3DGNA

A non-biological atp binding protein crystallized in the presence of 100 mm adp
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
69
structure length
69
Chain Sequence
DDDDKKTNWLKRIYRVRPCVKCKVAPRDWKVKNKHLRIYNMCKTCFNNSIDIGDDTYHGHVDWLMYADS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP Binding Protein-DX
publication title A synthetic protein selected for ligand binding affinity mediates ATP hydrolysis.
pubmed doi rcsb
source organism Unidentified
molecule tags De novo protein
total genus 18
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2008-06-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.210 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3dgnA00
3LT8A 3DGLA 3LTDA 1UW1A 3DGMA 3DGNA 3LT9A 2P09A 3DGOA 2P0XA 2P05A 3LTBA 3LTCA 3LTAA
chains in the Genus database with same CATH superfamily
2W9QA 1BSAA 2F56A 2E2VA 5A0OB 3WODG 4N6MA 3NX0A 3EBTA 4CJNA 1DMQA 2D42A 1VQM3 1B2UA 1TIJA 2R4IA 4KFFA 2HMLB 1SIIA 4N6OB 4CDLA 1QMAA 2WO0A 3PYJA 1RN4A 3GZBA 1AVKA 1OGXA 1T2IA 1U8CB 2RNTA 3F40A 2P0MA 3KFQC 3CME3 2XGLA 3N8BA 5AIGA 1K8A4 1O7NB 5AI1A 2CFKA 9RNTA 1BRKA 1RGKA 2OWPA 4HM4B 3PS8A 2FNQA 5DREA 1CEWI 1JV2B 1IT8A 3FG1A 1AR0A 3GZRA 1OF5B 1YVBI 4WYKA 4BTWA 1VZZA 3NXJA 3BLZA 6STDA 2JQ5A 3Q2PA 1OCVA 1OHPA 2Z76A 3OWYA 1ASKA 1X1XA 4FR9A 3SX1A 1O7GB 3S67A 4HM0B 4ZM8A 2ZL8A 1G0TA 2KAAA 3NQZA 3OWSA 2RGQA 4EYCA 2OTL3 1A67A 1JKGA 3G16A 1MNLA 1RGGA 1GY7A 3B4OA 4XBXA 4EV2A 3G713 1WMPA 2XRXB 1O7MB 5G1LA 1BSEA 1CH0A 1LOWA 2PNCA 3DH2A 1UI8A 3PCRA 4MJDA 3WA3A 3HX8A 3CCL3 2GEYA 3DZLA 5IG3A 4RNTA 5GSPA 1MWUA 2CWUA 4R4KA 1JB5A 2OQEA 1I0XA 3CU3A 3OXAA 2L4VA 3JUOA 1IDPA 2W2CA 3UL6A 1A90A 1N9EA 5HOHA 3F7SA 5CXOA 2CX1A 3PGBA 4K61A 1NWWA 8RNTA 2K0MA 4HM7B 1RRLA 1BRHA 3F7XA 4JF8A 2W56A 3HZPA 1VQL3 3EHCA 3S29A 3KN4A 1TTOA 3F8HA 4L8OA 4HM8B 4NHFA 3FG4A 1C54A 1NB3I 1OHOA 2BMOB 2H0IA 1BGSA 2KF3A 1YJW3 1RRHA 1VQ93 3FF0A 3DXOA 2XF3A 3FGYA 2WOFA 3WOEB 1QVG2 1W00A 4WWUC 1JN5A 1OGZA 3Q3FA 1W2B2 1LOYA 4N6NB 3H51A 1Q7HA 1NU3A 4HJLB 3U1WA 3SXXA 1D6UA 4HM6B 5IEPA 1FW7A 4HM3B 1LVNA 1B2MA 4BU4A 1US1A 2C4BA 3X3ZA 1GSPA 1SQWA 4EV5A 2MF7A 1HKXA 3EE1A 3RGAA 1KSIA 2HMNB 1RNBA 1NDOB 3EQQB 3O8YA 1I2FA 2ZA4A 4OK0A 2BIRA 2INXA 3MHEA 1W2ZA 3WMDA 1BUQA 1MGRA 1O7WB 1Q40A 4O3VA 1VQK3 3RDEA 4EC6A 1R4YA 1WMNA 3D5GA 4XBYA 1FGRA 3WOFB 3LTDA 2F5MA 2UX0A 4EBGA 4O2HA 6RNTA 1BNIA 3MYTA 4WYKB 3A76A 5EEOA 3OV4A 4H61A 1M904 1RNTA 1W6GA 4IT7A 4J5KA 3KSED 4LZIA 5AYRB 1LQGC 4BIRA 1HZ1A 1B2ZA 1YVSA 1TFOA 3LTBA 5ELUA 1BU4A 3NM2A 4PEJA 3UB1A 1AQZA 1EA2A 1Y4KA 2KRTA 2XGNA 5AEUB 1CYUA 1UI7A 1RLSA 3DGMA 4XDVA 4HM5B 3WA2X 3CD63 4AKZA 3BU4A 4OUQA 5BU4A 4HM1B 1JKGB 1UCLA 5AIHA 3ZG5A 2E2UA 1UDII 4KFDA 1W6CA 1KQS2 1NJI4 2CIUA 1FGQA 1BAOA 3I563 2YX9A 1QVF2 1EKMA 3AGNA 4IIAA 2CHCA 2BMRB 3EF8A 4XDWA 2UGIA 1TJDA 3EC9A 2V1LA 3E99A 4I4KA 1N8QA 3K5TA 1I3FA 4HM2B 4U13A 3STDA 1IV7A 2XSOB 2IUJA 3CCR3 1GMPA 4KZ1A 2P0XA 1JJ22 1GMRA 3D3LA 3EJVA 1BIRA 4CPKA 2Z77A 5EVHA 2RCDA 5G1KA 1N5HA 1OHSA 2P38A 2KF5A 3SLUA 1DYUA 5CF1A 3MWZA 1JBRA 3OX9A 4AEQA 2XFSA 1ZO2A 1LNIA 2GBXB 1IVXA 3D4AA 3GAXA 3M8CA 3Q1CA 1ZS7A 1OPYA 4HZBB 8CHOA 2W56B 3DGNA 2CK3H 1Q42A 3F9SA 4JRFA 1LRAA 1Q9EA 4J5GA 1I8VA 4HZ9B 1YI23 3FCSB 2GBWB 2LYXA 1W01A 4HVNA 3K7CA 3X3XA 1V57A 2SARA 2IUKA 3CXC2 5CK6A 5TGNA 2IMJA 3LXUX 1B20A 3PXMA 1BRSA 3FSDA 1YGEA 4K1UA 1JN5B 1IT7A 2P09A 3EX9A 3LZAA 2P05A 4N3VA 3LH4A 3UL5A 4G1MB 2XR8B 4GSPA 4O02B 3PCSA 1VQ53 1U5OA 1LQMB 1RKYA 3DGOA 2ZHXB 3JVCA 1RDSA 1NB5I 1DMNA 5HGRA 1BRGA 4X2OA 2PZVA 1MWSA 2HMKB 3F8XA 4RBNA 1Q814 3SVAA 2XSHB 4HYZA 1RGHA 2A15A 3GRDA 1WTHA 3HOHA 3K63A 2WGOA 3BNBA 4XBTA 1DETA 4K90B 2CKFB 4MMXB 2CWTA 1B2SA 1DMMA 1W02A 3NBRA 5AIIA 1V58A 1JNQA 1IK3A 1Q40B 1K9M4 1IQYA 1GY5A 3S5CA 2O9UX 3RNTA 4XM4A 3ZG0A 3QK9A 1Q864 1W4NA 3TDGA 1ROAA 5BIRA 3NQYA 1MGWA 1X1UA 2HMJB 3S27A 4FMDA 1BRJA 1GOYA 3DGYA 3V99A 5IG5A 3UJMA 1G02A 1O7HB 3EN8A 3KSPA 3MSOA 2Z7AA 4FCJA 4IPBA 5JBSA 3CCU3 4AKYA 3NV0A 1BNSA 1QJGA 1RGLA 4BTYA 5IERA 1A2KA 2WGQA 2YFLB 3T8NA 4MEIA 4N6LA 5M18A 1TRQA 3MKIA 1M9GA 1VQ43 2QEX3 3ZFZA 3B4PA 5D83A 3EB8A 3V92A 2CFWA 3KIIA 1GYBA 3CCS3 2WOHA 5G2GA 1S5AA 5M1AA 2HMMB 3T8UA 5DRVA 1STDA 3LYGA 1EEJA 3D79A 7GSPA 1K734 1ULIB 2ML5A 3NHXA 3X40A 2IA7A 3ECFA 1RJOA 2BNGA 2W04A 1RN1A 1BVIA 1IVVA 4N6V0 2F99A 2GU3A 3DUKA 5STDA 1TFKA 4CCVA 1ISKA 1GOVA 3I0YA 1DVCA 1TP6A 1JB4A 1T3BA 2GU1A 5RNTA 3ROBA 3CCV3 1QAFA 3CMA3 4X2HA 2JDIH 1A2PA 1UW1A 1LNHA 3AGOA 3HIIA 1JBTA 3K9MC 1STFI 2BU4A 1M1K4 2CFDA 1BOXA 4LGQA 3F14A 2BT3A 1ZX2A 2GXFA 3ER7A 1LOVA 2FXTA 1B2XA 1UCJA 3FH1A 3G8ZA 5LC7A 1BUJA 3EN1B 4HAAA 4RZMA 2OTJ3 3AMOA 3WDGB 3G0KA 2C11A 1IV9A 2IY2A 2STDA 4RNYA 3T0UA 3J7Yd 1VQN3 1FA3A 4BL3A 1RCKA 3KE7A 3BNCA 3OW22 2CFGA 2R41A 4J9AA 2K3DA 3CNXA 3DM8A 1N8R4 1MOLA 1KWIA 1UUWB 2AADA 4LEHA 3D5IA 3CCM3 1RTUA 2CFLA 1BSBA 1I70A 2OQEC 3IPTA 3SEDA 5ELJA 1JZOA 1VQ63 2BO9B 1HYFA 2FGTA 2H0HA 2YFIB 4XB5A 1LOXA 3AHWA 3GWRA 2W0QA 2ZDJA 3HI7A 1FUWA 1WMOA 1EQKA 1FUTA 1J2BA 1VQ73 5AYSC 5IENA 3LOYA 4DKIA 1RGFA 4EXRA 3CC43 2HOHA 5JPPA 1BNEA 4HOHA 1FYSA 2RBIA 3FZWA 1NO3A 4ILFA 5JPUA 1FGTA 3MG3A 2XEPA 2D1WA 4LMIA 3LMLA 7STDA 4HKVB 3CPOA 2GEXA 1RMSA 2HMOB 4N6TA 3SOYA 1FGMA 1SPUA 1WQLB 1Z1SA 3FLJA 1BNJA 1ZGXA 3GZYB 1GD3A 2GSPA 4GHOA 1R4CA 1W6YA 1Q824 2OOVC 3NV0B 2QGUA 1T2HA 1IVUA 1FGOA 1JRQA 1KD14 1AV4A 1OUNA 2C10A 1W5ZA 3B8LA 5I97A 3G4S3 3N54B 2AAEA 3VSYA 4TX4A 3QRDA 3X42A 5AEWB 2IYJA 3Q90A 4QWTA 3OWUA 4BTXA 1EG9B 3RGRA 1DE3A 4RNZA 1IU7A 1UCKA 5IF6A 1YNVX 4MMYB 1IQXA 5D81A 5EQLA 7RNTA 1T5YA 1GD4A 1ULJB 3NBJA 4BL2A 1B27A 2CH9A 1LXEA 1QAKA 3BNEA 3NM7A 4KVHA 4ORLA 2ML6A 4L8PA 4R80A 1RSNA 3X3YA 3B7CA 5FGOA 1JZDA 2H0GA 3X41A 1PYLA 2CG0A 3U97A 2KF4A 1K41A 3EBYA 1OH0A 3N9HA 1E97A 1I0VA 1I2EA 2QIYA 3HIGA 2CWVA 5BXQA 2MC8A 1UUVB 3BIRA 3KCHA 4O8SA 2L1SA 1BRNL 1B3SA 5LC6A 4EW5A 4GB5A 4R9LA 3G6E3 3JUMA 4LSOA 5KP1A 3MG1A 3AMOB 3VGNA 2BMQB 2Q07A 4H3UA 3CPW2 1JBSA 3H3HA 3CCE3 1G96A 2E2TA 1MWTA 3NUVA 3NBBA 1RGAA 3BNDA 3I553 1RGEA 2BHMA 1GY6A 3JUNA 4FMAA 4R1KA 2YFJB 4FMCA 1VQQA 2OCTA 1F8NA 2Z6BA 3GSPA 4OVMA 5BVBA 4Q53A 4FMBA 1KC84 4HBRA 2I9WA 1TRPA 4WFOA 1VQO3 1M1XB 5AIFA 1BRIA 1L5GB 1MWRA 3DGLA 4KT3B 5IEOA 3VF1A 2Y74A 3K0ZA 2SBLA 2XH9A 5IG0A 1S723 1N9JA 3LTAA 3D9RA 3MPHA 2F86B 1OF5A 1AVLA 1W7CA 1TUHA 1CQSA 1SJWA 2F5WA 1BSCA 3JUPA 1D6YA 5CLKA 1GMQA 1RHLA 5FW5A 1UGIA 4NREA 2OOVA 3WHOA 4WP5A 1Q7Y4 3FKAA 2M7OA 1YIJ3 5KP4A 5KP3A 3UNLA 2J8XB 2W9PA 2QA43 4KFEA 1TU5A 2F4YA 1YJN3 3PZWA 1VQ83 1A2VA 2W6JH 3S28A 2K54A 3FG3A 5IG4A 1YJ93 3CNMA 1OACA 3JUQA 1I2GA 1RGCA 1UCIA 3DY5A 3KZTA 4LYLB 2CG1A 1O7PB 3KKGA 2F98A 3IMAB 1PU4A 3SYUA 1E3RA 1YGWA 6GSPA 3CC23 4J8TA 1N5PA 5CF2A 3FF2A 4NPBA 2KXGA 1EUIC 5D82A 4R9KA 5M19A 1DVDA 1B21A 1UGHI 1FUSA 4MMZB 1IQ8A 1JB2A 4K1VA 1QALA 1HU9A 3AHSA 3URPA 5IW9A 1CYVA 3DMCA 2XFTA 1BSDA 1V74A 1YHQ3 3CC73 1RN7A 1PY3A 1SARA 1WNHA 2RFRA 1YIT3 1SIHA 2B24B 1PFPA 1IVWA 1UUGB 2KF6A 3HK4A 3V98A 3WR2A 1C7HA 3LT9A 4I5QA 1D6ZA 2W03A 1ROVA 2CX0A 1BANA 3LTCA 2KCDA 4FCMA 4GL6A 3CCJ3 2RSXA 1VQP3 1IYYA 1FZUA 3MG2A 4L7KA 1BNFA 1E3VA 3SOAA 4FCZA 2Y73A 3LT8A 1GOUA 3ALAA 4N6UA 2B1XB 3GZXB 3BB9A 4WHAA 2CW9A 1AY7A 2CC3A 1K28A 3L0RA 1X1YA 1GS3A 1X1WA 2LQVA 1I3IA 3CCQ3 3IJEB 1NNVA 2O3OA 4STDA 1BNGA 1BNRA 3A5EA 2UUGC 1RCLA
chains in the Genus database with same CATH topology
2W9QA 2E2VA 5A0OB 3WODG 4N6MA 3NX0A 3EBTA 1VQM3 1DMQA 2D42A 1TIJA 2R4IA 4KFFA 2HMLB 1SIIA 4N6OB 1QMAA 2WO0A 3PYJA 3GZBA 1AVKA 1OGXA 1U8CB 3F40A 3CME3 1K8A4 2P0MA 3KFQC 2XGLA 3N8BA 5AIGA 1O7NB 5AI1A 2CFKA 2OWPA 4HM4B 3PS8A 2FNQA 5DREA 1CEWI 1JV2B 1IT8A 3FG1A 1AR0A 3GZRA 1OF5B 1YVBI 4WYKA 4BTWA 1VZZA 3NXJA 3BLZA 6STDA 2JQ5A 3Q2PA 1OCVA 1OHPA 2Z76A 3OWYA 1ASKA 4FR9A 3SX1A 1O7GB 3S67A 4HM0B 4ZM8A 2ZL8A 3NQZA 3OWSA 2RGQA 4EYCA 2OTL3 1A67A 1JKGA 3G16A 1MNLA 1GY7A 3B4OA 4XBXA 4EV2A 3G713 1WMPA 2XRXB 1O7MB 2PNCA 3WA3A 1UI8A 3PCRA 4MJDA 3HX8A 3CCL3 2GEYA 3DZLA 5IG3A 2CWUA 4R4KA 1JB5A 2OQEA 3CU3A 3OXAA 2L4VA 3JUOA 1IDPA 2W2CA 3UL6A 1A90A 1N9EA 3F7SA 5CXOA 3PGBA 4K61A 1NWWA 2K0MA 4HM7B 1RRLA 3F7XA 4JF8A 2W56A 3HZPA 1VQL3 3EHCA 3S29A 3KN4A 3F8HA 4L8OA 4HM8B 4NHFA 3FG4A 1NB3I 1OHOA 2BMOB 1YJW3 1RRHA 1VQ93 3FF0A 3DXOA 2XF3A 3FGYA 2WOFA 3WOEB 1QVG2 1W00A 4WWUC 1JN5A 1OGZA 1W2B2 4N6NB 3H51A 3U1WA 1NU3A 4HJLB 3SXXA 1D6UA 4HM6B 5IEPA 4HM3B 1LVNA 1US1A 3X3ZA 1SQWA 4EV5A 2MF7A 1HKXA 3EE1A 3RGAA 1KSIA 2HMNB 1NDOB 3EQQB 3O8YA 4OK0A 2INXA 3MHEA 1BUQA 1W2ZA 3WMDA 1O7WB 4O3VA 1Q40A 1VQK3 3RDEA 4EC6A 1WMNA 3WOFB 4XBYA 1FGRA 3LTDA 2UX0A 4EBGA 4O2HA 3MYTA 4WYKB 3A76A 5EEOA 3OV4A 4H61A 1M904 1W6GA 5AYRB 4IT7A 4LZIA 3KSED 1TFOA 3LTBA 5ELUA 3NM2A 4PEJA 3UB1A 1EA2A 1Y4KA 2KRTA 2XGNA 5AEUB 1CYUA 1UI7A 3DGMA 4XDVA 3WA2X 4HM5B 3CD63 4AKZA 4OUQA 4HM1B 1JKGB 5AIHA 2E2UA 4KFDA 1W6CA 1KQS2 1NJI4 2CIUA 1FGQA 3I563 2YX9A 1QVF2 1EKMA 4IIAA 2CHCA 2BMRB 3EF8A 4XDWA 3EC9A 2V1LA 3E99A 4I4KA 1N8QA 3K5TA 3STDA 4HM2B 4U13A 1IV7A 2XSOB 2IUJA 3CCR3 4KZ1A 2P0XA 1JJ22 3D3LA 3EJVA 2Z77A 5EVHA 2RCDA 1N5HA 1OHSA 2P38A 5CF1A 3SLUA 1DYUA 3MWZA 3OX9A 4AEQA 2XFSA 1ZO2A 2GBXB 3GAXA 1IVXA 3M8CA 3Q1CA 4HZBB 1OPYA 8CHOA 2W56B 3DGNA 2CK3H 1Q42A 3F9SA 4JRFA 4HZ9B 1YI23 3FCSB 2GBWB 2LYXA 1W01A 4HVNA 3K7CA 3X3XA 2IUKA 3CXC2 5CK6A 5TGNA 2IMJA 3LXUX 4K1UA 3PXMA 3FSDA 1YGEA 1JN5B 1IT7A 2P09A 3EX9A 3LZAA 2P05A 4N3VA 3LH4A 3UL5A 4G1MB 2XR8B 4O02B 3PCSA 1VQ53 1U5OA 1RKYA 3DGOA 3JVCA 1NB5I 1DMNA 5HGRA 4X2OA 2PZVA 2HMKB 3F8XA 4RBNA 1Q814 3SVAA 2XSHB 4HYZA 2A15A 3GRDA 1WTHA 3K63A 2WGOA 3BNBA 4XBTA 4K90B 2CKFB 4MMXB 2CWTA 1DMMA 1W02A 3NBRA 5AIIA 1IK3A 1JNQA 1Q40B 1K9M4 1GY5A 1IQYA 3S5CA 2O9UX 4XM4A 3QK9A 1Q864 1W4NA 3TDGA 1ROAA 3NQYA 2HMJB 3S27A 4FMDA 3V99A 5IG5A 3UJMA 1O7HB 3EN8A 3KSPA 3MSOA 4FCJA 2Z7AA 4IPBA 5JBSA 3CCU3 4AKYA 3NV0A 1QJGA 4BTYA 5IERA 1A2KA 2WGQA 2YFLB 3T8NA 4MEIA 4N6LA 3MKIA 1M9GA 1VQ43 2QEX3 3B4PA 5D83A 3EB8A 3V92A 2CFWA 3KIIA 1GYBA 3CCS3 2WOHA 5G2GA 1S5AA 2HMMB 3T8UA 5DRVA 1STDA 3LYGA 1K734 1ULIB 2ML5A 3NHXA 3X40A 2IA7A 3ECFA 1RJOA 2BNGA 2W04A 4N6V0 1IVVA 2F99A 2GU3A 3DUKA 5STDA 1TFKA 4CCVA 1ISKA 3I0YA 1DVCA 1TP6A 2GU1A 1JB4A 3CCV3 3ROBA 1QAFA 3CMA3 4X2HA 2JDIH 1UW1A 1LNHA 3HIIA 3K9MC 1STFI 1M1K4 2CFDA 4LGQA 3F14A 2BT3A 1ZX2A 2GXFA 3ER7A 2FXTA 3FH1A 3G8ZA 5LC7A 3EN1B 4RZMA 2OTJ3 3AMOA 3WDGB 3G0KA 2C11A 1IV9A 2STDA 4RNYA 3T0UA 3J7Yd 1VQN3 1FA3A 3KE7A 3BNCA 3OW22 2CFGA 4J9AA 3CNXA 1N8R4 3DM8A 1MOLA 1KWIA 1UUWB 4LEHA 3CCM3 3IPTA 2CFLA 2OQEC 3SEDA 5ELJA 1VQ63 2BO9B 2FGTA 2YFIB 4XB5A 1LOXA 3GWRA 2W0QA 2ZDJA 3HI7A 1FUWA 1WMOA 1EQKA 1J2BA 1VQ73 5AYSC 5IENA 3LOYA 4EXRA 3CC43 5JPPA 3FZWA 1NO3A 5JPUA 1FGTA 3MG3A 2XEPA 2D1WA 4LMIA 3LMLA 7STDA 4HKVB 3CPOA 2GEXA 2HMOB 4N6TA 3SOYA 1FGMA 1SPUA 1WQLB 1Z1SA 3FLJA 3GZYB 1GD3A 1Q824 1R4CA 1W6YA 2OOVC 3NV0B 2QGUA 1IVUA 1FGOA 1JRQA 1KD14 1AV4A 1OUNA 2C10A 1W5ZA 3B8LA 5I97A 3G4S3 3N54B 3VSYA 4TX4A 3QRDA 3X42A 5AEWB 3Q90A 4QWTA 3OWUA 4BTXA 1EG9B 3RGRA 4RNZA 1IU7A 5IF6A 4MMYB 1IQXA 5D81A 5EQLA 1T5YA 1GD4A 1ULJB 3NBJA 2CH9A 1LXEA 1QAKA 3BNEA 3NM7A 4KVHA 4ORLA 2ML6A 4L8PA 4R80A 3X3YA 3B7CA 5FGOA 3X41A 2CG0A 3U97A 1K41A 3EBYA 1OH0A 3N9HA 1E97A 2QIYA 3HIGA 2CWVA 5BXQA 2MC8A 1UUVB 4O8SA 5LC6A 4GB5A 4R9LA 3G6E3 3JUMA 4LSOA 5KP1A 3MG1A 3AMOB 3VGNA 2BMQB 2Q07A 4H3UA 3CPW2 3H3HA 3CCE3 1G96A 2E2TA 3NUVA 3NBBA 3I553 3BNDA 2BHMA 1GY6A 3JUNA 4FMAA 4R1KA 2YFJB 4FMCA 2OCTA 1F8NA 2Z6BA 4OVMA 5BVBA 4Q53A 4FMBA 1KC84 4HBRA 2I9WA 4WFOA 1VQO3 1M1XB 5AIFA 1L5GB 3DGLA 5IEOA 3VF1A 2Y74A 3K0ZA 2SBLA 2XH9A 5IG0A 1S723 1N9JA 3LTAA 3D9RA 3MPHA 2F86B 1OF5A 1AVLA 1W7CA 1TUHA 1CQSA 1SJWA 3JUPA 1D6YA 5CLKA 5FW5A 4NREA 2OOVA 4WP5A 1Q7Y4 3FKAA 2M7OA 1YIJ3 5KP4A 5KP3A 3UNLA 2QA43 2W9PA 4KFEA 1TU5A 1YJN3 3PZWA 1VQ83 1A2VA 2W6JH 3S28A 2K54A 3FG3A 5IG4A 1YJ93 3CNMA 1OACA 3JUQA 3KZTA 3DY5A 2CG1A 1O7PB 3KKGA 2F98A 3IMAB 1PU4A 1E3RA 3CC23 4J8TA 1N5PA 5CF2A 3FF2A 5D82A 2KXGA 4R9KA 1DVDA 4MMZB 1IQ8A 1JB2A 4K1VA 1QALA 1HU9A 5IW9A 1CYVA 3DMCA 2XFTA 1V74A 1YHQ3 3CC73 1RN7A 1WNHA 2RFRA 1YIT3 1SIHA 2B24B 1PFPA 1IVWA 3HK4A 4CDLA 3V98A 1C7HA 3LT9A 1D6ZA 2W03A 1ROVA 3LTCA 3CCJ3 2KCDA 4FCMA 4GL6A 1VQP3 2RSXA 3MG2A 4L7KA 1E3VA 3SOAA 4FCZA 2Y73A 3LT8A 3ALAA 4N6UA 2B1XB 3GZXB 3BB9A 4WHAA 2CW9A 2CC3A 1K28A 3L0RA 1GS3A 2LQVA 3CCQ3 3IJEB 2O3OA 4STDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LT8 A;  3DGL A;  3LTD A;  1UW1 A;  3DGM A;  3DGN A;  3LT9 A;  2P09 A;  3DGO A;  2P0X A;  2P05 A;  3LTB A;  3LTC A;  3LTA A; 
#chains in the Genus database with same CATH topology
 2W9Q A;  1BSA A;  2F56 A;  2E2V A;  5A0O B;  3WOD G;  4N6M A;  3NX0 A;  3EBT A;  4CJN A;  1DMQ A;  2D42 A;  1VQM 3;  1B2U A;  1TIJ A;  2R4I A;  4KFF A;  2HML B;  1SII A;  4N6O B;  4CDL A;  1QMA A;  2WO0 A;  3PYJ A;  1RN4 A;  3GZB A;  1AVK A;  1OGX A;  1T2I A;  1U8C B;  2RNT A;  3F40 A;  2P0M A;  3KFQ C;  3CME 3;  2XGL A;  3N8B A;  5AIG A;  1K8A 4;  1O7N B;  5AI1 A;  2CFK A;  9RNT A;  1BRK A;  1RGK A;  2OWP A;  4HM4 B;  3PS8 A;  2FNQ A;  5DRE A;  1CEW I;  1JV2 B;  1IT8 A;  3FG1 A;  1AR0 A;  3GZR A;  1OF5 B;  1YVB I;  4WYK A;  4BTW A;  1VZZ A;  3NXJ A;  3BLZ A;  6STD A;  2JQ5 A;  3Q2P A;  1OCV A;  1OHP A;  2Z76 A;  3OWY A;  1ASK A;  1X1X A;  4FR9 A;  3SX1 A;  1O7G B;  3S67 A;  4HM0 B;  4ZM8 A;  2ZL8 A;  1G0T A;  2KAA A;  3NQZ A;  3OWS A;  2RGQ A;  4EYC A;  2OTL 3;  1A67 A;  1JKG A;  3G16 A;  1MNL A;  1RGG A;  1GY7 A;  3B4O A;  4XBX A;  4EV2 A;  3G71 3;  1WMP A;  2XRX B;  1O7M B;  5G1L A;  1BSE A;  1CH0 A;  1LOW A;  2PNC A;  3DH2 A;  1UI8 A;  3PCR A;  4MJD A;  3WA3 A;  3HX8 A;  3CCL 3;  2GEY A;  3DZL A;  5IG3 A;  4RNT A;  5GSP A;  1MWU A;  2CWU A;  4R4K A;  1JB5 A;  2OQE A;  1I0X A;  3CU3 A;  3OXA A;  2L4V A;  3JUO A;  1IDP A;  2W2C A;  3UL6 A;  1A90 A;  1N9E A;  5HOH A;  3F7S A;  5CXO A;  2CX1 A;  3PGB A;  4K61 A;  1NWW A;  8RNT A;  2K0M A;  4HM7 B;  1RRL A;  1BRH A;  3F7X A;  4JF8 A;  2W56 A;  3HZP A;  1VQL 3;  3EHC A;  3S29 A;  3KN4 A;  1TTO A;  3F8H A;  4L8O A;  4HM8 B;  4NHF A;  3FG4 A;  1C54 A;  1NB3 I;  1OHO A;  2BMO B;  2H0I A;  1BGS A;  2KF3 A;  1YJW 3;  1RRH A;  1VQ9 3;  3FF0 A;  3DXO A;  2XF3 A;  3FGY A;  2WOF A;  3WOE B;  1QVG 2;  1W00 A;  4WWU C;  1JN5 A;  1OGZ A;  3Q3F A;  1W2B 2;  1LOY A;  4N6N B;  3H51 A;  1Q7H A;  1NU3 A;  4HJL B;  3U1W A;  3SXX A;  1D6U A;  4HM6 B;  5IEP A;  1FW7 A;  4HM3 B;  1LVN A;  1B2M A;  4BU4 A;  1US1 A;  2C4B A;  3X3Z A;  1GSP A;  1SQW A;  4EV5 A;  2MF7 A;  1HKX A;  3EE1 A;  3RGA A;  1KSI A;  2HMN B;  1RNB A;  1NDO B;  3EQQ B;  3O8Y A;  1I2F A;  2ZA4 A;  4OK0 A;  2BIR A;  2INX A;  3MHE A;  1W2Z A;  3WMD A;  1BUQ A;  1MGR A;  1O7W B;  1Q40 A;  4O3V A;  1VQK 3;  3RDE A;  4EC6 A;  1R4Y A;  1WMN A;  3D5G A;  4XBY A;  1FGR A;  3WOF B;  3LTD A;  2F5M A;  2UX0 A;  4EBG A;  4O2H A;  6RNT A;  1BNI A;  3MYT A;  4WYK B;  3A76 A;  5EEO A;  3OV4 A;  4H61 A;  1M90 4;  1RNT A;  1W6G A;  4IT7 A;  4J5K A;  3KSE D;  4LZI A;  5AYR B;  1LQG C;  4BIR A;  1HZ1 A;  1B2Z A;  1YVS A;  1TFO A;  3LTB A;  5ELU A;  1BU4 A;  3NM2 A;  4PEJ A;  3UB1 A;  1AQZ A;  1EA2 A;  1Y4K A;  2KRT A;  2XGN A;  5AEU B;  1CYU A;  1UI7 A;  1RLS A;  3DGM A;  4XDV A;  4HM5 B;  3WA2 X;  3CD6 3;  4AKZ A;  3BU4 A;  4OUQ A;  5BU4 A;  4HM1 B;  1JKG B;  1UCL A;  5AIH A;  3ZG5 A;  2E2U A;  1UDI I;  4KFD A;  1W6C A;  1KQS 2;  1NJI 4;  2CIU A;  1FGQ A;  1BAO A;  3I56 3;  2YX9 A;  1QVF 2;  1EKM A;  3AGN A;  4IIA A;  2CHC A;  2BMR B;  3EF8 A;  4XDW A;  2UGI A;  1TJD A;  3EC9 A;  2V1L A;  3E99 A;  4I4K A;  1N8Q A;  3K5T A;  1I3F A;  4HM2 B;  4U13 A;  3STD A;  1IV7 A;  2XSO B;  2IUJ A;  3CCR 3;  1GMP A;  4KZ1 A;  2P0X A;  1JJ2 2;  1GMR A;  3D3L A;  3EJV A;  1BIR A;  4CPK A;  2Z77 A;  5EVH A;  2RCD A;  5G1K A;  1N5H A;  1OHS A;  2P38 A;  2KF5 A;  3SLU A;  1DYU A;  5CF1 A;  3MWZ A;  1JBR A;  3OX9 A;  4AEQ A;  2XFS A;  1ZO2 A;  1LNI A;  2GBX B;  1IVX A;  3D4A A;  3GAX A;  3M8C A;  3Q1C A;  1ZS7 A;  1OPY A;  4HZB B;  8CHO A;  2W56 B;  3DGN A;  2CK3 H;  1Q42 A;  3F9S A;  4JRF A;  1LRA A;  1Q9E A;  4J5G A;  1I8V A;  4HZ9 B;  1YI2 3;  3FCS B;  2GBW B;  2LYX A;  1W01 A;  4HVN A;  3K7C A;  3X3X A;  1V57 A;  2SAR A;  2IUK A;  3CXC 2;  5CK6 A;  5TGN A;  2IMJ A;  3LXU X;  1B20 A;  3PXM A;  1BRS A;  3FSD A;  1YGE A;  4K1U A;  1JN5 B;  1IT7 A;  2P09 A;  3EX9 A;  3LZA A;  2P05 A;  4N3V A;  3LH4 A;  3UL5 A;  4G1M B;  2XR8 B;  4GSP A;  4O02 B;  3PCS A;  1VQ5 3;  1U5O A;  1LQM B;  1RKY A;  3DGO A;  2ZHX B;  3JVC A;  1RDS A;  1NB5 I;  1DMN A;  5HGR A;  1BRG A;  4X2O A;  2PZV A;  1MWS A;  2HMK B;  3F8X A;  4RBN A;  1Q81 4;  3SVA A;  2XSH B;  4HYZ A;  1RGH A;  2A15 A;  3GRD A;  1WTH A;  3HOH A;  3K63 A;  2WGO A;  3BNB A;  4XBT A;  1DET A;  4K90 B;  2CKF B;  4MMX B;  2CWT A;  1B2S A;  1DMM A;  1W02 A;  3NBR A;  5AII A;  1V58 A;  1JNQ A;  1IK3 A;  1Q40 B;  1K9M 4;  1IQY A;  1GY5 A;  3S5C A;  2O9U X;  3RNT A;  4XM4 A;  3ZG0 A;  3QK9 A;  1Q86 4;  1W4N A;  3TDG A;  1ROA A;  5BIR A;  3NQY A;  1MGW A;  1X1U A;  2HMJ B;  3S27 A;  4FMD A;  1BRJ A;  1GOY A;  3DGY A;  3V99 A;  5IG5 A;  3UJM A;  1G02 A;  1O7H B;  3EN8 A;  3KSP A;  3MSO A;  2Z7A A;  4FCJ A;  4IPB A;  5JBS A;  3CCU 3;  4AKY A;  3NV0 A;  1BNS A;  1QJG A;  1RGL A;  4BTY A;  5IER A;  1A2K A;  2WGQ A;  2YFL B;  3T8N A;  4MEI A;  4N6L A;  5M18 A;  1TRQ A;  3MKI A;  1M9G A;  1VQ4 3;  2QEX 3;  3ZFZ A;  3B4P A;  5D83 A;  3EB8 A;  3V92 A;  2CFW A;  3KII A;  1GYB A;  3CCS 3;  2WOH A;  5G2G A;  1S5A A;  5M1A A;  2HMM B;  3T8U A;  5DRV A;  1STD A;  3LYG A;  1EEJ A;  3D79 A;  7GSP A;  1K73 4;  1ULI B;  2ML5 A;  3NHX A;  3X40 A;  2IA7 A;  3ECF A;  1RJO A;  2BNG A;  2W04 A;  1RN1 A;  1BVI A;  1IVV A;  4N6V 0;  2F99 A;  2GU3 A;  3DUK A;  5STD A;  1TFK A;  4CCV A;  1ISK A;  1GOV A;  3I0Y A;  1DVC A;  1TP6 A;  1JB4 A;  1T3B A;  2GU1 A;  5RNT A;  3ROB A;  3CCV 3;  1QAF A;  3CMA 3;  4X2H A;  2JDI H;  1A2P A;  1UW1 A;  1LNH A;  3AGO A;  3HII A;  1JBT A;  3K9M C;  1STF I;  2BU4 A;  1M1K 4;  2CFD A;  1BOX A;  4LGQ A;  3F14 A;  2BT3 A;  1ZX2 A;  2GXF A;  3ER7 A;  1LOV A;  2FXT A;  1B2X A;  1UCJ A;  3FH1 A;  3G8Z A;  5LC7 A;  1BUJ A;  3EN1 B;  4HAA A;  4RZM A;  2OTJ 3;  3AMO A;  3WDG B;  3G0K A;  2C11 A;  1IV9 A;  2IY2 A;  2STD A;  4RNY A;  3T0U A;  3J7Y d;  1VQN 3;  1FA3 A;  4BL3 A;  1RCK A;  3KE7 A;  3BNC A;  3OW2 2;  2CFG A;  2R41 A;  4J9A A;  2K3D A;  3CNX A;  3DM8 A;  1N8R 4;  1MOL A;  1KWI A;  1UUW B;  2AAD A;  4LEH A;  3D5I A;  3CCM 3;  1RTU A;  2CFL A;  1BSB A;  1I70 A;  2OQE C;  3IPT A;  3SED A;  5ELJ A;  1JZO A;  1VQ6 3;  2BO9 B;  1HYF A;  2FGT A;  2H0H A;  2YFI B;  4XB5 A;  1LOX A;  3AHW A;  3GWR A;  2W0Q A;  2ZDJ A;  3HI7 A;  1FUW A;  1WMO A;  1EQK A;  1FUT A;  1J2B A;  1VQ7 3;  5AYS C;  5IEN A;  3LOY A;  4DKI A;  1RGF A;  4EXR A;  3CC4 3;  2HOH A;  5JPP A;  1BNE A;  4HOH A;  1FYS A;  2RBI A;  3FZW A;  1NO3 A;  4ILF A;  5JPU A;  1FGT A;  3MG3 A;  2XEP A;  2D1W A;  4LMI A;  3LML A;  7STD A;  4HKV B;  3CPO A;  2GEX A;  1RMS A;  2HMO B;  4N6T A;  3SOY A;  1FGM A;  1SPU A;  1WQL B;  1Z1S A;  3FLJ A;  1BNJ A;  1ZGX A;  3GZY B;  1GD3 A;  2GSP A;  4GHO A;  1R4C A;  1W6Y A;  1Q82 4;  2OOV C;  3NV0 B;  2QGU A;  1T2H A;  1IVU A;  1FGO A;  1JRQ A;  1KD1 4;  1AV4 A;  1OUN A;  2C10 A;  1W5Z A;  3B8L A;  5I97 A;  3G4S 3;  3N54 B;  2AAE A;  3VSY A;  4TX4 A;  3QRD A;  3X42 A;  5AEW B;  2IYJ A;  3Q90 A;  4QWT A;  3OWU A;  4BTX A;  1EG9 B;  3RGR A;  1DE3 A;  4RNZ A;  1IU7 A;  1UCK A;  5IF6 A;  1YNV X;  4MMY B;  1IQX A;  5D81 A;  5EQL A;  7RNT A;  1T5Y A;  1GD4 A;  1ULJ B;  3NBJ A;  4BL2 A;  1B27 A;  2CH9 A;  1LXE A;  1QAK A;  3BNE A;  3NM7 A;  4KVH A;  4ORL A;  2ML6 A;  4L8P A;  4R80 A;  1RSN A;  3X3Y A;  3B7C A;  5FGO A;  1JZD A;  2H0G A;  3X41 A;  1PYL A;  2CG0 A;  3U97 A;  2KF4 A;  1K41 A;  3EBY A;  1OH0 A;  3N9H A;  1E97 A;  1I0V A;  1I2E A;  2QIY A;  3HIG A;  2CWV A;  5BXQ A;  2MC8 A;  1UUV B;  3BIR A;  3KCH A;  4O8S A;  2L1S A;  1BRN L;  1B3S A;  5LC6 A;  4EW5 A;  4GB5 A;  4R9L A;  3G6E 3;  3JUM A;  4LSO A;  5KP1 A;  3MG1 A;  3AMO B;  3VGN A;  2BMQ B;  2Q07 A;  4H3U A;  3CPW 2;  1JBS A;  3H3H A;  3CCE 3;  1G96 A;  2E2T A;  1MWT A;  3NUV A;  3NBB A;  1RGA A;  3BND A;  3I55 3;  1RGE A;  2BHM A;  1GY6 A;  3JUN A;  4FMA A;  4R1K A;  2YFJ B;  4FMC A;  1VQQ A;  2OCT A;  1F8N A;  2Z6B A;  3GSP A;  4OVM A;  5BVB A;  4Q53 A;  4FMB A;  1KC8 4;  4HBR A;  2I9W A;  1TRP A;  4WFO A;  1VQO 3;  1M1X B;  5AIF A;  1BRI A;  1L5G B;  1MWR A;  3DGL A;  4KT3 B;  5IEO A;  3VF1 A;  2Y74 A;  3K0Z A;  2SBL A;  2XH9 A;  5IG0 A;  1S72 3;  1N9J A;  3LTA A;  3D9R A;  3MPH A;  2F86 B;  1OF5 A;  1AVL A;  1W7C A;  1TUH A;  1CQS A;  1SJW A;  2F5W A;  1BSC A;  3JUP A;  1D6Y A;  5CLK A;  1GMQ A;  1RHL A;  5FW5 A;  1UGI A;  4NRE A;  2OOV A;  3WHO A;  4WP5 A;  1Q7Y 4;  3FKA A;  2M7O A;  1YIJ 3;  5KP4 A;  5KP3 A;  3UNL A;  2J8X B;  2W9P A;  2QA4 3;  4KFE A;  1TU5 A;  2F4Y A;  1YJN 3;  3PZW A;  1VQ8 3;  1A2V A;  2W6J H;  3S28 A;  2K54 A;  3FG3 A;  5IG4 A;  1YJ9 3;  3CNM A;  1OAC A;  3JUQ A;  1I2G A;  1RGC A;  1UCI A;  3DY5 A;  3KZT A;  4LYL B;  2CG1 A;  1O7P B;  3KKG A;  2F98 A;  3IMA B;  1PU4 A;  3SYU A;  1E3R A;  1YGW A;  6GSP A;  3CC2 3;  4J8T A;  1N5P A;  5CF2 A;  3FF2 A;  4NPB A;  2KXG A;  1EUI C;  5D82 A;  4R9K A;  5M19 A;  1DVD A;  1B21 A;  1UGH I;  1FUS A;  4MMZ B;  1IQ8 A;  1JB2 A;  4K1V A;  1QAL A;  1HU9 A;  3AHS A;  3URP A;  5IW9 A;  1CYV A;  3DMC A;  2XFT A;  1BSD A;  1V74 A;  1YHQ 3;  3CC7 3;  1RN7 A;  1PY3 A;  1SAR A;  1WNH A;  2RFR A;  1YIT 3;  1SIH A;  2B24 B;  1PFP A;  1IVW A;  1UUG B;  2KF6 A;  3HK4 A;  3V98 A;  3WR2 A;  1C7H A;  3LT9 A;  4I5Q A;  1D6Z A;  2W03 A;  1ROV A;  2CX0 A;  1BAN A;  3LTC A;  2KCD A;  4FCM A;  4GL6 A;  3CCJ 3;  2RSX A;  1VQP 3;  1IYY A;  1FZU A;  3MG2 A;  4L7K A;  1BNF A;  1E3V A;  3SOA A;  4FCZ A;  2Y73 A;  3LT8 A;  1GOU A;  3ALA A;  4N6U A;  2B1X B;  3GZX B;  3BB9 A;  4WHA A;  2CW9 A;  1AY7 A;  2CC3 A;  1K28 A;  3L0R A;  1X1Y A;  1GS3 A;  1X1W A;  2LQV A;  1I3I A;  3CCQ 3;  3IJE B;  1NNV A;  2O3O A;  4STD A;  1BNG A;  1BNR A;  3A5E A;  2UUG C;  1RCL A; 
#chains in the Genus database with same CATH homology
 2W9Q A;  2E2V A;  5A0O B;  3WOD G;  4N6M A;  3NX0 A;  3EBT A;  1VQM 3;  1DMQ A;  2D42 A;  1TIJ A;  2R4I A;  4KFF A;  2HML B;  1SII A;  4N6O B;  1QMA A;  2WO0 A;  3PYJ A;  3GZB A;  1AVK A;  1OGX A;  1U8C B;  3F40 A;  3CME 3;  1K8A 4;  2P0M A;  3KFQ C;  2XGL A;  3N8B A;  5AIG A;  1O7N B;  5AI1 A;  2CFK A;  2OWP A;  4HM4 B;  3PS8 A;  2FNQ A;  5DRE A;  1CEW I;  1JV2 B;  1IT8 A;  3FG1 A;  1AR0 A;  3GZR A;  1OF5 B;  1YVB I;  4WYK A;  4BTW A;  1VZZ A;  3NXJ A;  3BLZ A;  6STD A;  2JQ5 A;  3Q2P A;  1OCV A;  1OHP A;  2Z76 A;  3OWY A;  1ASK A;  4FR9 A;  3SX1 A;  1O7G B;  3S67 A;  4HM0 B;  4ZM8 A;  2ZL8 A;  3NQZ A;  3OWS A;  2RGQ A;  4EYC A;  2OTL 3;  1A67 A;  1JKG A;  3G16 A;  1MNL A;  1GY7 A;  3B4O A;  4XBX A;  4EV2 A;  3G71 3;  1WMP A;  2XRX B;  1O7M B;  2PNC A;  3WA3 A;  1UI8 A;  3PCR A;  4MJD A;  3HX8 A;  3CCL 3;  2GEY A;  3DZL A;  5IG3 A;  2CWU A;  4R4K A;  1JB5 A;  2OQE A;  3CU3 A;  3OXA A;  2L4V A;  3JUO A;  1IDP A;  2W2C A;  3UL6 A;  1A90 A;  1N9E A;  3F7S A;  5CXO A;  3PGB A;  4K61 A;  1NWW A;  2K0M A;  4HM7 B;  1RRL A;  3F7X A;  4JF8 A;  2W56 A;  3HZP A;  1VQL 3;  3EHC A;  3S29 A;  3KN4 A;  3F8H A;  4L8O A;  4HM8 B;  4NHF A;  3FG4 A;  1NB3 I;  1OHO A;  2BMO B;  1YJW 3;  1RRH A;  1VQ9 3;  3FF0 A;  3DXO A;  2XF3 A;  3FGY A;  2WOF A;  3WOE B;  1QVG 2;  1W00 A;  4WWU C;  1JN5 A;  1OGZ A;  1W2B 2;  4N6N B;  3H51 A;  3U1W A;  1NU3 A;  4HJL B;  3SXX A;  1D6U A;  4HM6 B;  5IEP A;  4HM3 B;  1LVN A;  1US1 A;  3X3Z A;  1SQW A;  4EV5 A;  2MF7 A;  1HKX A;  3EE1 A;  3RGA A;  1KSI A;  2HMN B;  1NDO B;  3EQQ B;  3O8Y A;  4OK0 A;  2INX A;  3MHE A;  1BUQ A;  1W2Z A;  3WMD A;  1O7W B;  4O3V A;  1Q40 A;  1VQK 3;  3RDE A;  4EC6 A;  1WMN A;  3WOF B;  4XBY A;  1FGR A;  3LTD A;  2UX0 A;  4EBG A;  4O2H A;  3MYT A;  4WYK B;  3A76 A;  5EEO A;  3OV4 A;  4H61 A;  1M90 4;  1W6G A;  5AYR B;  4IT7 A;  4LZI A;  3KSE D;  1TFO A;  3LTB A;  5ELU A;  3NM2 A;  4PEJ A;  3UB1 A;  1EA2 A;  1Y4K A;  2KRT A;  2XGN A;  5AEU B;  1CYU A;  1UI7 A;  3DGM A;  4XDV A;  3WA2 X;  4HM5 B;  3CD6 3;  4AKZ A;  4OUQ A;  4HM1 B;  1JKG B;  5AIH A;  2E2U A;  4KFD A;  1W6C A;  1KQS 2;  1NJI 4;  2CIU A;  1FGQ A;  3I56 3;  2YX9 A;  1QVF 2;  1EKM A;  4IIA A;  2CHC A;  2BMR B;  3EF8 A;  4XDW A;  3EC9 A;  2V1L A;  3E99 A;  4I4K A;  1N8Q A;  3K5T A;  3STD A;  4HM2 B;  4U13 A;  1IV7 A;  2XSO B;  2IUJ A;  3CCR 3;  4KZ1 A;  2P0X A;  1JJ2 2;  3D3L A;  3EJV A;  2Z77 A;  5EVH A;  2RCD A;  1N5H A;  1OHS A;  2P38 A;  5CF1 A;  3SLU A;  1DYU A;  3MWZ A;  3OX9 A;  4AEQ A;  2XFS A;  1ZO2 A;  2GBX B;  3GAX A;  1IVX A;  3M8C A;  3Q1C A;  4HZB B;  1OPY A;  8CHO A;  2W56 B;  3DGN A;  2CK3 H;  1Q42 A;  3F9S A;  4JRF A;  4HZ9 B;  1YI2 3;  3FCS B;  2GBW B;  2LYX A;  1W01 A;  4HVN A;  3K7C A;  3X3X A;  2IUK A;  3CXC 2;  5CK6 A;  5TGN A;  2IMJ A;  3LXU X;  4K1U A;  3PXM A;  3FSD A;  1YGE A;  1JN5 B;  1IT7 A;  2P09 A;  3EX9 A;  3LZA A;  2P05 A;  4N3V A;  3LH4 A;  3UL5 A;  4G1M B;  2XR8 B;  4O02 B;  3PCS A;  1VQ5 3;  1U5O A;  1RKY A;  3DGO A;  3JVC A;  1NB5 I;  1DMN A;  5HGR A;  4X2O A;  2PZV A;  2HMK B;  3F8X A;  4RBN A;  1Q81 4;  3SVA A;  2XSH B;  4HYZ A;  2A15 A;  3GRD A;  1WTH A;  3K63 A;  2WGO A;  3BNB A;  4XBT A;  4K90 B;  2CKF B;  4MMX B;  2CWT A;  1DMM A;  1W02 A;  3NBR A;  5AII A;  1IK3 A;  1JNQ A;  1Q40 B;  1K9M 4;  1GY5 A;  1IQY A;  3S5C A;  2O9U X;  4XM4 A;  3QK9 A;  1Q86 4;  1W4N A;  3TDG A;  1ROA A;  3NQY A;  2HMJ B;  3S27 A;  4FMD A;  3V99 A;  5IG5 A;  3UJM A;  1O7H B;  3EN8 A;  3KSP A;  3MSO A;  4FCJ A;  2Z7A A;  4IPB A;  5JBS A;  3CCU 3;  4AKY A;  3NV0 A;  1QJG A;  4BTY A;  5IER A;  1A2K A;  2WGQ A;  2YFL B;  3T8N A;  4MEI A;  4N6L A;  3MKI A;  1M9G A;  1VQ4 3;  2QEX 3;  3B4P A;  5D83 A;  3EB8 A;  3V92 A;  2CFW A;  3KII A;  1GYB A;  3CCS 3;  2WOH A;  5G2G A;  1S5A A;  2HMM B;  3T8U A;  5DRV A;  1STD A;  3LYG A;  1K73 4;  1ULI B;  2ML5 A;  3NHX A;  3X40 A;  2IA7 A;  3ECF A;  1RJO A;  2BNG A;  2W04 A;  4N6V 0;  1IVV A;  2F99 A;  2GU3 A;  3DUK A;  5STD A;  1TFK A;  4CCV A;  1ISK A;  3I0Y A;  1DVC A;  1TP6 A;  2GU1 A;  1JB4 A;  3CCV 3;  3ROB A;  1QAF A;  3CMA 3;  4X2H A;  2JDI H;  1UW1 A;  1LNH A;  3HII A;  3K9M C;  1STF I;  1M1K 4;  2CFD A;  4LGQ A;  3F14 A;  2BT3 A;  1ZX2 A;  2GXF A;  3ER7 A;  2FXT A;  3FH1 A;  3G8Z A;  5LC7 A;  3EN1 B;  4RZM A;  2OTJ 3;  3AMO A;  3WDG B;  3G0K A;  2C11 A;  1IV9 A;  2STD A;  4RNY A;  3T0U A;  3J7Y d;  1VQN 3;  1FA3 A;  3KE7 A;  3BNC A;  3OW2 2;  2CFG A;  4J9A A;  3CNX A;  1N8R 4;  3DM8 A;  1MOL A;  1KWI A;  1UUW B;  4LEH A;  3CCM 3;  3IPT A;  2CFL A;  2OQE C;  3SED A;  5ELJ A;  1VQ6 3;  2BO9 B;  2FGT A;  2YFI B;  4XB5 A;  1LOX A;  3GWR A;  2W0Q A;  2ZDJ A;  3HI7 A;  1FUW A;  1WMO A;  1EQK A;  1J2B A;  1VQ7 3;  5AYS C;  5IEN A;  3LOY A;  4EXR A;  3CC4 3;  5JPP A;  3FZW A;  1NO3 A;  5JPU A;  1FGT A;  3MG3 A;  2XEP A;  2D1W A;  4LMI A;  3LML A;  7STD A;  4HKV B;  3CPO A;  2GEX A;  2HMO B;  4N6T A;  3SOY A;  1FGM A;  1SPU A;  1WQL B;  1Z1S A;  3FLJ A;  3GZY B;  1GD3 A;  1Q82 4;  1R4C A;  1W6Y A;  2OOV C;  3NV0 B;  2QGU A;  1IVU A;  1FGO A;  1JRQ A;  1KD1 4;  1AV4 A;  1OUN A;  2C10 A;  1W5Z A;  3B8L A;  5I97 A;  3G4S 3;  3N54 B;  3VSY A;  4TX4 A;  3QRD A;  3X42 A;  5AEW B;  3Q90 A;  4QWT A;  3OWU A;  4BTX A;  1EG9 B;  3RGR A;  4RNZ A;  1IU7 A;  5IF6 A;  4MMY B;  1IQX A;  5D81 A;  5EQL A;  1T5Y A;  1GD4 A;  1ULJ B;  3NBJ A;  2CH9 A;  1LXE A;  1QAK A;  3BNE A;  3NM7 A;  4KVH A;  4ORL A;  2ML6 A;  4L8P A;  4R80 A;  3X3Y A;  3B7C A;  5FGO A;  3X41 A;  2CG0 A;  3U97 A;  1K41 A;  3EBY A;  1OH0 A;  3N9H A;  1E97 A;  2QIY A;  3HIG A;  2CWV A;  5BXQ A;  2MC8 A;  1UUV B;  4O8S A;  5LC6 A;  4GB5 A;  4R9L A;  3G6E 3;  3JUM A;  4LSO A;  5KP1 A;  3MG1 A;  3AMO B;  3VGN A;  2BMQ B;  2Q07 A;  4H3U A;  3CPW 2;  3H3H A;  3CCE 3;  1G96 A;  2E2T A;  3NUV A;  3NBB A;  3I55 3;  3BND A;  2BHM A;  1GY6 A;  3JUN A;  4FMA A;  4R1K A;  2YFJ B;  4FMC A;  2OCT A;  1F8N A;  2Z6B A;  4OVM A;  5BVB A;  4Q53 A;  4FMB A;  1KC8 4;  4HBR A;  2I9W A;  4WFO A;  1VQO 3;  1M1X B;  5AIF A;  1L5G B;  3DGL A;  5IEO A;  3VF1 A;  2Y74 A;  3K0Z A;  2SBL A;  2XH9 A;  5IG0 A;  1S72 3;  1N9J A;  3LTA A;  3D9R A;  3MPH A;  2F86 B;  1OF5 A;  1AVL A;  1W7C A;  1TUH A;  1CQS A;  1SJW A;  3JUP A;  1D6Y A;  5CLK A;  5FW5 A;  4NRE A;  2OOV A;  4WP5 A;  1Q7Y 4;  3FKA A;  2M7O A;  1YIJ 3;  5KP4 A;  5KP3 A;  3UNL A;  2QA4 3;  2W9P A;  4KFE A;  1TU5 A;  1YJN 3;  3PZW A;  1VQ8 3;  1A2V A;  2W6J H;  3S28 A;  2K54 A;  3FG3 A;  5IG4 A;  1YJ9 3;  3CNM A;  1OAC A;  3JUQ A;  3KZT A;  3DY5 A;  2CG1 A;  1O7P B;  3KKG A;  2F98 A;  3IMA B;  1PU4 A;  1E3R A;  3CC2 3;  4J8T A;  1N5P A;  5CF2 A;  3FF2 A;  5D82 A;  2KXG A;  4R9K A;  1DVD A;  4MMZ B;  1IQ8 A;  1JB2 A;  4K1V A;  1QAL A;  1HU9 A;  5IW9 A;  1CYV A;  3DMC A;  2XFT A;  1V74 A;  1YHQ 3;  3CC7 3;  1RN7 A;  1WNH A;  2RFR A;  1YIT 3;  1SIH A;  2B24 B;  1PFP A;  1IVW A;  3HK4 A;  4CDL A;  3V98 A;  1C7H A;  3LT9 A;  1D6Z A;  2W03 A;  1ROV A;  3LTC A;  3CCJ 3;  2KCD A;  4FCM A;  4GL6 A;  1VQP 3;  2RSX A;  3MG2 A;  4L7K A;  1E3V A;  3SOA A;  4FCZ A;  2Y73 A;  3LT8 A;  3ALA A;  4N6U A;  2B1X B;  3GZX B;  3BB9 A;  4WHA A;  2CW9 A;  2CC3 A;  1K28 A;  3L0R A;  1GS3 A;  2LQV A;  3CCQ 3;  3IJE B;  2O3O A;  4STD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...