1RSNA

Ribonuclease (rnase sa) (e.c.3.1.4.8) complexed with exo-2',3'-cyclophosphorothioate
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
96
structure length
96
Chain Sequence
DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIICGEATQEDYYTGDHYATFSLIDQTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase (guanyloribonuclease)
molecule keywords RIBONUCLEASE SA
publication title Complex of ribonuclease Sa with a cyclic nucleotide and a proposed model for the reaction intermediate.
pubmed doi rcsb
total genus 25
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1995-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1rsnA00
1I2FA 4BIRA 5BIRA 3SYUA 2C4BA 1GMRA 3D4AA 1SARA 1YGWA 1UCJA 1RGFA 1MGWA 1TTOA 1B3SA 4HAAA 3A5EA 1DETA 2AAEA 1BSEA 3BIRA 2F4YA 1BANA 1JBRA 1BNRA 1FUTA 3HOHA 1UCLA 6GSPA 1I8VA 1RCLA 1BNJA 1YVSA 2KF5A 1RNBA 3Q3FA 1HYFA 1YNVX 3AGNA 3AHWA 2F56A 4RNTA 1B2UA 7RNTA 1RGAA 3RNTA 3AHSA 1B2MA 1BUJA 1LOWA 1X1WA 1BNEA 1RN1A 1Q9EA 2SARA 2BU4A 5BU4A 1JBTA 1GSPA 1BSBA 3WR2A 3BU4A 1BOXA 4J5GA 1RLSA 2KF4A 1FYSA 1AQZA 1I70A 1LNIA 7GSPA 1BRKA 1BGSA 2ZA4A 1CH0A 1BRIA 3KCHA 1BRHA 1BAOA 1A2PA 1BNFA 5HOHA 1BIRA 3AGOA 3GSPA 1FW7A 1HZ1A 4GSPA 8RNTA 1B27A 2AADA 1BVIA 2F5MA 1FUSA 1T2IA 2KF6A 2RNTA 3DH2A 5GSPA 1LOVA 1AY7A 1BNIA 1MGRA 1BRGA 2RBIA 1G02A 1GOYA 1I3IA 1RGEA 1RGKA 1R4YA 2BIRA 1TRPA 1I0VA 6RNTA 3DGYA 1GOUA 1RMSA 1GMPA 1X1XA 1JBSA 1B2XA 4GHOA 1RHLA 1RTUA 1RDSA 2F5WA 1B2ZA 1UCIA 3D5IA 1GMQA 1UCKA 1RSNA 4BU4A 1I2EA 1ZGXA 1PYLA 1TRQA 1BSAA 1BSCA 1LOYA 1RGLA 1I0XA 1B21A 1RGHA 2KAAA 2HOHA 1BRSA 1LRAA 3D5GA 1X1UA 1BU4A 1RNTA 1RGCA 1I2GA 2KF3A 9RNTA 4J5KA 3WHOA 1B2SA 1RN4A 1PY3A 5RNTA 1BRNL 2GSPA 1BNSA 1BSDA 1BRJA 1IYYA 1BNGA 4HOHA 1DE3A 1I3FA 1B20A 1RGGA 1RCKA 3URPA 1FZUA 1C54A 1X1YA 1GOVA 1T2HA
chains in the Genus database with same CATH superfamily
2O3OA 1W00A 1W2ZA 4HM7B 1AVKA 4H3UA 1GMRA 2WGOA 3MYTA 3K7CA 4N6MA 4R9LA 1MGWA 1SQWA 1OHPA 3NM7A 5D83A 1DVCA 1GD4A 1CYUA 4HAAA 3A5EA 2AAEA 1BSEA 3IJEB 4XB5A 5AEWB 1BNRA 1GY5A 3HOHA 1TUHA 1IV7A 3DGNA 1YVSA 1SJWA 4K61A 1VQO3 3Q3FA 1AVLA 1YNVX 4FCMA 3AGNA 2P0MA 3AHWA 3FG1A 4RNTA 1GY7A 2WOHA 3ZG0A 4WWUC 1D6UA 1RGAA 3RNTA 3AHSA 3NV0B 4KZ1A 5D81A 4CCVA 5KP4A 1HU9A 1X1WA 1BNEA 3B8LA 4HZ9B 3CCV3 5BU4A 2BNGA 3U1WA 5JPUA 4OUQA 3EJVA 5IG4A 2OOVC 5ELJA 4EBGA 1OHOA 1UUGB 1RLSA 2UX0A 3EBYA 3OXAA 5CLKA 1VZZA 4BTWA 3LTCA 1AQZA 2XH9A 2P0XA 3DM8A 4R80A 5LC7A 1OACA 1VQ53 1W6CA 1BGSA 2ZA4A 5HGRA 1IT7A 1VQ73 2YFLB 3CC43 5DREA 4OK0A 1JZDA 1OGXA 5CXOA 3RGRA 1VQM3 1FW7A 3DY5A 3EHCA 4O2HA 1WMNA 4FCZA 2AADA 5BVBA 2L1SA 4BL3A 1M904 4U13A 2YFJB 2F5MA 3BNDA 4BTYA 5EEOA 2Q07A 3DH2A 5AIFA 5GSPA 3MHEA 2GEYA 1OH0A 2RBIA 4HM2B 3KN4A 1R4YA 2BIRA 2R41A 3D3LA 4H61A 4CPKA 5JBSA 3B7CA 1O7NB 1OHSA 1YVBI 2B24B 3BNEA 4GB5A 3DGLA 2Z76A 3OWUA 5STDA 1B2XA 1Z1SA 4RNZA 3SOAA 3CNXA 1B2MA 3KIIA 1TU5A 3F8HA 3X3YA 4X2OA 1RDSA 2CH9A 2BT3A 1B2ZA 4R4KA 3D5IA 1FGRA 2HMJB 3WA3A 1Q7HA 1RSNA 1TIJA 4K90B 3UL6A 3UB1A 3D79A 1YGEA 1RRHA 1ZGXA 3WOEB 3CMA3 3K63A 1IDPA 1RGLA 2KAAA 4LSOA 1B21A 1JRQA 2XF3A 3LT9A 2MF7A 1DYUA 1M1XB 2CW9A 1BU4A 1RN7A 1RNTA 3LMLA 3X3XA 3WHOA 1B2SA 1PY3A 3NX0A 1UW1A 1KC84 2XGLA 3SEDA 1VQ63 1K9M4 3GRDA 1IYYA 5TGNA 2PZVA 1IQXA 1JV2B 1OGZA 1S5AA 3M8CA 3CCU3 4BL2A 1RGGA 3F14A 2W04A 1VQ43 3CPOA 3NUVA 1N5HA 4KVHA 2IMJA 1JKGA 1RCKA 4PEJA 1VQ83 1GD3A 2B1XB 3G8ZA 4AEQA 1BUQA 4HVNA 2CK3H 5M19A 1O7GB 2E2VA 1M9GA 3NQYA 1A2VA 1T3BA 1W4NA 1X1YA 1W7CA 5G2GA 2C11A 2XFTA 1I2FA 3OX9A 2C4BA 1MWSA 3Q90A 5EQLA 4LZIA 4XDWA 1FUWA 1ULIB 2OQEA 4WHAA 1YGWA 2E2UA 1UCJA 3CCR3 1RGFA 3EN8A 1TFOA 1ISKA 1E3RA 4KFEA 1TTOA 1O7PB 1QJGA 1KD14 1DETA 1YJW3 1UUVB 2W2CA 4O3VA 3CC23 1UI7A 3F7SA 4K1VA 2M7OA 1RCLA 4IPBA 3AMOA 2K3DA 5AIGA 1NO3A 1HYFA 1STDA 3V92A 1A90A 1B2UA 7RNTA 3IMAB 2HMNB 2LQVA 1V58A 4KT3B 5IW9A 1OF5A 1IQYA 2CFWA 3RDEA 3JUNA 4FR9A 2BU4A 3FH1A 1RRLA 3NBJA 1N9EA 3FCSB 3N8BA 4FMCA 1FGMA 3CU3A 1JZOA 1AR0A 1BSBA 1V74A 2KCDA 3WODG 2UGIA 1BOXA 1IVUA 1PFPA 4J5GA 4XBTA 3DXOA 2KF4A 3QK9A 1TP6A 1LNIA 3BNCA 4N6TA 1GYBA 4MMXB 4NREA 1O7MB 4KFDA 4JF8A 4FMAA 1BRIA 2CFDA 2RFRA 4STDA 3S27A 3X40A 4X2HA 4R9KA 1VQL3 2OQEC 3CD63 2OCTA 1BAOA 3N54B 3G0KA 4MJDA 3K5TA 1PU4A 1LQMB 2RSXA 3LT8A 1HZ1A 2J8XB 5AI1A 1G0TA 1UGHI 4AKZA 1NB3I 3UJMA 1N8R4 3KSED 1RJOA 3FG4A 4JRFA 2IA7A 1FUSA 3X41A 3F9SA 2XSHB 2RCDA 1EKMA 1ULJB 3V99A 1BRGA 3GAXA 1I3IA 1RGKA 4AKYA 1N9JA 3PGBA 7STDA 2F98A 2BO9B 3JVCA 3DMCA 3PCSA 2XR8B 3EN1B 1IVWA 2ZHXB 2WGQA 2CWUA 6RNTA 3X42A 5M18A 1EQKA 3NM2A 3HZPA 2GXFA 2BMQB 3CC73 1HKXA 3FZWA 1J2BA 4GHOA 1RHLA 1U8CB 2OWPA 3HK4A 2Z6BA 3VF1A 5DRVA 5AYSC 1GMQA 2Y74A 5AYRB 3FLJA 3I553 2W56A 2YFIB 1UI8A 4BU4A 1NWWA 1Q814 1MNLA 1BSAA 1VQN3 3FF2A 3MPHA 4ILFA 2XRXB 1BRSA 3D5GA 3HIGA 3F40A 1X1UA 5AEUB 1WNHA 3AMOB 3CCQ3 2W9QA 1LOXA 1I2GA 1QAFA 2KF3A 3B4PA 6STDA 5IEPA 1MOLA 3X3ZA 1D6ZA 2F99A 3KZTA 1DMQA 4FMBA 2GSPA 1IQ8A 5ELUA 1BSDA 5BXQA 1BNGA 1ASKA 1OF5B 4HOHA 4XBXA 4N6UA 1LNHA 3KKGA 2CC3A 1IU7A 1I3FA 4RBNA 4HM4B 3FF0A 3ROBA 2OTL3 5AIIA 1N8QA 3GWRA 4LYLB 3HIIA 2CWVA 1L5GB 1G96A 5CF1A 3WDGB 2KXGA 1FZUA 2JQ5A 1YI23 4OVMA 1W5ZA 1NU3A 1DE3A 2ZL8A 1K8A4 5BIRA 4RZMA 2FGTA 4HBRA 2GBXB 1E97A 2FNQA 4HJLB 1SARA 2CX1A 2YX9A 1CYVA 1IVXA 3MG3A 4XM4A 5LC6A 1B3SA 3PS8A 1DVDA 3BIRA 2KRTA 3LTAA 4EYCA 1FUTA 3ALAA 4N6OB 5AIHA 1ZX2A 1UCLA 4O02B 3S28A 1I8VA 3WMDA 1BNJA 2KF5A 1WTHA 3CNMA 1Q864 4WYKA 4I5QA 8CHOA 3N9HA 2CHCA 2F56A 1U5OA 2GEXA 4HM5B 3F8XA 4QWTA 3PCRA 3A76A 2PNCA 1BUJA 2H0IA 4CDLA 5FGOA 1LXEA 1O7WB 1RN1A 4Q53A 1Q9EA 5KP3A 1KQS2 2SARA 3G6E3 1D6YA 2W9PA 4ORLA 1JBTA 3HI7A 4HM8B 4EV5A 1DMNA 1KWIA 3WR2A 5IG3A 1Y4KA 4HM6B 3FG3A 3I0YA 1I70A 2W56B 3ZG5A 5A0OB 5KP1A 7GSPA 1W2B2 1BRKA 3GZXB 2BHMA 3H51A 4J8TA 4XBYA 1K28A 3KCHA 3CCM3 3OWSA 3T8UA 2Z7AA 3NXJA 1JNQA 1BRHA 1Q42A 2LYXA 1A2PA 2CWTA 3EC9A 3T0UA 3FSDA 1BIRA 5HOHA 2QEX3 3GSPA 1QVG2 3K9MC 3MG1A 4L8PA 2IUKA 4GSPA 8RNTA 1IK3A 1JJ22 1B27A 2CKFB 1SIHA 1S723 2CFLA 1EA2A 2K54A 1DMMA 1T2IA 2STDA 1VQP3 2D1WA 3K0ZA 1MGRA 1GOYA 1RGEA 1TRPA 3MG2A 4FCJA 4LMIA 3RGAA 1CEWI 3VSYA 3DGYA 3FKAA 1RMSA 1Q824 4EXRA 4NHFA 4R1KA 3E99A 2XGNA 2HMOB 3GZRA 1NDOB 4N6LA 4I4KA 1OCVA 2W03A 1RTUA 5I97A 2MC8A 1UCIA 1YIT3 1YJ93 3QRDA 2CIUA 2A15A 2WOFA 1WQLB 3EX9A 3NBBA 1I2EA 3D9RA 1PYLA 1ZO2A 1TRQA 2ZDJA 3CCE3 1WMPA 1T5YA 1JB5A 1I0XA 1RGHA 3MKIA 2HOHA 2Y73A 3LYGA 1LRAA 1VQK3 1JN5A 4WYKB 1RGCA 3H3HA 9RNTA 4HKVB 4J5KA 4MEIA 1RN4A 2W0QA 2Z77A 2ML5A 3DGOA 5RNTA 1JKGB 1OUNA 1BRNL 3SX1A 4HYZA 4N3VA 3KE7A 2BMOB 2XFSA 1BNSA 1BRJA 1QAKA 2GU3A 1K41A 1IVVA 4CJNA 3JUQA 4DKIA 2P38A 4O8SA 3I563 3S5CA 4HM1B 3WOFB 3BLZA 4WFOA 3NHXA 3NQZA 3O8YA 3DZLA 4L8OA 2P05A 2H0HA 3UL5A 4TX4A 1ROAA 3EF8A 3JUMA 1C54A 5M1AA 1GOVA 3PZWA 1T2HA 4G1MB 4BIRA 3PXMA 3T8NA 4GL6A 3SYUA 1UUWB 2C10A 3D4AA 4FMDA 1UGIA 1W02A 1ZS7A 3JUOA 1NJI4 1R4CA 5IG0A 2F4YA 1BANA 1MWRA 1JBRA 3S67A 1Q40A 1EEJA 6GSPA 5CF2A 5IENA 1RNBA 1GS3A 1TFKA 1QALA 2E2TA 3SLUA 1YHQ3 3SXXA 2SBLA 1VQQA 4LEHA 5EVHA 1RKYA 3G4S3 2QGUA 2QIYA 2O9UX 1LOWA 2CFGA 2ML6A 2K0MA 3LH4A 1K734 2CFKA 4WP5A 4N6V0 4MMYB 4XDVA 2OTJ3 3EE1A 3G713 3TDGA 1GY6A 1GSPA 3L0RA 3HX8A 3S29A 2JDIH 3DGMA 3BU4A 1V57A 2HMLB 1F8NA 1M1K4 3LOYA 3ECFA 5G1KA 5IEOA 4EC6A 1FYSA 2HMMB 1FGTA 1LQGC 1N5PA 2IYJA 3LTDA 1W6YA 4IIAA 3CCL3 3SVAA 1KSIA 4J9AA 2BMRB 2L4VA 1CH0A 3BNBA 2IY2A 1W6GA 2XEPA 5FW5A 4N6NB 1JN5B 2FXTA 2H0GA 4KFFA 1BNFA 2CG0A 2UUGC 3LTBA 3AGOA 2V1LA 1EUIC 2HMKB 1QVF2 2WO0A 3STDA 5IERA 4ZM8A 2I9WA 1STFI 1US1A 1BVIA 2QA43 4EV2A 2KF6A 1A67A 2RNTA 1LOVA 1AY7A 1BNIA 3FGYA 3KFQC 3G16A 3LXUX 1TJDA 1G02A 1O7HB 1UDII 3GZYB 1FGQA 1C7HA 3NV0A 1FGOA 1I0VA 1MWUA 2RGQA 3IPTA 1NB5I 5JPPA 1LVNA 4HM0B 2W6JH 1QMAA 1GOUA 4NPBA 3OWYA 2CG1A 1GMPA 1X1XA 4L7KA 3WA2X 1JBSA 3JUPA 4HZBB 3SOYA 3BB9A 2GU1A 3NBRA 5CK6A 1FA3A 1IV9A 2D42A 2F5WA 4RNYA 3ER7A 1Q7Y4 1UCKA 4IT7A 4MMZB 1OPYA 5IG5A 3CME3 1JB2A 1BSCA 1LOYA 1Q40B 3OW22 1WMOA 3EB8A 2R4IA 3CPW2 4BTXA 2CX0A 3EBTA 3F7XA 3GZBA 5G1LA 3VGNA 3Q1CA 3MSOA 3LZAA 3EQQB 1ROVA 4K1UA 5IF6A 2XSOB 3CCS3 1SIIA 4LGQA 1YJN3 3CXC2 1NNVA 3U97A 2INXA 4EW5A 1W01A 1E3VA 3DUKA 3Q2PA 1SPUA 1EG9B 3KSPA 2IUJA 3UNLA 2P09A 1B20A 1AV4A 2OOVA 3MWZA 3URPA 1CQSA 3PYJA 4HM3B 3B4OA 1MWTA 3V98A 2GBWB 3J7Yd 1YIJ3 1VQ93 1A2KA 1JB4A 1IT8A 2F86B 5D82A 3ZFZA 3CCJ3 3OV4A
chains in the Genus database with same CATH topology
1I2FA 4BIRA 5BIRA 3SYUA 2C4BA 1GMRA 3D4AA 1SARA 1YGWA 1UCJA 1RGFA 1MGWA 1TTOA 1B3SA 4HAAA 3A5EA 1DETA 2AAEA 1BSEA 3BIRA 2F4YA 1BANA 1JBRA 1BNRA 1FUTA 3HOHA 1UCLA 6GSPA 1I8VA 1RCLA 1BNJA 1YVSA 2KF5A 1RNBA 3Q3FA 1HYFA 1YNVX 3AGNA 3AHWA 2F56A 4RNTA 1B2UA 7RNTA 1RGAA 3RNTA 3AHSA 1B2MA 1BUJA 1LOWA 1X1WA 1BNEA 1RN1A 1Q9EA 2SARA 2BU4A 5BU4A 1JBTA 1GSPA 1BSBA 3WR2A 3BU4A 1BOXA 4J5GA 1RLSA 2KF4A 1FYSA 1AQZA 1I70A 1LNIA 7GSPA 1BRKA 1BGSA 2ZA4A 1CH0A 1BRIA 3KCHA 1BRHA 1BAOA 1A2PA 1BNFA 5HOHA 1BIRA 3AGOA 3GSPA 1FW7A 1HZ1A 4GSPA 8RNTA 1B27A 2AADA 1BVIA 2F5MA 1FUSA 1T2IA 2KF6A 2RNTA 3DH2A 5GSPA 1LOVA 1AY7A 1BNIA 1MGRA 1BRGA 2RBIA 1G02A 1GOYA 1I3IA 1RGEA 1RGKA 1R4YA 2BIRA 1TRPA 1I0VA 6RNTA 3DGYA 1GOUA 1RMSA 1GMPA 1X1XA 1JBSA 1B2XA 4GHOA 1RHLA 1RTUA 1RDSA 2F5WA 1B2ZA 1UCIA 3D5IA 1GMQA 1UCKA 1RSNA 4BU4A 1I2EA 1ZGXA 1PYLA 1TRQA 1BSAA 1BSCA 1LOYA 1RGLA 1I0XA 1B21A 1RGHA 2KAAA 2HOHA 1BRSA 1LRAA 3D5GA 1X1UA 1BU4A 1RNTA 1RGCA 1I2GA 2KF3A 9RNTA 4J5KA 3WHOA 1B2SA 1RN4A 1PY3A 5RNTA 1BRNL 2GSPA 1BNSA 1BSDA 1BRJA 1IYYA 1BNGA 4HOHA 1DE3A 1I3FA 1B20A 1RGGA 1RCKA 3URPA 1FZUA 1C54A 1X1YA 1GOVA 1T2HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I2F A;  4BIR A;  5BIR A;  3SYU A;  2C4B A;  1GMR A;  3D4A A;  1SAR A;  1YGW A;  1UCJ A;  1RGF A;  1MGW A;  1TTO A;  1B3S A;  4HAA A;  3A5E A;  1DET A;  2AAE A;  1BSE A;  3BIR A;  2F4Y A;  1BAN A;  1JBR A;  1BNR A;  1FUT A;  3HOH A;  1UCL A;  6GSP A;  1I8V A;  1RCL A;  1BNJ A;  1YVS A;  2KF5 A;  1RNB A;  3Q3F A;  1HYF A;  1YNV X;  3AGN A;  3AHW A;  2F56 A;  4RNT A;  1B2U A;  7RNT A;  1RGA A;  3RNT A;  3AHS A;  1B2M A;  1BUJ A;  1LOW A;  1X1W A;  1BNE A;  1RN1 A;  1Q9E A;  2SAR A;  2BU4 A;  5BU4 A;  1JBT A;  1GSP A;  1BSB A;  3WR2 A;  3BU4 A;  1BOX A;  4J5G A;  1RLS A;  2KF4 A;  1FYS A;  1AQZ A;  1I70 A;  1LNI A;  7GSP A;  1BRK A;  1BGS A;  2ZA4 A;  1CH0 A;  1BRI A;  3KCH A;  1BRH A;  1BAO A;  1A2P A;  1BNF A;  5HOH A;  1BIR A;  3AGO A;  3GSP A;  1FW7 A;  1HZ1 A;  4GSP A;  8RNT A;  1B27 A;  2AAD A;  1BVI A;  2F5M A;  1FUS A;  1T2I A;  2KF6 A;  2RNT A;  3DH2 A;  5GSP A;  1LOV A;  1AY7 A;  1BNI A;  1MGR A;  1BRG A;  2RBI A;  1G02 A;  1GOY A;  1I3I A;  1RGE A;  1RGK A;  1R4Y A;  2BIR A;  1TRP A;  1I0V A;  6RNT A;  3DGY A;  1GOU A;  1RMS A;  1GMP A;  1X1X A;  1JBS A;  1B2X A;  4GHO A;  1RHL A;  1RTU A;  1RDS A;  2F5W A;  1B2Z A;  1UCI A;  3D5I A;  1GMQ A;  1UCK A;  1RSN A;  4BU4 A;  1I2E A;  1ZGX A;  1PYL A;  1TRQ A;  1BSA A;  1BSC A;  1LOY A;  1RGL A;  1I0X A;  1B21 A;  1RGH A;  2KAA A;  2HOH A;  1BRS A;  1LRA A;  3D5G A;  1X1U A;  1BU4 A;  1RNT A;  1RGC A;  1I2G A;  2KF3 A;  9RNT A;  4J5K A;  3WHO A;  1B2S A;  1RN4 A;  1PY3 A;  5RNT A;  1BRN L;  2GSP A;  1BNS A;  1BSD A;  1BRJ A;  1IYY A;  1BNG A;  4HOH A;  1DE3 A;  1I3F A;  1B20 A;  1RGG A;  1RCK A;  3URP A;  1FZU A;  1C54 A;  1X1Y A;  1GOV A;  1T2H A; 
#chains in the Genus database with same CATH topology
 2O3O A;  1W00 A;  1W2Z A;  4HM7 B;  1AVK A;  4H3U A;  1GMR A;  2WGO A;  3MYT A;  3K7C A;  4N6M A;  4R9L A;  1MGW A;  1SQW A;  1OHP A;  3NM7 A;  5D83 A;  1DVC A;  1GD4 A;  1CYU A;  4HAA A;  3A5E A;  2AAE A;  1BSE A;  3IJE B;  4XB5 A;  5AEW B;  1BNR A;  1GY5 A;  3HOH A;  1TUH A;  1IV7 A;  3DGN A;  1YVS A;  1SJW A;  4K61 A;  1VQO 3;  3Q3F A;  1AVL A;  1YNV X;  4FCM A;  3AGN A;  2P0M A;  3AHW A;  3FG1 A;  4RNT A;  1GY7 A;  2WOH A;  3ZG0 A;  4WWU C;  1D6U A;  1RGA A;  3RNT A;  3AHS A;  3NV0 B;  4KZ1 A;  5D81 A;  4CCV A;  5KP4 A;  1HU9 A;  1X1W A;  1BNE A;  3B8L A;  4HZ9 B;  3CCV 3;  5BU4 A;  2BNG A;  3U1W A;  5JPU A;  4OUQ A;  3EJV A;  5IG4 A;  2OOV C;  5ELJ A;  4EBG A;  1OHO A;  1UUG B;  1RLS A;  2UX0 A;  3EBY A;  3OXA A;  5CLK A;  1VZZ A;  4BTW A;  3LTC A;  1AQZ A;  2XH9 A;  2P0X A;  3DM8 A;  4R80 A;  5LC7 A;  1OAC A;  1VQ5 3;  1W6C A;  1BGS A;  2ZA4 A;  5HGR A;  1IT7 A;  1VQ7 3;  2YFL B;  3CC4 3;  5DRE A;  4OK0 A;  1JZD A;  1OGX A;  5CXO A;  3RGR A;  1VQM 3;  1FW7 A;  3DY5 A;  3EHC A;  4O2H A;  1WMN A;  4FCZ A;  2AAD A;  5BVB A;  2L1S A;  4BL3 A;  1M90 4;  4U13 A;  2YFJ B;  2F5M A;  3BND A;  4BTY A;  5EEO A;  2Q07 A;  3DH2 A;  5AIF A;  5GSP A;  3MHE A;  2GEY A;  1OH0 A;  2RBI A;  4HM2 B;  3KN4 A;  1R4Y A;  2BIR A;  2R41 A;  3D3L A;  4H61 A;  4CPK A;  5JBS A;  3B7C A;  1O7N B;  1OHS A;  1YVB I;  2B24 B;  3BNE A;  4GB5 A;  3DGL A;  2Z76 A;  3OWU A;  5STD A;  1B2X A;  1Z1S A;  4RNZ A;  3SOA A;  3CNX A;  1B2M A;  3KII A;  1TU5 A;  3F8H A;  3X3Y A;  4X2O A;  1RDS A;  2CH9 A;  2BT3 A;  1B2Z A;  4R4K A;  3D5I A;  1FGR A;  2HMJ B;  3WA3 A;  1Q7H A;  1RSN A;  1TIJ A;  4K90 B;  3UL6 A;  3UB1 A;  3D79 A;  1YGE A;  1RRH A;  1ZGX A;  3WOE B;  3CMA 3;  3K63 A;  1IDP A;  1RGL A;  2KAA A;  4LSO A;  1B21 A;  1JRQ A;  2XF3 A;  3LT9 A;  2MF7 A;  1DYU A;  1M1X B;  2CW9 A;  1BU4 A;  1RN7 A;  1RNT A;  3LML A;  3X3X A;  3WHO A;  1B2S A;  1PY3 A;  3NX0 A;  1UW1 A;  1KC8 4;  2XGL A;  3SED A;  1VQ6 3;  1K9M 4;  3GRD A;  1IYY A;  5TGN A;  2PZV A;  1IQX A;  1JV2 B;  1OGZ A;  1S5A A;  3M8C A;  3CCU 3;  4BL2 A;  1RGG A;  3F14 A;  2W04 A;  1VQ4 3;  3CPO A;  3NUV A;  1N5H A;  4KVH A;  2IMJ A;  1JKG A;  1RCK A;  4PEJ A;  1VQ8 3;  1GD3 A;  2B1X B;  3G8Z A;  4AEQ A;  1BUQ A;  4HVN A;  2CK3 H;  5M19 A;  1O7G B;  2E2V A;  1M9G A;  3NQY A;  1A2V A;  1T3B A;  1W4N A;  1X1Y A;  1W7C A;  5G2G A;  2C11 A;  2XFT A;  1I2F A;  3OX9 A;  2C4B A;  1MWS A;  3Q90 A;  5EQL A;  4LZI A;  4XDW A;  1FUW A;  1ULI B;  2OQE A;  4WHA A;  1YGW A;  2E2U A;  1UCJ A;  3CCR 3;  1RGF A;  3EN8 A;  1TFO A;  1ISK A;  1E3R A;  4KFE A;  1TTO A;  1O7P B;  1QJG A;  1KD1 4;  1DET A;  1YJW 3;  1UUV B;  2W2C A;  4O3V A;  3CC2 3;  1UI7 A;  3F7S A;  4K1V A;  2M7O A;  1RCL A;  4IPB A;  3AMO A;  2K3D A;  5AIG A;  1NO3 A;  1HYF A;  1STD A;  3V92 A;  1A90 A;  1B2U A;  7RNT A;  3IMA B;  2HMN B;  2LQV A;  1V58 A;  4KT3 B;  5IW9 A;  1OF5 A;  1IQY A;  2CFW A;  3RDE A;  3JUN A;  4FR9 A;  2BU4 A;  3FH1 A;  1RRL A;  3NBJ A;  1N9E A;  3FCS B;  3N8B A;  4FMC A;  1FGM A;  3CU3 A;  1JZO A;  1AR0 A;  1BSB A;  1V74 A;  2KCD A;  3WOD G;  2UGI A;  1BOX A;  1IVU A;  1PFP A;  4J5G A;  4XBT A;  3DXO A;  2KF4 A;  3QK9 A;  1TP6 A;  1LNI A;  3BNC A;  4N6T A;  1GYB A;  4MMX B;  4NRE A;  1O7M B;  4KFD A;  4JF8 A;  4FMA A;  1BRI A;  2CFD A;  2RFR A;  4STD A;  3S27 A;  3X40 A;  4X2H A;  4R9K A;  1VQL 3;  2OQE C;  3CD6 3;  2OCT A;  1BAO A;  3N54 B;  3G0K A;  4MJD A;  3K5T A;  1PU4 A;  1LQM B;  2RSX A;  3LT8 A;  1HZ1 A;  2J8X B;  5AI1 A;  1G0T A;  1UGH I;  4AKZ A;  1NB3 I;  3UJM A;  1N8R 4;  3KSE D;  1RJO A;  3FG4 A;  4JRF A;  2IA7 A;  1FUS A;  3X41 A;  3F9S A;  2XSH B;  2RCD A;  1EKM A;  1ULJ B;  3V99 A;  1BRG A;  3GAX A;  1I3I A;  1RGK A;  4AKY A;  1N9J A;  3PGB A;  7STD A;  2F98 A;  2BO9 B;  3JVC A;  3DMC A;  3PCS A;  2XR8 B;  3EN1 B;  1IVW A;  2ZHX B;  2WGQ A;  2CWU A;  6RNT A;  3X42 A;  5M18 A;  1EQK A;  3NM2 A;  3HZP A;  2GXF A;  2BMQ B;  3CC7 3;  1HKX A;  3FZW A;  1J2B A;  4GHO A;  1RHL A;  1U8C B;  2OWP A;  3HK4 A;  2Z6B A;  3VF1 A;  5DRV A;  5AYS C;  1GMQ A;  2Y74 A;  5AYR B;  3FLJ A;  3I55 3;  2W56 A;  2YFI B;  1UI8 A;  4BU4 A;  1NWW A;  1Q81 4;  1MNL A;  1BSA A;  1VQN 3;  3FF2 A;  3MPH A;  4ILF A;  2XRX B;  1BRS A;  3D5G A;  3HIG A;  3F40 A;  1X1U A;  5AEU B;  1WNH A;  3AMO B;  3CCQ 3;  2W9Q A;  1LOX A;  1I2G A;  1QAF A;  2KF3 A;  3B4P A;  6STD A;  5IEP A;  1MOL A;  3X3Z A;  1D6Z A;  2F99 A;  3KZT A;  1DMQ A;  4FMB A;  2GSP A;  1IQ8 A;  5ELU A;  1BSD A;  5BXQ A;  1BNG A;  1ASK A;  1OF5 B;  4HOH A;  4XBX A;  4N6U A;  1LNH A;  3KKG A;  2CC3 A;  1IU7 A;  1I3F A;  4RBN A;  4HM4 B;  3FF0 A;  3ROB A;  2OTL 3;  5AII A;  1N8Q A;  3GWR A;  4LYL B;  3HII A;  2CWV A;  1L5G B;  1G96 A;  5CF1 A;  3WDG B;  2KXG A;  1FZU A;  2JQ5 A;  1YI2 3;  4OVM A;  1W5Z A;  1NU3 A;  1DE3 A;  2ZL8 A;  1K8A 4;  5BIR A;  4RZM A;  2FGT A;  4HBR A;  2GBX B;  1E97 A;  2FNQ A;  4HJL B;  1SAR A;  2CX1 A;  2YX9 A;  1CYV A;  1IVX A;  3MG3 A;  4XM4 A;  5LC6 A;  1B3S A;  3PS8 A;  1DVD A;  3BIR A;  2KRT A;  3LTA A;  4EYC A;  1FUT A;  3ALA A;  4N6O B;  5AIH A;  1ZX2 A;  1UCL A;  4O02 B;  3S28 A;  1I8V A;  3WMD A;  1BNJ A;  2KF5 A;  1WTH A;  3CNM A;  1Q86 4;  4WYK A;  4I5Q A;  8CHO A;  3N9H A;  2CHC A;  2F56 A;  1U5O A;  2GEX A;  4HM5 B;  3F8X A;  4QWT A;  3PCR A;  3A76 A;  2PNC A;  1BUJ A;  2H0I A;  4CDL A;  5FGO A;  1LXE A;  1O7W B;  1RN1 A;  4Q53 A;  1Q9E A;  5KP3 A;  1KQS 2;  2SAR A;  3G6E 3;  1D6Y A;  2W9P A;  4ORL A;  1JBT A;  3HI7 A;  4HM8 B;  4EV5 A;  1DMN A;  1KWI A;  3WR2 A;  5IG3 A;  1Y4K A;  4HM6 B;  3FG3 A;  3I0Y A;  1I70 A;  2W56 B;  3ZG5 A;  5A0O B;  5KP1 A;  7GSP A;  1W2B 2;  1BRK A;  3GZX B;  2BHM A;  3H51 A;  4J8T A;  4XBY A;  1K28 A;  3KCH A;  3CCM 3;  3OWS A;  3T8U A;  2Z7A A;  3NXJ A;  1JNQ A;  1BRH A;  1Q42 A;  2LYX A;  1A2P A;  2CWT A;  3EC9 A;  3T0U A;  3FSD A;  1BIR A;  5HOH A;  2QEX 3;  3GSP A;  1QVG 2;  3K9M C;  3MG1 A;  4L8P A;  2IUK A;  4GSP A;  8RNT A;  1IK3 A;  1JJ2 2;  1B27 A;  2CKF B;  1SIH A;  1S72 3;  2CFL A;  1EA2 A;  2K54 A;  1DMM A;  1T2I A;  2STD A;  1VQP 3;  2D1W A;  3K0Z A;  1MGR A;  1GOY A;  1RGE A;  1TRP A;  3MG2 A;  4FCJ A;  4LMI A;  3RGA A;  1CEW I;  3VSY A;  3DGY A;  3FKA A;  1RMS A;  1Q82 4;  4EXR A;  4NHF A;  4R1K A;  3E99 A;  2XGN A;  2HMO B;  3GZR A;  1NDO B;  4N6L A;  4I4K A;  1OCV A;  2W03 A;  1RTU A;  5I97 A;  2MC8 A;  1UCI A;  1YIT 3;  1YJ9 3;  3QRD A;  2CIU A;  2A15 A;  2WOF A;  1WQL B;  3EX9 A;  3NBB A;  1I2E A;  3D9R A;  1PYL A;  1ZO2 A;  1TRQ A;  2ZDJ A;  3CCE 3;  1WMP A;  1T5Y A;  1JB5 A;  1I0X A;  1RGH A;  3MKI A;  2HOH A;  2Y73 A;  3LYG A;  1LRA A;  1VQK 3;  1JN5 A;  4WYK B;  1RGC A;  3H3H A;  9RNT A;  4HKV B;  4J5K A;  4MEI A;  1RN4 A;  2W0Q A;  2Z77 A;  2ML5 A;  3DGO A;  5RNT A;  1JKG B;  1OUN A;  1BRN L;  3SX1 A;  4HYZ A;  4N3V A;  3KE7 A;  2BMO B;  2XFS A;  1BNS A;  1BRJ A;  1QAK A;  2GU3 A;  1K41 A;  1IVV A;  4CJN A;  3JUQ A;  4DKI A;  2P38 A;  4O8S A;  3I56 3;  3S5C A;  4HM1 B;  3WOF B;  3BLZ A;  4WFO A;  3NHX A;  3NQZ A;  3O8Y A;  3DZL A;  4L8O A;  2P05 A;  2H0H A;  3UL5 A;  4TX4 A;  1ROA A;  3EF8 A;  3JUM A;  1C54 A;  5M1A A;  1GOV A;  3PZW A;  1T2H A;  4G1M B;  4BIR A;  3PXM A;  3T8N A;  4GL6 A;  3SYU A;  1UUW B;  2C10 A;  3D4A A;  4FMD A;  1UGI A;  1W02 A;  1ZS7 A;  3JUO A;  1NJI 4;  1R4C A;  5IG0 A;  2F4Y A;  1BAN A;  1MWR A;  1JBR A;  3S67 A;  1Q40 A;  1EEJ A;  6GSP A;  5CF2 A;  5IEN A;  1RNB A;  1GS3 A;  1TFK A;  1QAL A;  2E2T A;  3SLU A;  1YHQ 3;  3SXX A;  2SBL A;  1VQQ A;  4LEH A;  5EVH A;  1RKY A;  3G4S 3;  2QGU A;  2QIY A;  2O9U X;  1LOW A;  2CFG A;  2ML6 A;  2K0M A;  3LH4 A;  1K73 4;  2CFK A;  4WP5 A;  4N6V 0;  4MMY B;  4XDV A;  2OTJ 3;  3EE1 A;  3G71 3;  3TDG A;  1GY6 A;  1GSP A;  3L0R A;  3HX8 A;  3S29 A;  2JDI H;  3DGM A;  3BU4 A;  1V57 A;  2HML B;  1F8N A;  1M1K 4;  3LOY A;  3ECF A;  5G1K A;  5IEO A;  4EC6 A;  1FYS A;  2HMM B;  1FGT A;  1LQG C;  1N5P A;  2IYJ A;  3LTD A;  1W6Y A;  4IIA A;  3CCL 3;  3SVA A;  1KSI A;  4J9A A;  2BMR B;  2L4V A;  1CH0 A;  3BNB A;  2IY2 A;  1W6G A;  2XEP A;  5FW5 A;  4N6N B;  1JN5 B;  2FXT A;  2H0G A;  4KFF A;  1BNF A;  2CG0 A;  2UUG C;  3LTB A;  3AGO A;  2V1L A;  1EUI C;  2HMK B;  1QVF 2;  2WO0 A;  3STD A;  5IER A;  4ZM8 A;  2I9W A;  1STF I;  1US1 A;  1BVI A;  2QA4 3;  4EV2 A;  2KF6 A;  1A67 A;  2RNT A;  1LOV A;  1AY7 A;  1BNI A;  3FGY A;  3KFQ C;  3G16 A;  3LXU X;  1TJD A;  1G02 A;  1O7H B;  1UDI I;  3GZY B;  1FGQ A;  1C7H A;  3NV0 A;  1FGO A;  1I0V A;  1MWU A;  2RGQ A;  3IPT A;  1NB5 I;  5JPP A;  1LVN A;  4HM0 B;  2W6J H;  1QMA A;  1GOU A;  4NPB A;  3OWY A;  2CG1 A;  1GMP A;  1X1X A;  4L7K A;  3WA2 X;  1JBS A;  3JUP A;  4HZB B;  3SOY A;  3BB9 A;  2GU1 A;  3NBR A;  5CK6 A;  1FA3 A;  1IV9 A;  2D42 A;  2F5W A;  4RNY A;  3ER7 A;  1Q7Y 4;  1UCK A;  4IT7 A;  4MMZ B;  1OPY A;  5IG5 A;  3CME 3;  1JB2 A;  1BSC A;  1LOY A;  1Q40 B;  3OW2 2;  1WMO A;  3EB8 A;  2R4I A;  3CPW 2;  4BTX A;  2CX0 A;  3EBT A;  3F7X A;  3GZB A;  5G1L A;  3VGN A;  3Q1C A;  3MSO A;  3LZA A;  3EQQ B;  1ROV A;  4K1U A;  5IF6 A;  2XSO B;  3CCS 3;  1SII A;  4LGQ A;  1YJN 3;  3CXC 2;  1NNV A;  3U97 A;  2INX A;  4EW5 A;  1W01 A;  1E3V A;  3DUK A;  3Q2P A;  1SPU A;  1EG9 B;  3KSP A;  2IUJ A;  3UNL A;  2P09 A;  1B20 A;  1AV4 A;  2OOV A;  3MWZ A;  3URP A;  1CQS A;  3PYJ A;  4HM3 B;  3B4O A;  1MWT A;  3V98 A;  2GBW B;  3J7Y d;  1YIJ 3;  1VQ9 3;  1A2K A;  1JB4 A;  1IT8 A;  2F86 B;  5D82 A;  3ZFZ A;  3CCJ 3;  3OV4 A; 
#chains in the Genus database with same CATH homology
 1I2F A;  4BIR A;  5BIR A;  3SYU A;  2C4B A;  1GMR A;  3D4A A;  1SAR A;  1YGW A;  1UCJ A;  1RGF A;  1MGW A;  1TTO A;  1B3S A;  4HAA A;  3A5E A;  1DET A;  2AAE A;  1BSE A;  3BIR A;  2F4Y A;  1BAN A;  1JBR A;  1BNR A;  1FUT A;  3HOH A;  1UCL A;  6GSP A;  1I8V A;  1RCL A;  1BNJ A;  1YVS A;  2KF5 A;  1RNB A;  3Q3F A;  1HYF A;  1YNV X;  3AGN A;  3AHW A;  2F56 A;  4RNT A;  1B2U A;  7RNT A;  1RGA A;  3RNT A;  3AHS A;  1B2M A;  1BUJ A;  1LOW A;  1X1W A;  1BNE A;  1RN1 A;  1Q9E A;  2SAR A;  2BU4 A;  5BU4 A;  1JBT A;  1GSP A;  1BSB A;  3WR2 A;  3BU4 A;  1BOX A;  4J5G A;  1RLS A;  2KF4 A;  1FYS A;  1AQZ A;  1I70 A;  1LNI A;  7GSP A;  1BRK A;  1BGS A;  2ZA4 A;  1CH0 A;  1BRI A;  3KCH A;  1BRH A;  1BAO A;  1A2P A;  1BNF A;  5HOH A;  1BIR A;  3AGO A;  3GSP A;  1FW7 A;  1HZ1 A;  4GSP A;  8RNT A;  1B27 A;  2AAD A;  1BVI A;  2F5M A;  1FUS A;  1T2I A;  2KF6 A;  2RNT A;  3DH2 A;  5GSP A;  1LOV A;  1AY7 A;  1BNI A;  1MGR A;  1BRG A;  2RBI A;  1G02 A;  1GOY A;  1I3I A;  1RGE A;  1RGK A;  1R4Y A;  2BIR A;  1TRP A;  1I0V A;  6RNT A;  3DGY A;  1GOU A;  1RMS A;  1GMP A;  1X1X A;  1JBS A;  1B2X A;  4GHO A;  1RHL A;  1RTU A;  1RDS A;  2F5W A;  1B2Z A;  1UCI A;  3D5I A;  1GMQ A;  1UCK A;  1RSN A;  4BU4 A;  1I2E A;  1ZGX A;  1PYL A;  1TRQ A;  1BSA A;  1BSC A;  1LOY A;  1RGL A;  1I0X A;  1B21 A;  1RGH A;  2KAA A;  2HOH A;  1BRS A;  1LRA A;  3D5G A;  1X1U A;  1BU4 A;  1RNT A;  1RGC A;  1I2G A;  2KF3 A;  9RNT A;  4J5K A;  3WHO A;  1B2S A;  1RN4 A;  1PY3 A;  5RNT A;  1BRN L;  2GSP A;  1BNS A;  1BSD A;  1BRJ A;  1IYY A;  1BNG A;  4HOH A;  1DE3 A;  1I3F A;  1B20 A;  1RGG A;  1RCK A;  3URP A;  1FZU A;  1C54 A;  1X1Y A;  1GOV A;  1T2H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...