4BIRA

Ribonuclease t1: free his92gln mutant
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITQTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GUANYL-SPECIFIC RIBONUCLEASE T1
publication title Role of histidine-40 in ribonuclease T1 catalysis: three-dimensionalstructures of the partially active His40Lys mutant.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Endoribonuclease
total genus 26
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1998-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 4birA00
1LOYA 1BNSA 1GMPA 1RGLA 1ZGXA 1BSAA 1RGEA 1G02A 1AY7A 3AHWA 4J5GA 8RNTA 1BAOA 1B2SA 1FUSA 2RBIA 2HOHA 1T2IA 1BRSA 1A2PA 2RNTA 1BNFA 1BANA 1GOUA 1LRAA 3BIRA 9RNTA 1BVIA 4HAAA 3AGNA 1PYLA 1RCLA 1BNIA 1B21A 1BSBA 1BNGA 1GOYA 2KAAA 1UCLA 1I3IA 1B20A 1X1XA 2F4YA 2KF3A 5BU4A 1BSEA 1I2EA 2AAEA 2GSPA 3AHSA 5HOHA 1RGFA 3BU4A 1BNRA 1RNTA 2KF4A 3D4AA 1JBTA 1RGAA 1BSCA 1Q9EA 1LOVA 1YNVX 2SARA 4BU4A 1RHLA 3DH2A 2BIRA 1GMRA 1RGHA 1RN1A 1I70A 3WR2A 1B2MA 1BNJA 5BIRA 1GSPA 1T2HA 1C54A 4HOHA 2F5MA 1I3FA 3Q3FA 1BIRA 1GMQA 1UCKA 1B2XA 1JBSA 3WHOA 3URPA 2KF6A 1X1WA 4GHOA 1B2ZA 1HZ1A 1JBRA 1BGSA 1BRKA 1BNEA 3GSPA 1RSNA 6GSPA 5RNTA 1X1UA 1FZUA 1BU4A 1AQZA 4BIRA 1RGGA 4J5KA 1GOVA 3AGOA 1R4YA 1RN4A 4RNTA 1RCKA 7RNTA 1BRNL 1RTUA 1SARA 4GSPA 1CH0A 1YGWA 1RGCA 1MGWA 1UCJA 3KCHA 1I2GA 1MGRA 3DGYA 1TTOA 1YVSA 1BUJA 1PY3A 1B2UA 7GSPA 1TRPA 1RMSA 1RDSA 1RNBA 2C4BA 3D5GA 1B27A 1LOWA 1BOXA 1UCIA 6RNTA 1DE3A 1RLSA 3D5IA 1DETA 1FYSA 3HOHA 3A5EA 1B3SA 2ZA4A 2AADA 2F5WA 1I2FA 3RNTA 1BRGA 1RGKA 1TRQA 1X1YA 1I0XA 1BSDA 2BU4A 1FW7A 1BRIA 1FUTA 1HYFA 1BRJA 3SYUA 1I8VA 1LNIA 2F56A 5GSPA 1IYYA 2KF5A 1I0VA 1BRHA
chains in the Genus database with same CATH superfamily
1LOYA 1W6CA 2HMNB 4HBRA 1BSAA 2WGOA 3FH1A 3OX9A 1AY7A 3TDGA 1MWRA 3LMLA 1OGXA 1L5GB 2CWVA 3NM2A 2CFGA 2CX1A 1UUWB 5EQLA 1QVF2 1DVDA 5CLKA 4K1UA 1D6UA 1T2IA 4XDWA 1A2PA 2MF7A 2OTL3 4FCZA 1BANA 3EQQB 3NBRA 1LRAA 2K54A 2UX0A 3OWSA 9RNTA 2F86B 3PZWA 1PYLA 3HK4A 1N5HA 1B21A 1BSBA 1GY5A 1UUGB 3MSOA 2BMQB 3WMDA 5AEUB 4LZIA 2CFKA 2JDIH 3K5TA 1VQP3 1I3IA 2P0MA 1GD3A 2WOHA 3ER7A 4FMDA 1JKGA 3IJEB 3UL5A 1CYUA 5AEWB 2V1LA 1ZO2A 2A15A 3DMCA 4HM6B 1JZDA 3MKIA 3BU4A 3PCRA 5CK6A 3H3HA 3N9HA 3A76A 2KF4A 3EN1B 1RGAA 3MG2A 4K90B 3Q2PA 3FGYA 2W56B 3KSED 5BXQA 1YJN3 3GRDA 1EEJA 1C7HA 2BIRA 3MWZA 1RN1A 3QK9A 1B2MA 4KT3B 5ELUA 1JN5B 1GSPA 1T2HA 4JRFA 3CCV3 4XM4A 3T8UA 3JUNA 2CHCA 1TU5A 2CWUA 2I9WA 3BB9A 1UCKA 4STDA 1O7WB 1WTHA 2C10A 2Y74A 3URPA 3FCSB 3KSPA 4RNZA 1JBRA 1BGSA 1BRKA 3I563 1BNEA 1RSNA 1QAKA 4LMIA 1EKMA 3NXJA 1GS3A 3BLZA 2M7OA 1VQN3 1BU4A 1IT7A 3G16A 4N6UA 3LYGA 3HI7A 4BIRA 1TFKA 5D81A 1RGGA 3FF0A 4J5KA 3MPHA 2E2VA 3FG4A 6STDA 1RN4A 1D6YA 5BVBA 1PFPA 1VQ43 4FMAA 1YVBI 4K1VA 3IPTA 1EA2A 1EG9B 3FKAA 4K61A 3GWRA 4OK0A 1Q814 2PNCA 1VQ53 3K0ZA 3V92A 2RCDA 1CEWI 1I2GA 1LVNA 1MGRA 1BUJA 3BNBA 1RMSA 2SBLA 1OCVA 4NPBA 2C4BA 5D82A 1SIHA 4AKYA 1FGQA 1MWSA 1BOXA 1QAFA 3EBTA 5EEOA 1Q40B 3F7SA 2ML5A 3BNDA 2D1WA 2CFWA 1IQXA 1JRQA 3PS8A 4N3VA 1U5OA 4R9LA 2B1XB 3UB1A 3HOHA 1SPUA 3U1WA 1W6GA 1K41A 2W03A 2ZDJA 3CCR3 5IG3A 2AADA 1NJI4 1W01A 1IVWA 1M9GA 1OHSA 2XEPA 1VQM3 1RN7A 2Y73A 1IK3A 3B4PA 1E3VA 1LXEA 3T8NA 2F98A 3JUPA 2XGNA 3FG3A 1RGKA 2OQEA 4QWTA 1I0XA 1BSDA 5FW5A 1KC84 3STDA 1CQSA 1FGOA 1HYFA 1LNIA 3KE7A 3G6E3 4ZM8A 1AVKA 2INXA 4BL2A 3M8CA 8CHOA 3S67A 1CYVA 1DMNA 3GZBA 3ZG5A 2LYXA 2IYJA 4WHAA 4EXRA 4CJNA 2OOVC 1STDA 1V58A 1G02A 3UJMA 3EX9A 5TGNA 2CKFB 5ELJA 4NREA 1BAOA 1KSIA 3AMOA 2HOHA 3PXMA 1BRSA 3NQYA 1QJGA 3OV4A 2O9UX 1DVCA 1FGRA 3BIRA 3ZG0A 1VQ63 4RNYA 1YJ93 1RCLA 3F9SA 1BNGA 3LTCA 1GOYA 3GZYB 4HJLB 1IQYA 4HZBB 2E2TA 4G1MB 1B20A 1OGZA 2KF3A 1QALA 3ZFZA 1KD14 1BSEA 1I2EA 3EF8A 4JF8A 5IENA 2GSPA 3AHSA 3DUKA 3CMA3 2Z6BA 3LH4A 4HVNA 3CCQ3 1WMOA 1YNVX 3S29A 1RHLA 1UGIA 1TJDA 5DREA 4N6MA 4R80A 1BNJA 5BIRA 4N6V0 1C54A 2JQ5A 4ILFA 1NO3A 3DZLA 4AEQA 1G96A 2R41A 3NUVA 3Q3FA 1K28A 1N8R4 1GMQA 2CG0A 2O3OA 4WFOA 3WHOA 4GHOA 1X1WA 2CC3A 3LOYA 5A0OB 2GBWB 2GEXA 4DKIA 3K7CA 1YJW3 3MHEA 1HZ1A 1ROVA 4I4KA 1R4CA 3JUQA 2UUGC 1KWIA 2P09A 4KFDA 1A2VA 2QEX3 2XF3A 5RNTA 4EW5A 4L7KA 4WP5A 2BMRB 5IG4A 3CPW2 3PCSA 3LXUX 3AGOA 3LT9A 5AYRB 3LT8A 1R4YA 1JKGB 4RNTA 5LC7A 4X2OA 1W4NA 1RTUA 5EVHA 4HYZA 1SARA 4HM7B 1OUNA 2K0MA 2XR8B 4O3VA 3CCU3 2QA43 2H0HA 1CH0A 1IVXA 1YGWA 1RGCA 3KCHA 1RKYA 2MC8A 3NV0A 1V74A 1M1K4 1A90A 2YFIB 1PY3A 4HKVB 1B2UA 2GBXB 3ALAA 7GSPA 3FSDA 1RDSA 1LNHA 3CNXA 3EHCA 3IMAB 4Q53A 3I0YA 1W02A 1B27A 5G2GA 1VQ83 3CC43 1V57A 1ULJB 3JVCA 1IQ8A 3B4OA 1M1XB 1JN5A 1UCIA 3CC23 3D5IA 1DE3A 1DETA 3GAXA 3CCM3 3VSYA 1GD4A 3F8XA 2K3DA 2KCDA 1VQL3 4FR9A 3S5CA 4IPBA 3B7CA 1IV7A 1BUQA 4IIAA 1LQGC 3F14A 2YFJB 4FMBA 1J2BA 2HMMB 1Z1SA 3J7Yd 1FUTA 3X3ZA 3S28A 3ROBA 1BRJA 3CNMA 1I8VA 4HM4B 4O8SA 2OTJ3 1YHQ3 2STDA 2ZL8A 3D3LA 1IYYA 1LOXA 3G8ZA 1W2ZA 4J9AA 1ASKA 3DXOA 1Q864 4XBXA 2W0QA 3ECFA 1FGTA 1GMPA 1RGLA 2YX9A 2R4IA 1ZGXA 1FGMA 2P0XA 1Q42A 4HM8B 3DGMA 3AHWA 2OQEC 3WOFB 5M19A 2RBIA 3WOEB 5IG5A 2CIUA 3OXAA 2IUKA 4EV2A 2RNTA 1BNFA 1ZX2A 1RRLA 5JBSA 2HMJB 1BVIA 1T3BA 3AGNA 4LSOA 2XFSA 5IEOA 3CCJ3 1OF5A 2KAAA 3JUOA 4N6NB 3D9RA 1UCLA 2W04A 2W9QA 1ISKA 3MYTA 3KKGA 2F99A 1ROAA 3DM8A 3UL6A 3EC9A 1RRHA 4NHFA 5HGRA 1X1XA 3B8LA 1IU7A 4EV5A 4HZ9B 1G0TA 2OWPA 5HOHA 5M18A 1STFI 1FUWA 1RJOA 1VZZA 4MMXB 2RFRA 1BNRA 1RNTA 3D4AA 1HU9A 1K734 1JBTA 3WODG 4O2HA 4PEJA 2CH9A 4KZ1A 3UNLA 2GU1A 1LOVA 2WO0A 4EC6A 4BU4A 1HKXA 1IV9A 1GMRA 1RGHA 3WR2A 1I70A 1DMMA 2CWTA 3WA2X 3K63A 4HOHA 3F8HA 1US1A 3FLJA 5KP1A 1BIRA 4CDLA 1A2KA 1JV2B 4RBNA 1N5PA 2KF6A 4CCVA 3KFQC 1Y4KA 5G1LA 1S723 3AMOB 1SQWA 1B2ZA 5AIFA 2XGLA 3N8BA 2GU3A 2W6JH 4KFEA 1NB3I 4XDVA 1JZOA 3CU3A 1FZUA 4N6OB 4OUQA 1WQLB 3CCS3 1FA3A 1T5YA 1ZS7A 2IA7A 1N9EA 1ULIB 1W6YA 1QVG2 1VQQA 1A67A 1DYUA 3FZWA 1YGEA 4L8OA 1JB5A 1GOVA 1TIJA 3VF1A 4XBTA 7RNTA 1BRNL 3QRDA 3CXC2 4HM2B 3S27A 1K8A4 3SVAA 3WDGB 1Q824 1YIT3 1TP6A 1W00A 5JPUA 1UCJA 4X2HA 4WYKA 4MEIA 3WA3A 2P05A 2GXFA 3DGYA 1TTOA 1YVSA 3OWUA 4J8TA 3EN8A 4EBGA 3SOAA 3SEDA 3D5GA 3DGLA 4N6TA 1OACA 3GZXB 1LOWA 3EE1A 4H3UA 5M1AA 3RGRA 2P38A 3X3YA 4HM0B 3V98A 1RLSA 5STDA 4WWUC 6RNTA 1M904 4KVHA 1NDOB 1O7MB 1OH0A 3SXXA 4L8PA 5D83A 1SIIA 1GY7A 1OHOA 2WGQA 2WOFA 4GL6A 1MNLA 1B3SA 4XBYA 1O7PB 1JB2A 2L1SA 3DGOA 3BNEA 3DGNA 5AIGA 2CG1A 4LEHA 2OCTA 3X41A 1I2FA 1MWTA 3LTDA 1TRQA 1X1YA 3FF2A 1TUHA 2BU4A 3NBJA 1NB5I 3CD63 4I5QA 3Q1CA 5IERA 4IT7A 2W9PA 3HX8A 5GSPA 1EUIC 2IUJA 1WMNA 1IVUA 2W56A 2BHMA 1QMAA 1I0VA 2W2CA 1AVLA 1BNSA 3NV0B 3G0KA 1MOLA 4AKZA 1RGEA 5I97A 3D79A 4N6LA 2ML6A 2BT3A 4H61A 4R4KA 1DMQA 1N8QA 4EYCA 1VQ93 1AV4A 4J5GA 8RNTA 2FXTA 1B2SA 3V99A 3MG3A 1FUSA 2UGIA 3EB8A 3NBBA 1GOUA 3PGBA 3CME3 1WMPA 5G1KA 4HAAA 3CCE3 5CF2A 1BNIA 4KFFA 3JUMA 4BTXA 1K9M4 2HMLB 2Z77A 1D6ZA 2J8XB 2QIYA 2YFLB 1IDPA 5IEPA 2CFDA 1IVVA 1NU3A 3N54B 2F4YA 5BU4A 3BNCA 3RDEA 3DY5A 2AAEA 1YIJ3 7STDA 1RGFA 2XSHB 1N9JA 4HM5B 5IF6A 3SOYA 1KQS2 1BSCA 1Q9EA 2RGQA 3F40A 3HIGA 5JPPA 1UGHI 2SARA 3DH2A 3G713 3CCL3 3LTAA 1SJWA 1GY6A 1W7CA 3NM7A 5KP3A 3CC73 1O7HB 2F5MA 3HIIA 1I3FA 1Q40A 3LZAA 5AI1A 3Q90A 1B2XA 2PZVA 1JBSA 2Z76A 1TFOA 3E99A 2XFTA 3F7XA 3L0RA 2H0IA 1S5AA 3LTBA 4FMCA 5KP4A 3I553 2HMOB 3GSPA 3NQZA 3X42A 2CW9A 4CPKA 1UDII 6GSPA 5FGOA 4BTWA 1OPYA 1X1UA 1E97A 3CPOA 1O7GB 1OF5B 2BO9B 3O8YA 2Q07A 1AQZA 2KXGA 3U97A 3VGNA 2BMOB 3FG1A 4FCMA 4LYLB 3G4S3 4LGQA 1O7NB 2HMKB 4O02B 1YI23 2IY2A 1U8CB 2C11A 2E2UA 4FCJA 1RCKA 2XH9A 2BNGA 3H51A 2D42A 1IT8A 4MMYB 2KRTA 4BTYA 4R1KA 1UI8A 1UI7A 4GSPA 4TX4A 3T0UA 3KIIA 4MMZB 1MGWA 4R9KA 1AR0A 1OHPA 2FGTA 5LC6A 1F8NA 3KN4A 4ORLA 3MG1A 1TRPA 2FNQA 1RNBA 3NHXA 1W5ZA 3X40A 3X3XA 1VQK3 1JNQA 5AIHA 4HM1B 2CFLA 5DRVA 4HM3B 3EBYA 2QGUA 3GZRA 1FYSA 3NX0A 4RZMA 1WNHA 5CXOA 3K9MC 3OW22 3KZTA 2RSXA 1VQO3 1LQMB 1JJ22 3A5EA 1JB4A 2IMJA 3SX1A 5CF1A 1PU4A 3RGAA 2H0GA 4GB5A 1NWWA 2XSOB 1W2B2 2ZA4A 2ZHXB 1EQKA 2F5WA 2B24B 2LQVA 3PYJA 5AYSC 2OOVA 2GEYA 5AIIA 2CK3H 5IW9A 3RNTA 4BL3A 1BRGA 2L4VA 3EJVA 4MJDA 4OVMA 5IG0A 1NNVA 1GYBA 1Q7HA 1FW7A 2Z7AA 1BRIA 1MWUA 1VQ73 3SLUA 3SYUA 4XB5A 2F56A 2CX0A 3OWYA 1Q7Y4 1UUVB 4U13A 1E3RA 2XRXB 3HZPA 2KF5A 1UW1A 1BRHA 4WYKB
chains in the Genus database with same CATH topology
1LOYA 1BNSA 1GMPA 1RGLA 1ZGXA 1BSAA 1RGEA 1G02A 1AY7A 3AHWA 4J5GA 8RNTA 1BAOA 1B2SA 1FUSA 2RBIA 2HOHA 1T2IA 1BRSA 1A2PA 2RNTA 1BNFA 1BANA 1GOUA 1LRAA 3BIRA 9RNTA 1BVIA 4HAAA 3AGNA 1PYLA 1RCLA 1BNIA 1B21A 1BSBA 1BNGA 1GOYA 2KAAA 1UCLA 1I3IA 1B20A 1X1XA 2F4YA 2KF3A 5BU4A 1BSEA 1I2EA 2AAEA 2GSPA 3AHSA 5HOHA 1RGFA 3BU4A 1BNRA 1RNTA 2KF4A 3D4AA 1JBTA 1RGAA 1BSCA 1Q9EA 1LOVA 1YNVX 2SARA 4BU4A 1RHLA 3DH2A 2BIRA 1GMRA 1RGHA 1RN1A 1I70A 3WR2A 1B2MA 1BNJA 5BIRA 1GSPA 1T2HA 1C54A 4HOHA 2F5MA 1I3FA 3Q3FA 1BIRA 1GMQA 1UCKA 1B2XA 1JBSA 3WHOA 3URPA 2KF6A 1X1WA 4GHOA 1B2ZA 1HZ1A 1JBRA 1BGSA 1BRKA 1BNEA 3GSPA 1RSNA 6GSPA 5RNTA 1X1UA 1FZUA 1BU4A 1AQZA 4BIRA 1RGGA 4J5KA 1GOVA 3AGOA 1R4YA 1RN4A 4RNTA 1RCKA 7RNTA 1BRNL 1RTUA 1SARA 4GSPA 1CH0A 1YGWA 1RGCA 1MGWA 1UCJA 3KCHA 1I2GA 1MGRA 3DGYA 1TTOA 1YVSA 1BUJA 1PY3A 1B2UA 7GSPA 1TRPA 1RMSA 1RDSA 1RNBA 2C4BA 3D5GA 1B27A 1LOWA 1BOXA 1UCIA 6RNTA 1DE3A 1RLSA 3D5IA 1DETA 1FYSA 3HOHA 3A5EA 1B3SA 2ZA4A 2AADA 2F5WA 1I2FA 3RNTA 1BRGA 1RGKA 1TRQA 1X1YA 1I0XA 1BSDA 2BU4A 1FW7A 1BRIA 1FUTA 1HYFA 1BRJA 3SYUA 1I8VA 1LNIA 2F56A 5GSPA 1IYYA 2KF5A 1I0VA 1BRHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LOY A;  1BNS A;  1GMP A;  1RGL A;  1ZGX A;  1BSA A;  1RGE A;  1G02 A;  1AY7 A;  3AHW A;  4J5G A;  8RNT A;  1BAO A;  1B2S A;  1FUS A;  2RBI A;  2HOH A;  1T2I A;  1BRS A;  1A2P A;  2RNT A;  1BNF A;  1BAN A;  1GOU A;  1LRA A;  3BIR A;  9RNT A;  1BVI A;  4HAA A;  3AGN A;  1PYL A;  1RCL A;  1BNI A;  1B21 A;  1BSB A;  1BNG A;  1GOY A;  2KAA A;  1UCL A;  1I3I A;  1B20 A;  1X1X A;  2F4Y A;  2KF3 A;  5BU4 A;  1BSE A;  1I2E A;  2AAE A;  2GSP A;  3AHS A;  5HOH A;  1RGF A;  3BU4 A;  1BNR A;  1RNT A;  2KF4 A;  3D4A A;  1JBT A;  1RGA A;  1BSC A;  1Q9E A;  1LOV A;  1YNV X;  2SAR A;  4BU4 A;  1RHL A;  3DH2 A;  2BIR A;  1GMR A;  1RGH A;  1RN1 A;  1I70 A;  3WR2 A;  1B2M A;  1BNJ A;  5BIR A;  1GSP A;  1T2H A;  1C54 A;  4HOH A;  2F5M A;  1I3F A;  3Q3F A;  1BIR A;  1GMQ A;  1UCK A;  1B2X A;  1JBS A;  3WHO A;  3URP A;  2KF6 A;  1X1W A;  4GHO A;  1B2Z A;  1HZ1 A;  1JBR A;  1BGS A;  1BRK A;  1BNE A;  3GSP A;  1RSN A;  6GSP A;  5RNT A;  1X1U A;  1FZU A;  1BU4 A;  1AQZ A;  4BIR A;  1RGG A;  4J5K A;  1GOV A;  3AGO A;  1R4Y A;  1RN4 A;  4RNT A;  1RCK A;  7RNT A;  1BRN L;  1RTU A;  1SAR A;  4GSP A;  1CH0 A;  1YGW A;  1RGC A;  1MGW A;  1UCJ A;  3KCH A;  1I2G A;  1MGR A;  3DGY A;  1TTO A;  1YVS A;  1BUJ A;  1PY3 A;  1B2U A;  7GSP A;  1TRP A;  1RMS A;  1RDS A;  1RNB A;  2C4B A;  3D5G A;  1B27 A;  1LOW A;  1BOX A;  1UCI A;  6RNT A;  1DE3 A;  1RLS A;  3D5I A;  1DET A;  1FYS A;  3HOH A;  3A5E A;  1B3S A;  2ZA4 A;  2AAD A;  2F5W A;  1I2F A;  3RNT A;  1BRG A;  1RGK A;  1TRQ A;  1X1Y A;  1I0X A;  1BSD A;  2BU4 A;  1FW7 A;  1BRI A;  1FUT A;  1HYF A;  1BRJ A;  3SYU A;  1I8V A;  1LNI A;  2F56 A;  5GSP A;  1IYY A;  2KF5 A;  1I0V A;  1BRH A; 
#chains in the Genus database with same CATH topology
 1LOY A;  1W6C A;  2HMN B;  4HBR A;  1BSA A;  2WGO A;  3FH1 A;  3OX9 A;  1AY7 A;  3TDG A;  1MWR A;  3LML A;  1OGX A;  1L5G B;  2CWV A;  3NM2 A;  2CFG A;  2CX1 A;  1UUW B;  5EQL A;  1QVF 2;  1DVD A;  5CLK A;  4K1U A;  1D6U A;  1T2I A;  4XDW A;  1A2P A;  2MF7 A;  2OTL 3;  4FCZ A;  1BAN A;  3EQQ B;  3NBR A;  1LRA A;  2K54 A;  2UX0 A;  3OWS A;  9RNT A;  2F86 B;  3PZW A;  1PYL A;  3HK4 A;  1N5H A;  1B21 A;  1BSB A;  1GY5 A;  1UUG B;  3MSO A;  2BMQ B;  3WMD A;  5AEU B;  4LZI A;  2CFK A;  2JDI H;  3K5T A;  1VQP 3;  1I3I A;  2P0M A;  1GD3 A;  2WOH A;  3ER7 A;  4FMD A;  1JKG A;  3IJE B;  3UL5 A;  1CYU A;  5AEW B;  2V1L A;  1ZO2 A;  2A15 A;  3DMC A;  4HM6 B;  1JZD A;  3MKI A;  3BU4 A;  3PCR A;  5CK6 A;  3H3H A;  3N9H A;  3A76 A;  2KF4 A;  3EN1 B;  1RGA A;  3MG2 A;  4K90 B;  3Q2P A;  3FGY A;  2W56 B;  3KSE D;  5BXQ A;  1YJN 3;  3GRD A;  1EEJ A;  1C7H A;  2BIR A;  3MWZ A;  1RN1 A;  3QK9 A;  1B2M A;  4KT3 B;  5ELU A;  1JN5 B;  1GSP A;  1T2H A;  4JRF A;  3CCV 3;  4XM4 A;  3T8U A;  3JUN A;  2CHC A;  1TU5 A;  2CWU A;  2I9W A;  3BB9 A;  1UCK A;  4STD A;  1O7W B;  1WTH A;  2C10 A;  2Y74 A;  3URP A;  3FCS B;  3KSP A;  4RNZ A;  1JBR A;  1BGS A;  1BRK A;  3I56 3;  1BNE A;  1RSN A;  1QAK A;  4LMI A;  1EKM A;  3NXJ A;  1GS3 A;  3BLZ A;  2M7O A;  1VQN 3;  1BU4 A;  1IT7 A;  3G16 A;  4N6U A;  3LYG A;  3HI7 A;  4BIR A;  1TFK A;  5D81 A;  1RGG A;  3FF0 A;  4J5K A;  3MPH A;  2E2V A;  3FG4 A;  6STD A;  1RN4 A;  1D6Y A;  5BVB A;  1PFP A;  1VQ4 3;  4FMA A;  1YVB I;  4K1V A;  3IPT A;  1EA2 A;  1EG9 B;  3FKA A;  4K61 A;  3GWR A;  4OK0 A;  1Q81 4;  2PNC A;  1VQ5 3;  3K0Z A;  3V92 A;  2RCD A;  1CEW I;  1I2G A;  1LVN A;  1MGR A;  1BUJ A;  3BNB A;  1RMS A;  2SBL A;  1OCV A;  4NPB A;  2C4B A;  5D82 A;  1SIH A;  4AKY A;  1FGQ A;  1MWS A;  1BOX A;  1QAF A;  3EBT A;  5EEO A;  1Q40 B;  3F7S A;  2ML5 A;  3BND A;  2D1W A;  2CFW A;  1IQX A;  1JRQ A;  3PS8 A;  4N3V A;  1U5O A;  4R9L A;  2B1X B;  3UB1 A;  3HOH A;  1SPU A;  3U1W A;  1W6G A;  1K41 A;  2W03 A;  2ZDJ A;  3CCR 3;  5IG3 A;  2AAD A;  1NJI 4;  1W01 A;  1IVW A;  1M9G A;  1OHS A;  2XEP A;  1VQM 3;  1RN7 A;  2Y73 A;  1IK3 A;  3B4P A;  1E3V A;  1LXE A;  3T8N A;  2F98 A;  3JUP A;  2XGN A;  3FG3 A;  1RGK A;  2OQE A;  4QWT A;  1I0X A;  1BSD A;  5FW5 A;  1KC8 4;  3STD A;  1CQS A;  1FGO A;  1HYF A;  1LNI A;  3KE7 A;  3G6E 3;  4ZM8 A;  1AVK A;  2INX A;  4BL2 A;  3M8C A;  8CHO A;  3S67 A;  1CYV A;  1DMN A;  3GZB A;  3ZG5 A;  2LYX A;  2IYJ A;  4WHA A;  4EXR A;  4CJN A;  2OOV C;  1STD A;  1V58 A;  1G02 A;  3UJM A;  3EX9 A;  5TGN A;  2CKF B;  5ELJ A;  4NRE A;  1BAO A;  1KSI A;  3AMO A;  2HOH A;  3PXM A;  1BRS A;  3NQY A;  1QJG A;  3OV4 A;  2O9U X;  1DVC A;  1FGR A;  3BIR A;  3ZG0 A;  1VQ6 3;  4RNY A;  1YJ9 3;  1RCL A;  3F9S A;  1BNG A;  3LTC A;  1GOY A;  3GZY B;  4HJL B;  1IQY A;  4HZB B;  2E2T A;  4G1M B;  1B20 A;  1OGZ A;  2KF3 A;  1QAL A;  3ZFZ A;  1KD1 4;  1BSE A;  1I2E A;  3EF8 A;  4JF8 A;  5IEN A;  2GSP A;  3AHS A;  3DUK A;  3CMA 3;  2Z6B A;  3LH4 A;  4HVN A;  3CCQ 3;  1WMO A;  1YNV X;  3S29 A;  1RHL A;  1UGI A;  1TJD A;  5DRE A;  4N6M A;  4R80 A;  1BNJ A;  5BIR A;  4N6V 0;  1C54 A;  2JQ5 A;  4ILF A;  1NO3 A;  3DZL A;  4AEQ A;  1G96 A;  2R41 A;  3NUV A;  3Q3F A;  1K28 A;  1N8R 4;  1GMQ A;  2CG0 A;  2O3O A;  4WFO A;  3WHO A;  4GHO A;  1X1W A;  2CC3 A;  3LOY A;  5A0O B;  2GBW B;  2GEX A;  4DKI A;  3K7C A;  1YJW 3;  3MHE A;  1HZ1 A;  1ROV A;  4I4K A;  1R4C A;  3JUQ A;  2UUG C;  1KWI A;  2P09 A;  4KFD A;  1A2V A;  2QEX 3;  2XF3 A;  5RNT A;  4EW5 A;  4L7K A;  4WP5 A;  2BMR B;  5IG4 A;  3CPW 2;  3PCS A;  3LXU X;  3AGO A;  3LT9 A;  5AYR B;  3LT8 A;  1R4Y A;  1JKG B;  4RNT A;  5LC7 A;  4X2O A;  1W4N A;  1RTU A;  5EVH A;  4HYZ A;  1SAR A;  4HM7 B;  1OUN A;  2K0M A;  2XR8 B;  4O3V A;  3CCU 3;  2QA4 3;  2H0H A;  1CH0 A;  1IVX A;  1YGW A;  1RGC A;  3KCH A;  1RKY A;  2MC8 A;  3NV0 A;  1V74 A;  1M1K 4;  1A90 A;  2YFI B;  1PY3 A;  4HKV B;  1B2U A;  2GBX B;  3ALA A;  7GSP A;  3FSD A;  1RDS A;  1LNH A;  3CNX A;  3EHC A;  3IMA B;  4Q53 A;  3I0Y A;  1W02 A;  1B27 A;  5G2G A;  1VQ8 3;  3CC4 3;  1V57 A;  1ULJ B;  3JVC A;  1IQ8 A;  3B4O A;  1M1X B;  1JN5 A;  1UCI A;  3CC2 3;  3D5I A;  1DE3 A;  1DET A;  3GAX A;  3CCM 3;  3VSY A;  1GD4 A;  3F8X A;  2K3D A;  2KCD A;  1VQL 3;  4FR9 A;  3S5C A;  4IPB A;  3B7C A;  1IV7 A;  1BUQ A;  4IIA A;  1LQG C;  3F14 A;  2YFJ B;  4FMB A;  1J2B A;  2HMM B;  1Z1S A;  3J7Y d;  1FUT A;  3X3Z A;  3S28 A;  3ROB A;  1BRJ A;  3CNM A;  1I8V A;  4HM4 B;  4O8S A;  2OTJ 3;  1YHQ 3;  2STD A;  2ZL8 A;  3D3L A;  1IYY A;  1LOX A;  3G8Z A;  1W2Z A;  4J9A A;  1ASK A;  3DXO A;  1Q86 4;  4XBX A;  2W0Q A;  3ECF A;  1FGT A;  1GMP A;  1RGL A;  2YX9 A;  2R4I A;  1ZGX A;  1FGM A;  2P0X A;  1Q42 A;  4HM8 B;  3DGM A;  3AHW A;  2OQE C;  3WOF B;  5M19 A;  2RBI A;  3WOE B;  5IG5 A;  2CIU A;  3OXA A;  2IUK A;  4EV2 A;  2RNT A;  1BNF A;  1ZX2 A;  1RRL A;  5JBS A;  2HMJ B;  1BVI A;  1T3B A;  3AGN A;  4LSO A;  2XFS A;  5IEO A;  3CCJ 3;  1OF5 A;  2KAA A;  3JUO A;  4N6N B;  3D9R A;  1UCL A;  2W04 A;  2W9Q A;  1ISK A;  3MYT A;  3KKG A;  2F99 A;  1ROA A;  3DM8 A;  3UL6 A;  3EC9 A;  1RRH A;  4NHF A;  5HGR A;  1X1X A;  3B8L A;  1IU7 A;  4EV5 A;  4HZ9 B;  1G0T A;  2OWP A;  5HOH A;  5M18 A;  1STF I;  1FUW A;  1RJO A;  1VZZ A;  4MMX B;  2RFR A;  1BNR A;  1RNT A;  3D4A A;  1HU9 A;  1K73 4;  1JBT A;  3WOD G;  4O2H A;  4PEJ A;  2CH9 A;  4KZ1 A;  3UNL A;  2GU1 A;  1LOV A;  2WO0 A;  4EC6 A;  4BU4 A;  1HKX A;  1IV9 A;  1GMR A;  1RGH A;  3WR2 A;  1I70 A;  1DMM A;  2CWT A;  3WA2 X;  3K63 A;  4HOH A;  3F8H A;  1US1 A;  3FLJ A;  5KP1 A;  1BIR A;  4CDL A;  1A2K A;  1JV2 B;  4RBN A;  1N5P A;  2KF6 A;  4CCV A;  3KFQ C;  1Y4K A;  5G1L A;  1S72 3;  3AMO B;  1SQW A;  1B2Z A;  5AIF A;  2XGL A;  3N8B A;  2GU3 A;  2W6J H;  4KFE A;  1NB3 I;  4XDV A;  1JZO A;  3CU3 A;  1FZU A;  4N6O B;  4OUQ A;  1WQL B;  3CCS 3;  1FA3 A;  1T5Y A;  1ZS7 A;  2IA7 A;  1N9E A;  1ULI B;  1W6Y A;  1QVG 2;  1VQQ A;  1A67 A;  1DYU A;  3FZW A;  1YGE A;  4L8O A;  1JB5 A;  1GOV A;  1TIJ A;  3VF1 A;  4XBT A;  7RNT A;  1BRN L;  3QRD A;  3CXC 2;  4HM2 B;  3S27 A;  1K8A 4;  3SVA A;  3WDG B;  1Q82 4;  1YIT 3;  1TP6 A;  1W00 A;  5JPU A;  1UCJ A;  4X2H A;  4WYK A;  4MEI A;  3WA3 A;  2P05 A;  2GXF A;  3DGY A;  1TTO A;  1YVS A;  3OWU A;  4J8T A;  3EN8 A;  4EBG A;  3SOA A;  3SED A;  3D5G A;  3DGL A;  4N6T A;  1OAC A;  3GZX B;  1LOW A;  3EE1 A;  4H3U A;  5M1A A;  3RGR A;  2P38 A;  3X3Y A;  4HM0 B;  3V98 A;  1RLS A;  5STD A;  4WWU C;  6RNT A;  1M90 4;  4KVH A;  1NDO B;  1O7M B;  1OH0 A;  3SXX A;  4L8P A;  5D83 A;  1SII A;  1GY7 A;  1OHO A;  2WGQ A;  2WOF A;  4GL6 A;  1MNL A;  1B3S A;  4XBY A;  1O7P B;  1JB2 A;  2L1S A;  3DGO A;  3BNE A;  3DGN A;  5AIG A;  2CG1 A;  4LEH A;  2OCT A;  3X41 A;  1I2F A;  1MWT A;  3LTD A;  1TRQ A;  1X1Y A;  3FF2 A;  1TUH A;  2BU4 A;  3NBJ A;  1NB5 I;  3CD6 3;  4I5Q A;  3Q1C A;  5IER A;  4IT7 A;  2W9P A;  3HX8 A;  5GSP A;  1EUI C;  2IUJ A;  1WMN A;  1IVU A;  2W56 A;  2BHM A;  1QMA A;  1I0V A;  2W2C A;  1AVL A;  1BNS A;  3NV0 B;  3G0K A;  1MOL A;  4AKZ A;  1RGE A;  5I97 A;  3D79 A;  4N6L A;  2ML6 A;  2BT3 A;  4H61 A;  4R4K A;  1DMQ A;  1N8Q A;  4EYC A;  1VQ9 3;  1AV4 A;  4J5G A;  8RNT A;  2FXT A;  1B2S A;  3V99 A;  3MG3 A;  1FUS A;  2UGI A;  3EB8 A;  3NBB A;  1GOU A;  3PGB A;  3CME 3;  1WMP A;  5G1K A;  4HAA A;  3CCE 3;  5CF2 A;  1BNI A;  4KFF A;  3JUM A;  4BTX A;  1K9M 4;  2HML B;  2Z77 A;  1D6Z A;  2J8X B;  2QIY A;  2YFL B;  1IDP A;  5IEP A;  2CFD A;  1IVV A;  1NU3 A;  3N54 B;  2F4Y A;  5BU4 A;  3BNC A;  3RDE A;  3DY5 A;  2AAE A;  1YIJ 3;  7STD A;  1RGF A;  2XSH B;  1N9J A;  4HM5 B;  5IF6 A;  3SOY A;  1KQS 2;  1BSC A;  1Q9E A;  2RGQ A;  3F40 A;  3HIG A;  5JPP A;  1UGH I;  2SAR A;  3DH2 A;  3G71 3;  3CCL 3;  3LTA A;  1SJW A;  1GY6 A;  1W7C A;  3NM7 A;  5KP3 A;  3CC7 3;  1O7H B;  2F5M A;  3HII A;  1I3F A;  1Q40 A;  3LZA A;  5AI1 A;  3Q90 A;  1B2X A;  2PZV A;  1JBS A;  2Z76 A;  1TFO A;  3E99 A;  2XFT A;  3F7X A;  3L0R A;  2H0I A;  1S5A A;  3LTB A;  4FMC A;  5KP4 A;  3I55 3;  2HMO B;  3GSP A;  3NQZ A;  3X42 A;  2CW9 A;  4CPK A;  1UDI I;  6GSP A;  5FGO A;  4BTW A;  1OPY A;  1X1U A;  1E97 A;  3CPO A;  1O7G B;  1OF5 B;  2BO9 B;  3O8Y A;  2Q07 A;  1AQZ A;  2KXG A;  3U97 A;  3VGN A;  2BMO B;  3FG1 A;  4FCM A;  4LYL B;  3G4S 3;  4LGQ A;  1O7N B;  2HMK B;  4O02 B;  1YI2 3;  2IY2 A;  1U8C B;  2C11 A;  2E2U A;  4FCJ A;  1RCK A;  2XH9 A;  2BNG A;  3H51 A;  2D42 A;  1IT8 A;  4MMY B;  2KRT A;  4BTY A;  4R1K A;  1UI8 A;  1UI7 A;  4GSP A;  4TX4 A;  3T0U A;  3KII A;  4MMZ B;  1MGW A;  4R9K A;  1AR0 A;  1OHP A;  2FGT A;  5LC6 A;  1F8N A;  3KN4 A;  4ORL A;  3MG1 A;  1TRP A;  2FNQ A;  1RNB A;  3NHX A;  1W5Z A;  3X40 A;  3X3X A;  1VQK 3;  1JNQ A;  5AIH A;  4HM1 B;  2CFL A;  5DRV A;  4HM3 B;  3EBY A;  2QGU A;  3GZR A;  1FYS A;  3NX0 A;  4RZM A;  1WNH A;  5CXO A;  3K9M C;  3OW2 2;  3KZT A;  2RSX A;  1VQO 3;  1LQM B;  1JJ2 2;  3A5E A;  1JB4 A;  2IMJ A;  3SX1 A;  5CF1 A;  1PU4 A;  3RGA A;  2H0G A;  4GB5 A;  1NWW A;  2XSO B;  1W2B 2;  2ZA4 A;  2ZHX B;  1EQK A;  2F5W A;  2B24 B;  2LQV A;  3PYJ A;  5AYS C;  2OOV A;  2GEY A;  5AII A;  2CK3 H;  5IW9 A;  3RNT A;  4BL3 A;  1BRG A;  2L4V A;  3EJV A;  4MJD A;  4OVM A;  5IG0 A;  1NNV A;  1GYB A;  1Q7H A;  1FW7 A;  2Z7A A;  1BRI A;  1MWU A;  1VQ7 3;  3SLU A;  3SYU A;  4XB5 A;  2F56 A;  2CX0 A;  3OWY A;  1Q7Y 4;  1UUV B;  4U13 A;  1E3R A;  2XRX B;  3HZP A;  2KF5 A;  1UW1 A;  1BRH A;  4WYK B; 
#chains in the Genus database with same CATH homology
 1LOY A;  1BNS A;  1GMP A;  1RGL A;  1ZGX A;  1BSA A;  1RGE A;  1G02 A;  1AY7 A;  3AHW A;  4J5G A;  8RNT A;  1BAO A;  1B2S A;  1FUS A;  2RBI A;  2HOH A;  1T2I A;  1BRS A;  1A2P A;  2RNT A;  1BNF A;  1BAN A;  1GOU A;  1LRA A;  3BIR A;  9RNT A;  1BVI A;  4HAA A;  3AGN A;  1PYL A;  1RCL A;  1BNI A;  1B21 A;  1BSB A;  1BNG A;  1GOY A;  2KAA A;  1UCL A;  1I3I A;  1B20 A;  1X1X A;  2F4Y A;  2KF3 A;  5BU4 A;  1BSE A;  1I2E A;  2AAE A;  2GSP A;  3AHS A;  5HOH A;  1RGF A;  3BU4 A;  1BNR A;  1RNT A;  2KF4 A;  3D4A A;  1JBT A;  1RGA A;  1BSC A;  1Q9E A;  1LOV A;  1YNV X;  2SAR A;  4BU4 A;  1RHL A;  3DH2 A;  2BIR A;  1GMR A;  1RGH A;  1RN1 A;  1I70 A;  3WR2 A;  1B2M A;  1BNJ A;  5BIR A;  1GSP A;  1T2H A;  1C54 A;  4HOH A;  2F5M A;  1I3F A;  3Q3F A;  1BIR A;  1GMQ A;  1UCK A;  1B2X A;  1JBS A;  3WHO A;  3URP A;  2KF6 A;  1X1W A;  4GHO A;  1B2Z A;  1HZ1 A;  1JBR A;  1BGS A;  1BRK A;  1BNE A;  3GSP A;  1RSN A;  6GSP A;  5RNT A;  1X1U A;  1FZU A;  1BU4 A;  1AQZ A;  4BIR A;  1RGG A;  4J5K A;  1GOV A;  3AGO A;  1R4Y A;  1RN4 A;  4RNT A;  1RCK A;  7RNT A;  1BRN L;  1RTU A;  1SAR A;  4GSP A;  1CH0 A;  1YGW A;  1RGC A;  1MGW A;  1UCJ A;  3KCH A;  1I2G A;  1MGR A;  3DGY A;  1TTO A;  1YVS A;  1BUJ A;  1PY3 A;  1B2U A;  7GSP A;  1TRP A;  1RMS A;  1RDS A;  1RNB A;  2C4B A;  3D5G A;  1B27 A;  1LOW A;  1BOX A;  1UCI A;  6RNT A;  1DE3 A;  1RLS A;  3D5I A;  1DET A;  1FYS A;  3HOH A;  3A5E A;  1B3S A;  2ZA4 A;  2AAD A;  2F5W A;  1I2F A;  3RNT A;  1BRG A;  1RGK A;  1TRQ A;  1X1Y A;  1I0X A;  1BSD A;  2BU4 A;  1FW7 A;  1BRI A;  1FUT A;  1HYF A;  1BRJ A;  3SYU A;  1I8V A;  1LNI A;  2F56 A;  5GSP A;  1IYY A;  2KF5 A;  1I0V A;  1BRH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...