AR0 A;  3RGR A;  1W6C A;  3OWY A;  1LOV A;  3SOA A;  4N6U A;  6RNT A;  2KAA A;  1MWT A;  5CXO A;  3PYJ A;  2CHC A;  3RNT A;  4LEH A;  2KRT A;  2CG1 A;  1GOY A;  3CCV 3;  3F8H A;  3RGA A;  2XSO B;  2ZDJ A;  1BRJ A;  3GZX B;  3G8Z A;  3AMO B;  1X1W A;  2RNT A;  2IUK A;  3DXO A;  1QMA A;  3S5C A;  1LOW A;  3X3X A;  1BSB A;  5KP3 A;  1A67 A;  3K7C A;  3D4A A;  1N9J A;  2CFW A;  1K73 4;  3AHW A;  5IEN A;  1RGK A;  3OWU A;  2XGL A;  1TFK A;  3CNM A;  2C11 A;  1NJI 4;  2BU4 A;  5IW9 A;  1MGW A;  1DMQ A;  1YVS A;  5HGR A;  4KFD A;  1DE3 A;  1N5H A;  2QEX 3;  4KFF A;  1VQK 3;  1TFO A;  1IVW A;  2YFL B;  4OVM A;  3ER7 A;  1DMN A;  1JB4 A;  2GU3 A;  3STD A;  4EC6 A;  3WOE B;  3EE1 A;  3FGY A;  3FG1 A;  5IF6 A;  4RBN A;  1VQ9 3;  2GXF A;  1O7P B;  1SPU A;  6GSP A;  2XSH B;  4HM3 B;  3J7Y d;  3QK9 A;  1I8V A;  3WHO A;  2L4V A;  5JPP A;  3BLZ A;  5ELU A;  3CC7 3;  2Y73 A;  1BRI A;  3WMD A;  3DM8 A;  3FF2 A;  2INX A;  1IVX A;  1SJW A;  3ZG0 A;  2SAR A;  3CME 3;  1GY7 A;  4L7K A;  1Q82 4;  1BSA A;  1TIJ A;  3S29 A;  4BTY A;  3DGL A;  3LT9 A;  2QIY A;  2JQ5 A;  1Z1S A;  4WYK B;  3CU3 A;  1BNE A;  2KF4 A;  1FGM A;  3NM7 A;  4AKY A;  7GSP A;  1FW7 A;  4OUQ A;  3UJM A;  1MWU A;  4STD A;  4BL3 A;  5IG0 A;  1S72 3;  3FLJ A;  1T3B A;  1BRK A;  1ISK A;  1K9M 4;  4HAA A;  5M18 A;  3CCQ 3;  2IA7 A;  3CCJ 3;  1HYF A;  5IG3 A;  1TTO A;  2C4B A;  4FCM A;  1VQ6 3;  3Q2P A;  1UDI I;  4NHF A; 
#chains in the Genus database with same CATH homology
 1CYU A;  1W7C A;  3OX9 A;  5EVH A;  1FA3 A;  1JN5 A;  3BNE A;  3F14 A;  3OWU A;  3SOY A;  1E97 A;  1Y4K A;  2PZV A;  2R4I A;  2YFI B;  1OAC A;  3I56 3;  2CW9 A;  2FGT A;  5KP1 A;  4JF8 A;  1OF5 A;  3I0Y A;  3NX0 A;  3EN1 B;  5AYR B;  5STD A;  4EBG A;  3CCE 3;  3CC4 3;  2W03 A;  3F9S A;  1HU9 A;  2ML6 A;  2P05 A;  2OCT A;  4PEJ A;  3K5T A;  1QAK A;  2GBX B;  2XGN A;  1VQ5 3;  2CFG A;  2Z76 A;  3MYT A;  3LYG A;  4R80 A;  3X3Y A;  2BO9 B;  3MG2 A;  5ELJ A;  3CCU 3;  3IJE B;  3E99 A;  3CPO A;  4FMD A;  2RCD A;  2CWV A;  1WMN A;  1YJ9 3;  1YJW 3;  2HMK B;  1TP6 A;  3AMO A;  3DZL A;  2UX0 A;  3LXU X;  4FMC A;  4ORL A;  1JRQ A;  2HML B;  1KQS 2;  3OV4 A;  2W9P A;  1GY6 A;  2CG0 A;  1LNH A;  1VQ7 3;  1DVD A;  1YIT 3;  3GWR A;  3KN4 A;  3FZW A;  5AIF A;  3A76 A;  2HMJ B;  4N6L A;  1IV7 A;  3KSP A;  4EYC A;  4HM1 B;  2BMQ B;  1VQM 3;  4IT7 A;  2BMR B;  2CFK A;  2WO0 A;  2RFR A;  5AIG A;  2Y74 A;  1GS3 A;  4KVH A;  3WA3 A;  3LZA A;  5AEW B;  3G6E 3;  1VZZ A;  1S5A A;  2SBL A;  3GAX A;  2P09 A;  1K28 A;  1FGO A;  2K54 A;  4FMA A;  3B4P A;  2PNC A;  3PCS A;  1L5G B;  3ALA A;  3FG4 A;  1OUN A;  2BT3 A;  3DGO A;  3OXA A;  3D3L A;  4I4K A;  4IPB A;  3WOD G;  1N8R 4;  1BUQ A;  3ECF A;  3BNB A;  2CH9 A;  4HBR A;  1O7N B;  1IQY A;  2I9W A;  4HM7 B;  5AII A;  2D1W A;  1DMM A;  3NV0 B;  2GEX A;  3CNX A;  4XBY A;  4WHA A;  2XH9 A;  1D6U A;  4KFE A;  1VQ4 3;  1E3R A;  4GB5 A;  1C7H A;  1YIJ 3;  3DUK A;  3F7X A;  1O7G B;  2WOF A;  4R9L A;  2CFD A;  3K9M C;  4WYK A;  3GZR A;  3JUP A;  3FKA A;  5BXQ A;  4RNY A;  2W9Q A;  3IMA B;  1QVG 2;  3Q90 A;  3K63 A;  1NB5 I;  1OHP A;  2ML5 A;  5JPU A;  1ROV A;  1RJO A;  4HKV B;  2CWU A;  5AI1 A;  1KWI A;  2YFJ B;  5EQL A;  5FW5 A;  1VQ8 3;  3HK4 A;  2RSX A;  1YVB I;  1WQL B;  4FR9 A;  2RGQ A;  4O2H A;  3L0R A;  3X41 A;  2Z77 A;  3I55 3;  4WFO A;  2CK3 H;  1JNQ A;  1ZX2 A;  2GEY A;  4K90 B;  3EQQ B;  1KSI A;  1U5O A;  4WP5 A;  1Q42 A;  4WWU C;  5D82 A;  1M1K 4;  3NBR A;  2P38 A;  1FGQ A;  2KXG A;  3JVC A;  2Q07 A;  4TX4 A;  3GZB A;  1O7M B;  2D42 A;  2B1X B;  2IMJ A;  1IQX A;  2B24 B;  3B8L A;  3O8Y A;  4FCZ A;  4LSO A;  1O7W B;  4H3U A;  1MNL A;  2E2T A;  2HMN B;  2W2C A;  2OTL 3;  5JBS A;  5DRE A;  1AVL A;  4RNZ A;  3MWZ A;  1UW1 A;  3HIG A;  2M7O A;  1YHQ 3;  4XDW A;  2P0X A;  3B4O A;  1GD4 A;  1MOL A;  3HII A;  1RRL A;  3MHE A;  6STD A;  4O02 B;  3N9H A;  3MPH A;  3N8B A;  1QAL A;  4MMY B;  1FGR A;  3KKG A;  4J9A A;  1E3V A;  2CFL A;  5KP4 A;  2OTJ 3;  4RZM A;  1M9G A;  3X40 A;  4X2H A;  3CMA 3;  4O8S A;  2XFT A;  3DMC A;  3G16 A;  3DGM A;  3EF8 A;  1US1 A;  5IF6 A;  2HMM B;  4EV5 A;  3WOF B;  3X3Z A;  3LT8 A;  1IVV A;  2CWT A;  3S67 A;  1A2V A;  3LTD A;  3DY5 A;  3U97 A;  5IEP A;  1SII A;  4N6O B;  2F86 B;  2W04 A;  3CC2 3;  1LOX A;  1OHS A;  1W00 A;  3KII A;  3MKI A;  2HMO B;  1RRH A;  1LXE A;  3NHX A;  1CEW I;  3UL6 A;  4NRE A;  2W56 B;  3S28 A;  3NV0 A;  3CCS 3;  5CF2 A;  1UI8 A;  3VGN A;  1W02 A;  4JRF A;  4R9K A;  3FF0 A;  3U1W A;  4H61 A;  1W2Z A;  4HZ9 B;  2WOH A;  3N54 B;  1KC8 4;  5AEU B;  2W0Q A;  3VF1 A;  1QVF 2;  1N8Q A;  4XB5 A;  3MG1 A;  2OQE A;  3KZT A;  3BNC A;  3NBJ A;  1ULI B;  4BTX A;  2MC8 A;  1LVN A;  3F7S A;  4N3V A;  4L8P A;  3EN8 A;  3NBB A;  2JDI H;  2QA4 3;  4HJL B;  5LC7 A;  1CQS A;  1JB5 A;  3NQY A;  1U8C B;  3EJV A;  5CK6 A;  1WTH A;  3FSD A;  3Q1C A;  2F99 A;  3ROB A;  4HM8 B;  4FCJ A;  1IK3 A;  1W5Z A;  2XEP A;  4MMX B;  3LH4 A;  1R4C A;  3EC9 A;  1RKY A;  3PZW A;  2OWP A;  3GZY B;  3T8U A;  1OPY A;  3KSE D;  3LTB A;  1VQL 3;  3NUV A;  1Q7Y 4;  3CXC 2;  1F8N A;  3EBT A;  4U13 A;  1W6Y A;  2E2V A;  2WGO A;  3HX8 A;  1NO3 A;  5TGN A;  4K1V A;  1IT7 A;  2O3O A;  3G71 3;  3SVA A;  1D6Y A;  2CIU A;  1W01 A;  3G4S 3;  3KFQ C;  1WMO A;  1PFP A;  4R4K A;  4BTW A;  1FGT A;  1Q40 B;  1NB3 I;  1NWW A;  1VQN 3;  4N6V 0;  1IT8 A;  1JV2 B;  1N5P A;  1QAF A;  4ZM8 A;  1W2B 2;  1G96 A;  4N6M A;  2V1L A;  3CD6 3;  4HM5 B;  2WGQ A;  3EHC A;  1D6Z A;  1GD3 A;  2GU1 A;  4KZ1 A;  1TU5 A;  4Q53 A;  1HKX A;  2OOV A;  1JJ2 2;  7STD A;  3S27 A;  3V92 A;  3HZP A;  5LC6 A;  2CC3 A;  4HZB B;  4N6N B;  1JB2 A;  3HI7 A;  4HYZ A;  1DYU A;  5IEO A;  1OGX A;  2KCD A;  2P0M A;  2A15 A;  1ROA A;  2O9U X;  3B7C A;  3NXJ A;  4HM0 B;  3SXX A;  2W6J H;  2W56 A;  1EG9 B;  2XR8 B;  3JUO A;  3PCR A;  3UB1 A;  2XF3 A;  2YX9 A;  3NQZ A;  3OWS A;  4IIA A;  3WDG B;  3JUN A;  2LQV A;  3JUQ A;  1M1X B;  1OH0 A;  3TDG A;  3T0U A;  2STD A;  3PS8 A;  3BB9 A;  3H3H A;  1UUV B;  2Z6B A;  4MJD A;  1JKG B;  4AKZ A;  1TUH A;  3LTC A;  1Q86 4;  1KD1 4;  2FXT A;  4HM6 B;  1A90 A;  4MMZ B;  2XFS A;  4XBX A;  5AYS C;  3CCM 3;  4CDL A;  4FMB A;  4X2O A;  3CCR 3;  4LZI A;  5A0O B;  4N6T A;  3EBY A;  2OQE C;  1EQK A;  4XM4 A;  4J8T A;  4EV2 A;  3LOY A;  1A2K A;  1T5Y A;  1ASK A;  5IER A;  3CCL 3;  3CPW 2;  3EB8 A;  1YI2 3;  3JUM A;  3KE7 A;  5G2G A;  2IUJ A;  4AEQ A;  1STF I;  3UL5 A;  2GBW B;  5BVB A;  3F40 A;  3LTA A;  4OK0 A;  3RDE A;  2LYX A;  1OHO A;  1K41 A;  1M90 4;  3FCS B;  1N9E A;  2BHM A;  3GRD A;  4K61 A;  4L8O A;  4EXR A;  5EEO A;  1AV4 A;  1CYV A;  1ULJ B;  1DVC A;  1EA2 A;  2BMO B;  1RN7 A;  4G1M B;  1IU7 A;  1J2B A;  1Q40 A;  1STD A;  1ZO2 A;  3H51 A;  4HVN A;  3MG3 A;  3QRD A;  1W6G A;  3V99 A;  5AIH A;  1GY5 A;  4XBT A;  1VQP 3;  4QWT A;  2Z7A A;  5D83 A;  8CHO A;  1UUW B;  4HM4 B;  1VQO 3;  3IPT A;  3FH1 A;  4O3V A;  3PXM A;  5FGO A;  2FNQ A;  1AVK A;  3T8N A;  1IQ8 A;  3FG3 A;  3X42 A;  3EX9 A;  3K0Z A;  3NM2 A;  4LMI A;  3DGN A;  4K1U A;  4MEI A;  2C10 A;  4LGQ A;  1Q81 4;  1WNH A;  1NDO B;  3SED A;  1QJG A;  3D9R A;  3BND A;  1WMP A;  1IDP A;  3LML A;  3M8C A;  1V74 A;  1O7H B;  2XRX B;  5DRV A;  3VSY A;  2QGU A;  2CKF B;  4GL6 A;  1NU3 A;  3UNL A;  2OOV C;  3SLU A;  1W4N A;  1OCV A;  3PGB A;  5IG5 A;  1K8A 4;  1IVU A;  1JN5 B;  4XDV A;  1OGZ A;  3V98 A;  1SQW A;  5I97 A;  1FUW A;  3G0K A;  3SX1 A;  5CF1 A;  1PU4 A;  1EKM A;  1SIH A;  4R1K A;  5D81 A;  1JKG A;  2MF7 A;  2F98 A;  5CLK A;  1OF5 B;  3F8X A;  4CCV A;  4HM2 B;  2ZL8 A;  3OW2 2;  2BNG A;  1UI7 A;  5IG4 A;  1YJN 3;  1IV9 A;  2K0M A;  2E2U A;  1YGE A;  3MSO A;  3WA2 X;  1AR0 A;  3RGR A;  1W6C A;  3OWY A;  3SOA A;  4N6U A;  5CXO A;  3PYJ A;  2CHC A;  4LEH A;  2KRT A;  2CG1 A;  3CCV 3;  3F8H A;  3RGA A;  2XSO B;  2ZDJ A;  3GZX B;  3G8Z A;  3AMO B;  2IUK A;  3DXO A;  1QMA A;  3S5C A;  3X3X A;  5KP3 A;  1A67 A;  3K7C A;  1N9J A;  2CFW A;  1K73 4;  5IEN A;  2XGL A;  1TFK A;  3CNM A;  2C11 A;  1NJI 4;  5IW9 A;  1DMQ A;  5HGR A;  4KFD A;  1N5H A;  2QEX 3;  4KFF A;  1VQK 3;  1TFO A;  1IVW A;  2YFL B;  4OVM A;  3ER7 A;  1DMN A;  1JB4 A;  2GU3 A;  3STD A;  4EC6 A;  3WOE B;  3EE1 A;  3FGY A;  3FG1 A;  4RBN A;  1VQ9 3;  2GXF A;  1O7P B;  1SPU A;  2XSH B;  4HM3 B;  3J7Y d;  3QK9 A;  2L4V A;  5JPP A;  3BLZ A;  5ELU A;  3CC7 3;  2Y73 A;  3WMD A;  3DM8 A;  3FF2 A;  2INX A;  1IVX A;  1SJW A;  3CME 3;  1GY7 A;  4L7K A;  1Q82 4;  1TIJ A;  3S29 A;  4BTY A;  3DGL A;  3LT9 A;  2QIY A;  2JQ5 A;  1Z1S A;  4WYK B;  3CU3 A;  4AKY A;  1FGM A;  3NM7 A;  4OUQ A;  3UJM A;  4STD A;  5IG0 A;  1S72 3;  3FLJ A;  1ISK A;  1K9M 4;  3CCQ 3;  2IA7 A;  3CCJ 3;  5IG3 A;  4FCM A;  1VQ6 3;  3Q2P A;  1GYB A;  4NHF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...