1TUHA

Structure of bal32a from a soil-derived mobile gene cassette
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
131
structure length
131
Chain Sequence
NEAEQNAETVRRGYAAFNSGDMKTLTELFDENASWHTPGRSRIAGDHKGREAIFAQFGRYGGETGGTFKAVLLHVLKSDDGRVIGIHRNTAERGGKRLDVGCCIVFEFKNGRVIDGREHFYDLYAWDEFWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Integron-associated Mobile Gene Cassettes Code for Folded Proteins: The Structure of Bal32a, a New Member of the Adaptable alpha+beta Barrel Family
pubmed doi rcsb
source organism Uncultured bacterium
molecule tags Unknown function
molecule keywords hypothetical protein EGC068
total genus 48
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2004-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1tuhA00
2F98A 4HM8B 7STDA 1NWWA 3DXOA 3JUPA 4HZ9B 1OF5B 5IEPA 3F8HA 2B1XB 4LMIA 3A76A 5IEOA 2GEYA 3EF8A 3GRDA 3KKGA 4HJLB 4HM6B 1W6YA 2A15A 2JQ5A 3CNMA 1ISKA 4L8PA 3FF0A 1E3RA 3GZBA 3MSOA 4LGQA 5AEWB 2Z7AA 2Z76A 2K54A 1SJWA 2YFLB 3G0KA 5KP1A 3JUQA 3CU3A 3OWYA 2YFIB 4OVMA 3VGNA 2OWPA 3DUKA 4I4KA 1OH0A 3FH1A 1W00A 2QIYA 5IG3A 1OF5A 3HK4A 3EN1B 5JPUA 2HMOB 1Q40B 2BMQB 3LZAA 1OCVA 3FKAA 1NDOB 5IG5A 1OGXA 2HMJB 3VSYA 3HX8A 1OHSA 1O7MB 1EA2A 4HM7B 2F86B 3NV0A 1NU3A 3H51A 1GYBA 3BB9A 4XM4A 1O7GB 3SOYA 3UJMA 4LEHA 4STDA 4WP5A 4X2OA 2GBXB 2HMKB 5D81A 3UNLA 5TGNA 8CHOA 2CKFB 3B7CA 4HKVB 1JKGB 3DM8A 3K7CA 4Q53A 4HM1B 1U5OA 3G8ZA 3NXJA 4HVNA 4OUQA 3OX9A 1QJGA 1W01A 3GZYB 3HZPA 2STDA 3GZXB 1DMMA 3F40A 2RCDA 4N3VA 3EBTA 4K1VA 1BUQA 4RZMA 4U13A 4WYKB 3ECFA 4XBYA 5CK6A 1JKGA 4CDLA 1E3VA 4R9LA 3T8UA 3EHCA 3EX9A 3MG1A 5AEUB 2IMJA 3ER7A 3D9RA 1ZX2A 4HM2B 1JN5A 5AIGA 2R4IA 3MG3A 5CLKA 1JB4A 3GWRA 1Q40A 4MJDA 3SEDA 3OXAA 3FF2A 5IG4A 4HZBB 1OHOA 1O7WB 2CHCA 5HGRA 3MG2A 4XB5A 1ULJB 5FW5A 1STDA 2PZVA 3K0ZA 1OPYA 3B8LA 3MHEA 1E97A 1TUHA 2GXFA 3MKIA 3NV0B 3NUVA 1AR0A 1DMNA 2B24B 2BMOB 2INXA 3EQQB 1VZZA 3F14A 4HM0B 2XRXB 1HKXA 4KVHA 4FCJA 2QGUA 1JB2A 2F99A 2GEXA 1S5AA 1EG9B 3BLZA 1Q42A 2HMNB 2BMRB 3EN8A 2YFJB 4H3UA 3B4OA 3I0YA 5IENA 1TP6A 4XBXA 4XDVA 1W02A 3CPOA 4PEJA 1GS3A 5CF2A 5JPPA 1ASKA 2W2CA 3SOAA 5CXOA 5CF1A 4IIAA 4WWUC 3GZRA 3OWUA 4GB5A 1Z1SA 3EC9A 4XBTA 5AIIA 1UUVB 5DRVA 3FZWA 5IG0A 5IF6A 4WYKA 4L8OA 4R1KA 3T8NA 3ROBA 1QMAA 1C7HA 3M8CA 3B4PA 3FGYA 3FSDA 2RGQA 3NHXA 3CNXA 3EBYA 2HMMB 4ORLA 3F7SA 3WMDA 1A2KA 3RGRA 2Z77A 1DMQA 5AIHA 3G16A 5G2GA 1CQSA 2XR8B 3E99A 4X2HA 2RFRA 4FCMA 3F7XA 2HMLB 2I9WA 4J8TA 5BXQA 2BNGA 4L7KA 4XDWA 5D82A 5IERA 2UX0A 1ULIB 1GY5A 3RGAA 4R9KA 3Q90A 5EVHA 4HM4B 5AIFA 3KE7A 1O7NB 5STDA 1GY6A 3F8XA 1JB5A 3MYTA 3NM2A 5AI1A 5KP4A 1JN5B 1UUWB 3DZLA 3H3HA 1GY7A 3KSPA 3NBRA 4HM3B 3STDA 1ZO2A 3EJVA 3DMCA 4HM5B 2GBWB 4K1UA 1K41A 3IPTA 3JUMA 6STDA 3KZTA 1O7PB 5D83A 5KP3A 1WQLB 3FLJA 3LYGA 1OGZA 1OUNA 3OWSA 1IDPA 5BVBA 2XSOB 1O7HB 1OHPA 3F9SA 3S5CA 5DREA 3OV4A 3JUNA 4J9AA 2XSHB 3JUOA
chains in the Genus database with same CATH superfamily
3S28A 7STDA 3PYJA 3JUPA 2KRTA 2OOVC 1X1YA 3SVAA 4EW5A 1IVUA 3A76A 1RN7A 2OTL3 1JRQA 2CX1A 1B21A 1W6YA 2CK3H 1VQ73 2BO9B 4NPBA 4EXRA 1JBSA 3MPHA 1E3RA 1VQ43 3FG3A 5AEWB 4KT3B 5HOHA 3KIIA 3SX1A 2Z76A 1NNVA 2K54A 2YFLB 3BNEA 5KP1A 4FMDA 2CFKA 1YIT3 2CX0A 3DUKA 3PZWA 3EN1B 2Y73A 3AGOA 3HIIA 5IG5A 4BL2A 1Q7Y4 4HM7B 2OTJ3 3LMLA 4XM4A 1AVLA 2W56A 4STDA 2GBXB 1N5HA 1UCLA 1YNVX 4HBRA 2BT3A 1W2B2 1MWRA 3B7CA 1I3FA 4FCZA 3CCQ3 1B2ZA 2P09A 1EUIC 1VQN3 4K61A 1BNRA 1QALA 1WTHA 3LOYA 3OX9A 2F5MA 3D5GA 1W01A 2STDA 2RCDA 4K1VA 2YX9A 1VQ53 1MOLA 1HZ1A 3FG1A 4RZMA 3DY5A 1UCKA 4R9LA 1DE3A 3EX9A 2W0QA 4WHAA 5AEUB 2IMJA 4EV5A 3IMAB 2P0MA 1VQ63 6GSPA 2W9PA 2CIUA 4HOHA 4N6OB 3KN4A 2MC8A 1I3IA 1Q40A 1EQKA 3D5IA 3FF2A 5IG4A 3CCE3 1O7WB 1UCIA 5BU4A 3MG2A 5FW5A 2D42A 5D81A 1ZS7A 1E97A 2GXFA 1QAFA 1W7CA 2BMOB 2INXA 3AMOA 1VZZA 1YJ93 4AEQA 1BU4A 2XRXB 3X41A 1RSNA 1BVIA 3ALAA 1EG9B 2D1WA 2KCDA 2HMNB 1T3BA 2BMRB 2YFJB 5M1AA 3B4OA 3S67A 7GSPA 3CPW2 4XBXA 3UL5A 2P0XA 4PEJA 5CF2A 1ASKA 2FXTA 3SOAA 2MF7A 2QEX3 3NQZA 1Q814 2ZDJA 3O8YA 3T8NA 4L8OA 3A5EA 1BRGA 3ROBA 1VQM3 4MMYB 1RN4A 1IV7A 3FGYA 3NHXA 2H0HA 5EQLA 3WMDA 3ZFZA 3LTDA 1A2KA 1RRHA 1DMQA 2ZL8A 2ML6A 1FGMA 1UDII 8RNTA 4XDWA 5ELUA 5IERA 3U97A 2UX0A 2C4BA 1VQL3 3RGAA 2KAAA 3LT9A 3V98A 3KE7A 1LOWA 5M19A 4QWTA 1GY6A 3TDGA 4BTWA 1YI23 1YJW3 5KP4A 1D6ZA 2P38A 2OOVA 1YIJ3 4HM3B 2FNQA 5AYSC 1DYUA 1M9GA 1WNHA 3CCL3 1N8QA 1D6YA 4LYLB 1MGWA 3WOFB 1WQLB 3FLJA 1GOUA 4DKIA 1B27A 1IDPA 3F9SA 1OHPA 3RDEA 3S5CA 1AVKA 5DREA 4J9AA 1HU9A 1CEWI 3RNTA 3JUOA 5I97A 1AV4A 2IA7A 2F98A 1NWWA 2ZHXB 1V74A 1LRAA 4HZ9B 5IEPA 2B1XB 1US1A 5IEOA 1BRNL 3CCV3 1W2ZA 4HJLB 3X42A 3BNBA 4GL6A 1U8CB 4FR9A 5G1LA 9RNTA 4L8PA 4GSPA 3AHWA 3GZBA 3MSOA 1B20A 3HI7A 1YGWA 1STFI 2CFWA 1PYLA 3WODG 3JUQA 1PY3A 3OWYA 1MNLA 5G1KA 3VGNA 2OWPA 4I4KA 3CC43 2QIYA 3N9HA 1BNIA 1OF5A 2M7OA 2SARA 2XH9A 5IG3A 5JPUA 1K9M4 1OACA 3LZAA 1OCVA 4N6NB 1FUTA 2HMJB 3VSYA 3HX8A 1OHSA 1O7MB 1KWIA 4R4KA 3U1WA 2GU1A 3BB9A 1A67A 1I2GA 1EKMA 1I2EA 1FUSA 3DGMA 4AKYA 1BANA 1FUWA 3UNLA 1RNTA 1BAOA 8CHOA 3Q1CA 2F5WA 1MWSA 1IQYA 3K7CA 1VQ93 3G8ZA 1YVSA 1QJGA 1BGSA 4N3VA 3Q3FA 3EBTA 1JZOA 2ZA4A 3ECFA 1RCKA 2AAEA 5CK6A 1LXEA 3CCS3 3MG1A 1S723 3N54B 4O3VA 1ZX2A 2BIRA 3SLUA 5LC7A 1AQZA 1JB4A 1UUGB 3LTBA 1Q824 1IQ8A 3PXMA 2KF4A 1JBTA 2IYJA 3OXAA 4FMAA 3ZG0A 4HZBB 1X1XA 3X3YA 3CCR3 1RGKA 3IJEB 3B8LA 1TUHA 2XEPA 2KF5A 3EQQB 1HYFA 2CW9A 4HM0B 1HKXA 4FCJA 2XFSA 1BUJA 2GEXA 5AIIA 4KFFA 4H3UA 1N9JA 1N9EA 1Q7HA 3I0YA 2CH9A 1W02A 4RNZA 2W2CA 5CF1A 5CXOA 1NJI4 4N6LA 2CWVA 1GMRA 2IY2A 3FG4A 3LTAA 3EC9A 4XBTA 5RNTA 1UUVB 2LYXA 3BU4A 5GSPA 1QMAA 1C7HA 4N6MA 4O02B 2E2TA 3FSDA 3WA2X 1TIJA 2P05A 3F7SA 1W6GA 3G4S3 2W6JH 1RGGA 1CQSA 2XR8B 3E99A 1RLSA 2RFRA 4FCMA 1SIIA 1TRPA 1LNIA 3Q90A 4TX4A 3KFQC 4ZM8A 5AIFA 5A0OB 4HYZA 3I563 1N8R4 4K90B 4RNYA 2F56A 1JB5A 5AI1A 2WGOA 2XFTA 3NBBA 1RGAA 1F8NA 2RSXA 3H3HA 1WMNA 1Y4KA 3EE1A 4GHOA 1BSEA 1BSDA 3S29A 1N5PA 4J5GA 1BNFA 4K1UA 3IPTA 5KP3A 1L5GB 3LYGA 1JV2B 1QAKA 5BVBA 1O7HB 1R4YA 1FYSA 1GMQA 1RGEA 2E2UA 2E2VA 2XSHB 1NB5I 1LQGC 2RNTA 3DH2A 1UGHI 4LSOA 4MEIA 4I5QA 1T2IA 3F8HA 6RNTA 3VF1A 1YVBI 1BRIA 3DGOA 3PCRA 3EF8A 3G6E3 3GRDA 4HM6B 1BNGA 3CNMA 2A15A 5M18A 5BIRA 3LT8A 1CYUA 1BSBA 1AY7A 2Z7AA 1M1XB 3G0KA 1RGCA 1FGOA 2K0MA 2GU3A 3V92A 3KSED 1RJOA 4EBGA 3OW22 3K63A 1D6UA 1FZUA 3Q2PA 1W00A 1A2PA 4HAAA 1BIRA 1Q40B 2BMQB 3X3ZA 1UCJA 1NDOB 4JRFA 1OGXA 3J7Yd 2XF3A 4ILFA 3WDGB 1EA2A 3HOHA 1LOVA 1NU3A 3BNDA 1GYBA 3CXC2 2ML5A 1O7GB 4NREA 3UJMA 2BHMA 1SARA 1VQP3 2HMKB 4IPBA 1T2HA 2CKFB 3D79A 3GAXA 1FA3A 1SIHA 3DM8A 1IVVA 2CFLA 3V99A 1B3SA 1U5OA 4OUQA 1X1UA 1GD4A 1LQMB 1YGEA 3URPA 3CC73 3HZPA 3GZXB 4N6TA 1IT7A 1BUQA 2IUJA 1X1WA 4XBYA 1IT8A 3WR2A 4CDLA 1VQK3 1B2UA 3EHCA 2HOHA 1FW7A 3ER7A 1R4CA 1ROAA 4HM2B 1TU5A 1RGHA 5AIGA 3CME3 3D4AA 2CG0A 3GWRA 1W6CA 2OQEC 3SEDA 1J2BA 4R80A 1OHOA 2V1LA 3PGBA 5TGNA 2CG1A 2Z6BA 1IK3A 2PZVA 1MWUA 1ZGXA 3MKIA 4Q53A 3NV0B 2KXGA 3NUVA 1AR0A 1DMNA 2B24B 3NXJA 2OQEA 1I70A 1K734 1FGQA 1ROVA 3RGRA 1SQWA 1T5YA 1I0VA 2F99A 3BLZA 3L0RA 2O3OA 5D83A 1RDSA 1Q42A 1KC84 4LZIA 3X3XA 2OCTA 3AHSA 4JF8A 2C11A 5AYRB 5IENA 2QA43 2WOHA 1GOVA 3CPOA 1GS3A 2XGNA 2J8XB 1NB3I 3DGNA 1QVG2 5FGOA 4J5KA 1RRLA 1TFKA 3FZWA 4O2HA 4WYKA 4R1KA 4CJNA 5EEOA 1MGRA 2IUKA 3S27A 4EYCA 3NQYA 1RCLA 5IW9A 3B4PA 4G1MB 1IVWA 3EBYA 2HMMB 2PNCA 2L4VA 3DGLA 4BTXA 2JDIH 3CCU3 2L1SA 5BXQA 3F7XA 2HMLB 2I9WA 2H0IA 2BNGA 3AMOB 4L7KA 5D82A 4MMZB 3WOEB 1ULIB 4WFOA 1GY5A 3CCM3 1KQS2 1RHLA 1BNJA 1G0TA 1DVCA 1CH0A 1TFOA 3ZG5A 2GSPA 4MMXB 4H61A 1PU4A 3LH4A 1V57A 3DZLA 3KSPA 3CMA3 1A90A 1GMPA 3EJVA 1IU7A 2UUGC 1IVXA 2GBWB 1WMPA 3JUMA 1JBRA 1O7PB 1LVNA 1OGZA 1UGIA 2XSOB 1BRSA 1KD14 2C10A 3OV4A 3JUNA 1UW1A 1BSCA 1BSAA 4HM8B 4EV2A 3DXOA 1JZDA 4CCVA 1RMSA 3KCHA 1OF5B 3EB8A 2W56B 4BU4A 1FGTA 2WOFA 4LMIA 3CCJ3 2GEYA 3KKGA 1QVF2 2CWUA 2JQ5A 1ISKA 2CFGA 2Q07A 3FF0A 4CPKA 1A2VA 2CC3A 2W9QA 2WO0A 1WMOA 4KFDA 3HIGA 4LGQA 3PCSA 4O8SA 1LOYA 1SJWA 2F4YA 1B2MA 3CU3A 4OVMA 2YFIB 3DGYA 1OH0A 3FH1A 1JNQA 3HK4A 1BNEA 1RGFA 3PS8A 4OK0A 5ELJA 2HMOB 4KFEA 3FKAA 2KF6A 3LTCA 1V58A 1YHQ3 1VQQA 1FGRA 3K9MC 2F86B 1IV9A 3H51A 3NV0A 1C54A 3SOYA 4LEHA 4WP5A 4X2OA 2AADA 4BIRA 1JKGB 1BNSA 2Y74A 4HM1B 4HVNA 2UGIA 1VQO3 1BOXA 3GZYB 1DMMA 3F40A 2W04A 1I0XA 4U13A 4WYKB 2W03A 2FGTA 1DETA 1JKGA 3CD63 1E3VA 4FMBA 4BL3A 1K8A4 3T8UA 2RBIA 1M904 3D9RA 1IQXA 5LC6A 4AKZA 1JN5A 2R4IA 3MG3A 5CLKA 4MJDA 4BTYA 1BRKA 3WHOA 1GD3A 3K5TA 3G713 4EC6A 2KF3A 5HGRA 2CHCA 1Q9EA 4XB5A 1RN1A 1ULJB 1RTUA 1STDA 3K0ZA 1OPYA 3MHEA 4HKVB 4KZ1A 1RGLA 1G02A 1TJDA 4R9KA 3UL6A 3UB1A 1BRHA 3F14A 1LOXA 4KVHA 2QGUA 1JB2A 3EN8A 1EEJA 1S5AA 1UI7A 4FMCA 1TP6A 4XDVA 5JPPA 3NX0A 3BIRA 3BNCA 3QK9A 1M1K4 4IIAA 4WWUC 3CC23 3GZRA 3OWUA 4GB5A 1Z1SA 1W5ZA 5DRVA 5IG0A 5IF6A 1MWTA 1W4NA 3LXUX 3M8CA 1BRJA 1TTOA 2R41A 4ORLA 2RGQA 7RNTA 1CYVA 3CNXA 4IT7A 1YJN3 2CFDA 3FCSB 3GSPA 2Z77A 5AIHA 3G16A 1SPUA 5G2GA 1G96A 1LNHA 4X2HA 3WA3A 1PFPA 4J8TA 2O9UX 1B2XA 3QRDA 4NHFA 1B2SA 3SYUA 1K28A 1TRQA 1RKYA 5EVHA 4HM4B 2BU4A 1GSPA 1KSIA 1O7NB 3MWZA 5STDA 3I553 3F8XA 3N8BA 3MYTA 3NM2A 1VQ83 1IYYA 1JN5B 3NM7A 1I8VA 1UUWB 3NBJA 1UI8A 3NBRA 1GY7A 3X40A 1NO3A 3AGNA 3STDA 1ZO2A 1RNBA 3DMCA 4HM5B 1DVDA 3T0UA 3JVCA 1K41A 2K3DA 6STDA 3KZTA 2LQVA 1OUNA 2SBLA 1GOYA 3OWSA 3SXXA 4N6V0 2WGQA 5JBSA 3D3LA 4RNTA 2H0GA 2CWTA 1Q864 1JJ22 1I2FA 4N6UA 4RBNA 2XGLA
chains in the Genus database with same CATH topology
3S28A 7STDA 3PYJA 3JUPA 2KRTA 2OOVC 3SVAA 1IVUA 3A76A 1RN7A 2OTL3 1JRQA 1W6YA 2CK3H 1VQ73 2BO9B 4EXRA 3MPHA 1E3RA 1VQ43 3FG3A 5AEWB 3KIIA 3SX1A 2Z76A 2K54A 2YFLB 3BNEA 5KP1A 4FMDA 2CFKA 1YIT3 3DUKA 3PZWA 3EN1B 2Y73A 3HIIA 5IG5A 1Q7Y4 4HM7B 2OTJ3 3LMLA 4XM4A 1AVLA 2W56A 4STDA 2GBXB 1N5HA 4HBRA 1W2B2 2BT3A 3B7CA 4FCZA 3CCQ3 2P09A 1VQN3 4K61A 1QALA 1WTHA 3LOYA 3OX9A 1W01A 2STDA 2RCDA 4K1VA 2YX9A 1VQ53 1MOLA 4RZMA 3FG1A 3DY5A 4R9LA 3EX9A 2W0QA 4WHAA 5AEUB 2IMJA 4EV5A 3IMAB 2P0MA 1VQ63 2W9PA 2CIUA 4N6OB 3KN4A 2MC8A 1Q40A 1EQKA 3FF2A 5IG4A 3CCE3 1O7WB 3MG2A 5FW5A 2D42A 5D81A 1E97A 2GXFA 1QAFA 1W7CA 2BMOB 2INXA 3AMOA 1VZZA 1YJ93 4AEQA 2XRXB 3X41A 3ALAA 1EG9B 2D1WA 2KCDA 2HMNB 2BMRB 3S67A 2YFJB 3B4OA 3CPW2 4XBXA 3UL5A 2P0XA 4PEJA 5CF2A 1ASKA 2FXTA 3SOAA 2MF7A 2QEX3 3NQZA 1Q814 2ZDJA 3O8YA 3T8NA 4L8OA 3ROBA 1VQM3 4MMYB 3FGYA 1IV7A 3NHXA 5EQLA 3WMDA 3LTDA 1A2KA 1RRHA 1DMQA 2ZL8A 2ML6A 1FGMA 4XDWA 5ELUA 5IERA 3U97A 2UX0A 1VQL3 3RGAA 3LT9A 3V98A 3KE7A 4QWTA 1GY6A 3TDGA 4BTWA 1YI23 1YJW3 5KP4A 1D6ZA 2P38A 2OOVA 1YIJ3 4HM3B 2FNQA 5AYSC 1DYUA 1M9GA 1WNHA 3CCL3 1N8QA 1D6YA 3WOFB 1WQLB 3FLJA 1IDPA 3F9SA 1OHPA 3RDEA 3S5CA 1AVKA 5DREA 4J9AA 1HU9A 1CEWI 5I97A 3JUOA 1AV4A 2IA7A 2F98A 1NWWA 1V74A 4HZ9B 5IEPA 2B1XB 1US1A 5IEOA 3CCV3 1W2ZA 4HJLB 3X42A 3BNBA 4GL6A 1U8CB 4FR9A 4L8PA 3GZBA 3MSOA 3HI7A 1STFI 2CFWA 3WODG 3JUQA 3OWYA 1MNLA 3VGNA 3CC43 2OWPA 4I4KA 2QIYA 3N9HA 2M7OA 1OF5A 5IG3A 2XH9A 5JPUA 1K9M4 1OACA 3LZAA 1OCVA 4N6NB 2HMJB 3VSYA 3HX8A 1OHSA 1O7MB 1KWIA 4R4KA 3U1WA 2GU1A 3BB9A 1A67A 1EKMA 3DGMA 1FUWA 4AKYA 3UNLA 8CHOA 3Q1CA 1IQYA 3K7CA 1VQ93 3G8ZA 1QJGA 4N3VA 3EBTA 3ECFA 5CK6A 1LXEA 3CCS3 3MG1A 1S723 3N54B 4O3VA 1ZX2A 3SLUA 5LC7A 1JB4A 3LTBA 1Q824 1IQ8A 3PXMA 3OXAA 4FMAA 4HZBB 3X3YA 3CCR3 3IJEB 3B8LA 1TUHA 2XEPA 3EQQB 4HM0B 2CW9A 1HKXA 4FCJA 2XFSA 2GEXA 5AIIA 4KFFA 4H3UA 1N9JA 1N9EA 3I0YA 2CH9A 1W02A 4RNZA 2W2CA 5CF1A 5CXOA 1NJI4 4N6LA 2CWVA 3FG4A 3LTAA 3EC9A 4XBTA 1UUVB 2LYXA 1QMAA 1C7HA 4N6MA 4O02B 2E2TA 3FSDA 3WA2X 1TIJA 2P05A 3F7SA 1W6GA 3G4S3 2W6JH 1CQSA 2XR8B 3E99A 2RFRA 4FCMA 1SIIA 3Q90A 4TX4A 3KFQC 4ZM8A 5AIFA 5A0OB 4HYZA 3I563 1N8R4 4K90B 4RNYA 1JB5A 5AI1A 2WGOA 2XFTA 3NBBA 1F8NA 2RSXA 3H3HA 1WMNA 1Y4KA 3EE1A 3S29A 1N5PA 4K1UA 3IPTA 5KP3A 1L5GB 3LYGA 1JV2B 1QAKA 5BVBA 1O7HB 2XSHB 2E2UA 2E2VA 1NB5I 4LSOA 4MEIA 3F8HA 3VF1A 1YVBI 3DGOA 3PCRA 3EF8A 3G6E3 3GRDA 4HM6B 3CNMA 2A15A 3LT8A 1CYUA 2Z7AA 1M1XB 3G0KA 1FGOA 2K0MA 2GU3A 3V92A 3KSED 1RJOA 4EBGA 3OW22 3K63A 1D6UA 3Q2PA 1W00A 1Q40B 2BMQB 3X3ZA 4JRFA 1NDOB 3J7Yd 1OGXA 2XF3A 3WDGB 1EA2A 1NU3A 3BNDA 1GYBA 3CXC2 2ML5A 1O7GB 4NREA 2BHMA 1VQP3 2HMKB 4IPBA 2CKFB 3GAXA 1FA3A 1SIHA 3DM8A 1IVVA 2CFLA 3V99A 1U5OA 4OUQA 1GD4A 1YGEA 3CC73 3HZPA 3GZXB 4N6TA 1IT7A 1BUQA 2IUJA 4XBYA 1IT8A 4CDLA 1VQK3 3EHCA 3ER7A 1R4CA 1ROAA 4HM2B 1TU5A 3CME3 5AIGA 2CG0A 3GWRA 1W6CA 2OQEC 3SEDA 1J2BA 4R80A 1OHOA 2V1LA 3PGBA 5TGNA 2CG1A 2Z6BA 1IK3A 2PZVA 3MKIA 4Q53A 3NV0B 2KXGA 3NUVA 1AR0A 1DMNA 2B24B 3NXJA 2OQEA 1K734 1FGQA 1ROVA 3RGRA 1SQWA 1T5YA 2F99A 3BLZA 3L0RA 2O3OA 5D83A 1Q42A 1KC84 4LZIA 3X3XA 2OCTA 5AYRB 4JF8A 2C11A 5IENA 2QA43 2WOHA 3CPOA 1GS3A 2XGNA 3DGNA 1NB3I 1QVG2 5FGOA 1RRLA 1TFKA 3FZWA 4O2HA 4WYKA 4R1KA 4EYCA 5EEOA 3S27A 2IUKA 5IW9A 3NQYA 3B4PA 4G1MB 1IVWA 3EBYA 2HMMB 2PNCA 2L4VA 3DGLA 4BTXA 2JDIH 3CCU3 5BXQA 3F7XA 2HMLB 2I9WA 2BNGA 3AMOB 4L7KA 5D82A 4MMZB 3WOEB 1ULIB 4WFOA 1GY5A 3CCM3 1KQS2 1DVCA 1TFOA 4MMXB 4H61A 1PU4A 3LH4A 3DZLA 3KSPA 3CMA3 1A90A 3EJVA 1IU7A 1IVXA 2GBWB 1WMPA 3JUMA 1O7PB 1LVNA 1OGZA 2XSOB 1KD14 2C10A 3OV4A 3JUNA 1UW1A 4HM8B 4EV2A 3DXOA 4CCVA 1OF5B 3EB8A 2W56B 1FGTA 2WOFA 4LMIA 3CCJ3 2GEYA 3KKGA 1QVF2 2CWUA 2JQ5A 1ISKA 2CFGA 2Q07A 3FF0A 1A2VA 2CC3A 2W9QA 2WO0A 1WMOA 4KFDA 3HIGA 4LGQA 3PCSA 4O8SA 1SJWA 3CU3A 4OVMA 2YFIB 1OH0A 3FH1A 1JNQA 3HK4A 3PS8A 4OK0A 5ELJA 2HMOB 4KFEA 3FKAA 3LTCA 1YHQ3 1FGRA 3K9MC 2F86B 1IV9A 3H51A 3NV0A 3SOYA 4LEHA 4WP5A 4X2OA 1JKGB 2Y74A 4HM1B 4HVNA 1VQO3 3GZYB 1DMMA 3F40A 2W04A 4U13A 4WYKB 2W03A 2FGTA 1JKGA 3CD63 1E3VA 4FMBA 1K8A4 3T8UA 1M904 3D9RA 1IQXA 5LC6A 4AKZA 1JN5A 2R4IA 3MG3A 5CLKA 4MJDA 4BTYA 1GD3A 3K5TA 3G713 4EC6A 5HGRA 2CHCA 4XB5A 1ULJB 4KZ1A 1STDA 3K0ZA 3MHEA 1OPYA 4HKVB 4R9KA 3UJMA 3UL6A 3UB1A 3F14A 1LOXA 4KVHA 2QGUA 1JB2A 3EN8A 1UI7A 1S5AA 4FMCA 1TP6A 4XDVA 5JPPA 3NX0A 3BNCA 3QK9A 1M1K4 4IIAA 4WWUC 3CC23 3GZRA 3OWUA 4GB5A 1Z1SA 1W5ZA 5DRVA 5IG0A 5IF6A 1W4NA 3LXUX 3M8CA 4ORLA 1YJN3 2RGQA 1CYVA 3CNXA 4IT7A 2CFDA 3FCSB 2Z77A 5AIHA 3G16A 1SPUA 5G2GA 1LNHA 1G96A 4X2HA 3WA3A 1PFPA 4J8TA 2O9UX 3QRDA 4NHFA 1K28A 1RKYA 5EVHA 4HM4B 1KSIA 1O7NB 3MWZA 5STDA 3I553 3F8XA 3N8BA 3MYTA 3NM2A 1VQ83 1JN5B 3NM7A 3NBJA 1UUWB 1UI8A 3NBRA 1GY7A 3X40A 1NO3A 3STDA 1ZO2A 3DMCA 4HM5B 1DVDA 3T0UA 3JVCA 1K41A 6STDA 3KZTA 2LQVA 1OUNA 2SBLA 3OWSA 3SXXA 4N6V0 2WGQA 5JBSA 3D3LA 2CWTA 1Q864 1JJ22 4N6UA 4RBNA 2XGLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F98 A;  4HM8 B;  7STD A;  1NWW A;  3DXO A;  3JUP A;  4HZ9 B;  1OF5 B;  5IEP A;  3F8H A;  2B1X B;  4LMI A;  3A76 A;  5IEO A;  2GEY A;  3EF8 A;  3GRD A;  3KKG A;  4HJL B;  4HM6 B;  1W6Y A;  2A15 A;  2JQ5 A;  3CNM A;  1ISK A;  4L8P A;  3FF0 A;  1E3R A;  3GZB A;  3MSO A;  4LGQ A;  5AEW B;  2Z7A A;  2Z76 A;  2K54 A;  1SJW A;  2YFL B;  3G0K A;  5KP1 A;  3JUQ A;  3CU3 A;  3OWY A;  2YFI B;  4OVM A;  3VGN A;  2OWP A;  3DUK A;  4I4K A;  1OH0 A;  3FH1 A;  1W00 A;  2QIY A;  5IG3 A;  1OF5 A;  3HK4 A;  3EN1 B;  5JPU A;  2HMO B;  1Q40 B;  2BMQ B;  3LZA A;  1OCV A;  3FKA A;  1NDO B;  5IG5 A;  1OGX A;  2HMJ B;  3VSY A;  3HX8 A;  1OHS A;  1O7M B;  1EA2 A;  4HM7 B;  2F86 B;  3NV0 A;  1NU3 A;  3H51 A;  1GYB A;  3BB9 A;  4XM4 A;  1O7G B;  3SOY A;  3UJM A;  4LEH A;  4STD A;  4WP5 A;  4X2O A;  2GBX B;  2HMK B;  5D81 A;  3UNL A;  5TGN A;  8CHO A;  2CKF B;  3B7C A;  4HKV B;  1JKG B;  3DM8 A;  3K7C A;  4Q53 A;  4HM1 B;  1U5O A;  3G8Z A;  3NXJ A;  4HVN A;  4OUQ A;  3OX9 A;  1QJG A;  1W01 A;  3GZY B;  3HZP A;  2STD A;  3GZX B;  1DMM A;  3F40 A;  2RCD A;  4N3V A;  3EBT A;  4K1V A;  1BUQ A;  4RZM A;  4U13 A;  4WYK B;  3ECF A;  4XBY A;  5CK6 A;  1JKG A;  4CDL A;  1E3V A;  4R9L A;  3T8U A;  3EHC A;  3EX9 A;  3MG1 A;  5AEU B;  2IMJ A;  3ER7 A;  3D9R A;  1ZX2 A;  4HM2 B;  1JN5 A;  5AIG A;  2R4I A;  3MG3 A;  5CLK A;  1JB4 A;  3GWR A;  1Q40 A;  4MJD A;  3SED A;  3OXA A;  3FF2 A;  5IG4 A;  4HZB B;  1OHO A;  1O7W B;  2CHC A;  5HGR A;  3MG2 A;  4XB5 A;  1ULJ B;  5FW5 A;  1STD A;  2PZV A;  3K0Z A;  1OPY A;  3B8L A;  3MHE A;  1E97 A;  1TUH A;  2GXF A;  3MKI A;  3NV0 B;  3NUV A;  1AR0 A;  1DMN A;  2B24 B;  2BMO B;  2INX A;  3EQQ B;  1VZZ A;  3F14 A;  4HM0 B;  2XRX B;  1HKX A;  4KVH A;  4FCJ A;  2QGU A;  1JB2 A;  2F99 A;  2GEX A;  1S5A A;  1EG9 B;  3BLZ A;  1Q42 A;  2HMN B;  2BMR B;  3EN8 A;  2YFJ B;  4H3U A;  3B4O A;  3I0Y A;  5IEN A;  1TP6 A;  4XBX A;  4XDV A;  1W02 A;  3CPO A;  4PEJ A;  1GS3 A;  5CF2 A;  5JPP A;  1ASK A;  2W2C A;  3SOA A;  5CXO A;  5CF1 A;  4IIA A;  4WWU C;  3GZR A;  3OWU A;  4GB5 A;  1Z1S A;  3EC9 A;  4XBT A;  5AII A;  1UUV B;  5DRV A;  3FZW A;  5IG0 A;  5IF6 A;  4WYK A;  4L8O A;  4R1K A;  3T8N A;  3ROB A;  1QMA A;  1C7H A;  3M8C A;  3B4P A;  3FGY A;  3FSD A;  2RGQ A;  3NHX A;  3CNX A;  3EBY A;  2HMM B;  4ORL A;  3F7S A;  3WMD A;  1A2K A;  3RGR A;  2Z77 A;  1DMQ A;  5AIH A;  3G16 A;  5G2G A;  1CQS A;  2XR8 B;  3E99 A;  4X2H A;  2RFR A;  4FCM A;  3F7X A;  2HML B;  2I9W A;  4J8T A;  5BXQ A;  2BNG A;  4L7K A;  4XDW A;  5D82 A;  5IER A;  2UX0 A;  1ULI B;  1GY5 A;  3RGA A;  4R9K A;  3Q90 A;  5EVH A;  4HM4 B;  5AIF A;  3KE7 A;  1O7N B;  5STD A;  1GY6 A;  3F8X A;  1JB5 A;  3MYT A;  3NM2 A;  5AI1 A;  5KP4 A;  1JN5 B;  1UUW B;  3DZL A;  3H3H A;  1GY7 A;  3KSP A;  3NBR A;  4HM3 B;  3STD A;  1ZO2 A;  3EJV A;  3DMC A;  4HM5 B;  2GBW B;  4K1U A;  1K41 A;  3IPT A;  3JUM A;  6STD A;  3KZT A;  1O7P B;  5D83 A;  5KP3 A;  1WQL B;  3FLJ A;  3LYG A;  1OGZ A;  1OUN A;  3OWS A;  1IDP A;  5BVB A;  2XSO B;  1O7H B;  1OHP A;  3F9S A;  3S5C A;  5DRE A;  3OV4 A;  3JUN A;  4J9A A;  2XSH B;  3JUO A; 
#chains in the Genus database with same CATH topology
 3S28 A;  7STD A;  3PYJ A;  3JUP A;  2KRT A;  2OOV C;  1X1Y A;  3SVA A;  4EW5 A;  1IVU A;  3A76 A;  1RN7 A;  2OTL 3;  1JRQ A;  2CX1 A;  1B21 A;  1W6Y A;  2CK3 H;  1VQ7 3;  2BO9 B;  4NPB A;  4EXR A;  1JBS A;  3MPH A;  1E3R A;  1VQ4 3;  3FG3 A;  5AEW B;  4KT3 B;  5HOH A;  3KII A;  3SX1 A;  2Z76 A;  1NNV A;  2K54 A;  2YFL B;  3BNE A;  5KP1 A;  4FMD A;  2CFK A;  1YIT 3;  2CX0 A;  3DUK A;  3PZW A;  3EN1 B;  2Y73 A;  3AGO A;  3HII A;  5IG5 A;  4BL2 A;  1Q7Y 4;  4HM7 B;  2OTJ 3;  3LML A;  4XM4 A;  1AVL A;  2W56 A;  4STD A;  2GBX B;  1N5H A;  1UCL A;  1YNV X;  4HBR A;  2BT3 A;  1W2B 2;  1MWR A;  3B7C A;  1I3F A;  4FCZ A;  3CCQ 3;  1B2Z A;  2P09 A;  1EUI C;  1VQN 3;  4K61 A;  1BNR A;  1QAL A;  1WTH A;  3LOY A;  3OX9 A;  2F5M A;  3D5G A;  1W01 A;  2STD A;  2RCD A;  4K1V A;  2YX9 A;  1VQ5 3;  1MOL A;  1HZ1 A;  3FG1 A;  4RZM A;  3DY5 A;  1UCK A;  4R9L A;  1DE3 A;  3EX9 A;  2W0Q A;  4WHA A;  5AEU B;  2IMJ A;  4EV5 A;  3IMA B;  2P0M A;  1VQ6 3;  6GSP A;  2W9P A;  2CIU A;  4HOH A;  4N6O B;  3KN4 A;  2MC8 A;  1I3I A;  1Q40 A;  1EQK A;  3D5I A;  3FF2 A;  5IG4 A;  3CCE 3;  1O7W B;  1UCI A;  5BU4 A;  3MG2 A;  5FW5 A;  2D42 A;  5D81 A;  1ZS7 A;  1E97 A;  2GXF A;  1QAF A;  1W7C A;  2BMO B;  2INX A;  3AMO A;  1VZZ A;  1YJ9 3;  4AEQ A;  1BU4 A;  2XRX B;  3X41 A;  1RSN A;  1BVI A;  3ALA A;  1EG9 B;  2D1W A;  2KCD A;  2HMN B;  1T3B A;  2BMR B;  2YFJ B;  5M1A A;  3B4O A;  3S67 A;  7GSP A;  3CPW 2;  4XBX A;  3UL5 A;  2P0X A;  4PEJ A;  5CF2 A;  1ASK A;  2FXT A;  3SOA A;  2MF7 A;  2QEX 3;  3NQZ A;  1Q81 4;  2ZDJ A;  3O8Y A;  3T8N A;  4L8O A;  3A5E A;  1BRG A;  3ROB A;  1VQM 3;  4MMY B;  1RN4 A;  1IV7 A;  3FGY A;  3NHX A;  2H0H A;  5EQL A;  3WMD A;  3ZFZ A;  3LTD A;  1A2K A;  1RRH A;  1DMQ A;  2ZL8 A;  2ML6 A;  1FGM A;  1UDI I;  8RNT A;  4XDW A;  5ELU A;  5IER A;  3U97 A;  2UX0 A;  2C4B A;  1VQL 3;  3RGA A;  2KAA A;  3LT9 A;  3V98 A;  3KE7 A;  1LOW A;  5M19 A;  4QWT A;  1GY6 A;  3TDG A;  4BTW A;  1YI2 3;  1YJW 3;  5KP4 A;  1D6Z A;  2P38 A;  2OOV A;  1YIJ 3;  4HM3 B;  2FNQ A;  5AYS C;  1DYU A;  1M9G A;  1WNH A;  3CCL 3;  1N8Q A;  1D6Y A;  4LYL B;  1MGW A;  3WOF B;  1WQL B;  3FLJ A;  1GOU A;  4DKI A;  1B27 A;  1IDP A;  3F9S A;  1OHP A;  3RDE A;  3S5C A;  1AVK A;  5DRE A;  4J9A A;  1HU9 A;  1CEW I;  3RNT A;  3JUO A;  5I97 A;  1AV4 A;  2IA7 A;  2F98 A;  1NWW A;  2ZHX B;  1V74 A;  1LRA A;  4HZ9 B;  5IEP A;  2B1X B;  1US1 A;  5IEO A;  1BRN L;  3CCV 3;  1W2Z A;  4HJL B;  3X42 A;  3BNB A;  4GL6 A;  1U8C B;  4FR9 A;  5G1L A;  9RNT A;  4L8P A;  4GSP A;  3AHW A;  3GZB A;  3MSO A;  1B20 A;  3HI7 A;  1YGW A;  1STF I;  2CFW A;  1PYL A;  3WOD G;  3JUQ A;  1PY3 A;  3OWY A;  1MNL A;  5G1K A;  3VGN A;  2OWP A;  4I4K A;  3CC4 3;  2QIY A;  3N9H A;  1BNI A;  1OF5 A;  2M7O A;  2SAR A;  2XH9 A;  5IG3 A;  5JPU A;  1K9M 4;  1OAC A;  3LZA A;  1OCV A;  4N6N B;  1FUT A;  2HMJ B;  3VSY A;  3HX8 A;  1OHS A;  1O7M B;  1KWI A;  4R4K A;  3U1W A;  2GU1 A;  3BB9 A;  1A67 A;  1I2G A;  1EKM A;  1I2E A;  1FUS A;  3DGM A;  4AKY A;  1BAN A;  1FUW A;  3UNL A;  1RNT A;  1BAO A;  8CHO A;  3Q1C A;  2F5W A;  1MWS A;  1IQY A;  3K7C A;  1VQ9 3;  3G8Z A;  1YVS A;  1QJG A;  1BGS A;  4N3V A;  3Q3F A;  3EBT A;  1JZO A;  2ZA4 A;  3ECF A;  1RCK A;  2AAE A;  5CK6 A;  1LXE A;  3CCS 3;  3MG1 A;  1S72 3;  3N54 B;  4O3V A;  1ZX2 A;  2BIR A;  3SLU A;  5LC7 A;  1AQZ A;  1JB4 A;  1UUG B;  3LTB A;  1Q82 4;  1IQ8 A;  3PXM A;  2KF4 A;  1JBT A;  2IYJ A;  3OXA A;  4FMA A;  3ZG0 A;  4HZB B;  1X1X A;  3X3Y A;  3CCR 3;  1RGK A;  3IJE B;  3B8L A;  1TUH A;  2XEP A;  2KF5 A;  3EQQ B;  1HYF A;  2CW9 A;  4HM0 B;  1HKX A;  4FCJ A;  2XFS A;  1BUJ A;  2GEX A;  5AII A;  4KFF A;  4H3U A;  1N9J A;  1N9E A;  1Q7H A;  3I0Y A;  2CH9 A;  1W02 A;  4RNZ A;  2W2C A;  5CF1 A;  5CXO A;  1NJI 4;  4N6L A;  2CWV A;  1GMR A;  2IY2 A;  3FG4 A;  3LTA A;  3EC9 A;  4XBT A;  5RNT A;  1UUV B;  2LYX A;  3BU4 A;  5GSP A;  1QMA A;  1C7H A;  4N6M A;  4O02 B;  2E2T A;  3FSD A;  3WA2 X;  1TIJ A;  2P05 A;  3F7S A;  1W6G A;  3G4S 3;  2W6J H;  1RGG A;  1CQS A;  2XR8 B;  3E99 A;  1RLS A;  2RFR A;  4FCM A;  1SII A;  1TRP A;  1LNI A;  3Q90 A;  4TX4 A;  3KFQ C;  4ZM8 A;  5AIF A;  5A0O B;  4HYZ A;  3I56 3;  1N8R 4;  4K90 B;  4RNY A;  2F56 A;  1JB5 A;  5AI1 A;  2WGO A;  2XFT A;  3NBB A;  1RGA A;  1F8N A;  2RSX A;  3H3H A;  1WMN A;  1Y4K A;  3EE1 A;  4GHO A;  1BSE A;  1BSD A;  3S29 A;  1N5P A;  4J5G A;  1BNF A;  4K1U A;  3IPT A;  5KP3 A;  1L5G B;  3LYG A;  1JV2 B;  1QAK A;  5BVB A;  1O7H B;  1R4Y A;  1FYS A;  1GMQ A;  1RGE A;  2E2U A;  2E2V A;  2XSH B;  1NB5 I;  1LQG C;  2RNT A;  3DH2 A;  1UGH I;  4LSO A;  4MEI A;  4I5Q A;  1T2I A;  3F8H A;  6RNT A;  3VF1 A;  1YVB I;  1BRI A;  3DGO A;  3PCR A;  3EF8 A;  3G6E 3;  3GRD A;  4HM6 B;  1BNG A;  3CNM A;  2A15 A;  5M18 A;  5BIR A;  3LT8 A;  1CYU A;  1BSB A;  1AY7 A;  2Z7A A;  1M1X B;  3G0K A;  1RGC A;  1FGO A;  2K0M A;  2GU3 A;  3V92 A;  3KSE D;  1RJO A;  4EBG A;  3OW2 2;  3K63 A;  1D6U A;  1FZU A;  3Q2P A;  1W00 A;  1A2P A;  4HAA A;  1BIR A;  1Q40 B;  2BMQ B;  3X3Z A;  1UCJ A;  1NDO B;  4JRF A;  1OGX A;  3J7Y d;  2XF3 A;  4ILF A;  3WDG B;  1EA2 A;  3HOH A;  1LOV A;  1NU3 A;  3BND A;  1GYB A;  3CXC 2;  2ML5 A;  1O7G B;  4NRE A;  3UJM A;  2BHM A;  1SAR A;  1VQP 3;  2HMK B;  4IPB A;  1T2H A;  2CKF B;  3D79 A;  3GAX A;  1FA3 A;  1SIH A;  3DM8 A;  1IVV A;  2CFL A;  3V99 A;  1B3S A;  1U5O A;  4OUQ A;  1X1U A;  1GD4 A;  1LQM B;  1YGE A;  3URP A;  3CC7 3;  3HZP A;  3GZX B;  4N6T A;  1IT7 A;  1BUQ A;  2IUJ A;  1X1W A;  4XBY A;  1IT8 A;  3WR2 A;  4CDL A;  1VQK 3;  1B2U A;  3EHC A;  2HOH A;  1FW7 A;  3ER7 A;  1R4C A;  1ROA A;  4HM2 B;  1TU5 A;  1RGH A;  5AIG A;  3CME 3;  3D4A A;  2CG0 A;  3GWR A;  1W6C A;  2OQE C;  3SED A;  1J2B A;  4R80 A;  1OHO A;  2V1L A;  3PGB A;  5TGN A;  2CG1 A;  2Z6B A;  1IK3 A;  2PZV A;  1MWU A;  1ZGX A;  3MKI A;  4Q53 A;  3NV0 B;  2KXG A;  3NUV A;  1AR0 A;  1DMN A;  2B24 B;  3NXJ A;  2OQE A;  1I70 A;  1K73 4;  1FGQ A;  1ROV A;  3RGR A;  1SQW A;  1T5Y A;  1I0V A;  2F99 A;  3BLZ A;  3L0R A;  2O3O A;  5D83 A;  1RDS A;  1Q42 A;  1KC8 4;  4LZI A;  3X3X A;  2OCT A;  3AHS A;  4JF8 A;  2C11 A;  5AYR B;  5IEN A;  2QA4 3;  2WOH A;  1GOV A;  3CPO A;  1GS3 A;  2XGN A;  2J8X B;  1NB3 I;  3DGN A;  1QVG 2;  5FGO A;  4J5K A;  1RRL A;  1TFK A;  3FZW A;  4O2H A;  4WYK A;  4R1K A;  4CJN A;  5EEO A;  1MGR A;  2IUK A;  3S27 A;  4EYC A;  3NQY A;  1RCL A;  5IW9 A;  3B4P A;  4G1M B;  1IVW A;  3EBY A;  2HMM B;  2PNC A;  2L4V A;  3DGL A;  4BTX A;  2JDI H;  3CCU 3;  2L1S A;  5BXQ A;  3F7X A;  2HML B;  2I9W A;  2H0I A;  2BNG A;  3AMO B;  4L7K A;  5D82 A;  4MMZ B;  3WOE B;  1ULI B;  4WFO A;  1GY5 A;  3CCM 3;  1KQS 2;  1RHL A;  1BNJ A;  1G0T A;  1DVC A;  1CH0 A;  1TFO A;  3ZG5 A;  2GSP A;  4MMX B;  4H61 A;  1PU4 A;  3LH4 A;  1V57 A;  3DZL A;  3KSP A;  3CMA 3;  1A90 A;  1GMP A;  3EJV A;  1IU7 A;  2UUG C;  1IVX A;  2GBW B;  1WMP A;  3JUM A;  1JBR A;  1O7P B;  1LVN A;  1OGZ A;  1UGI A;  2XSO B;  1BRS A;  1KD1 4;  2C10 A;  3OV4 A;  3JUN A;  1UW1 A;  1BSC A;  1BSA A;  4HM8 B;  4EV2 A;  3DXO A;  1JZD A;  4CCV A;  1RMS A;  3KCH A;  1OF5 B;  3EB8 A;  2W56 B;  4BU4 A;  1FGT A;  2WOF A;  4LMI A;  3CCJ 3;  2GEY A;  3KKG A;  1QVF 2;  2CWU A;  2JQ5 A;  1ISK A;  2CFG A;  2Q07 A;  3FF0 A;  4CPK A;  1A2V A;  2CC3 A;  2W9Q A;  2WO0 A;  1WMO A;  4KFD A;  3HIG A;  4LGQ A;  3PCS A;  4O8S A;  1LOY A;  1SJW A;  2F4Y A;  1B2M A;  3CU3 A;  4OVM A;  2YFI B;  3DGY A;  1OH0 A;  3FH1 A;  1JNQ A;  3HK4 A;  1BNE A;  1RGF A;  3PS8 A;  4OK0 A;  5ELJ A;  2HMO B;  4KFE A;  3FKA A;  2KF6 A;  3LTC A;  1V58 A;  1YHQ 3;  1VQQ A;  1FGR A;  3K9M C;  2F86 B;  1IV9 A;  3H51 A;  3NV0 A;  1C54 A;  3SOY A;  4LEH A;  4WP5 A;  4X2O A;  2AAD A;  4BIR A;  1JKG B;  1BNS A;  2Y74 A;  4HM1 B;  4HVN A;  2UGI A;  1VQO 3;  1BOX A;  3GZY B;  1DMM A;  3F40 A;  2W04 A;  1I0X A;  4U13 A;  4WYK B;  2W03 A;  2FGT A;  1DET A;  1JKG A;  3CD6 3;  1E3V A;  4FMB A;  4BL3 A;  1K8A 4;  3T8U A;  2RBI A;  1M90 4;  3D9R A;  1IQX A;  5LC6 A;  4AKZ A;  1JN5 A;  2R4I A;  3MG3 A;  5CLK A;  4MJD A;  4BTY A;  1BRK A;  3WHO A;  1GD3 A;  3K5T A;  3G71 3;  4EC6 A;  2KF3 A;  5HGR A;  2CHC A;  1Q9E A;  4XB5 A;  1RN1 A;  1ULJ B;  1RTU A;  1STD A;  3K0Z A;  1OPY A;  3MHE A;  4HKV B;  4KZ1 A;  1RGL A;  1G02 A;  1TJD A;  4R9K A;  3UL6 A;  3UB1 A;  1BRH A;  3F14 A;  1LOX A;  4KVH A;  2QGU A;  1JB2 A;  3EN8 A;  1EEJ A;  1S5A A;  1UI7 A;  4FMC A;  1TP6 A;  4XDV A;  5JPP A;  3NX0 A;  3BIR A;  3BNC A;  3QK9 A;  1M1K 4;  4IIA A;  4WWU C;  3CC2 3;  3GZR A;  3OWU A;  4GB5 A;  1Z1S A;  1W5Z A;  5DRV A;  5IG0 A;  5IF6 A;  1MWT A;  1W4N A;  3LXU X;  3M8C A;  1BRJ A;  1TTO A;  2R41 A;  4ORL A;  2RGQ A;  7RNT A;  1CYV A;  3CNX A;  4IT7 A;  1YJN 3;  2CFD A;  3FCS B;  3GSP A;  2Z77 A;  5AIH A;  3G16 A;  1SPU A;  5G2G A;  1G96 A;  1LNH A;  4X2H A;  3WA3 A;  1PFP A;  4J8T A;  2O9U X;  1B2X A;  3QRD A;  4NHF A;  1B2S A;  3SYU A;  1K28 A;  1TRQ A;  1RKY A;  5EVH A;  4HM4 B;  2BU4 A;  1GSP A;  1KSI A;  1O7N B;  3MWZ A;  5STD A;  3I55 3;  3F8X A;  3N8B A;  3MYT A;  3NM2 A;  1VQ8 3;  1IYY A;  1JN5 B;  3NM7 A;  1I8V A;  1UUW B;  3NBJ A;  1UI8 A;  3NBR A;  1GY7 A;  3X40 A;  1NO3 A;  3AGN A;  3STD A;  1ZO2 A;  1RNB A;  3DMC A;  4HM5 B;  1DVD A;  3T0U A;  3JVC A;  1K41 A;  2K3D A;  6STD A;  3KZT A;  2LQV A;  1OUN A;  2SBL A;  1GOY A;  3OWS A;  3SXX A;  4N6V 0;  2WGQ A;  5JBS A;  3D3L A;  4RNT A;  2H0G A;  2CWT A;  1Q86 4;  1JJ2 2;  1I2F A;  4N6U A;  4RBN A;  2XGL A; 
#chains in the Genus database with same CATH homology
 3S28 A;  7STD A;  3PYJ A;  3JUP A;  2KRT A;  2OOV C;  3SVA A;  1IVU A;  3A76 A;  1RN7 A;  2OTL 3;  1JRQ A;  1W6Y A;  2CK3 H;  1VQ7 3;  2BO9 B;  4EXR A;  3MPH A;  1E3R A;  1VQ4 3;  3FG3 A;  5AEW B;  3KII A;  3SX1 A;  2Z76 A;  2K54 A;  2YFL B;  3BNE A;  5KP1 A;  4FMD A;  2CFK A;  1YIT 3;  3DUK A;  3PZW A;  3EN1 B;  2Y73 A;  3HII A;  5IG5 A;  1Q7Y 4;  4HM7 B;  2OTJ 3;  3LML A;  4XM4 A;  1AVL A;  2W56 A;  4STD A;  2GBX B;  1N5H A;  4HBR A;  1W2B 2;  2BT3 A;  3B7C A;  4FCZ A;  3CCQ 3;  2P09 A;  1VQN 3;  4K61 A;  1QAL A;  1WTH A;  3LOY A;  3OX9 A;  1W01 A;  2STD A;  2RCD A;  4K1V A;  2YX9 A;  1VQ5 3;  1MOL A;  4RZM A;  3FG1 A;  3DY5 A;  4R9L A;  3EX9 A;  2W0Q A;  4WHA A;  5AEU B;  2IMJ A;  4EV5 A;  3IMA B;  2P0M A;  1VQ6 3;  2W9P A;  2CIU A;  4N6O B;  3KN4 A;  2MC8 A;  1Q40 A;  1EQK A;  3FF2 A;  5IG4 A;  3CCE 3;  1O7W B;  3MG2 A;  5FW5 A;  2D42 A;  5D81 A;  1E97 A;  2GXF A;  1QAF A;  1W7C A;  2BMO B;  2INX A;  3AMO A;  1VZZ A;  1YJ9 3;  4AEQ A;  2XRX B;  3X41 A;  3ALA A;  1EG9 B;  2D1W A;  2KCD A;  2HMN B;  2BMR B;  3S67 A;  2YFJ B;  3B4O A;  3CPW 2;  4XBX A;  3UL5 A;  2P0X A;  4PEJ A;  5CF2 A;  1ASK A;  2FXT A;  3SOA A;  2MF7 A;  2QEX 3;  3NQZ A;  1Q81 4;  2ZDJ A;  3O8Y A;  3T8N A;  4L8O A;  3ROB A;  1VQM 3;  4MMY B;  3FGY A;  1IV7 A;  3NHX A;  5EQL A;  3WMD A;  3LTD A;  1A2K A;  1RRH A;  1DMQ A;  2ZL8 A;  2ML6 A;  1FGM A;  4XDW A;  5ELU A;  5IER A;  3U97 A;  2UX0 A;  1VQL 3;  3RGA A;  3LT9 A;  3V98 A;  3KE7 A;  4QWT A;  1GY6 A;  3TDG A;  4BTW A;  1YI2 3;  1YJW 3;  5KP4 A;  1D6Z A;  2P38 A;  2OOV A;  1YIJ 3;  4HM3 B;  2FNQ A;  5AYS C;  1DYU A;  1M9G A;  1WNH A;  3CCL 3;  1N8Q A;  1D6Y A;  3WOF B;  1WQL B;  3FLJ A;  1IDP A;  3F9S A;  1OHP A;  3RDE A;  3S5C A;  1AVK A;  5DRE A;  4J9A A;  1HU9 A;  1CEW I;  5I97 A;  3JUO A;  1AV4 A;  2IA7 A;  2F98 A;  1NWW A;  1V74 A;  4HZ9 B;  5IEP A;  2B1X B;  1US1 A;  5IEO A;  3CCV 3;  1W2Z A;  4HJL B;  3X42 A;  3BNB A;  4GL6 A;  1U8C B;  4FR9 A;  4L8P A;  3GZB A;  3MSO A;  3HI7 A;  1STF I;  2CFW A;  3WOD G;  3JUQ A;  3OWY A;  1MNL A;  3VGN A;  3CC4 3;  2OWP A;  4I4K A;  2QIY A;  3N9H A;  2M7O A;  1OF5 A;  5IG3 A;  2XH9 A;  5JPU A;  1K9M 4;  1OAC A;  3LZA A;  1OCV A;  4N6N B;  2HMJ B;  3VSY A;  3HX8 A;  1OHS A;  1O7M B;  1KWI A;  4R4K A;  3U1W A;  2GU1 A;  3BB9 A;  1A67 A;  1EKM A;  3DGM A;  1FUW A;  4AKY A;  3UNL A;  8CHO A;  3Q1C A;  1IQY A;  3K7C A;  1VQ9 3;  3G8Z A;  1QJG A;  4N3V A;  3EBT A;  3ECF A;  5CK6 A;  1LXE A;  3CCS 3;  3MG1 A;  1S72 3;  3N54 B;  4O3V A;  1ZX2 A;  3SLU A;  5LC7 A;  1JB4 A;  3LTB A;  1Q82 4;  1IQ8 A;  3PXM A;  3OXA A;  4FMA A;  4HZB B;  3X3Y A;  3CCR 3;  3IJE B;  3B8L A;  1TUH A;  2XEP A;  3EQQ B;  4HM0 B;  2CW9 A;  1HKX A;  4FCJ A;  2XFS A;  2GEX A;  5AII A;  4KFF A;  4H3U A;  1N9J A;  1N9E A;  3I0Y A;  2CH9 A;  1W02 A;  4RNZ A;  2W2C A;  5CF1 A;  5CXO A;  1NJI 4;  4N6L A;  2CWV A;  3FG4 A;  3LTA A;  3EC9 A;  4XBT A;  1UUV B;  2LYX A;  1QMA A;  1C7H A;  4N6M A;  4O02 B;  2E2T A;  3FSD A;  3WA2 X;  1TIJ A;  2P05 A;  3F7S A;  1W6G A;  3G4S 3;  2W6J H;  1CQS A;  2XR8 B;  3E99 A;  2RFR A;  4FCM A;  1SII A;  3Q90 A;  4TX4 A;  3KFQ C;  4ZM8 A;  5AIF A;  5A0O B;  4HYZ A;  3I56 3;  1N8R 4;  4K90 B;  4RNY A;  1JB5 A;  5AI1 A;  2WGO A;  2XFT A;  3NBB A;  1F8N A;  2RSX A;  3H3H A;  1WMN A;  1Y4K A;  3EE1 A;  3S29 A;  1N5P A;  4K1U A;  3IPT A;  5KP3 A;  1L5G B;  3LYG A;  1JV2 B;  1QAK A;  5BVB A;  1O7H B;  2XSH B;  2E2U A;  2E2V A;  1NB5 I;  4LSO A;  4MEI A;  3F8H A;  3VF1 A;  1YVB I;  3DGO A;  3PCR A;  3EF8 A;  3G6E 3;  3GRD A;  4HM6 B;  3CNM A;  2A15 A;  3LT8 A;  1CYU A;  2Z7A A;  1M1X B;  3G0K A;  1FGO A;  2K0M A;  2GU3 A;  3V92 A;  3KSE D;  1RJO A;  4EBG A;  3OW2 2;  3K63 A;  1D6U A;  3Q2P A;  1W00 A;  1Q40 B;  2BMQ B;  3X3Z A;  4JRF A;  1NDO B;  3J7Y d;  1OGX A;  2XF3 A;  3WDG B;  1EA2 A;  1NU3 A;  3BND A;  1GYB A;  3CXC 2;  2ML5 A;  1O7G B;  4NRE A;  2BHM A;  1VQP 3;  2HMK B;  4IPB A;  2CKF B;  3GAX A;  1FA3 A;  1SIH A;  3DM8 A;  1IVV A;  2CFL A;  3V99 A;  1U5O A;  4OUQ A;  1GD4 A;  1YGE A;  3CC7 3;  3HZP A;  3GZX B;  4N6T A;  1IT7 A;  1BUQ A;  2IUJ A;  4XBY A;  1IT8 A;  4CDL A;  1VQK 3;  3EHC A;  3ER7 A;  1R4C A;  1ROA A;  4HM2 B;  1TU5 A;  3CME 3;  5AIG A;  2CG0 A;  3GWR A;  1W6C A;  2OQE C;  3SED A;  1J2B A;  4R80 A;  1OHO A;  2V1L A;  3PGB A;  5TGN A;  2CG1 A;  2Z6B A;  1IK3 A;  2PZV A;  3MKI A;  4Q53 A;  3NV0 B;  2KXG A;  3NUV A;  1AR0 A;  1DMN A;  2B24 B;  3NXJ A;  2OQE A;  1K73 4;  1FGQ A;  1ROV A;  3RGR A;  1SQW A;  1T5Y A;  2F99 A;  3BLZ A;  3L0R A;  2O3O A;  5D83 A;  1Q42 A;  1KC8 4;  4LZI A;  3X3X A;  2OCT A;  5AYR B;  4JF8 A;  2C11 A;  5IEN A;  2QA4 3;  2WOH A;  3CPO A;  1GS3 A;  2XGN A;  3DGN A;  1NB3 I;  1QVG 2;  5FGO A;  1RRL A;  1TFK A;  3FZW A;  4O2H A;  4WYK A;  4R1K A;  4EYC A;  5EEO A;  3S27 A;  2IUK A;  5IW9 A;  3NQY A;  3B4P A;  4G1M B;  1IVW A;  3EBY A;  2HMM B;  2PNC A;  2L4V A;  3DGL A;  4BTX A;  2JDI H;  3CCU 3;  5BXQ A;  3F7X A;  2HML B;  2I9W A;  2BNG A;  3AMO B;  4L7K A;  5D82 A;  4MMZ B;  3WOE B;  1ULI B;  4WFO A;  1GY5 A;  3CCM 3;  1KQS 2;  1DVC A;  1TFO A;  4MMX B;  4H61 A;  1PU4 A;  3LH4 A;  3DZL A;  3KSP A;  3CMA 3;  1A90 A;  3EJV A;  1IU7 A;  1IVX A;  2GBW B;  1WMP A;  3JUM A;  1O7P B;  1LVN A;  1OGZ A;  2XSO B;  1KD1 4;  2C10 A;  3OV4 A;  3JUN A;  1UW1 A;  4HM8 B;  4EV2 A;  3DXO A;  4CCV A;  1OF5 B;  3EB8 A;  2W56 B;  1FGT A;  2WOF A;  4LMI A;  3CCJ 3;  2GEY A;  3KKG A;  1QVF 2;  2CWU A;  2JQ5 A;  1ISK A;  2CFG A;  2Q07 A;  3FF0 A;  1A2V A;  2CC3 A;  2W9Q A;  2WO0 A;  1WMO A;  4KFD A;  3HIG A;  4LGQ A;  3PCS A;  4O8S A;  1SJW A;  3CU3 A;  4OVM A;  2YFI B;  1OH0 A;  3FH1 A;  1JNQ A;  3HK4 A;  3PS8 A;  4OK0 A;  5ELJ A;  2HMO B;  4KFE A;  3FKA A;  3LTC A;  1YHQ 3;  1FGR A;  3K9M C;  2F86 B;  1IV9 A;  3H51 A;  3NV0 A;  3SOY A;  4LEH A;  4WP5 A;  4X2O A;  1JKG B;  2Y74 A;  4HM1 B;  4HVN A;  1VQO 3;  3GZY B;  1DMM A;  3F40 A;  2W04 A;  4U13 A;  4WYK B;  2W03 A;  2FGT A;  1JKG A;  3CD6 3;  1E3V A;  4FMB A;  1K8A 4;  3T8U A;  1M90 4;  3D9R A;  1IQX A;  5LC6 A;  4AKZ A;  1JN5 A;  2R4I A;  3MG3 A;  5CLK A;  4MJD A;  4BTY A;  1GD3 A;  3K5T A;  3G71 3;  4EC6 A;  5HGR A;  2CHC A;  4XB5 A;  1ULJ B;  4KZ1 A;  1STD A;  3K0Z A;  3MHE A;  1OPY A;  4HKV B;  4R9K A;  3UJM A;  3UL6 A;  3UB1 A;  3F14 A;  1LOX A;  4KVH A;  2QGU A;  1JB2 A;  3EN8 A;  1UI7 A;  1S5A A;  4FMC A;  1TP6 A;  4XDV A;  5JPP A;  3NX0 A;  3BNC A;  3QK9 A;  1M1K 4;  4IIA A;  4WWU C;  3CC2 3;  3GZR A;  3OWU A;  4GB5 A;  1Z1S A;  1W5Z A;  5DRV A;  5IG0 A;  5IF6 A;  1W4N A;  3LXU X;  3M8C A;  4ORL A;  1YJN 3;  2RGQ A;  1CYV A;  3CNX A;  4IT7 A;  2CFD A;  3FCS B;  2Z77 A;  5AIH A;  3G16 A;  1SPU A;  5G2G A;  1LNH A;  1G96 A;  4X2H A;  3WA3 A;  1PFP A;  4J8T A;  2O9U X;  3QRD A;  4NHF A;  1K28 A;  1RKY A;  5EVH A;  4HM4 B;  1KSI A;  1O7N B;  3MWZ A;  5STD A;  3I55 3;  3F8X A;  3N8B A;  3MYT A;  3NM2 A;  1VQ8 3;  1JN5 B;  3NM7 A;  3NBJ A;  1UUW B;  1UI8 A;  3NBR A;  1GY7 A;  3X40 A;  1NO3 A;  3STD A;  1ZO2 A;  3DMC A;  4HM5 B;  1DVD A;  3T0U A;  3JVC A;  1K41 A;  6STD A;  3KZT A;  2LQV A;  1OUN A;  2SBL A;  3OWS A;  3SXX A;  4N6V 0;  2WGQ A;  5JBS A;  3D3L A;  2CWT A;  1Q86 4;  1JJ2 2;  4N6U A;  4RBN A;  2XGL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...