1TUHA

Structure of bal32a from a soil-derived mobile gene cassette
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
131
structure length
131
Chain Sequence
b'NEAEQNAETVRRGYAAFNSGDMKTLTELFDENASWHTPGRSRIAGDHKGREAIFAQFGRYGGETGGTFKAVLLHVLKSDDGRVIGIHRNTAERGGKRLDVGCCIVFEFKNGRVIDGREHFYDLYAWDEFWR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein EGC068
publication title Integron-associated Mobile Gene Cassettes Code for Folded Proteins: The Structure of Bal32a, a New Member of the Adaptable alpha+beta Barrel Family
pubmed doi rcsb
source organism Uncultured bacterium
molecule tags Unknown function
total genus 48
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2004-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1tuhA00
3S5CA 5D83A 1Q40B 2QGUA 1JN5A 5IEOA 5CLKA 1NWWA 3ECFA 1JKGB 2PZVA 1OH0A 1W02A 3B8LA 7STDA 4WP5A 3STDA 1GYBA 4HVNA 2Z76A 1DMNA 4X2OA 5AIHA 1O7WB 3NBRA 3OWSA 3H3HA 5CF2A 5IENA 1QJGA 3RGAA 3SEDA 1EA2A 1ZX2A 2OWPA 5BVBA 1ASKA 3VSYA 1S5AA 5IG4A 3GRDA 3KKGA 1Q42A 1JN5B 3BLZA 3F8XA 2BMOB 3MG2A 5AI1A 1SJWA 3OV4A 1DMMA 4WYKA 4R1KA 5TGNA 3NV0A 3G16A 3G8ZA 1OHOA 4HM0B 4LEHA 1JB2A 4HM4B 5STDA 5IF6A 1OUNA 2XRXB 3B4OA 3EC9A 3GZBA 2YFJB 3GZYB 4HM1B 5G2GA 2GXFA 3MYTA 1OGZA 3I0YA 2YFIB 5IEPA 3F14A 3F8HA 4J8TA 3ROBA 1O7GB 1W6YA 2HMNB 1JB5A 1Z1SA 4HM5B 5CXOA 3DM8A 6STDA 4WYKB 3IPTA 2W2CA 3NV0B 2A15A 1OF5A 3K0ZA 5IERA 2RGQA 3OXAA 3EJVA 4XDWA 1CQSA 1O7MB 3SOYA 2JQ5A 2IMJA 3MKIA 5DRVA 5D82A 3JUMA 4X2HA 3VGNA 3CU3A 3HK4A 4LGQA 2I9WA 3JUQA 4J9AA 5BXQA 3JUPA 3FSDA 1K41A 3A76A 3E99A 4FCJA 5DREA 5AEUB 3F40A 1OPYA 3F9SA 3CNMA 2K54A 4IIAA 4ORLA 3MG3A 4H3UA 2HMKB 3MHEA 1OF5B 2CHCA 3SOAA 4XM4A 4HZ9B 5JPPA 1TUHA 3B7CA 1O7NB 3EQQB 3FKAA 1OGXA 5AIFA 4HM3B 2F98A 4HM8B 3WMDA 2HMLB 2GBXB 4CDLA 1QMAA 5HGRA 3FH1A 3ER7A 4K1VA 5KP1A 5AEWB 1UUVB 1ULIB 4LMIA 1BUQA 3KZTA 1OHPA 4KVHA 1O7HB 2XSOB 2HMOB 2INXA 4XDVA 4OVMA 1OHSA 3FZWA 4L8OA 2HMMB 1IDPA 2BNGA 3OWUA 4PEJA 3F7SA 1AR0A 8CHOA 2YFLB 3KE7A 2UX0A 2GEXA 3EX9A 1TP6A 4MJDA 3HZPA 3EN8A 4HJLB 2RFRA 2F99A 4HM7B 3EN1B 3NUVA 3DXOA 2GEYA 4HM2B 4STDA 2HMJB 3T8NA 3LYGA 1NU3A 4WWUC 3GZXB 2XR8B 1HKXA 3Q90A 4FCMA 5JPUA 4XBYA 1U5OA 4R9KA 4XB5A 3DMCA 4Q53A 3H51A 3DUKA 3OWYA 2GBWB 4XBTA 5EVHA 1GY5A 4XBXA 4L7KA 5IG0A 3G0KA 1GY7A 1WQLB 3NXJA 3NM2A 3FF0A 3GWRA 2F86B 3LZAA 3UNLA 1ULJB 2CKFB 4N3VA 5KP4A 1STDA 4HKVB 2STDA 3RGRA 2BMQB 1W00A 4HZBB 5CF1A 3NHXA 3MG1A 1C7HA 3FGYA 1E97A 3GZRA 1NDOB 1EG9B 1ZO2A 4I4KA 3HX8A 5KP3A 2XSHB 3OX9A 4GB5A 2Z7AA 4U13A 2R4IA 2B24B 2B1XB 2BMRB 5CK6A 1OCVA 5AIIA 1GS3A 1JB4A 1DMQA 2RCDA 4RZMA 1Q40A 4R9LA 5IG5A 4L8PA 3K7CA 4K1UA 3BB9A 1JKGA 4OUQA 3F7XA 3JUNA 1E3VA 1O7PB 3JUOA 2Z77A 1GY6A 3EF8A 3CNXA 3EBYA 3MSOA 1UUWB 1A2KA 5FW5A 3B4PA 3FLJA 5AIGA 3D9RA 4HM6B 3EHCA 1W01A 3KSPA 3T8UA 3M8CA 1E3RA 5D81A 3EBTA 2QIYA 3CPOA 3UJMA 1VZZA 1ISKA 3DZLA 5IG3A 3FF2A
chains in the Genus database with same CATH superfamily
3S5CA 1RMSA 1RGLA 2WO0A 4WFOA 4BTYA 1STFI 5D83A 1Q40B 3WA3A 2QGUA 1JN5A 3SYUA 5IEOA 1DETA 5CLKA 1OACA 3UL5A 2W04A 4BTWA 1NWWA 2QA43 1RLSA 4RNTA 4CPKA 4RNZA 1ZGXA 3ECFA 1BNFA 2XEPA 1JKGB 4JF8A 1YJ93 2PZVA 3CC23 3I553 1B27A 1OH0A 1CEWI 1W5ZA 1W02A 1W6GA 3QK9A 3B8LA 1BSDA 2W56B 1WMNA 7STDA 3PXMA 4WP5A 3STDA 3FF2A 4BTXA 1KD14 3MPHA 1GYBA 1WMOA 4HVNA 1GOYA 1N9JA 1PFPA 2Z76A 1DMNA 4X2OA 3RDEA 1B3SA 4AKYA 1VQM3 4N6MA 5AIHA 1O7WB 1UI8A 1YI23 2F56A 3NBRA 3WA2X 3PGBA 3OWSA 1A2VA 1VQO3 1IQ8A 3K9MC 1M904 1GD4A 1RGKA 2P05A 3H3HA 5CF2A 5IENA 1RGEA 1QJGA 1VQ43 4KZ1A 1BSCA 1RRLA 3RGAA 3SEDA 4FMCA 4ILFA 4H61A 1EA2A 1ZX2A 2E2VA 1EQKA 2OWPA 3IMAB 3WDGB 5BVBA 1ASKA 2P0MA 4N6OB 1N8R4 3VSYA 1TRQA 2WGOA 1BSAA 1S5AA 1YGWA 3NBJA 4O3VA 1VQ53 3S28A 3U97A 2HOHA 1RJOA 3Q2PA 1K28A 5IG4A 3CCS3 2GU1A 1HZ1A 2Y74A 1YGEA 2CX0A 3GRDA 3KKGA 2IA7A 1I2EA 4HYZA 3CCL3 1B2MA 1EEJA 1AVLA 4FMAA 1B20A 2L4VA 1QAKA 3HI7A 3LTDA 1JRQA 4KFFA 2H0GA 1FYSA 1BANA 2UUGC 1Q42A 3S67A 1YJN3 1JN5B 1UCLA 4OK0A 3DY5A 3BLZA 3F8XA 3URPA 2BMOB 2AAEA 4BL3A 3MG2A 4NREA 5AI1A 1SJWA 3OV4A 1DMMA 3LTAA 2GU3A 1Q9EA 2H0IA 4EW5A 4WYKA 3NM7A 1FA3A 3ZG0A 4N6UA 2C10A 2CFWA 2PNCA 3CD63 4R1KA 5TGNA 3NV0A 3CXC2 3G16A 3G8ZA 1ROAA 4AKZA 4RNYA 1OHOA 3CME3 2Z6BA 2CG1A 1UGIA 1BNIA 4HM0B 3EB8A 1FW7A 4CJNA 4LEHA 1K8A4 1QVG2 1JB2A 1QAFA 2IYJA 1MGWA 1BNEA 1I2GA 2UGIA 4HM4B 1T5YA 3LH4A 3CPW2 3DGYA 5STDA 5IF6A 1BSBA 1OUNA 3NQYA 2CWTA 2XRXB 3B4OA 3EC9A 2D1WA 3GZBA 2BU4A 1X1UA 2YFJB 1KWIA 3GZYB 1N9EA 4HM1B 5G2GA 2GXFA 5LC6A 4NPBA 4GL6A 8RNTA 3MYTA 1OGZA 1MWSA 2FNQA 3N9HA 1IT7A 2CG0A 5A0OB 1BU4A 1FUTA 1UCIA 3I0YA 5M1AA 2RSXA 2CFGA 3RNTA 2YFIB 2RBIA 1BRJA 1V74A 5IEPA 3F14A 3F8HA 1I0XA 5HOHA 4J8TA 3GAXA 1NNVA 1AVKA 1L5GB 3ROBA 3I563 3DGOA 4G1MB 4GHOA 2OOVC 1O7GB 1W6YA 2HMNB 4JRFA 1JB5A 1MGRA 1K9M4 3LMLA 1Z1SA 2LQVA 1RCLA 4HM5B 1W6CA 5CXOA 3CMA3 2XGLA 2O3OA 3DM8A 6STDA 4N6NB 4WYKB 3IPTA 2W2CA 3BIRA 4CCVA 1TFOA 2F4YA 3LT9A 4BIRA 3AHSA 3NV0B 2A15A 5BU4A 1OF5A 2ZHXB 3K0ZA 5IERA 3G4S3 2RGQA 3OXAA 3WOEB 1KSIA 1G0TA 3EJVA 1BRIA 4XDWA 3SVAA 5G1KA 1CQSA 1I3FA 1CYVA 1O7MB 3FG1A 4FMBA 1HU9A 1M1XB 1GSPA 7RNTA 1BUJA 3SOYA 1IK3A 3SXXA 2FGTA 2JQ5A 1JV2B 2IMJA 3MKIA 1UI7A 1NO3A 5DRVA 7GSPA 1US1A 3J7Yd 4HOHA 5D82A 3JUMA 1DE3A 4X2HA 3VGNA 1B2UA 3NQZA 1LNHA 1MWRA 3CU3A 2Q07A 3FCSB 1DYUA 3HK4A 3QRDA 2W0QA 4LGQA 1GOUA 2I9WA 3JUQA 4J9AA 5BXQA 3JUPA 1IQYA 3FSDA 2XFSA 3HOHA 2MF7A 1K41A 3D4AA 1N5PA 2XFTA 3BNDA 3A76A 9RNTA 3E99A 4FCJA 4AEQA 2SBLA 5DREA 1S723 1W2ZA 5AEUB 5M18A 2OTL3 2CWUA 3F40A 4N6TA 1OPYA 1BNJA 4QWTA 5ELJA 1BOXA 3F9SA 3TDGA 3CNMA 1RDSA 2K54A 3LTBA 1BNSA 4KFDA 1NB5I 1TFKA 4IIAA 4R4KA 4ORLA 4O8SA 4MMZB 3MG3A 2CIUA 1LXEA 3GSPA 4HBRA 2QEX3 3L0RA 2H0HA 3PYJA 2V1LA 4H3UA 1JBRA 1AY7A 1M1K4 2HMKB 1BSEA 2O9UX 2OQEC 1BGSA 3MHEA 1OF5B 2CHCA 3PCRA 3SOAA 4XM4A 3UL6A 5M19A 1C54A 4HZ9B 1LOXA 3HIGA 1TJDA 2IUJA 2WOHA 1G96A 1WNHA 1IVXA 1BRSA 5JPPA 3WOFB 1LOYA 1TUHA 2Y73A 1UDII 3B7CA 1YVSA 4MEIA 3G713 1U8CB 4LSOA 2OCTA 1LNIA 1O7NB 2BIRA 2RNTA 1R4YA 1UUGB 1VQL3 5ELUA 4EC6A 2W6JH 1UCKA 2KAAA 3EQQB 1FGTA 3CCQ3 2K3DA 3FKAA 4LZIA 2KF5A 5FGOA 1OGXA 3X40A 5AIFA 2KXGA 2CW9A 1T2IA 2WOFA 4O2HA 1JJ22 3D5GA 2L1SA 2D42A 2W9QA 4HM3B 2F98A 1D6UA 4HM8B 3WMDA 2HMLB 2KF3A 2GBXB 3MWZA 1SPUA 3CC73 1BIRA 4CDLA 1QMAA 5HGRA 2ZL8A 1GOVA 2C4BA 3NBBA 3CCV3 2BT3A 3FH1A 2KRTA 3ER7A 4K1VA 3X3YA 5AEWB 5KP1A 1UUVB 2CWVA 1ULIB 4BU4A 4LMIA 1BUQA 1TIJA 2FXTA 3KZTA 4WHAA 1OHPA 4KVHA 1O7HB 1BVIA 2P38A 3X3ZA 1MOLA 1AQZA 2XSOB 1B2ZA 1BNGA 1NB3I 2HMOB 2INXA 2KCDA 4HAAA 4XDVA 4OVMA 1OHSA 1ROVA 3FZWA 4L8OA 1VQK3 2HMMB 1IDPA 2BNGA 4EV5A 3OWUA 4PEJA 1VQP3 1RN4A 3F7SA 3LOYA 1NJI4 1AR0A 3S29A 1IU7A 8CHOA 2YFLB 4GSPA 2CFDA 3KE7A 1JBSA 2CC3A 2UX0A 2CFLA 2GEXA 3EX9A 1A90A 1W4NA 1WTHA 1FGRA 1TP6A 1UGHI 2P0XA 1IQXA 4MJDA 3HZPA 2OOVA 3V98A 3WR2A 1B2SA 1N5HA 3EN8A 1QVF2 1FUWA 1JZDA 4NHFA 3S27A 4J5GA 2XH9A 1RSNA 3DGNA 3VF1A 4KT3B 4FMDA 4HJLB 1GMRA 2RFRA 4I5QA 2F99A 1LQMB 4HM7B 1FUSA 1JZOA 1LQGC 3D3LA 3EN1B 3NUVA 3DXOA 1RTUA 2W03A 2GEYA 1SIIA 1V58A 4HM2B 4STDA 1RCKA 1SIHA 3KCHA 1I8VA 2HMJB 3D79A 3T8NA 1Y4KA 3LYGA 1RN1A 1T2HA 3K63A 3D5IA 1RNBA 3AGNA 2WGQA 1NU3A 1SARA 3DGLA 2R41A 4IT7A 4WWUC 3GZXB 2KF6A 2XR8B 1EKMA 4BL2A 1HKXA 3Q90A 1D6YA 1I70A 1Q7HA 3NX0A 4FCMA 1VQ73 1DVCA 2ZA4A 3DGMA 3O8YA 6RNTA 1MNLA 2CH9A 1Q864 6GSPA 5JPUA 1IVUA 3BNCA 4XBYA 1UW1A 1U5OA 1Q824 1I3IA 5I97A 2P09A 3SX1A 2BO9B 4R9KA 3KSED 1IYYA 1LVNA 3CC43 1JBTA 3JVCA 1T3BA 4XB5A 4LYLB 2K0MA 3DMCA 5GSPA 1FGOA 3A5EA 4Q53A 3H51A 4ZM8A 3DUKA 3OWYA 1IVVA 4KFEA 2GBWB 4MMYB 3G6E3 3CCE3 2XGNA 4XBTA 2IY2A 3HIIA 1R4CA 5EVHA 1GY5A 4XBXA 3FG3A 1BNRA 2W9PA 1FGQA 2F5WA 1YIT3 2M7OA 1WMPA 4L7KA 3CCJ3 1PU4A 5IG0A 3G0KA 1GY7A 1WQLB 2IUKA 3NXJA 1X1XA 1MWUA 3NM2A 3FF0A 3GWRA 2C11A 4O02B 2F86B 5EQLA 2OQEA 1GMQA 3BNEA 3LZAA 1BAOA 3CCU3 3UNLA 1ULJB 2CKFB 5RNTA 3Q1CA 4EXRA 1RKYA 3LXUX 4N3VA 1D6ZA 2AADA 3PCSA 5KP4A 1STDA 4HKVB 2STDA 5BIRA 1KQS2 5AYRB 3LT8A 1RGGA 1YIJ3 1AV4A 1W2B2 3RGRA 1HYFA 2XF3A 3OW22 2BMQB 5IW9A 1BRHA 1W00A 4HZBB 5CF1A 3ALAA 3NHXA 1RGAA 1GD3A 1M9GA 3MG1A 1C7HA 3FGYA 1E97A 3AMOA 3GZRA 1B21A 3ZFZA 4DKIA 1RNTA 1RGHA 2LYXA 1NDOB 4EYCA 1EG9B 3KFQC 1Q7Y4 1ZO2A 4I4KA 1LOVA 3SLUA 1G02A 1FGMA 2ML6A 3HX8A 5JBSA 2ML5A 5KP3A 2XSHB 3OX9A 1X1YA 4GB5A 1A2PA 1VQ83 2MC8A 1GMPA 1F8NA 1IV9A 3LTCA 4K61A 2Z7AA 3AGOA 3KIIA 4U13A 2R4IA 2B24B 1IT8A 2JDIH 5EEOA 3BNBA 3PS8A 2B1XB 2BMRB 1DVDA 5CK6A 1IVWA 1OCVA 3V99A 2CK3H 1CYUA 1RRHA 5AIIA 3X3XA 3CCR3 1W7CA 3K5TA 3KN4A 1JNQA 1YVBI 4FCZA 1GS3A 4N6LA 2E2UA 1JB4A 3CCM3 1CH0A 3EE1A 4R80A 3U1WA 1DMQA 2RCDA 4RZMA 3UB1A 1YHQ3 4RBNA 1KC84 1Q40A 3N54B 4K90B 4R9LA 1RGCA 3ZG5A 5IG5A 1TTOA 2E2TA 1LRAA 1TRPA 4L8PA 5G1LA 1RGFA 1FZUA 1BRKA 1PYLA 3K7CA 1QALA 2BHMA 3BB9A 4K1UA 2OTJ3 3V92A 1JKGA 1I2FA 2ZDJA 1YJW3 4OUQA 3F7XA 1LOWA 3BU4A 3JUNA 1E3VA 3FG4A 3WHOA 1O7PB 2W56A 3JUOA 3X41A 1VQN3 2SARA 1VQ93 2Z77A 3AHWA 1GY6A 1ZS7A 1B2XA 1X1WA 1BRGA 3EF8A 3CNXA 3EBYA 1VQQA 3MSOA 3T0UA 1UUWB 1A2KA 1RN7A 2CX1A 3X42A 1K734 5FW5A 3Q3FA 3AMOB 1N8QA 3B4PA 4MMXB 4FR9A 3FLJA 1RHLA 1V57A 2GSPA 3IJEB 5AIGA 2YX9A 3D9RA 3DH2A 1BRNL 4HM6B 4EV2A 3EHCA 1EUIC 4EBGA 1W01A 3WODG 3KSPA 1TU5A 3T8UA 5LC7A 3PZWA 3M8CA 1A67A 1SQWA 2F5MA 4TX4A 1E3RA 5AYSC 1UCJA 1MWTA 2KF4A 4IPBA 4N6V0 1PY3A 1YNVX 5D81A 2J8XB 1J2BA 1IV7A 3EBTA 2QIYA 3N8BA 1Q814 2CFKA 3CPOA 3UJMA 1VZZA 4J5KA 1VQ63 1ISKA 3DZLA 5IG3A 1I0VA
chains in the Genus database with same CATH topology
3S5CA 2WO0A 4WFOA 4BTYA 1STFI 5D83A 1Q40B 3WA3A 2QGUA 1JN5A 5IEOA 5CLKA 1OACA 3UL5A 2W04A 4BTWA 1NWWA 2QA43 4RNZA 3ECFA 2XEPA 1JKGB 4JF8A 1YJ93 2PZVA 3CC23 3I553 1OH0A 1CEWI 1W5ZA 1W02A 1W6GA 3QK9A 3B8LA 2W56B 1WMNA 7STDA 3PXMA 4WP5A 3STDA 4BTXA 1KD14 3MPHA 1GYBA 1WMOA 4HVNA 1N9JA 1PFPA 2Z76A 1VQM3 1DMNA 4X2OA 3RDEA 4AKYA 4N6MA 5AIHA 1O7WB 1UI8A 1YI23 3NBRA 3WA2X 3PGBA 3OWSA 1A2VA 1VQO3 1IQ8A 3K9MC 1M904 1GD4A 2P05A 3H3HA 5CF2A 5IENA 1QJGA 1VQ43 4KZ1A 1RRLA 3RGAA 3SEDA 4FMCA 4H61A 1EA2A 1ZX2A 2E2VA 1EQKA 2OWPA 3IMAB 3WDGB 5BVBA 1ASKA 2P0MA 4N6OB 1N8R4 3VSYA 4O3VA 2WGOA 3NBJA 1S5AA 1VQ53 3S28A 3U97A 1RJOA 3Q2PA 1K28A 5IG4A 3CCS3 2GU1A 2Y74A 1YGEA 3GRDA 3KKGA 2IA7A 4HYZA 3CCL3 1AVLA 4FMAA 2L4VA 1QAKA 3HI7A 3LTDA 1JRQA 4KFFA 1Q42A 3S67A 1YJN3 1JN5B 4OK0A 3DY5A 3BLZA 3F8XA 2BMOB 3MG2A 4NREA 5AI1A 1SJWA 3OV4A 1DMMA 3LTAA 2GU3A 4WYKA 3NM7A 1FA3A 4N6UA 2C10A 2CFWA 2PNCA 3CD63 4R1KA 5TGNA 3NV0A 3CXC2 3G16A 3G8ZA 1ROAA 4AKZA 4RNYA 1OHOA 3CME3 2Z6BA 2CG1A 4HM0B 3EB8A 4LEHA 1K8A4 1QVG2 1JB2A 1QAFA 4HM4B 1T5YA 3LH4A 3CPW2 5STDA 5IF6A 1OUNA 3NQYA 2CWTA 2XRXB 3B4OA 3EC9A 2D1WA 3GZBA 2YFJB 1KWIA 3GZYB 1N9EA 4HM1B 5G2GA 2GXFA 5LC6A 4GL6A 3MYTA 1OGZA 2FNQA 3N9HA 1IT7A 2CG0A 5A0OB 3I0YA 2RSXA 2CFGA 2YFIB 1V74A 5IEPA 3F14A 3F8HA 4J8TA 3GAXA 1AVKA 1L5GB 3ROBA 3I563 3DGOA 4G1MB 2OOVC 1O7GB 1W6YA 2HMNB 4JRFA 1JB5A 1K9M4 3LMLA 1Z1SA 2LQVA 4HM5B 1W6CA 5CXOA 3CMA3 2XGLA 2O3OA 3DM8A 6STDA 4N6NB 4WYKB 3IPTA 2W2CA 4CCVA 1TFOA 3LT9A 3NV0B 2A15A 1OF5A 3K0ZA 3G4S3 5IERA 2RGQA 3OXAA 3WOEB 1KSIA 3EJVA 4XDWA 3SVAA 1CQSA 1O7MB 1CYVA 3FG1A 4FMBA 1HU9A 1M1XB 3SOYA 1IK3A 3SXXA 2FGTA 2JQ5A 1JV2B 2IMJA 3MKIA 1UI7A 1NO3A 5DRVA 1US1A 3J7Yd 5D82A 3JUMA 4X2HA 3VGNA 3NQZA 1LNHA 3CU3A 2Q07A 3FCSB 1DYUA 3HK4A 3QRDA 2W0QA 4LGQA 2I9WA 3JUQA 4J9AA 5BXQA 3JUPA 1IQYA 3FSDA 2XFSA 2MF7A 1K41A 1N5PA 2XFTA 3BNDA 3A76A 3E99A 4FCJA 4AEQA 2SBLA 5DREA 1S723 1W2ZA 5AEUB 2OTL3 2CWUA 3F40A 4N6TA 1OPYA 4QWTA 5ELJA 3F9SA 3TDGA 3CNMA 2K54A 3LTBA 4KFDA 1NB5I 1TFKA 4IIAA 4R4KA 4ORLA 4O8SA 4MMZB 3MG3A 2CIUA 1LXEA 4HBRA 2QEX3 3L0RA 3PYJA 2V1LA 4H3UA 1M1K4 2HMKB 2O9UX 2OQEC 3MHEA 1OF5B 2CHCA 3PCRA 3SOAA 4XM4A 3UL6A 4HZ9B 1LOXA 3HIGA 2IUJA 2WOHA 1G96A 1WNHA 1IVXA 5JPPA 3WOFB 1TUHA 2Y73A 3B7CA 4MEIA 3G713 1U8CB 4LSOA 2OCTA 1O7NB 1VQL3 5ELUA 4EC6A 2W6JH 3EQQB 1FGTA 3CCQ3 3FKAA 4LZIA 5FGOA 3X40A 1OGXA 5AIFA 2KXGA 2CW9A 2WOFA 4O2HA 1JJ22 2D42A 2W9QA 4HM3B 2F98A 1D6UA 4HM8B 3WMDA 2HMLB 2GBXB 3MWZA 1SPUA 3CC73 4CDLA 1QMAA 5HGRA 2ZL8A 3NBBA 3CCV3 2BT3A 3FH1A 2KRTA 3ER7A 4K1VA 3X3YA 5AEWB 5KP1A 1UUVB 2CWVA 1ULIB 4LMIA 1BUQA 1TIJA 2FXTA 3KZTA 4WHAA 1OHPA 4KVHA 1O7HB 2P38A 3X3ZA 1MOLA 2XSOB 1NB3I 2HMOB 2INXA 2KCDA 4XDVA 4OVMA 1OHSA 1ROVA 3FZWA 4L8OA 1VQK3 2HMMB 1IDPA 2BNGA 4EV5A 3OWUA 4PEJA 1VQP3 3F7SA 3LOYA 1NJI4 1AR0A 3S29A 1IU7A 8CHOA 2YFLB 2CFDA 3KE7A 2CC3A 2UX0A 2CFLA 2GEXA 3EX9A 1A90A 1W4NA 1WTHA 1FGRA 1TP6A 2P0XA 4MJDA 1IQXA 3V98A 3HZPA 2OOVA 1FUWA 1N5HA 3EN8A 1QVF2 4NHFA 3S27A 2XH9A 3DGNA 3VF1A 4FMDA 4HJLB 2RFRA 2F99A 4HM7B 3D3LA 3EN1B 3NUVA 3DXOA 2W03A 2GEYA 1SIIA 4HM2B 4STDA 1SIHA 2HMJB 3T8NA 1Y4KA 3LYGA 3K63A 2WGQA 1NU3A 3DGLA 4IT7A 4WWUC 3GZXB 2XR8B 1EKMA 1HKXA 3Q90A 1D6YA 3NX0A 4FCMA 1VQ73 1DVCA 3DGMA 3O8YA 1MNLA 2CH9A 1Q864 5JPUA 1IVUA 3BNCA 4XBYA 1UW1A 1U5OA 1Q824 5I97A 2P09A 3SX1A 2BO9B 4R9KA 3KSED 1LVNA 3CC43 3JVCA 4XB5A 2K0MA 3DMCA 1FGOA 4Q53A 3H51A 4ZM8A 3DUKA 3OWYA 1IVVA 4KFEA 2GBWB 4MMYB 3G6E3 3CCE3 2XGNA 4XBTA 3HIIA 1R4CA 5EVHA 1GY5A 4XBXA 3FG3A 2W9PA 1FGQA 1YIT3 2M7OA 1WMPA 4L7KA 3CCJ3 1PU4A 5IG0A 3G0KA 1GY7A 2IUKA 1WQLB 3NXJA 3NM2A 3FF0A 3GWRA 2C11A 4O02B 2F86B 5EQLA 2OQEA 3BNEA 3LZAA 3CCU3 3UNLA 1ULJB 2CKFB 3Q1CA 4EXRA 1RKYA 3LXUX 4N3VA 1D6ZA 3PCSA 5KP4A 1STDA 4HKVB 2STDA 1KQS2 5AYRB 3LT8A 1YIJ3 1W2B2 1AV4A 3RGRA 2XF3A 3OW22 2BMQB 5IW9A 1W00A 4HZBB 5CF1A 3ALAA 3NHXA 1GD3A 1M9GA 3MG1A 1C7HA 3FGYA 1E97A 3AMOA 3GZRA 2LYXA 1NDOB 4EYCA 1EG9B 3KFQC 1Q7Y4 1ZO2A 4I4KA 3SLUA 2ML6A 1FGMA 3HX8A 5JBSA 2ML5A 5KP3A 2XSHB 3OX9A 4GB5A 1VQ83 2MC8A 1F8NA 1IV9A 3LTCA 4K61A 2Z7AA 3KIIA 4U13A 2R4IA 2B24B 2JDIH 1IT8A 5EEOA 3BNBA 3PS8A 2B1XB 2BMRB 1DVDA 5CK6A 1IVWA 1OCVA 3V99A 2CK3H 1CYUA 1RRHA 5AIIA 3X3XA 3CCR3 1W7CA 3K5TA 3KN4A 1JNQA 1YVBI 4FCZA 1GS3A 4N6LA 2E2UA 1JB4A 3CCM3 3EE1A 4R80A 3U1WA 1DMQA 2RCDA 4RZMA 3UB1A 1YHQ3 4RBNA 1KC84 1Q40A 3N54B 4K90B 4R9LA 5IG5A 2E2TA 4L8PA 3K7CA 1QALA 2BHMA 3BB9A 4K1UA 2OTJ3 3V92A 1JKGA 2ZDJA 1YJW3 4OUQA 3F7XA 3JUNA 1E3VA 3FG4A 3X41A 1O7PB 2W56A 3JUOA 1VQN3 1VQ93 2Z77A 1GY6A 3EF8A 3CNXA 3EBYA 3MSOA 3T0UA 1UUWB 1A2KA 1RN7A 3X42A 1K734 5FW5A 3AMOB 1N8QA 3B4PA 4MMXB 4FR9A 3FLJA 5AIGA 3IJEB 2YX9A 3D9RA 4HM6B 4EV2A 3EHCA 4EBGA 1W01A 3WODG 3KSPA 1TU5A 3T8UA 5LC7A 3PZWA 3M8CA 1A67A 1SQWA 4TX4A 1E3RA 5AYSC 4IPBA 4N6V0 5D81A 1J2BA 1IV7A 3EBTA 2QIYA 3N8BA 1Q814 2CFKA 3CPOA 3UJMA 1VZZA 1VQ63 1ISKA 3DZLA 5IG3A 3FF2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S5C A;  5D83 A;  1Q40 B;  2QGU A;  1JN5 A;  5IEO A;  5CLK A;  1NWW A;  3ECF A;  1JKG B;  2PZV A;  1OH0 A;  1W02 A;  3B8L A;  7STD A;  4WP5 A;  3STD A;  1GYB A;  4HVN A;  2Z76 A;  1DMN A;  4X2O A;  5AIH A;  1O7W B;  3NBR A;  3OWS A;  3H3H A;  5CF2 A;  5IEN A;  1QJG A;  3RGA A;  3SED A;  1EA2 A;  1ZX2 A;  2OWP A;  5BVB A;  1ASK A;  3VSY A;  1S5A A;  5IG4 A;  3GRD A;  3KKG A;  1Q42 A;  1JN5 B;  3BLZ A;  3F8X A;  2BMO B;  3MG2 A;  5AI1 A;  1SJW A;  3OV4 A;  1DMM A;  4WYK A;  4R1K A;  5TGN A;  3NV0 A;  3G16 A;  3G8Z A;  1OHO A;  4HM0 B;  4LEH A;  1JB2 A;  4HM4 B;  5STD A;  5IF6 A;  1OUN A;  2XRX B;  3B4O A;  3EC9 A;  3GZB A;  2YFJ B;  3GZY B;  4HM1 B;  5G2G A;  2GXF A;  3MYT A;  1OGZ A;  3I0Y A;  2YFI B;  5IEP A;  3F14 A;  3F8H A;  4J8T A;  3ROB A;  1O7G B;  1W6Y A;  2HMN B;  1JB5 A;  1Z1S A;  4HM5 B;  5CXO A;  3DM8 A;  6STD A;  4WYK B;  3IPT A;  2W2C A;  3NV0 B;  2A15 A;  1OF5 A;  3K0Z A;  5IER A;  2RGQ A;  3OXA A;  3EJV A;  4XDW A;  1CQS A;  1O7M B;  3SOY A;  2JQ5 A;  2IMJ A;  3MKI A;  5DRV A;  5D82 A;  3JUM A;  4X2H A;  3VGN A;  3CU3 A;  3HK4 A;  4LGQ A;  2I9W A;  3JUQ A;  4J9A A;  5BXQ A;  3JUP A;  3FSD A;  1K41 A;  3A76 A;  3E99 A;  4FCJ A;  5DRE A;  5AEU B;  3F40 A;  1OPY A;  3F9S A;  3CNM A;  2K54 A;  4IIA A;  4ORL A;  3MG3 A;  4H3U A;  2HMK B;  3MHE A;  1OF5 B;  2CHC A;  3SOA A;  4XM4 A;  4HZ9 B;  5JPP A;  1TUH A;  3B7C A;  1O7N B;  3EQQ B;  3FKA A;  1OGX A;  5AIF A;  4HM3 B;  2F98 A;  4HM8 B;  3WMD A;  2HML B;  2GBX B;  4CDL A;  1QMA A;  5HGR A;  3FH1 A;  3ER7 A;  4K1V A;  5KP1 A;  5AEW B;  1UUV B;  1ULI B;  4LMI A;  1BUQ A;  3KZT A;  1OHP A;  4KVH A;  1O7H B;  2XSO B;  2HMO B;  2INX A;  4XDV A;  4OVM A;  1OHS A;  3FZW A;  4L8O A;  2HMM B;  1IDP A;  2BNG A;  3OWU A;  4PEJ A;  3F7S A;  1AR0 A;  8CHO A;  2YFL B;  3KE7 A;  2UX0 A;  2GEX A;  3EX9 A;  1TP6 A;  4MJD A;  3HZP A;  3EN8 A;  4HJL B;  2RFR A;  2F99 A;  4HM7 B;  3EN1 B;  3NUV A;  3DXO A;  2GEY A;  4HM2 B;  4STD A;  2HMJ B;  3T8N A;  3LYG A;  1NU3 A;  4WWU C;  3GZX B;  2XR8 B;  1HKX A;  3Q90 A;  4FCM A;  5JPU A;  4XBY A;  1U5O A;  4R9K A;  4XB5 A;  3DMC A;  4Q53 A;  3H51 A;  3DUK A;  3OWY A;  2GBW B;  4XBT A;  5EVH A;  1GY5 A;  4XBX A;  4L7K A;  5IG0 A;  3G0K A;  1GY7 A;  1WQL B;  3NXJ A;  3NM2 A;  3FF0 A;  3GWR A;  2F86 B;  3LZA A;  3UNL A;  1ULJ B;  2CKF B;  4N3V A;  5KP4 A;  1STD A;  4HKV B;  2STD A;  3RGR A;  2BMQ B;  1W00 A;  4HZB B;  5CF1 A;  3NHX A;  3MG1 A;  1C7H A;  3FGY A;  1E97 A;  3GZR A;  1NDO B;  1EG9 B;  1ZO2 A;  4I4K A;  3HX8 A;  5KP3 A;  2XSH B;  3OX9 A;  4GB5 A;  2Z7A A;  4U13 A;  2R4I A;  2B24 B;  2B1X B;  2BMR B;  5CK6 A;  1OCV A;  5AII A;  1GS3 A;  1JB4 A;  1DMQ A;  2RCD A;  4RZM A;  1Q40 A;  4R9L A;  5IG5 A;  4L8P A;  3K7C A;  4K1U A;  3BB9 A;  1JKG A;  4OUQ A;  3F7X A;  3JUN A;  1E3V A;  1O7P B;  3JUO A;  2Z77 A;  1GY6 A;  3EF8 A;  3CNX A;  3EBY A;  3MSO A;  1UUW B;  1A2K A;  5FW5 A;  3B4P A;  3FLJ A;  5AIG A;  3D9R A;  4HM6 B;  3EHC A;  1W01 A;  3KSP A;  3T8U A;  3M8C A;  1E3R A;  5D81 A;  3EBT A;  2QIY A;  3CPO A;  3UJM A;  1VZZ A;  1ISK A;  3DZL A;  5IG3 A;  3FF2 A; 
#chains in the Genus database with same CATH topology
 3S5C A;  1RMS A;  1RGL A;  2WO0 A;  4WFO A;  4BTY A;  1STF I;  5D83 A;  1Q40 B;  3WA3 A;  2QGU A;  1JN5 A;  3SYU A;  5IEO A;  1DET A;  5CLK A;  1OAC A;  3UL5 A;  2W04 A;  4BTW A;  1NWW A;  2QA4 3;  1RLS A;  4RNT A;  4CPK A;  4RNZ A;  1ZGX A;  3ECF A;  1BNF A;  2XEP A;  1JKG B;  4JF8 A;  1YJ9 3;  2PZV A;  3CC2 3;  3I55 3;  1B27 A;  1OH0 A;  1CEW I;  1W5Z A;  1W02 A;  1W6G A;  3QK9 A;  3B8L A;  1BSD A;  2W56 B;  1WMN A;  7STD A;  3PXM A;  4WP5 A;  3STD A;  3FF2 A;  4BTX A;  1KD1 4;  3MPH A;  1GYB A;  1WMO A;  4HVN A;  1GOY A;  1N9J A;  1PFP A;  2Z76 A;  1DMN A;  4X2O A;  3RDE A;  1B3S A;  4AKY A;  1VQM 3;  4N6M A;  5AIH A;  1O7W B;  1UI8 A;  1YI2 3;  2F56 A;  3NBR A;  3WA2 X;  3PGB A;  3OWS A;  1A2V A;  1VQO 3;  1IQ8 A;  3K9M C;  1M90 4;  1GD4 A;  1RGK A;  2P05 A;  3H3H A;  5CF2 A;  5IEN A;  1RGE A;  1QJG A;  1VQ4 3;  4KZ1 A;  1BSC A;  1RRL A;  3RGA A;  3SED A;  4FMC A;  4ILF A;  4H61 A;  1EA2 A;  1ZX2 A;  2E2V A;  1EQK A;  2OWP A;  3IMA B;  3WDG B;  5BVB A;  1ASK A;  2P0M A;  4N6O B;  1N8R 4;  3VSY A;  1TRQ A;  2WGO A;  1BSA A;  1S5A A;  1YGW A;  3NBJ A;  4O3V A;  1VQ5 3;  3S28 A;  3U97 A;  2HOH A;  1RJO A;  3Q2P A;  1K28 A;  5IG4 A;  3CCS 3;  2GU1 A;  1HZ1 A;  2Y74 A;  1YGE A;  2CX0 A;  3GRD A;  3KKG A;  2IA7 A;  1I2E A;  4HYZ A;  3CCL 3;  1B2M A;  1EEJ A;  1AVL A;  4FMA A;  1B20 A;  2L4V A;  1QAK A;  3HI7 A;  3LTD A;  1JRQ A;  4KFF A;  2H0G A;  1FYS A;  1BAN A;  2UUG C;  1Q42 A;  3S67 A;  1YJN 3;  1JN5 B;  1UCL A;  4OK0 A;  3DY5 A;  3BLZ A;  3F8X A;  3URP A;  2BMO B;  2AAE A;  4BL3 A;  3MG2 A;  4NRE A;  5AI1 A;  1SJW A;  3OV4 A;  1DMM A;  3LTA A;  2GU3 A;  1Q9E A;  2H0I A;  4EW5 A;  4WYK A;  3NM7 A;  1FA3 A;  3ZG0 A;  4N6U A;  2C10 A;  2CFW A;  2PNC A;  3CD6 3;  4R1K A;  5TGN A;  3NV0 A;  3CXC 2;  3G16 A;  3G8Z A;  1ROA A;  4AKZ A;  4RNY A;  1OHO A;  3CME 3;  2Z6B A;  2CG1 A;  1UGI A;  1BNI A;  4HM0 B;  3EB8 A;  1FW7 A;  4CJN A;  4LEH A;  1K8A 4;  1QVG 2;  1JB2 A;  1QAF A;  2IYJ A;  1MGW A;  1BNE A;  1I2G A;  2UGI A;  4HM4 B;  1T5Y A;  3LH4 A;  3CPW 2;  3DGY A;  5STD A;  5IF6 A;  1BSB A;  1OUN A;  3NQY A;  2CWT A;  2XRX B;  3B4O A;  3EC9 A;  2D1W A;  3GZB A;  2BU4 A;  1X1U A;  2YFJ B;  1KWI A;  3GZY B;  1N9E A;  4HM1 B;  5G2G A;  2GXF A;  5LC6 A;  4NPB A;  4GL6 A;  8RNT A;  3MYT A;  1OGZ A;  1MWS A;  2FNQ A;  3N9H A;  1IT7 A;  2CG0 A;  5A0O B;  1BU4 A;  1FUT A;  1UCI A;  3I0Y A;  5M1A A;  2RSX A;  2CFG A;  3RNT A;  2YFI B;  2RBI A;  1BRJ A;  1V74 A;  5IEP A;  3F14 A;  3F8H A;  1I0X A;  5HOH A;  4J8T A;  3GAX A;  1NNV A;  1AVK A;  1L5G B;  3ROB A;  3I56 3;  3DGO A;  4G1M B;  4GHO A;  2OOV C;  1O7G B;  1W6Y A;  2HMN B;  4JRF A;  1JB5 A;  1MGR A;  1K9M 4;  3LML A;  1Z1S A;  2LQV A;  1RCL A;  4HM5 B;  1W6C A;  5CXO A;  3CMA 3;  2XGL A;  2O3O A;  3DM8 A;  6STD A;  4N6N B;  4WYK B;  3IPT A;  2W2C A;  3BIR A;  4CCV A;  1TFO A;  2F4Y A;  3LT9 A;  4BIR A;  3AHS A;  3NV0 B;  2A15 A;  5BU4 A;  1OF5 A;  2ZHX B;  3K0Z A;  5IER A;  3G4S 3;  2RGQ A;  3OXA A;  3WOE B;  1KSI A;  1G0T A;  3EJV A;  1BRI A;  4XDW A;  3SVA A;  5G1K A;  1CQS A;  1I3F A;  1CYV A;  1O7M B;  3FG1 A;  4FMB A;  1HU9 A;  1M1X B;  1GSP A;  7RNT A;  1BUJ A;  3SOY A;  1IK3 A;  3SXX A;  2FGT A;  2JQ5 A;  1JV2 B;  2IMJ A;  3MKI A;  1UI7 A;  1NO3 A;  5DRV A;  7GSP A;  1US1 A;  3J7Y d;  4HOH A;  5D82 A;  3JUM A;  1DE3 A;  4X2H A;  3VGN A;  1B2U A;  3NQZ A;  1LNH A;  1MWR A;  3CU3 A;  2Q07 A;  3FCS B;  1DYU A;  3HK4 A;  3QRD A;  2W0Q A;  4LGQ A;  1GOU A;  2I9W A;  3JUQ A;  4J9A A;  5BXQ A;  3JUP A;  1IQY A;  3FSD A;  2XFS A;  3HOH A;  2MF7 A;  1K41 A;  3D4A A;  1N5P A;  2XFT A;  3BND A;  3A76 A;  9RNT A;  3E99 A;  4FCJ A;  4AEQ A;  2SBL A;  5DRE A;  1S72 3;  1W2Z A;  5AEU B;  5M18 A;  2OTL 3;  2CWU A;  3F40 A;  4N6T A;  1OPY A;  1BNJ A;  4QWT A;  5ELJ A;  1BOX A;  3F9S A;  3TDG A;  3CNM A;  1RDS A;  2K54 A;  3LTB A;  1BNS A;  4KFD A;  1NB5 I;  1TFK A;  4IIA A;  4R4K A;  4ORL A;  4O8S A;  4MMZ B;  3MG3 A;  2CIU A;  1LXE A;  3GSP A;  4HBR A;  2QEX 3;  3L0R A;  2H0H A;  3PYJ A;  2V1L A;  4H3U A;  1JBR A;  1AY7 A;  1M1K 4;  2HMK B;  1BSE A;  2O9U X;  2OQE C;  1BGS A;  3MHE A;  1OF5 B;  2CHC A;  3PCR A;  3SOA A;  4XM4 A;  3UL6 A;  5M19 A;  1C54 A;  4HZ9 B;  1LOX A;  3HIG A;  1TJD A;  2IUJ A;  2WOH A;  1G96 A;  1WNH A;  1IVX A;  1BRS A;  5JPP A;  3WOF B;  1LOY A;  1TUH A;  2Y73 A;  1UDI I;  3B7C A;  1YVS A;  4MEI A;  3G71 3;  1U8C B;  4LSO A;  2OCT A;  1LNI A;  1O7N B;  2BIR A;  2RNT A;  1R4Y A;  1UUG B;  1VQL 3;  5ELU A;  4EC6 A;  2W6J H;  1UCK A;  2KAA A;  3EQQ B;  1FGT A;  3CCQ 3;  2K3D A;  3FKA A;  4LZI A;  2KF5 A;  5FGO A;  1OGX A;  3X40 A;  5AIF A;  2KXG A;  2CW9 A;  1T2I A;  2WOF A;  4O2H A;  1JJ2 2;  3D5G A;  2L1S A;  2D42 A;  2W9Q A;  4HM3 B;  2F98 A;  1D6U A;  4HM8 B;  3WMD A;  2HML B;  2KF3 A;  2GBX B;  3MWZ A;  1SPU A;  3CC7 3;  1BIR A;  4CDL A;  1QMA A;  5HGR A;  2ZL8 A;  1GOV A;  2C4B A;  3NBB A;  3CCV 3;  2BT3 A;  3FH1 A;  2KRT A;  3ER7 A;  4K1V A;  3X3Y A;  5AEW B;  5KP1 A;  1UUV B;  2CWV A;  1ULI B;  4BU4 A;  4LMI A;  1BUQ A;  1TIJ A;  2FXT A;  3KZT A;  4WHA A;  1OHP A;  4KVH A;  1O7H B;  1BVI A;  2P38 A;  3X3Z A;  1MOL A;  1AQZ A;  2XSO B;  1B2Z A;  1BNG A;  1NB3 I;  2HMO B;  2INX A;  2KCD A;  4HAA A;  4XDV A;  4OVM A;  1OHS A;  1ROV A;  3FZW A;  4L8O A;  1VQK 3;  2HMM B;  1IDP A;  2BNG A;  4EV5 A;  3OWU A;  4PEJ A;  1VQP 3;  1RN4 A;  3F7S A;  3LOY A;  1NJI 4;  1AR0 A;  3S29 A;  1IU7 A;  8CHO A;  2YFL B;  4GSP A;  2CFD A;  3KE7 A;  1JBS A;  2CC3 A;  2UX0 A;  2CFL A;  2GEX A;  3EX9 A;  1A90 A;  1W4N A;  1WTH A;  1FGR A;  1TP6 A;  1UGH I;  2P0X A;  1IQX A;  4MJD A;  3HZP A;  2OOV A;  3V98 A;  3WR2 A;  1B2S A;  1N5H A;  3EN8 A;  1QVF 2;  1FUW A;  1JZD A;  4NHF A;  3S27 A;  4J5G A;  2XH9 A;  1RSN A;  3DGN A;  3VF1 A;  4KT3 B;  4FMD A;  4HJL B;  1GMR A;  2RFR A;  4I5Q A;  2F99 A;  1LQM B;  4HM7 B;  1FUS A;  1JZO A;  1LQG C;  3D3L A;  3EN1 B;  3NUV A;  3DXO A;  1RTU A;  2W03 A;  2GEY A;  1SII A;  1V58 A;  4HM2 B;  4STD A;  1RCK A;  1SIH A;  3KCH A;  1I8V A;  2HMJ B;  3D79 A;  3T8N A;  1Y4K A;  3LYG A;  1RN1 A;  1T2H A;  3K63 A;  3D5I A;  1RNB A;  3AGN A;  2WGQ A;  1NU3 A;  1SAR A;  3DGL A;  2R41 A;  4IT7 A;  4WWU C;  3GZX B;  2KF6 A;  2XR8 B;  1EKM A;  4BL2 A;  1HKX A;  3Q90 A;  1D6Y A;  1I70 A;  1Q7H A;  3NX0 A;  4FCM A;  1VQ7 3;  1DVC A;  2ZA4 A;  3DGM A;  3O8Y A;  6RNT A;  1MNL A;  2CH9 A;  1Q86 4;  6GSP A;  5JPU A;  1IVU A;  3BNC A;  4XBY A;  1UW1 A;  1U5O A;  1Q82 4;  1I3I A;  5I97 A;  2P09 A;  3SX1 A;  2BO9 B;  4R9K A;  3KSE D;  1IYY A;  1LVN A;  3CC4 3;  1JBT A;  3JVC A;  1T3B A;  4XB5 A;  4LYL B;  2K0M A;  3DMC A;  5GSP A;  1FGO A;  3A5E A;  4Q53 A;  3H51 A;  4ZM8 A;  3DUK A;  3OWY A;  1IVV A;  4KFE A;  2GBW B;  4MMY B;  3G6E 3;  3CCE 3;  2XGN A;  4XBT A;  2IY2 A;  3HII A;  1R4C A;  5EVH A;  1GY5 A;  4XBX A;  3FG3 A;  1BNR A;  2W9P A;  1FGQ A;  2F5W A;  1YIT 3;  2M7O A;  1WMP A;  4L7K A;  3CCJ 3;  1PU4 A;  5IG0 A;  3G0K A;  1GY7 A;  1WQL B;  2IUK A;  3NXJ A;  1X1X A;  1MWU A;  3NM2 A;  3FF0 A;  3GWR A;  2C11 A;  4O02 B;  2F86 B;  5EQL A;  2OQE A;  1GMQ A;  3BNE A;  3LZA A;  1BAO A;  3CCU 3;  3UNL A;  1ULJ B;  2CKF B;  5RNT A;  3Q1C A;  4EXR A;  1RKY A;  3LXU X;  4N3V A;  1D6Z A;  2AAD A;  3PCS A;  5KP4 A;  1STD A;  4HKV B;  2STD A;  5BIR A;  1KQS 2;  5AYR B;  3LT8 A;  1RGG A;  1YIJ 3;  1AV4 A;  1W2B 2;  3RGR A;  1HYF A;  2XF3 A;  3OW2 2;  2BMQ B;  5IW9 A;  1BRH A;  1W00 A;  4HZB B;  5CF1 A;  3ALA A;  3NHX A;  1RGA A;  1GD3 A;  1M9G A;  3MG1 A;  1C7H A;  3FGY A;  1E97 A;  3AMO A;  3GZR A;  1B21 A;  3ZFZ A;  4DKI A;  1RNT A;  1RGH A;  2LYX A;  1NDO B;  4EYC A;  1EG9 B;  3KFQ C;  1Q7Y 4;  1ZO2 A;  4I4K A;  1LOV A;  3SLU A;  1G02 A;  1FGM A;  2ML6 A;  3HX8 A;  5JBS A;  2ML5 A;  5KP3 A;  2XSH B;  3OX9 A;  1X1Y A;  4GB5 A;  1A2P A;  1VQ8 3;  2MC8 A;  1GMP A;  1F8N A;  1IV9 A;  3LTC A;  4K61 A;  2Z7A A;  3AGO A;  3KII A;  4U13 A;  2R4I A;  2B24 B;  1IT8 A;  2JDI H;  5EEO A;  3BNB A;  3PS8 A;  2B1X B;  2BMR B;  1DVD A;  5CK6 A;  1IVW A;  1OCV A;  3V99 A;  2CK3 H;  1CYU A;  1RRH A;  5AII A;  3X3X A;  3CCR 3;  1W7C A;  3K5T A;  3KN4 A;  1JNQ A;  1YVB I;  4FCZ A;  1GS3 A;  4N6L A;  2E2U A;  1JB4 A;  3CCM 3;  1CH0 A;  3EE1 A;  4R80 A;  3U1W A;  1DMQ A;  2RCD A;  4RZM A;  3UB1 A;  1YHQ 3;  4RBN A;  1KC8 4;  1Q40 A;  3N54 B;  4K90 B;  4R9L A;  1RGC A;  3ZG5 A;  5IG5 A;  1TTO A;  2E2T A;  1LRA A;  1TRP A;  4L8P A;  5G1L A;  1RGF A;  1FZU A;  1BRK A;  1PYL A;  3K7C A;  1QAL A;  2BHM A;  3BB9 A;  4K1U A;  2OTJ 3;  3V92 A;  1JKG A;  1I2F A;  2ZDJ A;  1YJW 3;  4OUQ A;  3F7X A;  1LOW A;  3BU4 A;  3JUN A;  1E3V A;  3FG4 A;  3WHO A;  1O7P B;  2W56 A;  3JUO A;  3X41 A;  1VQN 3;  2SAR A;  1VQ9 3;  2Z77 A;  3AHW A;  1GY6 A;  1ZS7 A;  1B2X A;  1X1W A;  1BRG A;  3EF8 A;  3CNX A;  3EBY A;  1VQQ A;  3MSO A;  3T0U A;  1UUW B;  1A2K A;  1RN7 A;  2CX1 A;  3X42 A;  1K73 4;  5FW5 A;  3Q3F A;  3AMO B;  1N8Q A;  3B4P A;  4MMX B;  4FR9 A;  3FLJ A;  1RHL A;  1V57 A;  2GSP A;  3IJE B;  5AIG A;  2YX9 A;  3D9R A;  3DH2 A;  1BRN L;  4HM6 B;  4EV2 A;  3EHC A;  1EUI C;  4EBG A;  1W01 A;  3WOD G;  3KSP A;  1TU5 A;  3T8U A;  5LC7 A;  3PZW A;  3M8C A;  1A67 A;  1SQW A;  2F5M A;  4TX4 A;  1E3R A;  5AYS C;  1UCJ A;  1MWT A;  2KF4 A;  4IPB A;  4N6V 0;  1PY3 A;  1YNV X;  5D81 A;  2J8X B;  1J2B A;  1IV7 A;  3EBT A;  2QIY A;  3N8B A;  1Q81 4;  2CFK A;  3CPO A;  3UJM A;  1VZZ A;  4J5K A;  1VQ6 3;  1ISK A;  3DZL A;  5IG3 A;  1I0V A; 
#chains in the Genus database with same CATH homology
 3S5C A;  2WO0 A;  4WFO A;  4BTY A;  1STF I;  5D83 A;  1Q40 B;  3WA3 A;  2QGU A;  1JN5 A;  5IEO A;  5CLK A;  1OAC A;  3UL5 A;  2W04 A;  4BTW A;  1NWW A;  2QA4 3;  4RNZ A;  3ECF A;  2XEP A;  1JKG B;  4JF8 A;  1YJ9 3;  2PZV A;  3CC2 3;  3I55 3;  1OH0 A;  1CEW I;  1W5Z A;  1W02 A;  1W6G A;  3QK9 A;  3B8L A;  2W56 B;  1WMN A;  7STD A;  3PXM A;  4WP5 A;  3STD A;  4BTX A;  1KD1 4;  3MPH A;  1GYB A;  1WMO A;  4HVN A;  1N9J A;  1PFP A;  2Z76 A;  1VQM 3;  1DMN A;  4X2O A;  3RDE A;  4AKY A;  4N6M A;  5AIH A;  1O7W B;  1UI8 A;  1YI2 3;  3NBR A;  3WA2 X;  3PGB A;  3OWS A;  1A2V A;  1VQO 3;  1IQ8 A;  3K9M C;  1M90 4;  1GD4 A;  2P05 A;  3H3H A;  5CF2 A;  5IEN A;  1QJG A;  1VQ4 3;  4KZ1 A;  1RRL A;  3RGA A;  3SED A;  4FMC A;  4H61 A;  1EA2 A;  1ZX2 A;  2E2V A;  1EQK A;  2OWP A;  3IMA B;  3WDG B;  5BVB A;  1ASK A;  2P0M A;  4N6O B;  1N8R 4;  3VSY A;  4O3V A;  2WGO A;  3NBJ A;  1S5A A;  1VQ5 3;  3S28 A;  3U97 A;  1RJO A;  3Q2P A;  1K28 A;  5IG4 A;  3CCS 3;  2GU1 A;  2Y74 A;  1YGE A;  3GRD A;  3KKG A;  2IA7 A;  4HYZ A;  3CCL 3;  1AVL A;  4FMA A;  2L4V A;  1QAK A;  3HI7 A;  3LTD A;  1JRQ A;  4KFF A;  1Q42 A;  3S67 A;  1YJN 3;  1JN5 B;  4OK0 A;  3DY5 A;  3BLZ A;  3F8X A;  2BMO B;  3MG2 A;  4NRE A;  5AI1 A;  1SJW A;  3OV4 A;  1DMM A;  3LTA A;  2GU3 A;  4WYK A;  3NM7 A;  1FA3 A;  4N6U A;  2C10 A;  2CFW A;  2PNC A;  3CD6 3;  4R1K A;  5TGN A;  3NV0 A;  3CXC 2;  3G16 A;  3G8Z A;  1ROA A;  4AKZ A;  4RNY A;  1OHO A;  3CME 3;  2Z6B A;  2CG1 A;  4HM0 B;  3EB8 A;  4LEH A;  1K8A 4;  1QVG 2;  1JB2 A;  1QAF A;  4HM4 B;  1T5Y A;  3LH4 A;  3CPW 2;  5STD A;  5IF6 A;  1OUN A;  3NQY A;  2CWT A;  2XRX B;  3B4O A;  3EC9 A;  2D1W A;  3GZB A;  2YFJ B;  1KWI A;  3GZY B;  1N9E A;  4HM1 B;  5G2G A;  2GXF A;  5LC6 A;  4GL6 A;  3MYT A;  1OGZ A;  2FNQ A;  3N9H A;  1IT7 A;  2CG0 A;  5A0O B;  3I0Y A;  2RSX A;  2CFG A;  2YFI B;  1V74 A;  5IEP A;  3F14 A;  3F8H A;  4J8T A;  3GAX A;  1AVK A;  1L5G B;  3ROB A;  3I56 3;  3DGO A;  4G1M B;  2OOV C;  1O7G B;  1W6Y A;  2HMN B;  4JRF A;  1JB5 A;  1K9M 4;  3LML A;  1Z1S A;  2LQV A;  4HM5 B;  1W6C A;  5CXO A;  3CMA 3;  2XGL A;  2O3O A;  3DM8 A;  6STD A;  4N6N B;  4WYK B;  3IPT A;  2W2C A;  4CCV A;  1TFO A;  3LT9 A;  3NV0 B;  2A15 A;  1OF5 A;  3K0Z A;  3G4S 3;  5IER A;  2RGQ A;  3OXA A;  3WOE B;  1KSI A;  3EJV A;  4XDW A;  3SVA A;  1CQS A;  1O7M B;  1CYV A;  3FG1 A;  4FMB A;  1HU9 A;  1M1X B;  3SOY A;  1IK3 A;  3SXX A;  2FGT A;  2JQ5 A;  1JV2 B;  2IMJ A;  3MKI A;  1UI7 A;  1NO3 A;  5DRV A;  1US1 A;  3J7Y d;  5D82 A;  3JUM A;  4X2H A;  3VGN A;  3NQZ A;  1LNH A;  3CU3 A;  2Q07 A;  3FCS B;  1DYU A;  3HK4 A;  3QRD A;  2W0Q A;  4LGQ A;  2I9W A;  3JUQ A;  4J9A A;  5BXQ A;  3JUP A;  1IQY A;  3FSD A;  2XFS A;  2MF7 A;  1K41 A;  1N5P A;  2XFT A;  3BND A;  3A76 A;  3E99 A;  4FCJ A;  4AEQ A;  2SBL A;  5DRE A;  1S72 3;  1W2Z A;  5AEU B;  2OTL 3;  2CWU A;  3F40 A;  4N6T A;  1OPY A;  4QWT A;  5ELJ A;  3F9S A;  3TDG A;  3CNM A;  2K54 A;  3LTB A;  4KFD A;  1NB5 I;  1TFK A;  4IIA A;  4R4K A;  4ORL A;  4O8S A;  4MMZ B;  3MG3 A;  2CIU A;  1LXE A;  4HBR A;  2QEX 3;  3L0R A;  3PYJ A;  2V1L A;  4H3U A;  1M1K 4;  2HMK B;  2O9U X;  2OQE C;  3MHE A;  1OF5 B;  2CHC A;  3PCR A;  3SOA A;  4XM4 A;  3UL6 A;  4HZ9 B;  1LOX A;  3HIG A;  2IUJ A;  2WOH A;  1G96 A;  1WNH A;  1IVX A;  5JPP A;  3WOF B;  1TUH A;  2Y73 A;  3B7C A;  4MEI A;  3G71 3;  1U8C B;  4LSO A;  2OCT A;  1O7N B;  1VQL 3;  5ELU A;  4EC6 A;  2W6J H;  3EQQ B;  1FGT A;  3CCQ 3;  3FKA A;  4LZI A;  5FGO A;  3X40 A;  1OGX A;  5AIF A;  2KXG A;  2CW9 A;  2WOF A;  4O2H A;  1JJ2 2;  2D42 A;  2W9Q A;  4HM3 B;  2F98 A;  1D6U A;  4HM8 B;  3WMD A;  2HML B;  2GBX B;  3MWZ A;  1SPU A;  3CC7 3;  4CDL A;  1QMA A;  5HGR A;  2ZL8 A;  3NBB A;  3CCV 3;  2BT3 A;  3FH1 A;  2KRT A;  3ER7 A;  4K1V A;  3X3Y A;  5AEW B;  5KP1 A;  1UUV B;  2CWV A;  1ULI B;  4LMI A;  1BUQ A;  1TIJ A;  2FXT A;  3KZT A;  4WHA A;  1OHP A;  4KVH A;  1O7H B;  2P38 A;  3X3Z A;  1MOL A;  2XSO B;  1NB3 I;  2HMO B;  2INX A;  2KCD A;  4XDV A;  4OVM A;  1OHS A;  1ROV A;  3FZW A;  4L8O A;  1VQK 3;  2HMM B;  1IDP A;  2BNG A;  4EV5 A;  3OWU A;  4PEJ A;  1VQP 3;  3F7S A;  3LOY A;  1NJI 4;  1AR0 A;  3S29 A;  1IU7 A;  8CHO A;  2YFL B;  2CFD A;  3KE7 A;  2CC3 A;  2UX0 A;  2CFL A;  2GEX A;  3EX9 A;  1A90 A;  1W4N A;  1WTH A;  1FGR A;  1TP6 A;  2P0X A;  4MJD A;  1IQX A;  3V98 A;  3HZP A;  2OOV A;  1FUW A;  1N5H A;  3EN8 A;  1QVF 2;  4NHF A;  3S27 A;  2XH9 A;  3DGN A;  3VF1 A;  4FMD A;  4HJL B;  2RFR A;  2F99 A;  4HM7 B;  3D3L A;  3EN1 B;  3NUV A;  3DXO A;  2W03 A;  2GEY A;  1SII A;  4HM2 B;  4STD A;  1SIH A;  2HMJ B;  3T8N A;  1Y4K A;  3LYG A;  3K63 A;  2WGQ A;  1NU3 A;  3DGL A;  4IT7 A;  4WWU C;  3GZX B;  2XR8 B;  1EKM A;  1HKX A;  3Q90 A;  1D6Y A;  3NX0 A;  4FCM A;  1VQ7 3;  1DVC A;  3DGM A;  3O8Y A;  1MNL A;  2CH9 A;  1Q86 4;  5JPU A;  1IVU A;  3BNC A;  4XBY A;  1UW1 A;  1U5O A;  1Q82 4;  5I97 A;  2P09 A;  3SX1 A;  2BO9 B;  4R9K A;  3KSE D;  1LVN A;  3CC4 3;  3JVC A;  4XB5 A;  2K0M A;  3DMC A;  1FGO A;  4Q53 A;  3H51 A;  4ZM8 A;  3DUK A;  3OWY A;  1IVV A;  4KFE A;  2GBW B;  4MMY B;  3G6E 3;  3CCE 3;  2XGN A;  4XBT A;  3HII A;  1R4C A;  5EVH A;  1GY5 A;  4XBX A;  3FG3 A;  2W9P A;  1FGQ A;  1YIT 3;  2M7O A;  1WMP A;  4L7K A;  3CCJ 3;  1PU4 A;  5IG0 A;  3G0K A;  1GY7 A;  2IUK A;  1WQL B;  3NXJ A;  3NM2 A;  3FF0 A;  3GWR A;  2C11 A;  4O02 B;  2F86 B;  5EQL A;  2OQE A;  3BNE A;  3LZA A;  3CCU 3;  3UNL A;  1ULJ B;  2CKF B;  3Q1C A;  4EXR A;  1RKY A;  3LXU X;  4N3V A;  1D6Z A;  3PCS A;  5KP4 A;  1STD A;  4HKV B;  2STD A;  1KQS 2;  5AYR B;  3LT8 A;  1YIJ 3;  1W2B 2;  1AV4 A;  3RGR A;  2XF3 A;  3OW2 2;  2BMQ B;  5IW9 A;  1W00 A;  4HZB B;  5CF1 A;  3ALA A;  3NHX A;  1GD3 A;  1M9G A;  3MG1 A;  1C7H A;  3FGY A;  1E97 A;  3AMO A;  3GZR A;  2LYX A;  1NDO B;  4EYC A;  1EG9 B;  3KFQ C;  1Q7Y 4;  1ZO2 A;  4I4K A;  3SLU A;  2ML6 A;  1FGM A;  3HX8 A;  5JBS A;  2ML5 A;  5KP3 A;  2XSH B;  3OX9 A;  4GB5 A;  1VQ8 3;  2MC8 A;  1F8N A;  1IV9 A;  3LTC A;  4K61 A;  2Z7A A;  3KII A;  4U13 A;  2R4I A;  2B24 B;  2JDI H;  1IT8 A;  5EEO A;  3BNB A;  3PS8 A;  2B1X B;  2BMR B;  1DVD A;  5CK6 A;  1IVW A;  1OCV A;  3V99 A;  2CK3 H;  1CYU A;  1RRH A;  5AII A;  3X3X A;  3CCR 3;  1W7C A;  3K5T A;  3KN4 A;  1JNQ A;  1YVB I;  4FCZ A;  1GS3 A;  4N6L A;  2E2U A;  1JB4 A;  3CCM 3;  3EE1 A;  4R80 A;  3U1W A;  1DMQ A;  2RCD A;  4RZM A;  3UB1 A;  1YHQ 3;  4RBN A;  1KC8 4;  1Q40 A;  3N54 B;  4K90 B;  4R9L A;  5IG5 A;  2E2T A;  4L8P A;  3K7C A;  1QAL A;  2BHM A;  3BB9 A;  4K1U A;  2OTJ 3;  3V92 A;  1JKG A;  2ZDJ A;  1YJW 3;  4OUQ A;  3F7X A;  3JUN A;  1E3V A;  3FG4 A;  3X41 A;  1O7P B;  2W56 A;  3JUO A;  1VQN 3;  1VQ9 3;  2Z77 A;  1GY6 A;  3EF8 A;  3CNX A;  3EBY A;  3MSO A;  3T0U A;  1UUW B;  1A2K A;  1RN7 A;  3X42 A;  1K73 4;  5FW5 A;  3AMO B;  1N8Q A;  3B4P A;  4MMX B;  4FR9 A;  3FLJ A;  5AIG A;  3IJE B;  2YX9 A;  3D9R A;  4HM6 B;  4EV2 A;  3EHC A;  4EBG A;  1W01 A;  3WOD G;  3KSP A;  1TU5 A;  3T8U A;  5LC7 A;  3PZW A;  3M8C A;  1A67 A;  1SQW A;  4TX4 A;  1E3R A;  5AYS C;  4IPB A;  4N6V 0;  5D81 A;  1J2B A;  1IV7 A;  3EBT A;  2QIY A;  3N8B A;  1Q81 4;  2CFK A;  3CPO A;  3UJM A;  1VZZ A;  1VQ6 3;  1ISK A;  3DZL A;  5IG3 A;  3FF2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...