4BIRA

Ribonuclease t1: free his92gln mutant
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITQTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endoribonuclease
molecule keywords GUANYL-SPECIFIC RIBONUCLEASE T1
publication title Role of histidine-40 in ribonuclease T1 catalysis: three-dimensionalstructures of the partially active His40Lys mutant.
pubmed doi rcsb
source organism Aspergillus oryzae
total genus 26
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1998-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 4birA00
1AQZA 1ZGXA 1PY3A 2GSPA 2KF4A 1RCKA 2F56A 1BSEA 1BRKA 2HOHA 1CH0A 1TRQA 1RDSA 2C4BA 1B2SA 1BRJA 1UCLA 1RCLA 1Q9EA 1YVSA 1UCJA 3URPA 1JBRA 2RBIA 1RSNA 1B2UA 3KCHA 3AGOA 6GSPA 1RGGA 7GSPA 3SYUA 1LOVA 3DH2A 1RMSA 1PYLA 1BANA 1BNIA 1I0VA 1I3FA 1LNIA 1RGFA 1RN4A 1T2IA 2F4YA 1B2MA 1DE3A 1YGWA 3AHSA 1RN1A 1BIRA 1YNVX 5RNTA 2F5WA 1BUJA 1A2PA 1FUTA 5HOHA 1RGCA 5BIRA 1JBSA 3AGNA 5GSPA 1GOUA 1GOVA 1BSAA 1LRAA 2KF3A 1G02A 1GSPA 1BVIA 1FUSA 1I2GA 2BU4A 5BU4A 9RNTA 2AAEA 1RTUA 2KF6A 3AHWA 3Q3FA 3WR2A 1BNSA 3D5GA 1BRIA 1RGAA 1BRHA 1HYFA 1HZ1A 1R4YA 1T2HA 1TRPA 1RLSA 3BU4A 4BIRA 1BRNL 1IYYA 1BNJA 1B21A 1B27A 1BOXA 1B3SA 1RGKA 2SARA 1RGEA 1LOWA 1BSDA 1RNBA 3WHOA 2KAAA 1BNGA 2ZA4A 1BU4A 1RHLA 1BAOA 1I2EA 4HAAA 4HOHA 1GMPA 3HOHA 4RNTA 1RGHA 2F5MA 1I70A 1RNTA 1BSBA 4J5KA 1I2FA 1DETA 1X1YA 3D4AA 2RNTA 1BNFA 1FZUA 1B2ZA 1I3IA 1JBTA 1FYSA 1X1WA 1C54A 3GSPA 4BU4A 8RNTA 1MGWA 2AADA 4J5GA 3DGYA 1MGRA 1B20A 1SARA 4GSPA 1LOYA 1B2XA 4GHOA 3BIRA 3RNTA 7RNTA 1BGSA 2KF5A 6RNTA 1I0XA 1UCIA 1RGLA 3D5IA 3A5EA 1BRSA 1BNRA 1GMRA 1GMQA 1AY7A 1BRGA 2BIRA 1X1UA 1FW7A 1X1XA 1BNEA 1UCKA 1I8VA 1TTOA 1GOYA 1BSCA
chains in the Genus database with same CATH superfamily
3V98A 1ZGXA 1NO3A 2H0GA 4JF8A 1JN5A 4R80A 2YFJB 1BSEA 1U5OA 2IA7A 3KN4A 2HOHA 5IG5A 3UNLA 3CCV3 1TRQA 2RCDA 1A2VA 1G0TA 3PCSA 1GY7A 1MWTA 1QAKA 1UCLA 3OWSA 4N6UA 1RSNA 1YGEA 3CCJ3 3NM7A 2CWTA 4GB5A 1VQ53 3KCHA 4HM6B 6GSPA 2E2VA 4N6OB 4KFDA 3B4OA 4TX4A 1RKYA 3NHXA 1SIIA 2B24B 1QALA 4LYLB 1B2MA 3B4PA 1OHSA 1DE3A 1T2IA 1IVWA 1W5ZA 2ZL8A 1Z1SA 2W56A 3GZYB 3LYGA 4HM4B 1U8CB 1YGWA 4KFEA 5EQLA 3CME3 2OOVA 2D42A 1BIRA 2CIUA 3NV0B 2F5WA 1VQ43 2RGQA 2YFLB 5IENA 1A2PA 1BUJA 4RBNA 3WMDA 1LOXA 4WYKA 4BTWA 1KWIA 5IG3A 1ISKA 1IK3A 1JZOA 3KZTA 5STDA 2L4VA 1JKGA 3JVCA 3MKIA 2KF3A 2Z6BA 1O7HB 3MG3A 2PNCA 3E99A 1HU9A 1LVNA 5AIFA 5ELJA 3PZWA 1BVIA 1TUHA 1TJDA 3PCRA 2ZDJA 1N9EA 3CU3A 2JDIH 5D83A 3IMAB 3VGNA 5BU4A 2F98A 1IVXA 3EC9A 1VQO3 4G1MB 1O7PB 1W02A 3V92A 4N6MA 5IG4A 3CCR3 3CMA3 2CFDA 1Q42A 1RGAA 1VZZA 2XFTA 3KSED 4JRFA 1HZ1A 3F7SA 4WHAA 5AEWB 5TGNA 1O7WB 3ZFZA 1W7CA 1RLSA 4FMCA 1E97A 3DM8A 1BRNL 3ZG0A 2CH9A 2Z7AA 1CQSA 1JN5B 1KSIA 3MHEA 5M19A 3LTCA 3HIGA 5DRVA 3PYJA 1SIHA 3GAXA 4L7KA 3I553 2LQVA 1US1A 1RNBA 3WA2X 1BNGA 3FSDA 2GEXA 4X2HA 1V74A 1K41A 2CK3H 2F99A 2WGQA 2WOFA 1BAOA 4HAAA 1OHOA 2HMLB 1FA3A 2XGLA 3KKGA 3HOHA 1RGHA 1BSBA 3N9HA 2W04A 2ZHXB 1DETA 1GS3A 3EHCA 2HMOB 1IVVA 2CC3A 1BNFA 4N6V0 2GXFA 2W56B 4K90B 1FZUA 1B2ZA 3D9RA 3UJMA 1YJN3 1OH0A 3B8LA 1FYSA 3H51A 3S29A 2HMMB 2OCTA 3DZLA 2UX0A 4J5GA 2XRXB 3DGYA 2BNGA 1MGRA 1N5HA 1ROVA 2XSHB 3IPTA 1Q7HA 3ECFA 1AVKA 3MSOA 4HM7B 1AVLA 4GHOA 3OW22 4HZBB 3BIRA 3DY5A 3RNTA 1FGTA 1JKGB 1Q40A 1BGSA 1O7GB 2HMKB 2JQ5A 6RNTA 1I0XA 1UCIA 2E2TA 3M8CA 3NM2A 1GY6A 1BRSA 4MMXB 2OOVC 3VSYA 4J9AA 1GYBA 1GMRA 2XFSA 4RNZA 5AIIA 4R4KA 1YHQ3 4O3VA 2BIRA 4AKZA 3T8NA 1BNEA 1WMNA 1JV2B 4EV2A 7STDA 4DKIA 2J8XB 1EQKA 3Q2PA 3CC73 1GOYA 2IMJA 2QIYA 1NB3I 1YJ93 1BSCA 3FKAA 1AQZA 3Q90A 1PY3A 2KF4A 2OTL3 3F40A 4IPBA 4EW5A 3EB8A 1JRQA 1BRKA 2IUJA 1GD3A 3CCL3 1RDSA 5G1KA 5M1AA 3AMOB 4Q53A 1UCJA 2RBIA 4WYKB 1B2UA 3AGOA 2ML6A 1K734 1T3BA 1IV9A 1WMOA 2BHMA 2Q07A 1FGQA 3N8BA 1OGXA 3SYUA 7GSPA 2P09A 4HM1B 1PYLA 2W0QA 3KSPA 3FG4A 4ZM8A 5JPUA 1RN1A 4HYZA 1UI7A 1DMNA 3CPOA 1ZO2A 4O02B 3OWYA 1RGCA 4LSOA 3CCS3 2WO0A 3HI7A 3LOYA 3AGNA 3JUPA 3WDGB 3MG1A 2HMJB 1BSAA 1IV7A 2CWUA 2BO9B 2Y74A 2CFWA 2ML5A 3PGBA 3I563 1ULJB 5M18A 3NUVA 1FUSA 1FGMA 1Q40B 1I2GA 4KT3B 4XM4A 5JPPA 9RNTA 3K63A 3IJEB 2AAEA 3MPHA 2QGUA 4X2OA 3K7CA 2QEX3 1D6ZA 1RTUA 3S67A 1WQLB 2D1WA 2Y73A 3G6E3 1QMAA 3EN1B 1W4NA 3N54B 5HGRA 3CCQ3 1OPYA 1VQM3 3CPW2 3H3HA 1R4YA 1T2HA 2XR8B 1IYYA 3ROBA 1KC84 2L1SA 5AEUB 2B1XB 3S5CA 3WOFB 3SX1A 3CCU3 1LXEA 1NNVA 1SPUA 4NHFA 1DMMA 1LOWA 1QVG2 3QRDA 3NBBA 3T0UA 2P05A 2ZA4A 1BU4A 3RGAA 2C11A 3MG2A 4H61A 1EEJA 4IT7A 1SQWA 1IQXA 2F5MA 1SJWA 1W01A 1VQQA 1I2FA 1K28A 4IIAA 5EEOA 2H0IA 4I4KA 4BTXA 1JBSA 3G16A 1GD4A 1QJGA 3STDA 1CYUA 3EN8A 1JBTA 1X1WA 1C54A 5AIGA 1YVBI 4WFOA 4BU4A 8RNTA 3GZXB 3RDEA 2AADA 3EQQB 1AR0A 1LOYA 5CLKA 3AMOA 4XDWA 3CCE3 3L0RA 4K61A 5KP4A 3EBTA 4XBTA 1D6YA 2P0XA 3FG1A 5IERA 3DGMA 1OF5A 2Z77A 4FMAA 4AEQA 1W6CA 4RNYA 1GMQA 2CFKA 3DXOA 4XBYA 5AYSC 3MYTA 1A90A 1OACA 1ZX2A 2CX1A 5IG0A 2YX9A 3B7CA 4BL3A 1WNHA 4CDLA 2K0MA 2GBWB 1WTHA 1R4CA 4WWUC 1UUWB 1G96A 3CD63 1TTOA 3MWZA 1TU5A 3HK4A 1E3VA 1EG9B 3NQYA 1OGZA 1IT7A 2GSPA 1CEWI 4KFFA 5ELUA 3X42A 1RCKA 4OUQA 1LQMB 1MWUA 3OXAA 1A2KA 1N9JA 1CH0A 4KZ1A 1RN7A 2C4BA 3U1WA 1NDOB 3F9SA 1BRJA 2CFGA 1RCLA 1NWWA 1Q9EA 4NREA 3URPA 6STDA 1JBRA 1HKXA 3NBJA 2OQEA 3FLJA 3UB1A 5FGOA 1MNLA 3LTBA 5G2GA 3BNDA 1KQS2 3CCM3 1OUNA 2SBLA 3T8UA 3ER7A 1RMSA 5AIHA 1BANA 1I0VA 1I3FA 1LNIA 2W2CA 1RGFA 2XSOB 2F4YA 3KIIA 3CC43 1OCVA 3BNEA 2IUKA 3AHSA 3X3XA 3D3LA 1YNVX 1E3RA 4NPBA 3DMCA 2K3DA 4FCJA 1W6GA 3S27A 1AV4A 1FUTA 1JNQA 4FMDA 2WOHA 3GRDA 3EE1A 1IQ8A 3LTAA 3PXMA 3CNXA 4K1UA 1UW1A 1GOUA 3A76A 3HZPA 5BXQA 3CXC2 3GZBA 2A15A 3G8ZA 2C10A 3D79A 3RGRA 5G1LA 1O7MB 2INXA 1IVUA 4AKYA 1GY5A 3FG3A 3X3YA 2BU4A 1YIJ3 1FUWA 5IW9A 4N3VA 1UUGB 3DGOA 1OF5B 3DGNA 2P0MA 1TFOA 2HMNB 2KF6A 3AHWA 4WP5A 3Q3FA 2IYJA 4HVNA 3WR2A 4EC6A 3D5GA 1BRIA 1BRHA 3F8XA 1HYFA 2W6JH 1VQ73 3I0YA 3UL6A 4STDA 3BU4A 4ORLA 1N8QA 1B21A 5D82A 1B3SA 2CFLA 2H0HA 1Q864 4HZ9B 1DYUA 1MOLA 2SARA 4EYCA 2CHCA 3WODG 2BMOB 3X3ZA 1RRHA 1W2B2 1S5AA 3EJVA 3NBRA 4FCZA 3WHOA 1PU4A 2KAAA 2OTJ3 1RHLA 5DREA 2MC8A 1I2EA 2UGIA 4HJLB 2PZVA 4HOHA 2BMRB 2CWVA 5AI1A 1BUQA 1I70A 3LT9A 4H3UA 1N5PA 2UUGC 3PS8A 2Z76A 1VQN3 5CF1A 1X1YA 1M904 1F8NA 3JUMA 3D4AA 5EVHA 2RNTA 3HIIA 1ZS7A 3LT8A 1J2BA 3JUOA 1M1XB 4O8SA 4HKVB 4R9KA 3NQZA 4EV5A 5KP1A 1EUIC 3SVAA 3O8YA 1D6UA 1MGWA 2OQEC 3X41A 3BNBA 1B20A 4GSPA 2FNQA 3BLZA 4R9LA 5JBSA 1DVDA 3GWRA 1K8A4 5BVBA 3QK9A 3CC23 3KE7A 1FGRA 2KXGA 3A5EA 4N6LA 1O7NB 3LMLA 1L5GB 3HX8A 1AY7A 4HBRA 1FW7A 2CG1A 1X1XA 5A0OB 1VQ93 4LEHA 1Q814 3NXJA 3G0KA 2MF7A 4MJDA 1STFI 2M7OA 3GZRA 3FF2A 1EKMA 3JUQA 4N6NB 3G713 1JZDA 1VQK3 1VQ83 1IU7A 2F56A 1YIT3 3K5TA 1ROAA 2W9PA 1M9GA 1IQYA 3SOAA 4CJNA 3FZWA 5CXOA 3EBYA 4PEJA 1NJI4 1UDII 3F14A 3FF0A 1B2SA 3J7Yd 3DUKA 3SEDA 4ILFA 1YVSA 1JJ22 3VF1A 2P38A 1N8R4 4FR9A 1S723 1OHPA 4MEIA 2BT3A 4KVHA 4HM3B 4XBXA 1DMQA 3DGLA 1RGGA 3KFQC 2RSXA 2BMQB 2STDA 2XH9A 1LOVA 3DH2A 3TDGA 3NX0A 1BNIA 1RN4A 1M1K4 4EBGA 2E2UA 5IF6A 1VQL3 2YFIB 4U13A 2GBXB 3LH4A 4MMZB 5CF2A 4HM5B 4XDVA 2R4IA 3WA3A 5HOHA 1FGOA 4HM2B 4MMYB 2GEYA 3U97A 3V99A 2W03A 5BIRA 5GSPA 2I9WA 4L8OA 1YI23 4L8PA 1GOVA 1UI8A 2KRTA 1RJOA 1LRAA 2GU1A 1MWSA 2KCDA 3OV4A 4QWTA 1G02A 1GSPA 4EXRA 1UUVB 3LXUX 1ULIB 1W00A 4XB5A 1WMPA 2V1LA 3Q1CA 1UGHI 4HM0B 4OK0A 1W6YA 1TIJA 2CW9A 1MWRA 1C7HA 1JB5A 2IY2A 3K9MC 3OWUA 3WOEB 4OVMA 1IDPA 4HM8B 3EX9A 1BNSA 1DVCA 2O3OA 4O2HA 1CYVA 1W2ZA 1TRPA 4K1VA 5RNTA 4BIRA 2CKFB 1BNJA 1UGIA 2FGTA 2K54A 1B27A 1BOXA 1LQGC 1Y4KA 1RGKA 1QAFA 1YJW3 1RGEA 2XGNA 5IEOA 1A67A 4FMBA 1RRLA 3OX9A 1BSDA 1LNHA 1PFPA 1V58A 2XF3A 2CG0A 3UL5A 2OWPA 3LZAA 5IEPA 8CHOA 2W9QA 1TFKA 3JUNA 4LMIA 1GMPA 4RNTA 1RNTA 4FCMA 4J5KA 5CK6A 4BTYA 2R41A 3S28A 1Q7Y4 3NV0A 3G4S3 1IT8A 4N6TA 5I97A 1VQ63 1I3IA 4J8TA 3SOYA 1T5YA 3FGYA 2LYXA 2XEPA 2RFRA 3GSPA 3CNMA 4BL2A 1JB2A 3SLUA 4LZIA 1NU3A 1EA2A 1SARA 3BB9A 4RZMA 4GL6A 5D81A 2QA43 1KD14 1B2XA 1NB5I 2GU3A 1JB4A 3FCSB 3K0ZA 4LGQA 7RNTA 1VQP3 2KF5A 3BNCA 3F7XA 2WGOA 2F86B 4R1KA 2O9UX 3F8HA 3LTDA 1RGLA 3D5IA 3EF8A 1ASKA 4I5QA 1BNRA 4CCVA 5LC6A 1V57A 4CPKA 1K9M4 5KP3A 1TP6A 1BRGA 1X1UA 1STDA 1Q824 3SXXA 2FXTA 2CX0A 3FH1A 3ZG5A 3ALAA 1UCKA 1I8VA 5FW5A 5AYRB 1QVF2 5LC7A 3X40A
chains in the Genus database with same CATH topology
1AQZA 1ZGXA 1PY3A 2GSPA 2KF4A 1RCKA 2F56A 1BSEA 1BRKA 2HOHA 1CH0A 1TRQA 1RDSA 2C4BA 1B2SA 1BRJA 1UCLA 1RCLA 1Q9EA 1YVSA 1UCJA 3URPA 1JBRA 2RBIA 1RSNA 1B2UA 3KCHA 3AGOA 6GSPA 1RGGA 7GSPA 3SYUA 1LOVA 3DH2A 1RMSA 1PYLA 1BANA 1BNIA 1I0VA 1I3FA 1LNIA 1RGFA 1RN4A 1T2IA 2F4YA 1B2MA 1DE3A 1YGWA 3AHSA 1RN1A 1BIRA 1YNVX 5RNTA 2F5WA 1BUJA 1A2PA 1FUTA 5HOHA 1RGCA 5BIRA 1JBSA 3AGNA 5GSPA 1GOUA 1GOVA 1BSAA 1LRAA 2KF3A 1G02A 1GSPA 1BVIA 1FUSA 1I2GA 2BU4A 5BU4A 9RNTA 2AAEA 1RTUA 2KF6A 3AHWA 3Q3FA 3WR2A 1BNSA 3D5GA 1BRIA 1RGAA 1BRHA 1HYFA 1HZ1A 1R4YA 1T2HA 1TRPA 1RLSA 3BU4A 4BIRA 1BRNL 1IYYA 1BNJA 1B21A 1B27A 1BOXA 1B3SA 1RGKA 2SARA 1RGEA 1LOWA 1BSDA 1RNBA 3WHOA 2KAAA 1BNGA 2ZA4A 1BU4A 1RHLA 1BAOA 1I2EA 4HAAA 4HOHA 1GMPA 3HOHA 4RNTA 1RGHA 2F5MA 1I70A 1RNTA 1BSBA 4J5KA 1I2FA 1DETA 1X1YA 3D4AA 2RNTA 1BNFA 1FZUA 1B2ZA 1I3IA 1JBTA 1FYSA 1X1WA 1C54A 3GSPA 4BU4A 8RNTA 1MGWA 2AADA 4J5GA 3DGYA 1MGRA 1B20A 1SARA 4GSPA 1LOYA 1B2XA 4GHOA 3BIRA 3RNTA 7RNTA 1BGSA 2KF5A 6RNTA 1I0XA 1UCIA 1RGLA 3D5IA 3A5EA 1BRSA 1BNRA 1GMRA 1GMQA 1AY7A 1BRGA 2BIRA 1X1UA 1FW7A 1X1XA 1BNEA 1UCKA 1I8VA 1TTOA 1GOYA 1BSCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AQZ A;  1ZGX A;  1PY3 A;  2GSP A;  2KF4 A;  1RCK A;  2F56 A;  1BSE A;  1BRK A;  2HOH A;  1CH0 A;  1TRQ A;  1RDS A;  2C4B A;  1B2S A;  1BRJ A;  1UCL A;  1RCL A;  1Q9E A;  1YVS A;  1UCJ A;  3URP A;  1JBR A;  2RBI A;  1RSN A;  1B2U A;  3KCH A;  3AGO A;  6GSP A;  1RGG A;  7GSP A;  3SYU A;  1LOV A;  3DH2 A;  1RMS A;  1PYL A;  1BAN A;  1BNI A;  1I0V A;  1I3F A;  1LNI A;  1RGF A;  1RN4 A;  1T2I A;  2F4Y A;  1B2M A;  1DE3 A;  1YGW A;  3AHS A;  1RN1 A;  1BIR A;  1YNV X;  5RNT A;  2F5W A;  1BUJ A;  1A2P A;  1FUT A;  5HOH A;  1RGC A;  5BIR A;  1JBS A;  3AGN A;  5GSP A;  1GOU A;  1GOV A;  1BSA A;  1LRA A;  2KF3 A;  1G02 A;  1GSP A;  1BVI A;  1FUS A;  1I2G A;  2BU4 A;  5BU4 A;  9RNT A;  2AAE A;  1RTU A;  2KF6 A;  3AHW A;  3Q3F A;  3WR2 A;  1BNS A;  3D5G A;  1BRI A;  1RGA A;  1BRH A;  1HYF A;  1HZ1 A;  1R4Y A;  1T2H A;  1TRP A;  1RLS A;  3BU4 A;  4BIR A;  1BRN L;  1IYY A;  1BNJ A;  1B21 A;  1B27 A;  1BOX A;  1B3S A;  1RGK A;  2SAR A;  1RGE A;  1LOW A;  1BSD A;  1RNB A;  3WHO A;  2KAA A;  1BNG A;  2ZA4 A;  1BU4 A;  1RHL A;  1BAO A;  1I2E A;  4HAA A;  4HOH A;  1GMP A;  3HOH A;  4RNT A;  1RGH A;  2F5M A;  1I70 A;  1RNT A;  1BSB A;  4J5K A;  1I2F A;  1DET A;  1X1Y A;  3D4A A;  2RNT A;  1BNF A;  1FZU A;  1B2Z A;  1I3I A;  1JBT A;  1FYS A;  1X1W A;  1C54 A;  3GSP A;  4BU4 A;  8RNT A;  1MGW A;  2AAD A;  4J5G A;  3DGY A;  1MGR A;  1B20 A;  1SAR A;  4GSP A;  1LOY A;  1B2X A;  4GHO A;  3BIR A;  3RNT A;  7RNT A;  1BGS A;  2KF5 A;  6RNT A;  1I0X A;  1UCI A;  1RGL A;  3D5I A;  3A5E A;  1BRS A;  1BNR A;  1GMR A;  1GMQ A;  1AY7 A;  1BRG A;  2BIR A;  1X1U A;  1FW7 A;  1X1X A;  1BNE A;  1UCK A;  1I8V A;  1TTO A;  1GOY A;  1BSC A; 
#chains in the Genus database with same CATH topology
 3V98 A;  1ZGX A;  1NO3 A;  2H0G A;  4JF8 A;  1JN5 A;  4R80 A;  2YFJ B;  1BSE A;  1U5O A;  2IA7 A;  3KN4 A;  2HOH A;  5IG5 A;  3UNL A;  3CCV 3;  1TRQ A;  2RCD A;  1A2V A;  1G0T A;  3PCS A;  1GY7 A;  1MWT A;  1QAK A;  1UCL A;  3OWS A;  4N6U A;  1RSN A;  1YGE A;  3CCJ 3;  3NM7 A;  2CWT A;  4GB5 A;  1VQ5 3;  3KCH A;  4HM6 B;  6GSP A;  2E2V A;  4N6O B;  4KFD A;  3B4O A;  4TX4 A;  1RKY A;  3NHX A;  1SII A;  2B24 B;  1QAL A;  4LYL B;  1B2M A;  3B4P A;  1OHS A;  1DE3 A;  1T2I A;  1IVW A;  1W5Z A;  2ZL8 A;  1Z1S A;  2W56 A;  3GZY B;  3LYG A;  4HM4 B;  1U8C B;  1YGW A;  4KFE A;  5EQL A;  3CME 3;  2OOV A;  2D42 A;  1BIR A;  2CIU A;  3NV0 B;  2F5W A;  1VQ4 3;  2RGQ A;  2YFL B;  5IEN A;  1A2P A;  1BUJ A;  4RBN A;  3WMD A;  1LOX A;  4WYK A;  4BTW A;  1KWI A;  5IG3 A;  1ISK A;  1IK3 A;  1JZO A;  3KZT A;  5STD A;  2L4V A;  1JKG A;  3JVC A;  3MKI A;  2KF3 A;  2Z6B A;  1O7H B;  3MG3 A;  2PNC A;  3E99 A;  1HU9 A;  1LVN A;  5AIF A;  5ELJ A;  3PZW A;  1BVI A;  1TUH A;  1TJD A;  3PCR A;  2ZDJ A;  1N9E A;  3CU3 A;  2JDI H;  5D83 A;  3IMA B;  3VGN A;  5BU4 A;  2F98 A;  1IVX A;  3EC9 A;  1VQO 3;  4G1M B;  1O7P B;  1W02 A;  3V92 A;  4N6M A;  5IG4 A;  3CCR 3;  3CMA 3;  2CFD A;  1Q42 A;  1RGA A;  1VZZ A;  2XFT A;  3KSE D;  4JRF A;  1HZ1 A;  3F7S A;  4WHA A;  5AEW B;  5TGN A;  1O7W B;  3ZFZ A;  1W7C A;  1RLS A;  4FMC A;  1E97 A;  3DM8 A;  1BRN L;  3ZG0 A;  2CH9 A;  2Z7A A;  1CQS A;  1JN5 B;  1KSI A;  3MHE A;  5M19 A;  3LTC A;  3HIG A;  5DRV A;  3PYJ A;  1SIH A;  3GAX A;  4L7K A;  3I55 3;  2LQV A;  1US1 A;  1RNB A;  3WA2 X;  1BNG A;  3FSD A;  2GEX A;  4X2H A;  1V74 A;  1K41 A;  2CK3 H;  2F99 A;  2WGQ A;  2WOF A;  1BAO A;  4HAA A;  1OHO A;  2HML B;  1FA3 A;  2XGL A;  3KKG A;  3HOH A;  1RGH A;  1BSB A;  3N9H A;  2W04 A;  2ZHX B;  1DET A;  1GS3 A;  3EHC A;  2HMO B;  1IVV A;  2CC3 A;  1BNF A;  4N6V 0;  2GXF A;  2W56 B;  4K90 B;  1FZU A;  1B2Z A;  3D9R A;  3UJM A;  1YJN 3;  1OH0 A;  3B8L A;  1FYS A;  3H51 A;  3S29 A;  2HMM B;  2OCT A;  3DZL A;  2UX0 A;  4J5G A;  2XRX B;  3DGY A;  2BNG A;  1MGR A;  1N5H A;  1ROV A;  2XSH B;  3IPT A;  1Q7H A;  3ECF A;  1AVK A;  3MSO A;  4HM7 B;  1AVL A;  4GHO A;  3OW2 2;  4HZB B;  3BIR A;  3DY5 A;  3RNT A;  1FGT A;  1JKG B;  1Q40 A;  1BGS A;  1O7G B;  2HMK B;  2JQ5 A;  6RNT A;  1I0X A;  1UCI A;  2E2T A;  3M8C A;  3NM2 A;  1GY6 A;  1BRS A;  4MMX B;  2OOV C;  3VSY A;  4J9A A;  1GYB A;  1GMR A;  2XFS A;  4RNZ A;  5AII A;  4R4K A;  1YHQ 3;  4O3V A;  2BIR A;  4AKZ A;  3T8N A;  1BNE A;  1WMN A;  1JV2 B;  4EV2 A;  7STD A;  4DKI A;  2J8X B;  1EQK A;  3Q2P A;  3CC7 3;  1GOY A;  2IMJ A;  2QIY A;  1NB3 I;  1YJ9 3;  1BSC A;  3FKA A;  1AQZ A;  3Q90 A;  1PY3 A;  2KF4 A;  2OTL 3;  3F40 A;  4IPB A;  4EW5 A;  3EB8 A;  1JRQ A;  1BRK A;  2IUJ A;  1GD3 A;  3CCL 3;  1RDS A;  5G1K A;  5M1A A;  3AMO B;  4Q53 A;  1UCJ A;  2RBI A;  4WYK B;  1B2U A;  3AGO A;  2ML6 A;  1K73 4;  1T3B A;  1IV9 A;  1WMO A;  2BHM A;  2Q07 A;  1FGQ A;  3N8B A;  1OGX A;  3SYU A;  7GSP A;  2P09 A;  4HM1 B;  1PYL A;  2W0Q A;  3KSP A;  3FG4 A;  4ZM8 A;  5JPU A;  1RN1 A;  4HYZ A;  1UI7 A;  1DMN A;  3CPO A;  1ZO2 A;  4O02 B;  3OWY A;  1RGC A;  4LSO A;  3CCS 3;  2WO0 A;  3HI7 A;  3LOY A;  3AGN A;  3JUP A;  3WDG B;  3MG1 A;  2HMJ B;  1BSA A;  1IV7 A;  2CWU A;  2BO9 B;  2Y74 A;  2CFW A;  2ML5 A;  3PGB A;  3I56 3;  1ULJ B;  5M18 A;  3NUV A;  1FUS A;  1FGM A;  1Q40 B;  1I2G A;  4KT3 B;  4XM4 A;  5JPP A;  9RNT A;  3K63 A;  3IJE B;  2AAE A;  3MPH A;  2QGU A;  4X2O A;  3K7C A;  2QEX 3;  1D6Z A;  1RTU A;  3S67 A;  1WQL B;  2D1W A;  2Y73 A;  3G6E 3;  1QMA A;  3EN1 B;  1W4N A;  3N54 B;  5HGR A;  3CCQ 3;  1OPY A;  1VQM 3;  3CPW 2;  3H3H A;  1R4Y A;  1T2H A;  2XR8 B;  1IYY A;  3ROB A;  1KC8 4;  2L1S A;  5AEU B;  2B1X B;  3S5C A;  3WOF B;  3SX1 A;  3CCU 3;  1LXE A;  1NNV A;  1SPU A;  4NHF A;  1DMM A;  1LOW A;  1QVG 2;  3QRD A;  3NBB A;  3T0U A;  2P05 A;  2ZA4 A;  1BU4 A;  3RGA A;  2C11 A;  3MG2 A;  4H61 A;  1EEJ A;  4IT7 A;  1SQW A;  1IQX A;  2F5M A;  1SJW A;  1W01 A;  1VQQ A;  1I2F A;  1K28 A;  4IIA A;  5EEO A;  2H0I A;  4I4K A;  4BTX A;  1JBS A;  3G16 A;  1GD4 A;  1QJG A;  3STD A;  1CYU A;  3EN8 A;  1JBT A;  1X1W A;  1C54 A;  5AIG A;  1YVB I;  4WFO A;  4BU4 A;  8RNT A;  3GZX B;  3RDE A;  2AAD A;  3EQQ B;  1AR0 A;  1LOY A;  5CLK A;  3AMO A;  4XDW A;  3CCE 3;  3L0R A;  4K61 A;  5KP4 A;  3EBT A;  4XBT A;  1D6Y A;  2P0X A;  3FG1 A;  5IER A;  3DGM A;  1OF5 A;  2Z77 A;  4FMA A;  4AEQ A;  1W6C A;  4RNY A;  1GMQ A;  2CFK A;  3DXO A;  4XBY A;  5AYS C;  3MYT A;  1A90 A;  1OAC A;  1ZX2 A;  2CX1 A;  5IG0 A;  2YX9 A;  3B7C A;  4BL3 A;  1WNH A;  4CDL A;  2K0M A;  2GBW B;  1WTH A;  1R4C A;  4WWU C;  1UUW B;  1G96 A;  3CD6 3;  1TTO A;  3MWZ A;  1TU5 A;  3HK4 A;  1E3V A;  1EG9 B;  3NQY A;  1OGZ A;  1IT7 A;  2GSP A;  1CEW I;  4KFF A;  5ELU A;  3X42 A;  1RCK A;  4OUQ A;  1LQM B;  1MWU A;  3OXA A;  1A2K A;  1N9J A;  1CH0 A;  4KZ1 A;  1RN7 A;  2C4B A;  3U1W A;  1NDO B;  3F9S A;  1BRJ A;  2CFG A;  1RCL A;  1NWW A;  1Q9E A;  4NRE A;  3URP A;  6STD A;  1JBR A;  1HKX A;  3NBJ A;  2OQE A;  3FLJ A;  3UB1 A;  5FGO A;  1MNL A;  3LTB A;  5G2G A;  3BND A;  1KQS 2;  3CCM 3;  1OUN A;  2SBL A;  3T8U A;  3ER7 A;  1RMS A;  5AIH A;  1BAN A;  1I0V A;  1I3F A;  1LNI A;  2W2C A;  1RGF A;  2XSO B;  2F4Y A;  3KII A;  3CC4 3;  1OCV A;  3BNE A;  2IUK A;  3AHS A;  3X3X A;  3D3L A;  1YNV X;  1E3R A;  4NPB A;  3DMC A;  2K3D A;  4FCJ A;  1W6G A;  3S27 A;  1AV4 A;  1FUT A;  1JNQ A;  4FMD A;  2WOH A;  3GRD A;  3EE1 A;  1IQ8 A;  3LTA A;  3PXM A;  3CNX A;  4K1U A;  1UW1 A;  1GOU A;  3A76 A;  3HZP A;  5BXQ A;  3CXC 2;  3GZB A;  2A15 A;  3G8Z A;  2C10 A;  3D79 A;  3RGR A;  5G1L A;  1O7M B;  2INX A;  1IVU A;  4AKY A;  1GY5 A;  3FG3 A;  3X3Y A;  2BU4 A;  1YIJ 3;  1FUW A;  5IW9 A;  4N3V A;  1UUG B;  3DGO A;  1OF5 B;  3DGN A;  2P0M A;  1TFO A;  2HMN B;  2KF6 A;  3AHW A;  4WP5 A;  3Q3F A;  2IYJ A;  4HVN A;  3WR2 A;  4EC6 A;  3D5G A;  1BRI A;  1BRH A;  3F8X A;  1HYF A;  2W6J H;  1VQ7 3;  3I0Y A;  3UL6 A;  4STD A;  3BU4 A;  4ORL A;  1N8Q A;  1B21 A;  5D82 A;  1B3S A;  2CFL A;  2H0H A;  1Q86 4;  4HZ9 B;  1DYU A;  1MOL A;  2SAR A;  4EYC A;  2CHC A;  3WOD G;  2BMO B;  3X3Z A;  1RRH A;  1W2B 2;  1S5A A;  3EJV A;  3NBR A;  4FCZ A;  3WHO A;  1PU4 A;  2KAA A;  2OTJ 3;  1RHL A;  5DRE A;  2MC8 A;  1I2E A;  2UGI A;  4HJL B;  2PZV A;  4HOH A;  2BMR B;  2CWV A;  5AI1 A;  1BUQ A;  1I70 A;  3LT9 A;  4H3U A;  1N5P A;  2UUG C;  3PS8 A;  2Z76 A;  1VQN 3;  5CF1 A;  1X1Y A;  1M90 4;  1F8N A;  3JUM A;  3D4A A;  5EVH A;  2RNT A;  3HII A;  1ZS7 A;  3LT8 A;  1J2B A;  3JUO A;  1M1X B;  4O8S A;  4HKV B;  4R9K A;  3NQZ A;  4EV5 A;  5KP1 A;  1EUI C;  3SVA A;  3O8Y A;  1D6U A;  1MGW A;  2OQE C;  3X41 A;  3BNB A;  1B20 A;  4GSP A;  2FNQ A;  3BLZ A;  4R9L A;  5JBS A;  1DVD A;  3GWR A;  1K8A 4;  5BVB A;  3QK9 A;  3CC2 3;  3KE7 A;  1FGR A;  2KXG A;  3A5E A;  4N6L A;  1O7N B;  3LML A;  1L5G B;  3HX8 A;  1AY7 A;  4HBR A;  1FW7 A;  2CG1 A;  1X1X A;  5A0O B;  1VQ9 3;  4LEH A;  1Q81 4;  3NXJ A;  3G0K A;  2MF7 A;  4MJD A;  1STF I;  2M7O A;  3GZR A;  3FF2 A;  1EKM A;  3JUQ A;  4N6N B;  3G71 3;  1JZD A;  1VQK 3;  1VQ8 3;  1IU7 A;  2F56 A;  1YIT 3;  3K5T A;  1ROA A;  2W9P A;  1M9G A;  1IQY A;  3SOA A;  4CJN A;  3FZW A;  5CXO A;  3EBY A;  4PEJ A;  1NJI 4;  1UDI I;  3F14 A;  3FF0 A;  1B2S A;  3J7Y d;  3DUK A;  3SED A;  4ILF A;  1YVS A;  1JJ2 2;  3VF1 A;  2P38 A;  1N8R 4;  4FR9 A;  1S72 3;  1OHP A;  4MEI A;  2BT3 A;  4KVH A;  4HM3 B;  4XBX A;  1DMQ A;  3DGL A;  1RGG A;  3KFQ C;  2RSX A;  2BMQ B;  2STD A;  2XH9 A;  1LOV A;  3DH2 A;  3TDG A;  3NX0 A;  1BNI A;  1RN4 A;  1M1K 4;  4EBG A;  2E2U A;  5IF6 A;  1VQL 3;  2YFI B;  4U13 A;  2GBX B;  3LH4 A;  4MMZ B;  5CF2 A;  4HM5 B;  4XDV A;  2R4I A;  3WA3 A;  5HOH A;  1FGO A;  4HM2 B;  4MMY B;  2GEY A;  3U97 A;  3V99 A;  2W03 A;  5BIR A;  5GSP A;  2I9W A;  4L8O A;  1YI2 3;  4L8P A;  1GOV A;  1UI8 A;  2KRT A;  1RJO A;  1LRA A;  2GU1 A;  1MWS A;  2KCD A;  3OV4 A;  4QWT A;  1G02 A;  1GSP A;  4EXR A;  1UUV B;  3LXU X;  1ULI B;  1W00 A;  4XB5 A;  1WMP A;  2V1L A;  3Q1C A;  1UGH I;  4HM0 B;  4OK0 A;  1W6Y A;  1TIJ A;  2CW9 A;  1MWR A;  1C7H A;  1JB5 A;  2IY2 A;  3K9M C;  3OWU A;  3WOE B;  4OVM A;  1IDP A;  4HM8 B;  3EX9 A;  1BNS A;  1DVC A;  2O3O A;  4O2H A;  1CYV A;  1W2Z A;  1TRP A;  4K1V A;  5RNT A;  4BIR A;  2CKF B;  1BNJ A;  1UGI A;  2FGT A;  2K54 A;  1B27 A;  1BOX A;  1LQG C;  1Y4K A;  1RGK A;  1QAF A;  1YJW 3;  1RGE A;  2XGN A;  5IEO A;  1A67 A;  4FMB A;  1RRL A;  3OX9 A;  1BSD A;  1LNH A;  1PFP A;  1V58 A;  2XF3 A;  2CG0 A;  3UL5 A;  2OWP A;  3LZA A;  5IEP A;  8CHO A;  2W9Q A;  1TFK A;  3JUN A;  4LMI A;  1GMP A;  4RNT A;  1RNT A;  4FCM A;  4J5K A;  5CK6 A;  4BTY A;  2R41 A;  3S28 A;  1Q7Y 4;  3NV0 A;  3G4S 3;  1IT8 A;  4N6T A;  5I97 A;  1VQ6 3;  1I3I A;  4J8T A;  3SOY A;  1T5Y A;  3FGY A;  2LYX A;  2XEP A;  2RFR A;  3GSP A;  3CNM A;  4BL2 A;  1JB2 A;  3SLU A;  4LZI A;  1NU3 A;  1EA2 A;  1SAR A;  3BB9 A;  4RZM A;  4GL6 A;  5D81 A;  2QA4 3;  1KD1 4;  1B2X A;  1NB5 I;  2GU3 A;  1JB4 A;  3FCS B;  3K0Z A;  4LGQ A;  7RNT A;  1VQP 3;  2KF5 A;  3BNC A;  3F7X A;  2WGO A;  2F86 B;  4R1K A;  2O9U X;  3F8H A;  3LTD A;  1RGL A;  3D5I A;  3EF8 A;  1ASK A;  4I5Q A;  1BNR A;  4CCV A;  5LC6 A;  1V57 A;  4CPK A;  1K9M 4;  5KP3 A;  1TP6 A;  1BRG A;  1X1U A;  1STD A;  1Q82 4;  3SXX A;  2FXT A;  2CX0 A;  3FH1 A;  3ZG5 A;  3ALA A;  1UCK A;  1I8V A;  5FW5 A;  5AYR B;  1QVF 2;  5LC7 A;  3X40 A; 
#chains in the Genus database with same CATH homology
 1AQZ A;  1ZGX A;  1PY3 A;  2GSP A;  2KF4 A;  1RCK A;  2F56 A;  1BSE A;  1BRK A;  2HOH A;  1CH0 A;  1TRQ A;  1RDS A;  2C4B A;  1B2S A;  1BRJ A;  1UCL A;  1RCL A;  1Q9E A;  1YVS A;  1UCJ A;  3URP A;  1JBR A;  2RBI A;  1RSN A;  1B2U A;  3KCH A;  3AGO A;  6GSP A;  1RGG A;  7GSP A;  3SYU A;  1LOV A;  3DH2 A;  1RMS A;  1PYL A;  1BAN A;  1BNI A;  1I0V A;  1I3F A;  1LNI A;  1RGF A;  1RN4 A;  1T2I A;  2F4Y A;  1B2M A;  1DE3 A;  1YGW A;  3AHS A;  1RN1 A;  1BIR A;  1YNV X;  5RNT A;  2F5W A;  1BUJ A;  1A2P A;  1FUT A;  5HOH A;  1RGC A;  5BIR A;  1JBS A;  3AGN A;  5GSP A;  1GOU A;  1GOV A;  1BSA A;  1LRA A;  2KF3 A;  1G02 A;  1GSP A;  1BVI A;  1FUS A;  1I2G A;  2BU4 A;  5BU4 A;  9RNT A;  2AAE A;  1RTU A;  2KF6 A;  3AHW A;  3Q3F A;  3WR2 A;  1BNS A;  3D5G A;  1BRI A;  1RGA A;  1BRH A;  1HYF A;  1HZ1 A;  1R4Y A;  1T2H A;  1TRP A;  1RLS A;  3BU4 A;  4BIR A;  1BRN L;  1IYY A;  1BNJ A;  1B21 A;  1B27 A;  1BOX A;  1B3S A;  1RGK A;  2SAR A;  1RGE A;  1LOW A;  1BSD A;  1RNB A;  3WHO A;  2KAA A;  1BNG A;  2ZA4 A;  1BU4 A;  1RHL A;  1BAO A;  1I2E A;  4HAA A;  4HOH A;  1GMP A;  3HOH A;  4RNT A;  1RGH A;  2F5M A;  1I70 A;  1RNT A;  1BSB A;  4J5K A;  1I2F A;  1DET A;  1X1Y A;  3D4A A;  2RNT A;  1BNF A;  1FZU A;  1B2Z A;  1I3I A;  1JBT A;  1FYS A;  1X1W A;  1C54 A;  3GSP A;  4BU4 A;  8RNT A;  1MGW A;  2AAD A;  4J5G A;  3DGY A;  1MGR A;  1B20 A;  1SAR A;  4GSP A;  1LOY A;  1B2X A;  4GHO A;  3BIR A;  3RNT A;  7RNT A;  1BGS A;  2KF5 A;  6RNT A;  1I0X A;  1UCI A;  1RGL A;  3D5I A;  3A5E A;  1BRS A;  1BNR A;  1GMR A;  1GMQ A;  1AY7 A;  1BRG A;  2BIR A;  1X1U A;  1FW7 A;  1X1X A;  1BNE A;  1UCK A;  1I8V A;  1TTO A;  1GOY A;  1BSC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...