1TUHA

Structure of bal32a from a soil-derived mobile gene cassette
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
131
structure length
131
Chain Sequence
NEAEQNAETVRRGYAAFNSGDMKTLTELFDENASWHTPGRSRIAGDHKGREAIFAQFGRYGGETGGTFKAVLLHVLKSDDGRVIGIHRNTAERGGKRLDVGCCIVFEFKNGRVIDGREHFYDLYAWDEFWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords hypothetical protein EGC068
publication title Integron-associated Mobile Gene Cassettes Code for Folded Proteins: The Structure of Bal32a, a New Member of the Adaptable alpha+beta Barrel Family
pubmed doi rcsb
source organism Uncultured bacterium
total genus 48
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2004-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1tuhA00
3DM8A 5BVBA 2GXFA 1OUNA 4K1VA 1DMMA 3BB9A 4Q53A 4XBYA 4HM1B 3E99A 3FKAA 4R9LA 5CF2A 1DMQA 3FLJA 1Q42A 4K1UA 4R9KA 1SJWA 3F7XA 1TUHA 2PZVA 1OGXA 4XDWA 3MG3A 5IERA 3K7CA 1ULJB 1GS3A 1UUWB 8CHOA 4H3UA 4OUQA 1Q40A 3VGNA 4L8OA 5G2GA 1ASKA 2I9WA 1VZZA 3IPTA 3GZBA 3B4OA 2YFLB 1UUVB 3CPOA 5AI1A 5TGNA 5IEPA 4X2HA 2STDA 5KP1A 2RCDA 5IG4A 4XDVA 3A76A 3F8HA 4KVHA 1JB4A 3B8LA 3MG1A 1OPYA 4HKVB 3EN1B 5CXOA 2HMLB 4ORLA 4STDA 4HM8B 3EJVA 5DREA 1OHSA 3OXAA 3KKGA 3NXJA 1JKGA 2RFRA 3EBTA 3UJMA 1OHOA 1W00A 3G16A 5D82A 3H3HA 3MHEA 1STDA 4HZ9B 3F8XA 3SOAA 3UNLA 2XR8B 3JUPA 3MKIA 4RZMA 5IG5A 1O7NB 3NBRA 3JUOA 1S5AA 2A15A 2BNGA 2HMOB 2QIYA 2Z77A 1GY6A 1NDOB 3HZPA 4HM3B 4OVMA 3MSOA 1Z1SA 5FW5A 1W6YA 2R4IA 3BLZA 3OV4A 1K41A 3LYGA 2B24B 2XRXB 3DUKA 1GYBA 1EA2A 1QMAA 4HM5B 2RGQA 1JN5B 2CHCA 3DXOA 4HJLB 4LGQA 3SEDA 1O7GB 3HX8A 3RGAA 1C7HA 3EF8A 1QJGA 2OWPA 1OF5B 3FF2A 3EHCA 4L7KA 3K0ZA 3KZTA 3MYTA 1U5OA 1ZO2A 1JN5A 1E97A 5HGRA 1CQSA 3NV0B 5AIIA 3JUQA 3RGRA 3B4PA 5EVHA 3NV0A 3F7SA 5KP3A 5CK6A 2GEXA 1W01A 3T8NA 3ECFA 2K54A 3F9SA 2F98A 2GBXB 3OWUA 1ZX2A 5AEWB 3M8CA 2GBWB 2F86B 3JUNA 3GZXB 4X2OA 5BXQA 5IG3A 4LEHA 3F14A 5D83A 3H51A 3WMDA 1JB5A 3CNXA 3OX9A 5JPPA 1O7WB 4U13A 2HMNB 3F40A 4IIAA 1A2KA 3FGYA 2Z7AA 4WYKB 6STDA 4PEJA 1O7MB 2XSHB 1IDPA 1WQLB 1HKXA 2BMQB 2F99A 3DMCA 4I4KA 2CKFB 3D9RA 5STDA 3EQQB 5AIFA 5IG0A 3FF0A 3KE7A 2HMJB 1NWWA 4HM0B 4J8TA 4GB5A 2HMKB 5AIHA 4MJDA 1NU3A 5IF6A 3SOYA 5KP4A 1O7HB 1AR0A 4HM2B 3CU3A 5CLKA 2JQ5A 3EN8A 4J9AA 4XBTA 1BUQA 2BMOB 2XSOB 4R1KA 1DMNA 2B1XB 5AEUB 1EG9B 1TP6A 7STDA 3OWSA 5JPUA 3GWRA 1Q40B 4HM7B 1OF5A 4WP5A 2YFIB 3GZYB 2UX0A 3Q90A 1JB2A 3ROBA 5DRVA 2GEYA 3DZLA 5IEOA 3GZRA 4XM4A 4FCMA 1OGZA 3EC9A 3FZWA 4HVNA 2QGUA 3NM2A 3G8ZA 4CDLA 3NHXA 2IMJA 1O7PB 1ULIB 2INXA 4HM4B 2Z76A 3FSDA 3B7CA 3STDA 3I0YA 3MG2A 5AIGA 3CNMA 3FH1A 3G0KA 3VSYA 1JKGB 5IENA 5D81A 3EX9A 4WWUC 1W02A 3JUMA 4XB5A 1GY5A 3ER7A 3OWYA 3KSPA 1E3VA 4LMIA 2YFJB 1E3RA 1ISKA 3LZAA 4N3VA 4WYKA 4HZBB 2HMMB 3S5CA 4FCJA 3T8UA 2BMRB 1OHPA 3NUVA 3HK4A 3EBYA 5CF1A 4HM6B 1OCVA 1GY7A 2W2CA 4XBXA 1OH0A 3GRDA 4L8PA
chains in the Genus database with same CATH superfamily
3DM8A 2RNTA 1VQ73 3X41A 5BIRA 3BNCA 5BVBA 2GXFA 1OUNA 1TRPA 4K1VA 1DMMA 3BB9A 4Q53A 2Q07A 2OCTA 1LXEA 4XBYA 3V98A 2WGQA 2BT3A 4HM1B 1GOUA 2LQVA 2IUJA 1D6UA 3E99A 1CYVA 2IA7A 3FKAA 3Q2PA 4JF8A 4R9LA 5CF2A 3KIIA 1YJW3 2WOHA 1DMQA 2H0GA 3FLJA 1RKYA 1Q42A 4K1UA 4MMYB 2C4BA 4R9KA 1SJWA 3ZFZA 3J7Yd 1LOWA 2R41A 4H61A 3F7XA 1RGAA 1SIIA 3NQYA 3PYJA 1TUHA 2PZVA 3CMA3 4QWTA 1N9JA 1OGXA 4XDWA 3MG3A 1GMPA 1G96A 3QK9A 2GU3A 4BIRA 2CFDA 3PZWA 5M1AA 2CIUA 2RBIA 2OTL3 1IQXA 2P0MA 3DY5A 1BNRA 5IERA 1YIJ3 3CC73 2P05A 4NHFA 1A2VA 2H0HA 3K7CA 1ULJB 1GS3A 1UUWB 8CHOA 4H3UA 3D5GA 4OUQA 1YVBI 3FG1A 1B2MA 1RGCA 1FW7A 1BGSA 3IJEB 3EE1A 3GSPA 1A90A 3NBBA 2WOFA 2SARA 4N6TA 1WTHA 1Q40A 1W7CA 1RGLA 1TIJA 2W9PA 3CME3 3VGNA 1N5HA 2F5WA 4L8OA 1IVUA 5G2GA 1ASKA 2I9WA 1VZZA 3IPTA 3GZBA 1FZUA 3I553 1MWUA 1BAOA 3B4OA 3HIIA 2YFLB 2ZHXB 1UUVB 3CPOA 3KSED 4MEIA 1FGQA 2L4VA 3KN4A 5AI1A 2J8XB 3KFQC 5TGNA 5IEPA 1FUWA 1F8NA 4TX4A 2OQEA 4X2HA 4EV5A 1T5YA 1N9EA 1I0XA 4G1MB 2STDA 1AVLA 5KP1A 3LT8A 3LT9A 2RCDA 4CJNA 2H0IA 2O9UX 2L1SA 2W0QA 5IG4A 1IV9A 4XDVA 1A2PA 4ILFA 3A76A 1G02A 1FGRA 3N9HA 2W04A 3F8HA 4KVHA 3LOYA 1OACA 1BRHA 4HYZA 1U8CB 2BHMA 2LYXA 1JB4A 1FYSA 1UCIA 3LH4A 3D5IA 1LQMB 3X3XA 1UCKA 3B8LA 1EUIC 1AY7A 2KF5A 3MG1A 1KC84 2OQEC 8RNTA 4AKZA 1BRNL 1I8VA 3O8YA 1OPYA 1ZS7A 3EN1B 2E2TA 4HKVB 4IT7A 5CXOA 5AYSC 3X3YA 1Q7Y4 2HMLB 1MNLA 4ORLA 5LC7A 2AAEA 1TFKA 4STDA 4HM8B 3NM7A 1RDSA 3K63A 1S723 3EJVA 2W56A 5DREA 2OTJ3 1OHSA 1SQWA 4NREA 1T2IA 1JJ22 1BOXA 6GSPA 4EV2A 3CC23 2CFKA 3OXAA 4LZIA 2D1WA 3KKGA 3ZG5A 2CG1A 3NXJA 1VQ53 1BRSA 1JKGA 1YJN3 3BNBA 2RFRA 3EBTA 3PCSA 1BSDA 1VQ83 3UJMA 1IK3A 3NQZA 1OHOA 2MC8A 1TFOA 1UDII 1W00A 2C11A 3BIRA 3SX1A 4LYLB 2F56A 3G16A 5D82A 3UL5A 1VQN3 3H3HA 3NBJA 3MHEA 1STDA 3DGMA 1MGWA 4HZ9B 4R4KA 3F8XA 3SOAA 3UNLA 2Y74A 3WR2A 2W6JH 1EEJA 1NJI4 2XR8B 9RNTA 1BNSA 3JUPA 3MKIA 3WOEB 4DKIA 4GSPA 4N6MA 1LOYA 3IMAB 3VF1A 1N5PA 4RZMA 2WGOA 5IG5A 1NO3A 5EQLA 5JBSA 4BU4A 1B2UA 1JBSA 3I563 3G4S3 3A5EA 4RNZA 1O7NB 5GSPA 4BL3A 3NBRA 1N8R4 3JUOA 2CW9A 3DH2A 1YHQ3 1S5AA 4KFDA 2A15A 1US1A 1RSNA 1I70A 2BNGA 2HMOB 2QIYA 2Z77A 1X1XA 3FG3A 1B2SA 3K9MC 1X1WA 3AHWA 1GY6A 1NDOB 3HZPA 4BTXA 1WNHA 5FGOA 4EW5A 4HM3B 4OVMA 3MSOA 3X42A 1Z1SA 5G1LA 1K734 1VQM3 5FW5A 1M9GA 1W6YA 1AV4A 1YNVX 2R4IA 4N6V0 3BLZA 3D3LA 1I3IA 3OV4A 4N6UA 1JRQA 1TRQA 2KAAA 1K41A 3LYGA 1VQ63 4FMBA 2B24B 1D6YA 2XRXB 5HOHA 1FGOA 4KT3B 1W2ZA 1WMNA 3DUKA 3WDGB 1EQKA 1GYBA 2XH9A 1EA2A 1QVF2 4O3VA 1QMAA 4HM5B 3ZG0A 6RNTA 2RGQA 1JN5B 2CHCA 3HI7A 1RHLA 3DXOA 4HJLB 4IPBA 1W4NA 1O7GB 1MOLA 3HX8A 1HYFA 4LGQA 3RGAA 3SEDA 3X3ZA 1C7HA 3EF8A 1JZDA 1QJGA 4FR9A 2Y73A 2OWPA 1JBTA 1OF5B 3FF2A 5IW9A 1YI23 3EHCA 4L7KA 3K0ZA 1FGMA 3SVAA 4EXRA 2FGTA 3KZTA 4O02B 5I97A 3MYTA 1U5OA 1B2ZA 1AVKA 1ZO2A 1LOVA 1JN5A 2CFGA 5M18A 1E97A 5HGRA 1CQSA 4HOHA 4N6LA 4K90B 3BU4A 1RCKA 3NV0B 3CCR3 2F4YA 3CCJ3 5AIIA 3X40A 3RNTA 1GOYA 5BU4A 3G713 1VQP3 3CCL3 2OOVC 3FG4A 1BRIA 1V74A 3JUQA 1YVSA 1K9M4 1BSEA 1SPUA 3RGRA 1SARA 3B4PA 1DVDA 1T2HA 5EVHA 1RJOA 3QRDA 3NV0A 3F7SA 1DE3A 4NPBA 5KP3A 1K28A 3MPHA 2YX9A 3AHSA 1FUTA 1RMSA 1BNEA 5CK6A 2GEXA 3LMLA 2AADA 3BNEA 5RNTA 1WMOA 1W01A 1RGFA 3ECFA 3T8NA 1BANA 2K54A 1EKMA 2F98A 3F9SA 2GBXB 3OWUA 4EBGA 1ZX2A 3ALAA 2HOHA 1MGRA 4I5QA 2XEPA 5AEWB 3WA3A 3M8CA 3UL6A 3BNDA 2M7OA 2GBWB 1V58A 1Q9EA 2F86B 3WOFB 1HZ1A 1WMPA 1CH0A 2IYJA 1IYYA 3JUNA 3RDEA 3GZXB 1B3SA 2FXTA 1IQ8A 3HOHA 4J5GA 1PYLA 2ML5A 4X2OA 1TJDA 5BXQA 2ZDJA 1KQS2 5IG3A 1T3BA 1NNVA 2SBLA 1QALA 3F14A 3JVCA 4LEHA 4OK0A 1I3FA 1I2GA 5D83A 3H51A 1Q814 1BRKA 3LTCA 5G1KA 1Q824 1I0VA 1JNQA 3WMDA 1JB5A 3CNXA 3CCV3 1VQ43 3D79A 4MMXB 1Q864 1RCLA 2PNCA 3EB8A 3OX9A 5JPPA 1W6CA 3FCSB 3URPA 3T0UA 3CCE3 1O7WB 4U13A 1VQQA 3V99A 2HMNB 1C54A 3F40A 1VQL3 4IIAA 3UB1A 1A2KA 1CYUA 3AGNA 1GOVA 7GSPA 2BO9B 1RGEA 4BL2A 3FGYA 5M19A 2Z7AA 4WYKB 6STDA 2V1LA 4PEJA 4EC6A 1ZGXA 4WFOA 1DETA 1O7MB 3G6E3 2XSHB 2XGLA 1KD14 1I2FA 1UGHI 1RGHA 3SLUA 1IDPA 2QA43 1IT8A 1WQLB 3V92A 1HKXA 2BMQB 1FA3A 1UCJA 2F99A 2ML6A 3DMCA 2P0XA 1YGEA 3SXXA 1NB5I 4I4KA 4FCZA 2CKFB 3D9RA 1LNIA 2C10A 2WO0A 4BTYA 1W5ZA 2MF7A 2CFWA 3DGOA 2QEX3 5STDA 2CFLA 3EQQB 3WODG 3HIGA 2XGNA 2K0MA 2CWVA 5AIFA 3D4AA 1BNGA 1VQ93 3LTDA 2KCDA 5IG0A 2K3DA 1X1YA 4JRFA 1RNBA 3PXMA 3FF0A 3KE7A 1DYUA 1KSIA 3CCU3 1QAFA 3Q3FA 1CEWI 2HMJB 1NWWA 4HM0B 1BNJA 2GU1A 4J8TA 4O2HA 1RRHA 4GB5A 5AYRB 1UCLA 2HMKB 5AIHA 4MJDA 1A67A 1IVVA 1NU3A 5IF6A 1BSCA 3SOYA 1B21A 1IVWA 5KP4A 1O7HB 1AR0A 2KRTA 1JBRA 1LQGC 4HM2B 3CU3A 2Z6BA 3GAXA 1PU4A 5CLKA 2JQ5A 3EN8A 4J9AA 4N6NB 1FUSA 4XBTA 1BUQA 2XF3A 4HBRA 4AEQA 2XFTA 4CCVA 2BMOB 2XSOB 4R1KA 1DMNA 2OOVA 2B1XB 5AEUB 3N54B 1UI7A 1SIHA 2KF4A 4WHAA 1EG9B 3U97A 4FMCA 1UI8A 3WHOA 1TP6A 1B2XA 1LNHA 2E2UA 4R80A 7STDA 4GHOA 3OWSA 4KFEA 4MMZB 2F5MA 1BSBA 5EEOA 2IY2A 1YIT3 5JPUA 1BRJA 3GWRA 1B27A 4AKYA 1NB3I 3NX0A 1Q40B 4HM7B 1V57A 3LXUX 1GSPA 5LC6A 1OF5A 3CD63 1ROAA 4WP5A 2YFIB 3GZYB 1BSAA 3DGLA 2UX0A 3LTBA 1QVG2 3Q90A 1JB2A 1N8QA 2JDIH 3ROBA 2P09A 1X1UA 3LTAA 5DRVA 2GEYA 4KZ1A 3DZLA 4J5KA 4LSOA 4BTWA 1J2BA 5IEOA 1MWRA 2CX0A 3GZRA 4XM4A 3TDGA 3U1WA 1LOXA 2KF6A 1ROVA 1JZOA 4FCMA 1GD4A 4N6OB 1OGZA 1RNTA 3AMOB 3EC9A 3FZWA 1IV7A 4HVNA 3CXC2 3CCS3 2QGUA 3NM2A 2UGIA 3G8ZA 3L0RA 5ELJA 2CWUA 4CDLA 2CWTA 2IMJA 3NHXA 1O7PB 4K61A 4FMDA 1VQK3 1GD3A 3DGYA 1ULIB 2IUKA 2INXA 3OW22 2XFSA 1UW1A 4HM4B 2CG0A 2Z76A 3AGOA 3CCQ3 1STFI 2CK3H 4CPKA 1IVXA 3AMOA 1RN7A 3FSDA 3B7CA 2D42A 1R4YA 2ZA4A 2UUGC 1AQZA 1IT7A 3STDA 3PS8A 3CPW2 2P38A 7RNTA 3I0YA 2W56B 1PY3A 1W6GA 3MG2A 5ELUA 4HAAA 5AIGA 4FMAA 5A0OB 1Y4KA 1IU7A 1HU9A 1BUJA 3WA2X 3CNMA 3FH1A 3DGNA 3G0KA 1MWTA 1BVIA 1TU5A 1QAKA 3VSYA 1RN1A 1JKGB 5IENA 3PGBA 4O8SA 5D81A 2O3OA 2CX1A 2KXGA 1LVNA 3EX9A 1W02A 3N8BA 4WWUC 1UUGB 4KFFA 3JUMA 1B20A 1M1K4 4XB5A 3CC43 1GY5A 1G0TA 1KWIA 1YJ93 3ER7A 1K8A4 3OWYA 1W2B2 3PCRA 1BU4A 2W9QA 3KSPA 1UGIA 4RBNA 2GSPA 1LRAA 4RNYA 1E3VA 1RTUA 2W03A 1MWSA 1RN4A 2KF3A 1PFPA 3S28A 3K5TA 1DVCA 1JV2B 2E2VA 3KCHA 4LMIA 1VQO3 3CCM3 1BNIA 2YFJB 4EYCA 1E3RA 1ISKA 1TTOA 3LZAA 4N3VA 2CH9A 4WYKA 3S67A 1IQYA 4HZBB 2FNQA 1FGTA 2RSXA 2HMMB 3S5CA 2CC3A 2ZL8A 1BNFA 1RLSA 4FCJA 3S27A 1YGWA 1Q7HA 2BU4A 1L5GB 3T8UA 2BMRB 1OHPA 3NUVA 3HK4A 3Q1CA 4RNTA 1RGGA 3EBYA 1I2EA 1GMQA 5CF1A 1BRGA 4GL6A 1RRLA 4HM6B 1OCVA 4ZM8A 1GY7A 1RGKA 3S29A 2BIRA 1GMRA 2W2CA 3SYUA 4XBXA 1M904 1D6ZA 3MWZA 1BIRA 1OH0A 3GRDA 1M1XB 1R4CA 4L8PA
chains in the Genus database with same CATH topology
3DM8A 1VQ73 3X41A 3BNCA 5BVBA 2GXFA 1OUNA 4K1VA 1DMMA 3BB9A 4Q53A 2Q07A 2OCTA 1LXEA 4XBYA 3V98A 2WGQA 2BT3A 4HM1B 2LQVA 2IUJA 1D6UA 3E99A 1CYVA 2IA7A 3FKAA 3Q2PA 4JF8A 4R9LA 5CF2A 3KIIA 1YJW3 2WOHA 1DMQA 3FLJA 1RKYA 1Q42A 4K1UA 4MMYB 4R9KA 1SJWA 3J7Yd 4H61A 3F7XA 1SIIA 3NQYA 3PYJA 1TUHA 2PZVA 3CMA3 4QWTA 1N9JA 1OGXA 4XDWA 3MG3A 1G96A 3QK9A 2GU3A 2CFDA 3PZWA 2CIUA 2OTL3 1IQXA 2P0MA 3DY5A 5IERA 1YIJ3 3CC73 2P05A 4NHFA 1A2VA 3K7CA 1ULJB 1GS3A 1UUWB 8CHOA 4H3UA 4OUQA 1YVBI 3FG1A 3IJEB 3EE1A 1A90A 3NBBA 2WOFA 4N6TA 1WTHA 1Q40A 1W7CA 1TIJA 2W9PA 3CME3 3VGNA 1N5HA 4L8OA 1IVUA 5G2GA 1ASKA 2I9WA 1VZZA 3IPTA 3GZBA 3I553 3B4OA 3HIIA 2YFLB 3KSED 1UUVB 3CPOA 4MEIA 1FGQA 2L4VA 3KN4A 5AI1A 5TGNA 3KFQC 5IEPA 1FUWA 1F8NA 4TX4A 2OQEA 4X2HA 4EV5A 1T5YA 1N9EA 4G1MB 2STDA 1AVLA 5KP1A 3LT8A 3LT9A 2RCDA 2O9UX 5IG4A 2W0QA 1IV9A 4XDVA 3A76A 1FGRA 3N9HA 2W04A 3F8HA 4KVHA 3LOYA 1OACA 4HYZA 1U8CB 2BHMA 2LYXA 1JB4A 3LH4A 3X3XA 3B8LA 3MG1A 1KC84 2OQEC 4AKZA 3O8YA 1OPYA 4HKVB 3EN1B 2E2TA 4IT7A 5CXOA 5AYSC 3X3YA 1Q7Y4 2HMLB 1MNLA 4ORLA 5LC7A 1TFKA 4STDA 4HM8B 3NM7A 3K63A 1S723 3EJVA 2W56A 5DREA 2OTJ3 1OHSA 1SQWA 4NREA 1JJ22 4EV2A 3CC23 2CFKA 3OXAA 4LZIA 2D1WA 3KKGA 2CG1A 3NXJA 1VQ53 1JKGA 1YJN3 3BNBA 2RFRA 3EBTA 3PCSA 1VQ83 3UJMA 1IK3A 3NQZA 1OHOA 2MC8A 1TFOA 1W00A 2C11A 3SX1A 3G16A 5D82A 3UL5A 1VQN3 3H3HA 3NBJA 3MHEA 1STDA 3DGMA 4HZ9B 4R4KA 3F8XA 3SOAA 3UNLA 2Y74A 2W6JH 1NJI4 2XR8B 3JUPA 3MKIA 3WOEB 4N6MA 3IMAB 3VF1A 1N5PA 4RZMA 2WGOA 5IG5A 1NO3A 5EQLA 5JBSA 3I563 3G4S3 4RNZA 1O7NB 1N8R4 3NBRA 3JUOA 2CW9A 1YHQ3 1S5AA 4KFDA 2A15A 1US1A 2BNGA 2HMOB 2QIYA 2Z77A 3FG3A 3K9MC 1GY6A 1NDOB 3HZPA 4BTXA 1WNHA 5FGOA 4HM3B 4OVMA 3MSOA 3X42A 1Z1SA 1K734 1VQM3 5FW5A 1M9GA 1W6YA 1AV4A 2R4IA 4N6V0 3BLZA 3D3LA 3OV4A 4N6UA 1JRQA 1VQ63 1K41A 3LYGA 4FMBA 2B24B 1D6YA 2XRXB 1FGOA 1W2ZA 1WMNA 3DUKA 3WDGB 1EQKA 1GYBA 2XH9A 1EA2A 1QVF2 4O3VA 1QMAA 4HM5B 2RGQA 1JN5B 2CHCA 3HI7A 3DXOA 4HJLB 4IPBA 1W4NA 1O7GB 1MOLA 3HX8A 4LGQA 3RGAA 3SEDA 3X3ZA 1C7HA 3EF8A 1QJGA 4FR9A 2Y73A 2OWPA 1OF5B 3FF2A 5IW9A 1YI23 3EHCA 4L7KA 3K0ZA 1FGMA 3SVAA 4EXRA 2FGTA 3KZTA 4O02B 5I97A 3MYTA 1U5OA 1AVKA 1ZO2A 1JN5A 2CFGA 1E97A 5HGRA 1CQSA 4N6LA 4K90B 3NV0B 3CCR3 3CCJ3 5AIIA 3X40A 3G713 1VQP3 3CCL3 2OOVC 3FG4A 1V74A 3JUQA 1K9M4 1SPUA 3RGRA 3B4PA 1DVDA 5EVHA 1RJOA 3QRDA 3NV0A 3F7SA 5KP3A 1K28A 3MPHA 2YX9A 5CK6A 2GEXA 3LMLA 3BNEA 1WMOA 1W01A 3T8NA 3ECFA 2K54A 1EKMA 2F98A 3F9SA 2GBXB 3OWUA 4EBGA 1ZX2A 3ALAA 2XEPA 5AEWB 3WA3A 3M8CA 3UL6A 3BNDA 2M7OA 2GBWB 2F86B 3WOFB 1WMPA 3JUNA 3RDEA 3GZXB 2FXTA 1IQ8A 2ML5A 4X2OA 5BXQA 2ZDJA 1KQS2 5IG3A 2SBLA 1QALA 3F14A 3JVCA 4LEHA 4OK0A 1Q814 5D83A 3H51A 3LTCA 1Q824 1JNQA 3WMDA 1JB5A 3CNXA 3CCV3 1VQ43 4MMXB 1Q864 3OX9A 2PNCA 3EB8A 5JPPA 1W6CA 3FCSB 3T0UA 3CCE3 1O7WB 4U13A 3V99A 2HMNB 3F40A 1VQL3 4IIAA 3UB1A 1A2KA 1CYUA 2BO9B 3FGYA 2Z7AA 4WYKB 6STDA 2V1LA 4PEJA 4EC6A 4WFOA 1O7MB 3G6E3 2XSHB 2XGLA 1KD14 2QA43 3SLUA 1IDPA 1FA3A 1IT8A 1WQLB 3V92A 1HKXA 2BMQB 2F99A 2ML6A 3DMCA 2P0XA 1YGEA 3SXXA 1NB5I 4I4KA 4FCZA 2CKFB 3D9RA 2C10A 2WO0A 4BTYA 1W5ZA 2MF7A 2CFWA 3DGOA 2QEX3 5STDA 2CFLA 3EQQB 3WODG 3HIGA 2XGNA 2K0MA 2CWVA 5AIFA 1VQ93 3LTDA 2KCDA 5IG0A 4JRFA 3PXMA 3FF0A 3KE7A 1DYUA 1KSIA 3CCU3 1QAFA 1CEWI 2HMJB 1NWWA 4HM0B 2GU1A 4J8TA 4O2HA 1RRHA 4GB5A 5AYRB 2HMKB 5AIHA 4MJDA 1A67A 1IVVA 1NU3A 5IF6A 3SOYA 5KP4A 1IVWA 1O7HB 1AR0A 2KRTA 4HM2B 3CU3A 2Z6BA 3GAXA 1PU4A 5CLKA 2JQ5A 3EN8A 4J9AA 4N6NB 4XBTA 1BUQA 2XF3A 4HBRA 4AEQA 2XFTA 4CCVA 2BMOB 2XSOB 4R1KA 1DMNA 2OOVA 2B1XB 5AEUB 3N54B 1UI7A 1SIHA 4WHAA 3U97A 1EG9B 4FMCA 1UI8A 1TP6A 1LNHA 2E2UA 4R80A 7STDA 3OWSA 4KFEA 4MMZB 1YIT3 5EEOA 5JPUA 3GWRA 4AKYA 1NB3I 3NX0A 1Q40B 4HM7B 3LXUX 5LC6A 1OF5A 3CD63 1ROAA 4WP5A 2YFIB 3GZYB 3DGLA 2UX0A 3LTBA 1QVG2 3Q90A 1JB2A 1N8QA 2JDIH 3ROBA 2P09A 3LTAA 5DRVA 2GEYA 4KZ1A 3DZLA 4LSOA 4BTWA 1J2BA 5IEOA 3U1WA 3GZRA 4XM4A 3TDGA 1LOXA 1ROVA 4FCMA 1GD4A 4N6OB 1OGZA 3EC9A 3AMOB 3FZWA 4HVNA 1IV7A 3CXC2 3CCS3 2QGUA 3NM2A 3G8ZA 3L0RA 5ELJA 2CWUA 4CDLA 2CWTA 2IMJA 3NHXA 1O7PB 4K61A 4FMDA 1VQK3 1GD3A 1ULIB 2IUKA 2INXA 3OW22 2XFSA 1UW1A 4HM4B 2CG0A 2Z76A 3CCQ3 1STFI 2CK3H 1IVXA 3AMOA 1RN7A 3FSDA 3B7CA 2D42A 1IT7A 3STDA 3PS8A 3CPW2 2P38A 3I0YA 2W56B 1W6GA 3MG2A 5ELUA 5AIGA 5A0OB 4FMAA 1Y4KA 1IU7A 1HU9A 3WA2X 3CNMA 3FH1A 3DGNA 3G0KA 1TU5A 1QAKA 3VSYA 1JKGB 5IENA 3PGBA 4O8SA 5D81A 2O3OA 2KXGA 3EX9A 1LVNA 4WWUC 1W02A 3N8BA 4KFFA 3JUMA 1M1K4 3CC43 4XB5A 1GY5A 1KWIA 1YJ93 3ER7A 1K8A4 3OWYA 1W2B2 3PCRA 2W9QA 3KSPA 4RBNA 4RNYA 1E3VA 2W03A 1PFPA 3S28A 3K5TA 1DVCA 1JV2B 2E2VA 4LMIA 1VQO3 3CCM3 2YFJB 4EYCA 1E3RA 1ISKA 3LZAA 4N3VA 2CH9A 4WYKA 3S67A 1IQYA 4HZBB 2FNQA 1FGTA 2RSXA 2HMMB 3S5CA 2CC3A 2ZL8A 4FCJA 3S27A 1L5GB 3T8UA 2BMRB 1OHPA 3NUVA 3HK4A 3Q1CA 3EBYA 5CF1A 4GL6A 4HM6B 1RRLA 1OCVA 4ZM8A 1GY7A 3S29A 2W2CA 4XBXA 1M904 1D6ZA 3MWZA 1OH0A 3GRDA 1M1XB 1R4CA 4L8PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DM8 A;  5BVB A;  2GXF A;  1OUN A;  4K1V A;  1DMM A;  3BB9 A;  4Q53 A;  4XBY A;  4HM1 B;  3E99 A;  3FKA A;  4R9L A;  5CF2 A;  1DMQ A;  3FLJ A;  1Q42 A;  4K1U A;  4R9K A;  1SJW A;  3F7X A;  1TUH A;  2PZV A;  1OGX A;  4XDW A;  3MG3 A;  5IER A;  3K7C A;  1ULJ B;  1GS3 A;  1UUW B;  8CHO A;  4H3U A;  4OUQ A;  1Q40 A;  3VGN A;  4L8O A;  5G2G A;  1ASK A;  2I9W A;  1VZZ A;  3IPT A;  3GZB A;  3B4O A;  2YFL B;  1UUV B;  3CPO A;  5AI1 A;  5TGN A;  5IEP A;  4X2H A;  2STD A;  5KP1 A;  2RCD A;  5IG4 A;  4XDV A;  3A76 A;  3F8H A;  4KVH A;  1JB4 A;  3B8L A;  3MG1 A;  1OPY A;  4HKV B;  3EN1 B;  5CXO A;  2HML B;  4ORL A;  4STD A;  4HM8 B;  3EJV A;  5DRE A;  1OHS A;  3OXA A;  3KKG A;  3NXJ A;  1JKG A;  2RFR A;  3EBT A;  3UJM A;  1OHO A;  1W00 A;  3G16 A;  5D82 A;  3H3H A;  3MHE A;  1STD A;  4HZ9 B;  3F8X A;  3SOA A;  3UNL A;  2XR8 B;  3JUP A;  3MKI A;  4RZM A;  5IG5 A;  1O7N B;  3NBR A;  3JUO A;  1S5A A;  2A15 A;  2BNG A;  2HMO B;  2QIY A;  2Z77 A;  1GY6 A;  1NDO B;  3HZP A;  4HM3 B;  4OVM A;  3MSO A;  1Z1S A;  5FW5 A;  1W6Y A;  2R4I A;  3BLZ A;  3OV4 A;  1K41 A;  3LYG A;  2B24 B;  2XRX B;  3DUK A;  1GYB A;  1EA2 A;  1QMA A;  4HM5 B;  2RGQ A;  1JN5 B;  2CHC A;  3DXO A;  4HJL B;  4LGQ A;  3SED A;  1O7G B;  3HX8 A;  3RGA A;  1C7H A;  3EF8 A;  1QJG A;  2OWP A;  1OF5 B;  3FF2 A;  3EHC A;  4L7K A;  3K0Z A;  3KZT A;  3MYT A;  1U5O A;  1ZO2 A;  1JN5 A;  1E97 A;  5HGR A;  1CQS A;  3NV0 B;  5AII A;  3JUQ A;  3RGR A;  3B4P A;  5EVH A;  3NV0 A;  3F7S A;  5KP3 A;  5CK6 A;  2GEX A;  1W01 A;  3T8N A;  3ECF A;  2K54 A;  3F9S A;  2F98 A;  2GBX B;  3OWU A;  1ZX2 A;  5AEW B;  3M8C A;  2GBW B;  2F86 B;  3JUN A;  3GZX B;  4X2O A;  5BXQ A;  5IG3 A;  4LEH A;  3F14 A;  5D83 A;  3H51 A;  3WMD A;  1JB5 A;  3CNX A;  3OX9 A;  5JPP A;  1O7W B;  4U13 A;  2HMN B;  3F40 A;  4IIA A;  1A2K A;  3FGY A;  2Z7A A;  4WYK B;  6STD A;  4PEJ A;  1O7M B;  2XSH B;  1IDP A;  1WQL B;  1HKX A;  2BMQ B;  2F99 A;  3DMC A;  4I4K A;  2CKF B;  3D9R A;  5STD A;  3EQQ B;  5AIF A;  5IG0 A;  3FF0 A;  3KE7 A;  2HMJ B;  1NWW A;  4HM0 B;  4J8T A;  4GB5 A;  2HMK B;  5AIH A;  4MJD A;  1NU3 A;  5IF6 A;  3SOY A;  5KP4 A;  1O7H B;  1AR0 A;  4HM2 B;  3CU3 A;  5CLK A;  2JQ5 A;  3EN8 A;  4J9A A;  4XBT A;  1BUQ A;  2BMO B;  2XSO B;  4R1K A;  1DMN A;  2B1X B;  5AEU B;  1EG9 B;  1TP6 A;  7STD A;  3OWS A;  5JPU A;  3GWR A;  1Q40 B;  4HM7 B;  1OF5 A;  4WP5 A;  2YFI B;  3GZY B;  2UX0 A;  3Q90 A;  1JB2 A;  3ROB A;  5DRV A;  2GEY A;  3DZL A;  5IEO A;  3GZR A;  4XM4 A;  4FCM A;  1OGZ A;  3EC9 A;  3FZW A;  4HVN A;  2QGU A;  3NM2 A;  3G8Z A;  4CDL A;  3NHX A;  2IMJ A;  1O7P B;  1ULI B;  2INX A;  4HM4 B;  2Z76 A;  3FSD A;  3B7C A;  3STD A;  3I0Y A;  3MG2 A;  5AIG A;  3CNM A;  3FH1 A;  3G0K A;  3VSY A;  1JKG B;  5IEN A;  5D81 A;  3EX9 A;  4WWU C;  1W02 A;  3JUM A;  4XB5 A;  1GY5 A;  3ER7 A;  3OWY A;  3KSP A;  1E3V A;  4LMI A;  2YFJ B;  1E3R A;  1ISK A;  3LZA A;  4N3V A;  4WYK A;  4HZB B;  2HMM B;  3S5C A;  4FCJ A;  3T8U A;  2BMR B;  1OHP A;  3NUV A;  3HK4 A;  3EBY A;  5CF1 A;  4HM6 B;  1OCV A;  1GY7 A;  2W2C A;  4XBX A;  1OH0 A;  3GRD A;  4L8P A; 
#chains in the Genus database with same CATH topology
 3DM8 A;  2RNT A;  1VQ7 3;  3X41 A;  5BIR A;  3BNC A;  5BVB A;  2GXF A;  1OUN A;  1TRP A;  4K1V A;  1DMM A;  3BB9 A;  4Q53 A;  2Q07 A;  2OCT A;  1LXE A;  4XBY A;  3V98 A;  2WGQ A;  2BT3 A;  4HM1 B;  1GOU A;  2LQV A;  2IUJ A;  1D6U A;  3E99 A;  1CYV A;  2IA7 A;  3FKA A;  3Q2P A;  4JF8 A;  4R9L A;  5CF2 A;  3KII A;  1YJW 3;  2WOH A;  1DMQ A;  2H0G A;  3FLJ A;  1RKY A;  1Q42 A;  4K1U A;  4MMY B;  2C4B A;  4R9K A;  1SJW A;  3ZFZ A;  3J7Y d;  1LOW A;  2R41 A;  4H61 A;  3F7X A;  1RGA A;  1SII A;  3NQY A;  3PYJ A;  1TUH A;  2PZV A;  3CMA 3;  4QWT A;  1N9J A;  1OGX A;  4XDW A;  3MG3 A;  1GMP A;  1G96 A;  3QK9 A;  2GU3 A;  4BIR A;  2CFD A;  3PZW A;  5M1A A;  2CIU A;  2RBI A;  2OTL 3;  1IQX A;  2P0M A;  3DY5 A;  1BNR A;  5IER A;  1YIJ 3;  3CC7 3;  2P05 A;  4NHF A;  1A2V A;  2H0H A;  3K7C A;  1ULJ B;  1GS3 A;  1UUW B;  8CHO A;  4H3U A;  3D5G A;  4OUQ A;  1YVB I;  3FG1 A;  1B2M A;  1RGC A;  1FW7 A;  1BGS A;  3IJE B;  3EE1 A;  3GSP A;  1A90 A;  3NBB A;  2WOF A;  2SAR A;  4N6T A;  1WTH A;  1Q40 A;  1W7C A;  1RGL A;  1TIJ A;  2W9P A;  3CME 3;  3VGN A;  1N5H A;  2F5W A;  4L8O A;  1IVU A;  5G2G A;  1ASK A;  2I9W A;  1VZZ A;  3IPT A;  3GZB A;  1FZU A;  3I55 3;  1MWU A;  1BAO A;  3B4O A;  3HII A;  2YFL B;  2ZHX B;  1UUV B;  3CPO A;  3KSE D;  4MEI A;  1FGQ A;  2L4V A;  3KN4 A;  5AI1 A;  2J8X B;  3KFQ C;  5TGN A;  5IEP A;  1FUW A;  1F8N A;  4TX4 A;  2OQE A;  4X2H A;  4EV5 A;  1T5Y A;  1N9E A;  1I0X A;  4G1M B;  2STD A;  1AVL A;  5KP1 A;  3LT8 A;  3LT9 A;  2RCD A;  4CJN A;  2H0I A;  2O9U X;  2L1S A;  2W0Q A;  5IG4 A;  1IV9 A;  4XDV A;  1A2P A;  4ILF A;  3A76 A;  1G02 A;  1FGR A;  3N9H A;  2W04 A;  3F8H A;  4KVH A;  3LOY A;  1OAC A;  1BRH A;  4HYZ A;  1U8C B;  2BHM A;  2LYX A;  1JB4 A;  1FYS A;  1UCI A;  3LH4 A;  3D5I A;  1LQM B;  3X3X A;  1UCK A;  3B8L A;  1EUI C;  1AY7 A;  2KF5 A;  3MG1 A;  1KC8 4;  2OQE C;  8RNT A;  4AKZ A;  1BRN L;  1I8V A;  3O8Y A;  1OPY A;  1ZS7 A;  3EN1 B;  2E2T A;  4HKV B;  4IT7 A;  5CXO A;  5AYS C;  3X3Y A;  1Q7Y 4;  2HML B;  1MNL A;  4ORL A;  5LC7 A;  2AAE A;  1TFK A;  4STD A;  4HM8 B;  3NM7 A;  1RDS A;  3K63 A;  1S72 3;  3EJV A;  2W56 A;  5DRE A;  2OTJ 3;  1OHS A;  1SQW A;  4NRE A;  1T2I A;  1JJ2 2;  1BOX A;  6GSP A;  4EV2 A;  3CC2 3;  2CFK A;  3OXA A;  4LZI A;  2D1W A;  3KKG A;  3ZG5 A;  2CG1 A;  3NXJ A;  1VQ5 3;  1BRS A;  1JKG A;  1YJN 3;  3BNB A;  2RFR A;  3EBT A;  3PCS A;  1BSD A;  1VQ8 3;  3UJM A;  1IK3 A;  3NQZ A;  1OHO A;  2MC8 A;  1TFO A;  1UDI I;  1W00 A;  2C11 A;  3BIR A;  3SX1 A;  4LYL B;  2F56 A;  3G16 A;  5D82 A;  3UL5 A;  1VQN 3;  3H3H A;  3NBJ A;  3MHE A;  1STD A;  3DGM A;  1MGW A;  4HZ9 B;  4R4K A;  3F8X A;  3SOA A;  3UNL A;  2Y74 A;  3WR2 A;  2W6J H;  1EEJ A;  1NJI 4;  2XR8 B;  9RNT A;  1BNS A;  3JUP A;  3MKI A;  3WOE B;  4DKI A;  4GSP A;  4N6M A;  1LOY A;  3IMA B;  3VF1 A;  1N5P A;  4RZM A;  2WGO A;  5IG5 A;  1NO3 A;  5EQL A;  5JBS A;  4BU4 A;  1B2U A;  1JBS A;  3I56 3;  3G4S 3;  3A5E A;  4RNZ A;  1O7N B;  5GSP A;  4BL3 A;  3NBR A;  1N8R 4;  3JUO A;  2CW9 A;  3DH2 A;  1YHQ 3;  1S5A A;  4KFD A;  2A15 A;  1US1 A;  1RSN A;  1I70 A;  2BNG A;  2HMO B;  2QIY A;  2Z77 A;  1X1X A;  3FG3 A;  1B2S A;  3K9M C;  1X1W A;  3AHW A;  1GY6 A;  1NDO B;  3HZP A;  4BTX A;  1WNH A;  5FGO A;  4EW5 A;  4HM3 B;  4OVM A;  3MSO A;  3X42 A;  1Z1S A;  5G1L A;  1K73 4;  1VQM 3;  5FW5 A;  1M9G A;  1W6Y A;  1AV4 A;  1YNV X;  2R4I A;  4N6V 0;  3BLZ A;  3D3L A;  1I3I A;  3OV4 A;  4N6U A;  1JRQ A;  1TRQ A;  2KAA A;  1K41 A;  3LYG A;  1VQ6 3;  4FMB A;  2B24 B;  1D6Y A;  2XRX B;  5HOH A;  1FGO A;  4KT3 B;  1W2Z A;  1WMN A;  3DUK A;  3WDG B;  1EQK A;  1GYB A;  2XH9 A;  1EA2 A;  1QVF 2;  4O3V A;  1QMA A;  4HM5 B;  3ZG0 A;  6RNT A;  2RGQ A;  1JN5 B;  2CHC A;  3HI7 A;  1RHL A;  3DXO A;  4HJL B;  4IPB A;  1W4N A;  1O7G B;  1MOL A;  3HX8 A;  1HYF A;  4LGQ A;  3RGA A;  3SED A;  3X3Z A;  1C7H A;  3EF8 A;  1JZD A;  1QJG A;  4FR9 A;  2Y73 A;  2OWP A;  1JBT A;  1OF5 B;  3FF2 A;  5IW9 A;  1YI2 3;  3EHC A;  4L7K A;  3K0Z A;  1FGM A;  3SVA A;  4EXR A;  2FGT A;  3KZT A;  4O02 B;  5I97 A;  3MYT A;  1U5O A;  1B2Z A;  1AVK A;  1ZO2 A;  1LOV A;  1JN5 A;  2CFG A;  5M18 A;  1E97 A;  5HGR A;  1CQS A;  4HOH A;  4N6L A;  4K90 B;  3BU4 A;  1RCK A;  3NV0 B;  3CCR 3;  2F4Y A;  3CCJ 3;  5AII A;  3X40 A;  3RNT A;  1GOY A;  5BU4 A;  3G71 3;  1VQP 3;  3CCL 3;  2OOV C;  3FG4 A;  1BRI A;  1V74 A;  3JUQ A;  1YVS A;  1K9M 4;  1BSE A;  1SPU A;  3RGR A;  1SAR A;  3B4P A;  1DVD A;  1T2H A;  5EVH A;  1RJO A;  3QRD A;  3NV0 A;  3F7S A;  1DE3 A;  4NPB A;  5KP3 A;  1K28 A;  3MPH A;  2YX9 A;  3AHS A;  1FUT A;  1RMS A;  1BNE A;  5CK6 A;  2GEX A;  3LML A;  2AAD A;  3BNE A;  5RNT A;  1WMO A;  1W01 A;  1RGF A;  3ECF A;  3T8N A;  1BAN A;  2K54 A;  1EKM A;  2F98 A;  3F9S A;  2GBX B;  3OWU A;  4EBG A;  1ZX2 A;  3ALA A;  2HOH A;  1MGR A;  4I5Q A;  2XEP A;  5AEW B;  3WA3 A;  3M8C A;  3UL6 A;  3BND A;  2M7O A;  2GBW B;  1V58 A;  1Q9E A;  2F86 B;  3WOF B;  1HZ1 A;  1WMP A;  1CH0 A;  2IYJ A;  1IYY A;  3JUN A;  3RDE A;  3GZX B;  1B3S A;  2FXT A;  1IQ8 A;  3HOH A;  4J5G A;  1PYL A;  2ML5 A;  4X2O A;  1TJD A;  5BXQ A;  2ZDJ A;  1KQS 2;  5IG3 A;  1T3B A;  1NNV A;  2SBL A;  1QAL A;  3F14 A;  3JVC A;  4LEH A;  4OK0 A;  1I3F A;  1I2G A;  5D83 A;  3H51 A;  1Q81 4;  1BRK A;  3LTC A;  5G1K A;  1Q82 4;  1I0V A;  1JNQ A;  3WMD A;  1JB5 A;  3CNX A;  3CCV 3;  1VQ4 3;  3D79 A;  4MMX B;  1Q86 4;  1RCL A;  2PNC A;  3EB8 A;  3OX9 A;  5JPP A;  1W6C A;  3FCS B;  3URP A;  3T0U A;  3CCE 3;  1O7W B;  4U13 A;  1VQQ A;  3V99 A;  2HMN B;  1C54 A;  3F40 A;  1VQL 3;  4IIA A;  3UB1 A;  1A2K A;  1CYU A;  3AGN A;  1GOV A;  7GSP A;  2BO9 B;  1RGE A;  4BL2 A;  3FGY A;  5M19 A;  2Z7A A;  4WYK B;  6STD A;  2V1L A;  4PEJ A;  4EC6 A;  1ZGX A;  4WFO A;  1DET A;  1O7M B;  3G6E 3;  2XSH B;  2XGL A;  1KD1 4;  1I2F A;  1UGH I;  1RGH A;  3SLU A;  1IDP A;  2QA4 3;  1IT8 A;  1WQL B;  3V92 A;  1HKX A;  2BMQ B;  1FA3 A;  1UCJ A;  2F99 A;  2ML6 A;  3DMC A;  2P0X A;  1YGE A;  3SXX A;  1NB5 I;  4I4K A;  4FCZ A;  2CKF B;  3D9R A;  1LNI A;  2C10 A;  2WO0 A;  4BTY A;  1W5Z A;  2MF7 A;  2CFW A;  3DGO A;  2QEX 3;  5STD A;  2CFL A;  3EQQ B;  3WOD G;  3HIG A;  2XGN A;  2K0M A;  2CWV A;  5AIF A;  3D4A A;  1BNG A;  1VQ9 3;  3LTD A;  2KCD A;  5IG0 A;  2K3D A;  1X1Y A;  4JRF A;  1RNB A;  3PXM A;  3FF0 A;  3KE7 A;  1DYU A;  1KSI A;  3CCU 3;  1QAF A;  3Q3F A;  1CEW I;  2HMJ B;  1NWW A;  4HM0 B;  1BNJ A;  2GU1 A;  4J8T A;  4O2H A;  1RRH A;  4GB5 A;  5AYR B;  1UCL A;  2HMK B;  5AIH A;  4MJD A;  1A67 A;  1IVV A;  1NU3 A;  5IF6 A;  1BSC A;  3SOY A;  1B21 A;  1IVW A;  5KP4 A;  1O7H B;  1AR0 A;  2KRT A;  1JBR A;  1LQG C;  4HM2 B;  3CU3 A;  2Z6B A;  3GAX A;  1PU4 A;  5CLK A;  2JQ5 A;  3EN8 A;  4J9A A;  4N6N B;  1FUS A;  4XBT A;  1BUQ A;  2XF3 A;  4HBR A;  4AEQ A;  2XFT A;  4CCV A;  2BMO B;  2XSO B;  4R1K A;  1DMN A;  2OOV A;  2B1X B;  5AEU B;  3N54 B;  1UI7 A;  1SIH A;  2KF4 A;  4WHA A;  1EG9 B;  3U97 A;  4FMC A;  1UI8 A;  3WHO A;  1TP6 A;  1B2X A;  1LNH A;  2E2U A;  4R80 A;  7STD A;  4GHO A;  3OWS A;  4KFE A;  4MMZ B;  2F5M A;  1BSB A;  5EEO A;  2IY2 A;  1YIT 3;  5JPU A;  1BRJ A;  3GWR A;  1B27 A;  4AKY A;  1NB3 I;  3NX0 A;  1Q40 B;  4HM7 B;  1V57 A;  3LXU X;  1GSP A;  5LC6 A;  1OF5 A;  3CD6 3;  1ROA A;  4WP5 A;  2YFI B;  3GZY B;  1BSA A;  3DGL A;  2UX0 A;  3LTB A;  1QVG 2;  3Q90 A;  1JB2 A;  1N8Q A;  2JDI H;  3ROB A;  2P09 A;  1X1U A;  3LTA A;  5DRV A;  2GEY A;  4KZ1 A;  3DZL A;  4J5K A;  4LSO A;  4BTW A;  1J2B A;  5IEO A;  1MWR A;  2CX0 A;  3GZR A;  4XM4 A;  3TDG A;  3U1W A;  1LOX A;  2KF6 A;  1ROV A;  1JZO A;  4FCM A;  1GD4 A;  4N6O B;  1OGZ A;  1RNT A;  3AMO B;  3EC9 A;  3FZW A;  1IV7 A;  4HVN A;  3CXC 2;  3CCS 3;  2QGU A;  3NM2 A;  2UGI A;  3G8Z A;  3L0R A;  5ELJ A;  2CWU A;  4CDL A;  2CWT A;  2IMJ A;  3NHX A;  1O7P B;  4K61 A;  4FMD A;  1VQK 3;  1GD3 A;  3DGY A;  1ULI B;  2IUK A;  2INX A;  3OW2 2;  2XFS A;  1UW1 A;  4HM4 B;  2CG0 A;  2Z76 A;  3AGO A;  3CCQ 3;  1STF I;  2CK3 H;  4CPK A;  1IVX A;  3AMO A;  1RN7 A;  3FSD A;  3B7C A;  2D42 A;  1R4Y A;  2ZA4 A;  2UUG C;  1AQZ A;  1IT7 A;  3STD A;  3PS8 A;  3CPW 2;  2P38 A;  7RNT A;  3I0Y A;  2W56 B;  1PY3 A;  1W6G A;  3MG2 A;  5ELU A;  4HAA A;  5AIG A;  4FMA A;  5A0O B;  1Y4K A;  1IU7 A;  1HU9 A;  1BUJ A;  3WA2 X;  3CNM A;  3FH1 A;  3DGN A;  3G0K A;  1MWT A;  1BVI A;  1TU5 A;  1QAK A;  3VSY A;  1RN1 A;  1JKG B;  5IEN A;  3PGB A;  4O8S A;  5D81 A;  2O3O A;  2CX1 A;  2KXG A;  1LVN A;  3EX9 A;  1W02 A;  3N8B A;  4WWU C;  1UUG B;  4KFF A;  3JUM A;  1B20 A;  1M1K 4;  4XB5 A;  3CC4 3;  1GY5 A;  1G0T A;  1KWI A;  1YJ9 3;  3ER7 A;  1K8A 4;  3OWY A;  1W2B 2;  3PCR A;  1BU4 A;  2W9Q A;  3KSP A;  1UGI A;  4RBN A;  2GSP A;  1LRA A;  4RNY A;  1E3V A;  1RTU A;  2W03 A;  1MWS A;  1RN4 A;  2KF3 A;  1PFP A;  3S28 A;  3K5T A;  1DVC A;  1JV2 B;  2E2V A;  3KCH A;  4LMI A;  1VQO 3;  3CCM 3;  1BNI A;  2YFJ B;  4EYC A;  1E3R A;  1ISK A;  1TTO A;  3LZA A;  4N3V A;  2CH9 A;  4WYK A;  3S67 A;  1IQY A;  4HZB B;  2FNQ A;  1FGT A;  2RSX A;  2HMM B;  3S5C A;  2CC3 A;  2ZL8 A;  1BNF A;  1RLS A;  4FCJ A;  3S27 A;  1YGW A;  1Q7H A;  2BU4 A;  1L5G B;  3T8U A;  2BMR B;  1OHP A;  3NUV A;  3HK4 A;  3Q1C A;  4RNT A;  1RGG A;  3EBY A;  1I2E A;  1GMQ A;  5CF1 A;  1BRG A;  4GL6 A;  1RRL A;  4HM6 B;  1OCV A;  4ZM8 A;  1GY7 A;  1RGK A;  3S29 A;  2BIR A;  1GMR A;  2W2C A;  3SYU A;  4XBX A;  1M90 4;  1D6Z A;  3MWZ A;  1BIR A;  1OH0 A;  3GRD A;  1M1X B;  1R4C A;  4L8P A; 
#chains in the Genus database with same CATH homology
 3DM8 A;  1VQ7 3;  3X41 A;  3BNC A;  5BVB A;  2GXF A;  1OUN A;  4K1V A;  1DMM A;  3BB9 A;  4Q53 A;  2Q07 A;  2OCT A;  1LXE A;  4XBY A;  3V98 A;  2WGQ A;  2BT3 A;  4HM1 B;  2LQV A;  2IUJ A;  1D6U A;  3E99 A;  1CYV A;  2IA7 A;  3FKA A;  3Q2P A;  4JF8 A;  4R9L A;  5CF2 A;  3KII A;  1YJW 3;  2WOH A;  1DMQ A;  3FLJ A;  1RKY A;  1Q42 A;  4K1U A;  4MMY B;  4R9K A;  1SJW A;  3J7Y d;  4H61 A;  3F7X A;  1SII A;  3NQY A;  3PYJ A;  1TUH A;  2PZV A;  3CMA 3;  4QWT A;  1N9J A;  1OGX A;  4XDW A;  3MG3 A;  1G96 A;  3QK9 A;  2GU3 A;  2CFD A;  3PZW A;  2CIU A;  2OTL 3;  1IQX A;  2P0M A;  3DY5 A;  5IER A;  1YIJ 3;  3CC7 3;  2P05 A;  4NHF A;  1A2V A;  3K7C A;  1ULJ B;  1GS3 A;  1UUW B;  8CHO A;  4H3U A;  4OUQ A;  1YVB I;  3FG1 A;  3IJE B;  3EE1 A;  1A90 A;  3NBB A;  2WOF A;  4N6T A;  1WTH A;  1Q40 A;  1W7C A;  1TIJ A;  2W9P A;  3CME 3;  3VGN A;  1N5H A;  4L8O A;  1IVU A;  5G2G A;  1ASK A;  2I9W A;  1VZZ A;  3IPT A;  3GZB A;  3I55 3;  3B4O A;  3HII A;  2YFL B;  3KSE D;  1UUV B;  3CPO A;  4MEI A;  1FGQ A;  2L4V A;  3KN4 A;  5AI1 A;  5TGN A;  3KFQ C;  5IEP A;  1FUW A;  1F8N A;  4TX4 A;  2OQE A;  4X2H A;  4EV5 A;  1T5Y A;  1N9E A;  4G1M B;  2STD A;  1AVL A;  5KP1 A;  3LT8 A;  3LT9 A;  2RCD A;  2O9U X;  5IG4 A;  2W0Q A;  1IV9 A;  4XDV A;  3A76 A;  1FGR A;  3N9H A;  2W04 A;  3F8H A;  4KVH A;  3LOY A;  1OAC A;  4HYZ A;  1U8C B;  2BHM A;  2LYX A;  1JB4 A;  3LH4 A;  3X3X A;  3B8L A;  3MG1 A;  1KC8 4;  2OQE C;  4AKZ A;  3O8Y A;  1OPY A;  4HKV B;  3EN1 B;  2E2T A;  4IT7 A;  5CXO A;  5AYS C;  3X3Y A;  1Q7Y 4;  2HML B;  1MNL A;  4ORL A;  5LC7 A;  1TFK A;  4STD A;  4HM8 B;  3NM7 A;  3K63 A;  1S72 3;  3EJV A;  2W56 A;  5DRE A;  2OTJ 3;  1OHS A;  1SQW A;  4NRE A;  1JJ2 2;  4EV2 A;  3CC2 3;  2CFK A;  3OXA A;  4LZI A;  2D1W A;  3KKG A;  2CG1 A;  3NXJ A;  1VQ5 3;  1JKG A;  1YJN 3;  3BNB A;  2RFR A;  3EBT A;  3PCS A;  1VQ8 3;  3UJM A;  1IK3 A;  3NQZ A;  1OHO A;  2MC8 A;  1TFO A;  1W00 A;  2C11 A;  3SX1 A;  3G16 A;  5D82 A;  3UL5 A;  1VQN 3;  3H3H A;  3NBJ A;  3MHE A;  1STD A;  3DGM A;  4HZ9 B;  4R4K A;  3F8X A;  3SOA A;  3UNL A;  2Y74 A;  2W6J H;  1NJI 4;  2XR8 B;  3JUP A;  3MKI A;  3WOE B;  4N6M A;  3IMA B;  3VF1 A;  1N5P A;  4RZM A;  2WGO A;  5IG5 A;  1NO3 A;  5EQL A;  5JBS A;  3I56 3;  3G4S 3;  4RNZ A;  1O7N B;  1N8R 4;  3NBR A;  3JUO A;  2CW9 A;  1YHQ 3;  1S5A A;  4KFD A;  2A15 A;  1US1 A;  2BNG A;  2HMO B;  2QIY A;  2Z77 A;  3FG3 A;  3K9M C;  1GY6 A;  1NDO B;  3HZP A;  4BTX A;  1WNH A;  5FGO A;  4HM3 B;  4OVM A;  3MSO A;  3X42 A;  1Z1S A;  1K73 4;  1VQM 3;  5FW5 A;  1M9G A;  1W6Y A;  1AV4 A;  2R4I A;  4N6V 0;  3BLZ A;  3D3L A;  3OV4 A;  4N6U A;  1JRQ A;  1VQ6 3;  1K41 A;  3LYG A;  4FMB A;  2B24 B;  1D6Y A;  2XRX B;  1FGO A;  1W2Z A;  1WMN A;  3DUK A;  3WDG B;  1EQK A;  1GYB A;  2XH9 A;  1EA2 A;  1QVF 2;  4O3V A;  1QMA A;  4HM5 B;  2RGQ A;  1JN5 B;  2CHC A;  3HI7 A;  3DXO A;  4HJL B;  4IPB A;  1W4N A;  1O7G B;  1MOL A;  3HX8 A;  4LGQ A;  3RGA A;  3SED A;  3X3Z A;  1C7H A;  3EF8 A;  1QJG A;  4FR9 A;  2Y73 A;  2OWP A;  1OF5 B;  3FF2 A;  5IW9 A;  1YI2 3;  3EHC A;  4L7K A;  3K0Z A;  1FGM A;  3SVA A;  4EXR A;  2FGT A;  3KZT A;  4O02 B;  5I97 A;  3MYT A;  1U5O A;  1AVK A;  1ZO2 A;  1JN5 A;  2CFG A;  1E97 A;  5HGR A;  1CQS A;  4N6L A;  4K90 B;  3NV0 B;  3CCR 3;  3CCJ 3;  5AII A;  3X40 A;  3G71 3;  1VQP 3;  3CCL 3;  2OOV C;  3FG4 A;  1V74 A;  3JUQ A;  1K9M 4;  1SPU A;  3RGR A;  3B4P A;  1DVD A;  5EVH A;  1RJO A;  3QRD A;  3NV0 A;  3F7S A;  5KP3 A;  1K28 A;  3MPH A;  2YX9 A;  5CK6 A;  2GEX A;  3LML A;  3BNE A;  1WMO A;  1W01 A;  3T8N A;  3ECF A;  2K54 A;  1EKM A;  2F98 A;  3F9S A;  2GBX B;  3OWU A;  4EBG A;  1ZX2 A;  3ALA A;  2XEP A;  5AEW B;  3WA3 A;  3M8C A;  3UL6 A;  3BND A;  2M7O A;  2GBW B;  2F86 B;  3WOF B;  1WMP A;  3JUN A;  3RDE A;  3GZX B;  2FXT A;  1IQ8 A;  2ML5 A;  4X2O A;  5BXQ A;  2ZDJ A;  1KQS 2;  5IG3 A;  2SBL A;  1QAL A;  3F14 A;  3JVC A;  4LEH A;  4OK0 A;  1Q81 4;  5D83 A;  3H51 A;  3LTC A;  1Q82 4;  1JNQ A;  3WMD A;  1JB5 A;  3CNX A;  3CCV 3;  1VQ4 3;  4MMX B;  1Q86 4;  3OX9 A;  2PNC A;  3EB8 A;  5JPP A;  1W6C A;  3FCS B;  3T0U A;  3CCE 3;  1O7W B;  4U13 A;  3V99 A;  2HMN B;  3F40 A;  1VQL 3;  4IIA A;  3UB1 A;  1A2K A;  1CYU A;  2BO9 B;  3FGY A;  2Z7A A;  4WYK B;  6STD A;  2V1L A;  4PEJ A;  4EC6 A;  4WFO A;  1O7M B;  3G6E 3;  2XSH B;  2XGL A;  1KD1 4;  2QA4 3;  3SLU A;  1IDP A;  1FA3 A;  1IT8 A;  1WQL B;  3V92 A;  1HKX A;  2BMQ B;  2F99 A;  2ML6 A;  3DMC A;  2P0X A;  1YGE A;  3SXX A;  1NB5 I;  4I4K A;  4FCZ A;  2CKF B;  3D9R A;  2C10 A;  2WO0 A;  4BTY A;  1W5Z A;  2MF7 A;  2CFW A;  3DGO A;  2QEX 3;  5STD A;  2CFL A;  3EQQ B;  3WOD G;  3HIG A;  2XGN A;  2K0M A;  2CWV A;  5AIF A;  1VQ9 3;  3LTD A;  2KCD A;  5IG0 A;  4JRF A;  3PXM A;  3FF0 A;  3KE7 A;  1DYU A;  1KSI A;  3CCU 3;  1QAF A;  1CEW I;  2HMJ B;  1NWW A;  4HM0 B;  2GU1 A;  4J8T A;  4O2H A;  1RRH A;  4GB5 A;  5AYR B;  2HMK B;  5AIH A;  4MJD A;  1A67 A;  1IVV A;  1NU3 A;  5IF6 A;  3SOY A;  5KP4 A;  1IVW A;  1O7H B;  1AR0 A;  2KRT A;  4HM2 B;  3CU3 A;  2Z6B A;  3GAX A;  1PU4 A;  5CLK A;  2JQ5 A;  3EN8 A;  4J9A A;  4N6N B;  4XBT A;  1BUQ A;  2XF3 A;  4HBR A;  4AEQ A;  2XFT A;  4CCV A;  2BMO B;  2XSO B;  4R1K A;  1DMN A;  2OOV A;  2B1X B;  5AEU B;  3N54 B;  1UI7 A;  1SIH A;  4WHA A;  3U97 A;  1EG9 B;  4FMC A;  1UI8 A;  1TP6 A;  1LNH A;  2E2U A;  4R80 A;  7STD A;  3OWS A;  4KFE A;  4MMZ B;  1YIT 3;  5EEO A;  5JPU A;  3GWR A;  4AKY A;  1NB3 I;  3NX0 A;  1Q40 B;  4HM7 B;  3LXU X;  5LC6 A;  1OF5 A;  3CD6 3;  1ROA A;  4WP5 A;  2YFI B;  3GZY B;  3DGL A;  2UX0 A;  3LTB A;  1QVG 2;  3Q90 A;  1JB2 A;  1N8Q A;  2JDI H;  3ROB A;  2P09 A;  3LTA A;  5DRV A;  2GEY A;  4KZ1 A;  3DZL A;  4LSO A;  4BTW A;  1J2B A;  5IEO A;  3U1W A;  3GZR A;  4XM4 A;  3TDG A;  1LOX A;  1ROV A;  4FCM A;  1GD4 A;  4N6O B;  1OGZ A;  3EC9 A;  3AMO B;  3FZW A;  4HVN A;  1IV7 A;  3CXC 2;  3CCS 3;  2QGU A;  3NM2 A;  3G8Z A;  3L0R A;  5ELJ A;  2CWU A;  4CDL A;  2CWT A;  2IMJ A;  3NHX A;  1O7P B;  4K61 A;  4FMD A;  1VQK 3;  1GD3 A;  1ULI B;  2IUK A;  2INX A;  3OW2 2;  2XFS A;  1UW1 A;  4HM4 B;  2CG0 A;  2Z76 A;  3CCQ 3;  1STF I;  2CK3 H;  1IVX A;  3AMO A;  1RN7 A;  3FSD A;  3B7C A;  2D42 A;  1IT7 A;  3STD A;  3PS8 A;  3CPW 2;  2P38 A;  3I0Y A;  2W56 B;  1W6G A;  3MG2 A;  5ELU A;  5AIG A;  5A0O B;  4FMA A;  1Y4K A;  1IU7 A;  1HU9 A;  3WA2 X;  3CNM A;  3FH1 A;  3DGN A;  3G0K A;  1TU5 A;  1QAK A;  3VSY A;  1JKG B;  5IEN A;  3PGB A;  4O8S A;  5D81 A;  2O3O A;  2KXG A;  3EX9 A;  1LVN A;  4WWU C;  1W02 A;  3N8B A;  4KFF A;  3JUM A;  1M1K 4;  3CC4 3;  4XB5 A;  1GY5 A;  1KWI A;  1YJ9 3;  3ER7 A;  1K8A 4;  3OWY A;  1W2B 2;  3PCR A;  2W9Q A;  3KSP A;  4RBN A;  4RNY A;  1E3V A;  2W03 A;  1PFP A;  3S28 A;  3K5T A;  1DVC A;  1JV2 B;  2E2V A;  4LMI A;  1VQO 3;  3CCM 3;  2YFJ B;  4EYC A;  1E3R A;  1ISK A;  3LZA A;  4N3V A;  2CH9 A;  4WYK A;  3S67 A;  1IQY A;  4HZB B;  2FNQ A;  1FGT A;  2RSX A;  2HMM B;  3S5C A;  2CC3 A;  2ZL8 A;  4FCJ A;  3S27 A;  1L5G B;  3T8U A;  2BMR B;  1OHP A;  3NUV A;  3HK4 A;  3Q1C A;  3EBY A;  5CF1 A;  4GL6 A;  4HM6 B;  1RRL A;  1OCV A;  4ZM8 A;  1GY7 A;  3S29 A;  2W2C A;  4XBX A;  1M90 4;  1D6Z A;  3MWZ A;  1OH0 A;  3GRD A;  1M1X B;  1R4C A;  4L8P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...