3UB1A

Ntf2 like protein involved in plasmid conjugation
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
251
structure length
248
Chain Sequence
SLETQAFSFAEEFAWDYFSRYPSDTQDFVRRITKYTTEQLANEMNNGTYSDVIYTSAFYFEKYSENQVNVSVKARVRVYTPKAGQEQDQLQYDTNLVDYYLEVPIVFDKDMNMAVDALPVMTAPPEKAYFKNKEFSGTSENDADKTKKITDSVSQFFKAYYEQNQTQIDYFLVDGADIKGAGQKFSFNKIDRINIYKLSDKEFLAIVDLNVDSFGNAIKQGFNLTVVQEGDKFLVKTLEPRTSNIDLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords ORF13-like protein
publication title The conjugation protein TcpC from Clostridium perfringens is structurally related to the type IV secretion system protein VirB8 from Gram-negative bacteria.
pubmed doi rcsb
source organism Clostridium perfringens
total genus 53
structure length 248
sequence length 251
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12642 TpcC Conjugative transposon protein TcpC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.540 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ub1A02
3.10.450.540 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ub1A01
4EC6A 3UB1A
chains in the Genus database with same CATH superfamily
2O9UX 4R9LA 1K28A 4Q53A 4KT3B 3T8NA 2F56A 1L5GB 2K3DA 4L8PA 1DVCA 1G96A 1R4YA 3MPHA 3GSPA 3ROBA 4FCMA 2QGUA 1IT8A 1TUHA 4X2OA 3DGYA 5AIHA 1J2BA 1LOVA 5FW5A 2M7OA 3CCR3 4X2HA 2W56A 4K1UA 1LOWA 1UGIA 1WMOA 4HVNA 1QALA 3BU4A 1Q42A 2GBXB 4FMCA 4R9KA 3I0YA 2GBWB 3F7XA 1IVWA 1DMNA 2BO9B 2HMNB 3HOHA 4LEHA 4ILFA 1C54A 4HM4B 5BXQA 1BSAA 1IQXA 2BIRA 2BMOB 3AGOA 3CC73 1BNRA 3NM2A 4J5KA 3RNTA 3ZG0A 2JQ5A 4L8OA 3F8XA 3FH1A 2LYXA 2IUJA 2CW9A 1FUTA 1E97A 1SIIA 2KF3A 1BU4A 2CFDA 4HZBB 3EJVA 3K5TA 2W9QA 4O3VA 4KFEA 1JBTA 4N6UA 5D82A 3AGNA 3QK9A 1YGEA 2OOVA 1FGMA 8RNTA 3IJEB 1RHLA 1S723 2IMJA 3CCV3 4N3VA 1I3FA 3KE7A 5AYSC 1RGLA 3JUMA 4RNTA 4KZ1A 5TGNA 4KFFA 4N6LA 2XGNA 3ZG5A 2XSOB 4RZMA 1GOUA 1A67A 1W01A 2BNGA 1TP6A 4WFOA 2J8XB 3B4OA 4IPBA 5M19A 3GWRA 3K63A 3LTDA 1DVDA 2Z76A 1D6ZA 1CYUA 3OWUA 2H0HA 5EVHA 3GZBA 2CKFB 3SX1A 3T8UA 3PXMA 1BNJA 3G8ZA 1BRNL 5KP4A 1N9EA 2F5MA 1N8QA 1HZ1A 2OTJ3 2OWPA 3AHWA 3WHOA 1M9GA 4MEIA 3FSDA 4N6MA 4EV5A 1B2ZA 4EV2A 2GU3A 4ORLA 5A0OB 1LQMB 3NBRA 1UUWB 4JRFA 1Q40B 2R4IA 1GMPA 4HM3B 1N5HA 4OK0A 3URPA 5IF6A 1UCKA 2IUKA 2P09A 3LZAA 1UI7A 2CG1A 4HJLB 3OX9A 1SPUA 2CWVA 1BNIA 1X1WA 1CEWI 1C7HA 1OUNA 1B20A 1I3IA 3G0KA 1NNVA 1D6UA 1BRJA 1HYFA 1RN7A 1I2FA 3F40A 1ZGXA 2YFLB 1YVSA 4XBTA 2W56B 2A15A 2XGLA 3OV4A 3CD63 3LTCA 1RJOA 5IEOA 1X1XA 1FGQA 1SARA 3BIRA 1B2SA 3Q90A 4FMAA 3RDEA 2HMLB 1JB5A 1OGZA 1ULIB 1BNSA 1IDPA 2E2VA 2CC3A 5CK6A 4CCVA 1BRKA 1CYVA 4HM7B 3CC23 3FLJA 3NV0B 4NPBA 1CH0A 1B27A 3V98A 1JNQA 1OPYA 1TFKA 3O8YA 5IG3A 1YIT3 1O7NB 1UCJA 4R80A 3SYUA 3N9HA 2L1SA 3A76A 3HK4A 3DGMA 1A2KA 3EHCA 1Q824 2W03A 3KFQC 1SIHA 4BTXA 3F9SA 1BIRA 1OHSA 3J7Yd 1PFPA 2BMQB 3U97A 4HM2B 1VQ53 2SBLA 3D79A 3V99A 1OHOA 3KIIA 5AI1A 1M904 3CNXA 1GOYA 1BGSA 1I0VA 1W7CA 1X1UA 2Z7AA 3D3LA 2K54A 1KWIA 3LT8A 5LC7A 3X3YA 1VQP3 1Q864 2H0IA 1PYLA 1UUVB 3KSPA 2XFSA 1MGRA 3NUVA 3KSED 2W6JH 4L7KA 5M1AA 2F86B 1IU7A 4HKVB 1JRQA 1VQO3 1IYYA 2MF7A 3SVAA 1JZDA 2I9WA 3BB9A 3JUQA 1JB2A 2CFWA 4XDWA 4EYCA 5JPUA 4ZM8A 4J8TA 1KC84 1GY7A 4K1VA 2C4BA 4I4KA 4MMYB 3OXAA 4HZ9B 4O02B 3EQQB 2Z77A 4KVHA 1BRSA 5FGOA 2W2CA 4RBNA 1WMPA 3NQYA 1B2XA 3FF0A 2BHMA 3FF2A 4H61A 3SOYA 1N5PA 3OWYA 7RNTA 1RTUA 2O3OA 1B2MA 3DH2A 2CFKA 1BSCA 4LSOA 2F4YA 2HMKB 3EX9A 1MGWA 3TDGA 3BNBA 1AY7A 1NDOB 7STDA 3SXXA 4XM4A 1O7MB 1AV4A 2CHCA 3V92A 4CPKA 4HM0B 1GD3A 1BRHA 3NV0A 5ELUA 1BNEA 2ML6A 3LXUX 3AMOB 3JUPA 2OQEC 1GD4A 2JDIH 5EEOA 4FCJA 2LQVA 3U1WA 4XDVA 3EN8A 4FR9A 4MMZB 1GY6A 4AKYA 3N8BA 3E99A 1VQQA 1FYSA 1FUSA 1NB3I 2UGIA 2Y74A 1VQ73 1I8VA 2KF6A 1EEJA 2HMOB 2P38A 3LT9A 3MWZA 2D1WA 1ZO2A 1Q7HA 2CIUA 5D83A 1JBRA 3DZLA 1OF5A 1G02A 1US1A 4N6NB 3D5GA 5G1LA 3G6E3 1RNBA 2CFLA 4R4KA 1K41A 4GL6A 3FKAA 3UJMA 1LRAA 3EN1B 4OVMA 2R41A 3GZRA 3CXC2 1RRHA 3SOAA 3DGOA 3WMDA 2V1LA 3I563 1GMRA 1JV2B 2WGQA 3JVCA 2GU1A 1IVVA 1OHPA 1FA3A 3PCRA 3MSOA 4MJDA 1IV7A 2F5WA 1O7HB 1YIJ3 5IG4A 1S5AA 1W02A 2D42A 1V57A 2W04A 3NHXA 1TRQA 2PZVA 4EW5A 4CJNA 1KD14 2HOHA 4RNZA 2AAEA 5JPPA 1Q7Y4 1GSPA 1N8R4 1RGAA 1QJGA 3F8HA 5KP3A 3SLUA 6GSPA 3UB1A 1RGFA 1DETA 1UW1A 1BUQA 1LOYA 2CH9A 3KN4A 1JKGA 1WMNA 2INXA 1Z1SA 3Q2PA 2ZDJA 4GB5A 2KF4A 4BU4A 3EC9A 4HYZA 4GHOA 4AEQA 5BIRA 2FXTA 1TFOA 1KQS2 4FMDA 2YFIB 1UCIA 1RNTA 1F8NA 4LGQA 1YGWA 2C11A 4XB5A 4WWUC 3UNLA 1BSBA 1W6GA 3D5IA 3K9MC 3LOYA 3WODG 3WR2A 3CME3 4GSPA 4N6V0 1K9M4 1VZZA 4J9AA 1RRLA 4BL3A 1BAOA 5G1KA 2IYJA 1BRGA 2XF3A 3KKGA 1OH0A 3NX0A 5RNTA 4RNYA 2P0MA 5CF2A 2CK3H 2OCTA 1A2PA 1GYBA 2CX0A 1JBSA 3AMOA 1B2UA 1BVIA 4J5GA 4OUQA 8CHOA 1QVF2 2E2TA 1FGOA 2CG0A 5DRVA 1NB5I 4STDA 3X40A 3EBTA 1K734 3CC43 3I553 2H0GA 1RCLA 3CCS3 1E3RA 2MC8A 1DMMA 1RN1A 2XSHB 4XBXA 5HGRA 1STDA 1ZS7A 4I5QA 4O2HA 1U8CB 2BT3A 5AYRB 5KP1A 4BTWA 3S67A 3STDA 4HBRA 1DMQA 3BNEA 1JN5B 1RGGA 1IQ8A 3VF1A 3D9RA 3OWSA 3LTBA 3SEDA 1BUJA 2WO0A 6RNTA 2UUGC 3S27A 1AR0A 2PNCA 4AKZA 1IV9A 5STDA 1RDSA 1WTHA 3WDGB 5CLKA 1JJ22 3X41A 1OF5B 3B7CA 5BU4A 5M18A 2KF5A 4LZIA 4KFDA 1IK3A 1IT7A 2GEYA 2KAAA 1O7GB 1BNGA 1FZUA 2CWTA 2BMRB 1RGHA 4DKIA 3DXOA 3F14A 1WQLB 1M1K4 3EF8A 1G0TA 2OQEA 3A5EA 1I0XA 5LC6A 1RLSA 1TRPA 3K0ZA 4HM6B 3X3XA 1ROAA 3Q3FA 1U5OA 3MYTA 4TX4A 2OTL3 3UL6A 3MG1A 3NBJA 1BNFA 1VQM3 1EKMA 2UX0A 4U13A 3PGBA 3S29A 1BSDA 1JKGB 2B1XB 1MWSA 1LNHA 1UI8A 3WOEB 1W4NA 3FG4A 3ZFZA 2F99A 3PCSA 1QAFA 1PU4A 1RCKA 1KSIA 2WGOA 2XEPA 1STFI 4FMBA 1EUIC 3GZXB 2QA43 3S28A 2XRXB 5D81A 2W9PA 1GY5A 2XR8B 3BNDA 3MHEA 1YJ93 5BVBA 2YFJB 3Q1CA 1VQ83 3NQZA 1M1XB 1T2IA 3LH4A 3S5CA 4FCZA 3CCQ3 1NO3A 3CCL3 2E2UA 1TJDA 1LVNA 5JBSA 3PS8A 3L0RA 4EBGA 1QAKA 1EA2A 3EBYA 3M8CA 4N6OB 1RN4A 3BLZA 3KCHA 3NBBA 2P05A 1DYUA 1JN5A 1RGEA 1YNVX 3HX8A 1V58A 1ASKA 1K8A4 1TTOA 1Y4KA 1Q9EA 3NXJA 3DGNA 3EE1A 4H3UA 2IY2A 1Q814 4HAAA 3G4S3 3VGNA 5IERA 1B21A 5CXOA 3CCE3 2GSPA 1RGKA 1VQ43 1B3SA 2ZA4A 1I2EA 3CPOA 7GSPA 3CMA3 3IMAB 3F7SA 3G16A 4BL2A 4NHFA 1QMAA 3CU3A 2STDA 1RMSA 2QEX3 3WOFB 3WA3A 1EQKA 1NU3A 3HIGA 3GZYB 1JZOA 4N6TA 1R4CA 2C10A 1DE3A 3X3ZA 1LXEA 1T3BA 4QWTA 5EQLA 4BTYA 5AIFA 1A2VA 2RGQA 3KZTA 5HOHA 1RKYA 4NREA 2RNTA 1VQ63 4HM1B 1NWWA 4MMXB 1I70A 1AVKA 4WYKA 1O7PB 3JUNA 1W6CA 1GMQA 2QIYA 5AIIA 1FW7A 2P0XA 1MNLA 1UUGB 3H3HA 1TIJA 1YJN3 1HKXA 2L4VA 1W2ZA 5IEPA 2W0QA 4HM8B 3CCU3 3IPTA 2WOHA 2CX1A 3HIIA 3CCJ3 1T2HA 3H51A 3LMLA 3QRDA 5IENA 1VQK3 1D6YA 2AADA 2KCDA 4IT7A 5AEUB 3VSYA 4K90B 1SJWA 1MOLA 2FNQA 1BSEA 1IVUA 3JUOA 1MWRA 3NM7A 3N54B 1ISKA 2KRTA 3GAXA 1X1YA 4BIRA 1W6YA 3DGLA 3DY5A 6STDA 1FGTA 2GXFA 2ML5A 5G2GA 1OCVA 2OOVC 1YHQ3 5IW9A 5ELJA 1RSNA 3OW22 3UL5A 1HU9A 2WOFA 1I2GA 4PEJA 1YJW3 3RGAA 1W00A 5DREA 2BU4A 4HOHA 3ER7A 3DMCA 4WP5A 1T5YA 1V74A 1W2B2 5I97A 2IA7A 2F98A 3X42A 1NJI4 3DM8A 1N9JA 2FGTA 1BRIA 1YVBI 2YX9A 3B8LA 2B24B 3HZPA 4XBYA 4WHAA 1PY3A 5IG0A 1AVLA 1IVXA 4EXRA 3AHSA 1AQZA 1FGRA 2XH9A 2Z6BA 1W5ZA 2RSXA 2Q07A 2KXGA 3CCM3 5GSPA 1FUWA 4CDLA 3ECFA 4LYLB 5AEWB 3RGRA 5IG5A 1IQYA 1ROVA 1UCLA 3BNCA 2Y73A 1OACA 4K61A 2ZHXB 1VQN3 2XFTA 9RNTA 4R1KA 3DUKA 2RFRA 2RBIA 1UDII 1OGXA 3EB8A 1MWUA 2RCDA 3PZWA 2GEXA 1VQL3 3MG2A 1ZX2A 2SARA 1BANA 1UGHI 4LMIA 3CPW2 2HMMB 4IIAA 5AIGA 1QVG2 1BOXA 3ALAA 1MWTA 3HI7A 3LYGA 3MG3A 3WA2X 4EC6A 1O7WB 3K7CA 1VQ93 1GOVA 3T0UA 3GRDA 1A90A 3B4PA 3FGYA 3CNMA 1LNIA 4WYKB 3G713 1CQSA 1LQGC 1WNHA 1ULJB 4O8SA 1YI23 1E3VA 3FZWA 4G1MB 4HM5B 1SQWA 2HMJB 1TU5A 1EG9B 1LOXA 2K0MA 2CWUA 3FCSB 1RGCA 2ZL8A 1Q40A 3D4AA 1GS3A 3LTAA 3FG3A 3MKIA 4JF8A 5CF1A 3PYJA 2CFGA 1JB4A 3FG1A
chains in the Genus database with same CATH topology
2O9UX 4R9LA 1K28A 4Q53A 3T8NA 1L5GB 4L8PA 1DVCA 1G96A 3MPHA 3ROBA 4FCMA 2QGUA 1IT8A 1TUHA 4X2OA 5AIHA 5FW5A 2M7OA 3CCR3 4X2HA 2W56A 4K1UA 1WMOA 4HVNA 1QALA 1Q42A 2GBXB 4FMCA 4R9KA 3I0YA 2GBWB 3F7XA 1IVWA 1DMNA 2BO9B 2HMNB 4LEHA 4HM4B 5BXQA 1IQXA 2BMOB 3CC73 3NM2A 2JQ5A 4L8OA 3F8XA 3FH1A 2LYXA 2IUJA 2CW9A 1E97A 1SIIA 2CFDA 4HZBB 3EJVA 3K5TA 2W9QA 4O3VA 4KFEA 4N6UA 5D82A 3QK9A 1YGEA 2OOVA 1FGMA 3IJEB 1S723 2IMJA 3CCV3 4N3VA 3KE7A 5AYSC 3JUMA 5TGNA 4KZ1A 4KFFA 4N6LA 2XGNA 2XSOB 4RZMA 1W01A 2BNGA 1TP6A 4WFOA 3B4OA 4IPBA 1DVDA 3GWRA 3K63A 3LTDA 2Z76A 1D6ZA 1CYUA 3OWUA 5EVHA 3GZBA 2CKFB 3SX1A 3T8UA 3PXMA 3G8ZA 5KP4A 1N9EA 1N8QA 2OTJ3 2OWPA 1M9GA 4MEIA 3FSDA 4N6MA 4EV5A 4EV2A 2GU3A 4ORLA 5A0OB 3NBRA 1UUWB 4JRFA 1Q40B 2R4IA 4HM3B 1N5HA 4OK0A 5IF6A 2IUKA 2P09A 3LZAA 1UI7A 2CG1A 4HJLB 3OX9A 1SPUA 2CWVA 1CEWI 1C7HA 1OUNA 3G0KA 1D6UA 1RN7A 3F40A 2YFLB 4XBTA 2W56B 2A15A 2XGLA 3OV4A 3CD63 3LTCA 1RJOA 5IEOA 1FGQA 3Q90A 4FMAA 3RDEA 2HMLB 1JB5A 1OGZA 1ULIB 1IDPA 2E2VA 5CK6A 2CC3A 4CCVA 3CC23 1CYVA 4HM7B 3FLJA 3NV0B 3V98A 1JNQA 1OPYA 1TFKA 3O8YA 5IG3A 1YIT3 1O7NB 4R80A 3N9HA 3A76A 3HK4A 3DGMA 1A2KA 3EHCA 1Q824 2W03A 3KFQC 1SIHA 4BTXA 3F9SA 1OHSA 3J7Yd 1PFPA 2BMQB 3U97A 4HM2B 1VQ53 2SBLA 3V99A 1OHOA 3KIIA 5AI1A 1M904 3CNXA 3D3LA 1W7CA 3LT8A 2Z7AA 3X3YA 2K54A 1KWIA 5LC7A 1VQM3 1VQP3 1Q864 1UUVB 3KSPA 2XFSA 3NUVA 3KSED 2W6JH 4L7KA 2F86B 1IU7A 4HKVB 1JRQA 1VQO3 2MF7A 3SVAA 3BB9A 2I9WA 3JUQA 1JB2A 2CFWA 4XDWA 4EYCA 5JPUA 4ZM8A 4J8TA 1KC84 1GY7A 4K1VA 4I4KA 4MMYB 3OXAA 4HZ9B 4O02B 3EQQB 2Z77A 4KVHA 5FGOA 2W2CA 4RBNA 1WMPA 3NQYA 3FF0A 2BHMA 3FF2A 4H61A 3SOYA 1N5PA 3OWYA 2O3OA 2CFKA 4LSOA 2HMKB 3EX9A 3TDGA 3BNBA 1NDOB 7STDA 3SXXA 4XM4A 1O7MB 1AV4A 2CHCA 3V92A 4HM0B 1GD3A 3NV0A 5ELUA 2ML6A 3LXUX 3AMOB 3JUPA 2OQEC 1GD4A 2JDIH 5EEOA 4FCJA 2LQVA 3U1WA 4XDVA 3EN8A 4FR9A 4MMZB 1GY6A 4AKYA 3N8BA 3E99A 1NB3I 2Y74A 1VQ73 2HMOB 2P38A 3LT9A 3MWZA 2D1WA 1ZO2A 2CIUA 5D83A 3DZLA 1OF5A 1US1A 4N6NB 3G6E3 2CFLA 4R4KA 1K41A 4GL6A 3FKAA 3UJMA 3EN1B 4OVMA 3GZRA 3CXC2 1RRHA 3SOAA 3DGOA 3WMDA 2V1LA 3I563 1JV2B 2WGQA 3JVCA 2GU1A 1IVVA 1OHPA 1FA3A 3PCRA 3MSOA 4MJDA 1IV7A 1O7HB 1YIJ3 5IG4A 1S5AA 1W02A 2D42A 1KD14 2W04A 3NHXA 2PZVA 4RNZA 1Q7Y4 1A67A 5JPPA 1N8R4 5KP3A 1QJGA 3F8HA 3SLUA 3UB1A 1BUQA 1UW1A 2CH9A 3KN4A 1JKGA 1WMNA 2INXA 1Z1SA 3Q2PA 2ZDJA 4GB5A 3EC9A 4HYZA 4AEQA 2FXTA 1TFOA 1KQS2 4FMDA 2YFIB 1F8NA 4LGQA 2C11A 4XB5A 1J2BA 4WWUC 3UNLA 3LOYA 1W6GA 3K9MC 3CME3 3WODG 1K9M4 4N6V0 1VZZA 4J9AA 1RRLA 3NX0A 3KKGA 2XF3A 1OH0A 4RNYA 2P0MA 5CF2A 2CK3H 2OCTA 1GYBA 3AMOA 4OUQA 8CHOA 1QVF2 2E2TA 1FGOA 2CG0A 5DRVA 1NB5I 4STDA 3X40A 3EBTA 1K734 3CC43 3I553 3CCS3 1E3RA 2MC8A 1DMMA 2XSHB 4XBXA 5HGRA 1STDA 4O2HA 1U8CB 2BT3A 5AYRB 5KP1A 4BTWA 3S67A 3STDA 4HBRA 1DMQA 3BNEA 1JN5B 3VF1A 1IQ8A 3D9RA 3OWSA 3LTBA 3SEDA 2WO0A 3S27A 1AR0A 2PNCA 4AKZA 1IV9A 5STDA 1WTHA 3WDGB 5CLKA 1JJ22 3X41A 1OF5B 3B7CA 4LZIA 4KFDA 1IK3A 1IT7A 2GEYA 1O7GB 2CWTA 2BMRB 3DXOA 3F14A 1WQLB 1M1K4 3EF8A 2OQEA 5LC6A 3K0ZA 4HM6B 3X3XA 1ROAA 1U5OA 3MYTA 4TX4A 2OTL3 3UL6A 3MG1A 3NBJA 1EKMA 2UX0A 4U13A 3PGBA 3S29A 1JKGB 2B1XB 3WOEB 1LNHA 1UI8A 1W4NA 3FG4A 2F99A 3PCSA 1QAFA 1PU4A 2XEPA 1KSIA 2WGOA 1STFI 4FMBA 3GZXB 2QA43 3S28A 2XRXB 5D81A 2W9PA 1GY5A 2XR8B 3BNDA 3MHEA 1YJ93 5BVBA 2YFJB 3Q1CA 1VQ83 3NQZA 1M1XB 3LH4A 3S5CA 4FCZA 3CCQ3 1NO3A 3CCL3 2E2UA 1LVNA 5JBSA 3PS8A 3L0RA 4EBGA 1QAKA 1EA2A 3EBYA 3M8CA 4N6OB 3BLZA 3NBBA 2P05A 1DYUA 1JN5A 3HX8A 1ASKA 1K8A4 1Y4KA 3NXJA 3DGNA 3EE1A 4H3UA 1Q814 3G4S3 3VGNA 5IERA 5CXOA 3CCE3 1VQ43 3CPOA 3CMA3 3IMAB 3F7SA 3G16A 4NHFA 1QMAA 3CU3A 2STDA 2QEX3 3WOFB 3WA3A 1EQKA 1NU3A 3HIGA 3GZYB 4N6TA 1R4CA 2C10A 3X3ZA 1LXEA 4QWTA 5EQLA 4BTYA 5AIFA 1A2VA 2RGQA 3KZTA 1RKYA 4NREA 1VQ63 4HM1B 1NWWA 4MMXB 1AVKA 4WYKA 1O7PB 3JUNA 1W6CA 2QIYA 5AIIA 2P0XA 1MNLA 3H3HA 1TIJA 1YJN3 1HKXA 2L4VA 1W2ZA 5IEPA 2W0QA 4HM8B 3CCU3 3IPTA 2WOHA 3HIIA 3CCJ3 3H51A 3LMLA 3QRDA 5IENA 1VQK3 1D6YA 4IT7A 2KCDA 5AEUB 3VSYA 4K90B 1SJWA 1MOLA 2FNQA 1IVUA 3JUOA 3NM7A 3N54B 1ISKA 2KRTA 3GAXA 1W6YA 3DGLA 3DY5A 6STDA 1FGTA 2GXFA 2ML5A 5G2GA 1OCVA 2OOVC 1YHQ3 5IW9A 5ELJA 3OW22 3UL5A 1HU9A 2WOFA 4PEJA 1YJW3 3RGAA 1W00A 5DREA 3ER7A 3DMCA 4WP5A 1T5YA 1V74A 1W2B2 5I97A 2IA7A 2F98A 3X42A 1NJI4 3DM8A 1N9JA 2FGTA 2YX9A 1YVBI 3B8LA 3HZPA 2B24B 4XBYA 4WHAA 5IG0A 1AVLA 1IVXA 4EXRA 1FGRA 2XH9A 2Z6BA 1W5ZA 2RSXA 2Q07A 2KXGA 3CCM3 1FUWA 4CDLA 3ECFA 5AEWB 3RGRA 5IG5A 1IQYA 1ROVA 3BNCA 2Y73A 1OACA 4K61A 1VQN3 2XFTA 4R1KA 3DUKA 2RFRA 1OGXA 3EB8A 2RCDA 3PZWA 2GEXA 1VQL3 3MG2A 1ZX2A 4LMIA 3CPW2 2HMMB 4IIAA 5AIGA 1QVG2 3ALAA 3LYGA 3HI7A 3MG3A 3WA2X 4EC6A 1O7WB 3K7CA 1VQ93 3T0UA 3GRDA 1A90A 3B4PA 3FGYA 3CNMA 4WYKB 3G713 1CQSA 1WNHA 4O8SA 1ULJB 1YI23 1E3VA 3FZWA 4G1MB 4HM5B 1SQWA 2HMJB 1TU5A 1EG9B 1LOXA 2K0MA 2CWUA 3FCSB 2ZL8A 1Q40A 1GS3A 3LTAA 3FG3A 3MKIA 4JF8A 5CF1A 3PYJA 2CFGA 1JB4A 3FG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EC6 A;  3UB1 A; 
#chains in the Genus database with same CATH topology
 2O9U X;  4R9L A;  1K28 A;  4Q53 A;  4KT3 B;  3T8N A;  2F56 A;  1L5G B;  2K3D A;  4L8P A;  1DVC A;  1G96 A;  1R4Y A;  3MPH A;  3GSP A;  3ROB A;  4FCM A;  2QGU A;  1IT8 A;  1TUH A;  4X2O A;  3DGY A;  5AIH A;  1J2B A;  1LOV A;  5FW5 A;  2M7O A;  3CCR 3;  4X2H A;  2W56 A;  4K1U A;  1LOW A;  1UGI A;  1WMO A;  4HVN A;  1QAL A;  3BU4 A;  1Q42 A;  2GBX B;  4FMC A;  4R9K A;  3I0Y A;  2GBW B;  3F7X A;  1IVW A;  1DMN A;  2BO9 B;  2HMN B;  3HOH A;  4LEH A;  4ILF A;  1C54 A;  4HM4 B;  5BXQ A;  1BSA A;  1IQX A;  2BIR A;  2BMO B;  3AGO A;  3CC7 3;  1BNR A;  3NM2 A;  4J5K A;  3RNT A;  3ZG0 A;  2JQ5 A;  4L8O A;  3F8X A;  3FH1 A;  2LYX A;  2IUJ A;  2CW9 A;  1FUT A;  1E97 A;  1SII A;  2KF3 A;  1BU4 A;  2CFD A;  4HZB B;  3EJV A;  3K5T A;  2W9Q A;  4O3V A;  4KFE A;  1JBT A;  4N6U A;  5D82 A;  3AGN A;  3QK9 A;  1YGE A;  2OOV A;  1FGM A;  8RNT A;  3IJE B;  1RHL A;  1S72 3;  2IMJ A;  3CCV 3;  4N3V A;  1I3F A;  3KE7 A;  5AYS C;  1RGL A;  3JUM A;  4RNT A;  4KZ1 A;  5TGN A;  4KFF A;  4N6L A;  2XGN A;  3ZG5 A;  2XSO B;  4RZM A;  1GOU A;  1A67 A;  1W01 A;  2BNG A;  1TP6 A;  4WFO A;  2J8X B;  3B4O A;  4IPB A;  5M19 A;  3GWR A;  3K63 A;  3LTD A;  1DVD A;  2Z76 A;  1D6Z A;  1CYU A;  3OWU A;  2H0H A;  5EVH A;  3GZB A;  2CKF B;  3SX1 A;  3T8U A;  3PXM A;  1BNJ A;  3G8Z A;  1BRN L;  5KP4 A;  1N9E A;  2F5M A;  1N8Q A;  1HZ1 A;  2OTJ 3;  2OWP A;  3AHW A;  3WHO A;  1M9G A;  4MEI A;  3FSD A;  4N6M A;  4EV5 A;  1B2Z A;  4EV2 A;  2GU3 A;  4ORL A;  5A0O B;  1LQM B;  3NBR A;  1UUW B;  4JRF A;  1Q40 B;  2R4I A;  1GMP A;  4HM3 B;  1N5H A;  4OK0 A;  3URP A;  5IF6 A;  1UCK A;  2IUK A;  2P09 A;  3LZA A;  1UI7 A;  2CG1 A;  4HJL B;  3OX9 A;  1SPU A;  2CWV A;  1BNI A;  1X1W A;  1CEW I;  1C7H A;  1OUN A;  1B20 A;  1I3I A;  3G0K A;  1NNV A;  1D6U A;  1BRJ A;  1HYF A;  1RN7 A;  1I2F A;  3F40 A;  1ZGX A;  2YFL B;  1YVS A;  4XBT A;  2W56 B;  2A15 A;  2XGL A;  3OV4 A;  3CD6 3;  3LTC A;  1RJO A;  5IEO A;  1X1X A;  1FGQ A;  1SAR A;  3BIR A;  1B2S A;  3Q90 A;  4FMA A;  3RDE A;  2HML B;  1JB5 A;  1OGZ A;  1ULI B;  1BNS A;  1IDP A;  2E2V A;  2CC3 A;  5CK6 A;  4CCV A;  1BRK A;  1CYV A;  4HM7 B;  3CC2 3;  3FLJ A;  3NV0 B;  4NPB A;  1CH0 A;  1B27 A;  3V98 A;  1JNQ A;  1OPY A;  1TFK A;  3O8Y A;  5IG3 A;  1YIT 3;  1O7N B;  1UCJ A;  4R80 A;  3SYU A;  3N9H A;  2L1S A;  3A76 A;  3HK4 A;  3DGM A;  1A2K A;  3EHC A;  1Q82 4;  2W03 A;  3KFQ C;  1SIH A;  4BTX A;  3F9S A;  1BIR A;  1OHS A;  3J7Y d;  1PFP A;  2BMQ B;  3U97 A;  4HM2 B;  1VQ5 3;  2SBL A;  3D79 A;  3V99 A;  1OHO A;  3KII A;  5AI1 A;  1M90 4;  3CNX A;  1GOY A;  1BGS A;  1I0V A;  1W7C A;  1X1U A;  2Z7A A;  3D3L A;  2K54 A;  1KWI A;  3LT8 A;  5LC7 A;  3X3Y A;  1VQP 3;  1Q86 4;  2H0I A;  1PYL A;  1UUV B;  3KSP A;  2XFS A;  1MGR A;  3NUV A;  3KSE D;  2W6J H;  4L7K A;  5M1A A;  2F86 B;  1IU7 A;  4HKV B;  1JRQ A;  1VQO 3;  1IYY A;  2MF7 A;  3SVA A;  1JZD A;  2I9W A;  3BB9 A;  3JUQ A;  1JB2 A;  2CFW A;  4XDW A;  4EYC A;  5JPU A;  4ZM8 A;  4J8T A;  1KC8 4;  1GY7 A;  4K1V A;  2C4B A;  4I4K A;  4MMY B;  3OXA A;  4HZ9 B;  4O02 B;  3EQQ B;  2Z77 A;  4KVH A;  1BRS A;  5FGO A;  2W2C A;  4RBN A;  1WMP A;  3NQY A;  1B2X A;  3FF0 A;  2BHM A;  3FF2 A;  4H61 A;  3SOY A;  1N5P A;  3OWY A;  7RNT A;  1RTU A;  2O3O A;  1B2M A;  3DH2 A;  2CFK A;  1BSC A;  4LSO A;  2F4Y A;  2HMK B;  3EX9 A;  1MGW A;  3TDG A;  3BNB A;  1AY7 A;  1NDO B;  7STD A;  3SXX A;  4XM4 A;  1O7M B;  1AV4 A;  2CHC A;  3V92 A;  4CPK A;  4HM0 B;  1GD3 A;  1BRH A;  3NV0 A;  5ELU A;  1BNE A;  2ML6 A;  3LXU X;  3AMO B;  3JUP A;  2OQE C;  1GD4 A;  2JDI H;  5EEO A;  4FCJ A;  2LQV A;  3U1W A;  4XDV A;  3EN8 A;  4FR9 A;  4MMZ B;  1GY6 A;  4AKY A;  3N8B A;  3E99 A;  1VQQ A;  1FYS A;  1FUS A;  1NB3 I;  2UGI A;  2Y74 A;  1VQ7 3;  1I8V A;  2KF6 A;  1EEJ A;  2HMO B;  2P38 A;  3LT9 A;  3MWZ A;  2D1W A;  1ZO2 A;  1Q7H A;  2CIU A;  5D83 A;  1JBR A;  3DZL A;  1OF5 A;  1G02 A;  1US1 A;  4N6N B;  3D5G A;  5G1L A;  3G6E 3;  1RNB A;  2CFL A;  4R4K A;  1K41 A;  4GL6 A;  3FKA A;  3UJM A;  1LRA A;  3EN1 B;  4OVM A;  2R41 A;  3GZR A;  3CXC 2;  1RRH A;  3SOA A;  3DGO A;  3WMD A;  2V1L A;  3I56 3;  1GMR A;  1JV2 B;  2WGQ A;  3JVC A;  2GU1 A;  1IVV A;  1OHP A;  1FA3 A;  3PCR A;  3MSO A;  4MJD A;  1IV7 A;  2F5W A;  1O7H B;  1YIJ 3;  5IG4 A;  1S5A A;  1W02 A;  2D42 A;  1V57 A;  2W04 A;  3NHX A;  1TRQ A;  2PZV A;  4EW5 A;  4CJN A;  1KD1 4;  2HOH A;  4RNZ A;  2AAE A;  5JPP A;  1Q7Y 4;  1GSP A;  1N8R 4;  1RGA A;  1QJG A;  3F8H A;  5KP3 A;  3SLU A;  6GSP A;  3UB1 A;  1RGF A;  1DET A;  1UW1 A;  1BUQ A;  1LOY A;  2CH9 A;  3KN4 A;  1JKG A;  1WMN A;  2INX A;  1Z1S A;  3Q2P A;  2ZDJ A;  4GB5 A;  2KF4 A;  4BU4 A;  3EC9 A;  4HYZ A;  4GHO A;  4AEQ A;  5BIR A;  2FXT A;  1TFO A;  1KQS 2;  4FMD A;  2YFI B;  1UCI A;  1RNT A;  1F8N A;  4LGQ A;  1YGW A;  2C11 A;  4XB5 A;  4WWU C;  3UNL A;  1BSB A;  1W6G A;  3D5I A;  3K9M C;  3LOY A;  3WOD G;  3WR2 A;  3CME 3;  4GSP A;  4N6V 0;  1K9M 4;  1VZZ A;  4J9A A;  1RRL A;  4BL3 A;  1BAO A;  5G1K A;  2IYJ A;  1BRG A;  2XF3 A;  3KKG A;  1OH0 A;  3NX0 A;  5RNT A;  4RNY A;  2P0M A;  5CF2 A;  2CK3 H;  2OCT A;  1A2P A;  1GYB A;  2CX0 A;  1JBS A;  3AMO A;  1B2U A;  1BVI A;  4J5G A;  4OUQ A;  8CHO A;  1QVF 2;  2E2T A;  1FGO A;  2CG0 A;  5DRV A;  1NB5 I;  4STD A;  3X40 A;  3EBT A;  1K73 4;  3CC4 3;  3I55 3;  2H0G A;  1RCL A;  3CCS 3;  1E3R A;  2MC8 A;  1DMM A;  1RN1 A;  2XSH B;  4XBX A;  5HGR A;  1STD A;  1ZS7 A;  4I5Q A;  4O2H A;  1U8C B;  2BT3 A;  5AYR B;  5KP1 A;  4BTW A;  3S67 A;  3STD A;  4HBR A;  1DMQ A;  3BNE A;  1JN5 B;  1RGG A;  1IQ8 A;  3VF1 A;  3D9R A;  3OWS A;  3LTB A;  3SED A;  1BUJ A;  2WO0 A;  6RNT A;  2UUG C;  3S27 A;  1AR0 A;  2PNC A;  4AKZ A;  1IV9 A;  5STD A;  1RDS A;  1WTH A;  3WDG B;  5CLK A;  1JJ2 2;  3X41 A;  1OF5 B;  3B7C A;  5BU4 A;  5M18 A;  2KF5 A;  4LZI A;  4KFD A;  1IK3 A;  1IT7 A;  2GEY A;  2KAA A;  1O7G B;  1BNG A;  1FZU A;  2CWT A;  2BMR B;  1RGH A;  4DKI A;  3DXO A;  3F14 A;  1WQL B;  1M1K 4;  3EF8 A;  1G0T A;  2OQE A;  3A5E A;  1I0X A;  5LC6 A;  1RLS A;  1TRP A;  3K0Z A;  4HM6 B;  3X3X A;  1ROA A;  3Q3F A;  1U5O A;  3MYT A;  4TX4 A;  2OTL 3;  3UL6 A;  3MG1 A;  3NBJ A;  1BNF A;  1VQM 3;  1EKM A;  2UX0 A;  4U13 A;  3PGB A;  3S29 A;  1BSD A;  1JKG B;  2B1X B;  1MWS A;  1LNH A;  1UI8 A;  3WOE B;  1W4N A;  3FG4 A;  3ZFZ A;  2F99 A;  3PCS A;  1QAF A;  1PU4 A;  1RCK A;  1KSI A;  2WGO A;  2XEP A;  1STF I;  4FMB A;  1EUI C;  3GZX B;  2QA4 3;  3S28 A;  2XRX B;  5D81 A;  2W9P A;  1GY5 A;  2XR8 B;  3BND A;  3MHE A;  1YJ9 3;  5BVB A;  2YFJ B;  3Q1C A;  1VQ8 3;  3NQZ A;  1M1X B;  1T2I A;  3LH4 A;  3S5C A;  4FCZ A;  3CCQ 3;  1NO3 A;  3CCL 3;  2E2U A;  1TJD A;  1LVN A;  5JBS A;  3PS8 A;  3L0R A;  4EBG A;  1QAK A;  1EA2 A;  3EBY A;  3M8C A;  4N6O B;  1RN4 A;  3BLZ A;  3KCH A;  3NBB A;  2P05 A;  1DYU A;  1JN5 A;  1RGE A;  1YNV X;  3HX8 A;  1V58 A;  1ASK A;  1K8A 4;  1TTO A;  1Y4K A;  1Q9E A;  3NXJ A;  3DGN A;  3EE1 A;  4H3U A;  2IY2 A;  1Q81 4;  4HAA A;  3G4S 3;  3VGN A;  5IER A;  1B21 A;  5CXO A;  3CCE 3;  2GSP A;  1RGK A;  1VQ4 3;  1B3S A;  2ZA4 A;  1I2E A;  3CPO A;  7GSP A;  3CMA 3;  3IMA B;  3F7S A;  3G16 A;  4BL2 A;  4NHF A;  1QMA A;  3CU3 A;  2STD A;  1RMS A;  2QEX 3;  3WOF B;  3WA3 A;  1EQK A;  1NU3 A;  3HIG A;  3GZY B;  1JZO A;  4N6T A;  1R4C A;  2C10 A;  1DE3 A;  3X3Z A;  1LXE A;  1T3B A;  4QWT A;  5EQL A;  4BTY A;  5AIF A;  1A2V A;  2RGQ A;  3KZT A;  5HOH A;  1RKY A;  4NRE A;  2RNT A;  1VQ6 3;  4HM1 B;  1NWW A;  4MMX B;  1I70 A;  1AVK A;  4WYK A;  1O7P B;  3JUN A;  1W6C A;  1GMQ A;  2QIY A;  5AII A;  1FW7 A;  2P0X A;  1MNL A;  1UUG B;  3H3H A;  1TIJ A;  1YJN 3;  1HKX A;  2L4V A;  1W2Z A;  5IEP A;  2W0Q A;  4HM8 B;  3CCU 3;  3IPT A;  2WOH A;  2CX1 A;  3HII A;  3CCJ 3;  1T2H A;  3H51 A;  3LML A;  3QRD A;  5IEN A;  1VQK 3;  1D6Y A;  2AAD A;  2KCD A;  4IT7 A;  5AEU B;  3VSY A;  4K90 B;  1SJW A;  1MOL A;  2FNQ A;  1BSE A;  1IVU A;  3JUO A;  1MWR A;  3NM7 A;  3N54 B;  1ISK A;  2KRT A;  3GAX A;  1X1Y A;  4BIR A;  1W6Y A;  3DGL A;  3DY5 A;  6STD A;  1FGT A;  2GXF A;  2ML5 A;  5G2G A;  1OCV A;  2OOV C;  1YHQ 3;  5IW9 A;  5ELJ A;  1RSN A;  3OW2 2;  3UL5 A;  1HU9 A;  2WOF A;  1I2G A;  4PEJ A;  1YJW 3;  3RGA A;  1W00 A;  5DRE A;  2BU4 A;  4HOH A;  3ER7 A;  3DMC A;  4WP5 A;  1T5Y A;  1V74 A;  1W2B 2;  5I97 A;  2IA7 A;  2F98 A;  3X42 A;  1NJI 4;  3DM8 A;  1N9J A;  2FGT A;  1BRI A;  1YVB I;  2YX9 A;  3B8L A;  2B24 B;  3HZP A;  4XBY A;  4WHA A;  1PY3 A;  5IG0 A;  1AVL A;  1IVX A;  4EXR A;  3AHS A;  1AQZ A;  1FGR A;  2XH9 A;  2Z6B A;  1W5Z A;  2RSX A;  2Q07 A;  2KXG A;  3CCM 3;  5GSP A;  1FUW A;  4CDL A;  3ECF A;  4LYL B;  5AEW B;  3RGR A;  5IG5 A;  1IQY A;  1ROV A;  1UCL A;  3BNC A;  2Y73 A;  1OAC A;  4K61 A;  2ZHX B;  1VQN 3;  2XFT A;  9RNT A;  4R1K A;  3DUK A;  2RFR A;  2RBI A;  1UDI I;  1OGX A;  3EB8 A;  1MWU A;  2RCD A;  3PZW A;  2GEX A;  1VQL 3;  3MG2 A;  1ZX2 A;  2SAR A;  1BAN A;  1UGH I;  4LMI A;  3CPW 2;  2HMM B;  4IIA A;  5AIG A;  1QVG 2;  1BOX A;  3ALA A;  1MWT A;  3HI7 A;  3LYG A;  3MG3 A;  3WA2 X;  4EC6 A;  1O7W B;  3K7C A;  1VQ9 3;  1GOV A;  3T0U A;  3GRD A;  1A90 A;  3B4P A;  3FGY A;  3CNM A;  1LNI A;  4WYK B;  3G71 3;  1CQS A;  1LQG C;  1WNH A;  1ULJ B;  4O8S A;  1YI2 3;  1E3V A;  3FZW A;  4G1M B;  4HM5 B;  1SQW A;  2HMJ B;  1TU5 A;  1EG9 B;  1LOX A;  2K0M A;  2CWU A;  3FCS B;  1RGC A;  2ZL8 A;  1Q40 A;  3D4A A;  1GS3 A;  3LTA A;  3FG3 A;  3MKI A;  4JF8 A;  5CF1 A;  3PYJ A;  2CFG A;  1JB4 A;  3FG1 A; 
#chains in the Genus database with same CATH homology
 2O9U X;  4R9L A;  1K28 A;  4Q53 A;  3T8N A;  1L5G B;  4L8P A;  1DVC A;  1G96 A;  3MPH A;  3ROB A;  4FCM A;  2QGU A;  1IT8 A;  1TUH A;  4X2O A;  5AIH A;  5FW5 A;  2M7O A;  3CCR 3;  4X2H A;  2W56 A;  4K1U A;  1WMO A;  4HVN A;  1QAL A;  1Q42 A;  2GBX B;  4FMC A;  4R9K A;  3I0Y A;  2GBW B;  3F7X A;  1IVW A;  1DMN A;  2BO9 B;  2HMN B;  4LEH A;  4HM4 B;  5BXQ A;  1IQX A;  2BMO B;  3CC7 3;  3NM2 A;  2JQ5 A;  4L8O A;  3F8X A;  3FH1 A;  2LYX A;  2IUJ A;  2CW9 A;  1E97 A;  1SII A;  2CFD A;  4HZB B;  3EJV A;  3K5T A;  2W9Q A;  4O3V A;  4KFE A;  4N6U A;  5D82 A;  3QK9 A;  1YGE A;  2OOV A;  1FGM A;  3IJE B;  1S72 3;  2IMJ A;  3CCV 3;  4N3V A;  3KE7 A;  5AYS C;  3JUM A;  5TGN A;  4KZ1 A;  4KFF A;  4N6L A;  2XGN A;  2XSO B;  4RZM A;  1W01 A;  2BNG A;  1TP6 A;  4WFO A;  3B4O A;  4IPB A;  1DVD A;  3GWR A;  3K63 A;  3LTD A;  2Z76 A;  1D6Z A;  1CYU A;  3OWU A;  5EVH A;  3GZB A;  2CKF B;  3SX1 A;  3T8U A;  3PXM A;  3G8Z A;  5KP4 A;  1N9E A;  1N8Q A;  2OTJ 3;  2OWP A;  1M9G A;  4MEI A;  3FSD A;  4N6M A;  4EV5 A;  4EV2 A;  2GU3 A;  4ORL A;  5A0O B;  3NBR A;  1UUW B;  4JRF A;  1Q40 B;  2R4I A;  4HM3 B;  1N5H A;  4OK0 A;  5IF6 A;  2IUK A;  2P09 A;  3LZA A;  1UI7 A;  2CG1 A;  4HJL B;  3OX9 A;  1SPU A;  2CWV A;  1CEW I;  1C7H A;  1OUN A;  3G0K A;  1D6U A;  1RN7 A;  3F40 A;  2YFL B;  4XBT A;  2W56 B;  2A15 A;  2XGL A;  3OV4 A;  3CD6 3;  3LTC A;  1RJO A;  5IEO A;  1FGQ A;  3Q90 A;  4FMA A;  3RDE A;  2HML B;  1JB5 A;  1OGZ A;  1ULI B;  1IDP A;  2E2V A;  5CK6 A;  2CC3 A;  4CCV A;  3CC2 3;  1CYV A;  4HM7 B;  3FLJ A;  3NV0 B;  3V98 A;  1JNQ A;  1OPY A;  1TFK A;  3O8Y A;  5IG3 A;  1YIT 3;  1O7N B;  4R80 A;  3N9H A;  3A76 A;  3HK4 A;  3DGM A;  1A2K A;  3EHC A;  1Q82 4;  2W03 A;  3KFQ C;  1SIH A;  4BTX A;  3F9S A;  1OHS A;  3J7Y d;  1PFP A;  2BMQ B;  3U97 A;  4HM2 B;  1VQ5 3;  2SBL A;  3V99 A;  1OHO A;  3KII A;  5AI1 A;  1M90 4;  3CNX A;  3D3L A;  1W7C A;  3LT8 A;  2Z7A A;  3X3Y A;  2K54 A;  1KWI A;  5LC7 A;  1VQM 3;  1VQP 3;  1Q86 4;  1UUV B;  3KSP A;  2XFS A;  3NUV A;  3KSE D;  2W6J H;  4L7K A;  2F86 B;  1IU7 A;  4HKV B;  1JRQ A;  1VQO 3;  2MF7 A;  3SVA A;  3BB9 A;  2I9W A;  3JUQ A;  1JB2 A;  2CFW A;  4XDW A;  4EYC A;  5JPU A;  4ZM8 A;  4J8T A;  1KC8 4;  1GY7 A;  4K1V A;  4I4K A;  4MMY B;  3OXA A;  4HZ9 B;  4O02 B;  3EQQ B;  2Z77 A;  4KVH A;  5FGO A;  2W2C A;  4RBN A;  1WMP A;  3NQY A;  3FF0 A;  2BHM A;  3FF2 A;  4H61 A;  3SOY A;  1N5P A;  3OWY A;  2O3O A;  2CFK A;  4LSO A;  2HMK B;  3EX9 A;  3TDG A;  3BNB A;  1NDO B;  7STD A;  3SXX A;  4XM4 A;  1O7M B;  1AV4 A;  2CHC A;  3V92 A;  4HM0 B;  1GD3 A;  3NV0 A;  5ELU A;  2ML6 A;  3LXU X;  3AMO B;  3JUP A;  2OQE C;  1GD4 A;  2JDI H;  5EEO A;  4FCJ A;  2LQV A;  3U1W A;  4XDV A;  3EN8 A;  4FR9 A;  4MMZ B;  1GY6 A;  4AKY A;  3N8B A;  3E99 A;  1NB3 I;  2Y74 A;  1VQ7 3;  2HMO B;  2P38 A;  3LT9 A;  3MWZ A;  2D1W A;  1ZO2 A;  2CIU A;  5D83 A;  3DZL A;  1OF5 A;  1US1 A;  4N6N B;  3G6E 3;  2CFL A;  4R4K A;  1K41 A;  4GL6 A;  3FKA A;  3UJM A;  3EN1 B;  4OVM A;  3GZR A;  3CXC 2;  1RRH A;  3SOA A;  3DGO A;  3WMD A;  2V1L A;  3I56 3;  1JV2 B;  2WGQ A;  3JVC A;  2GU1 A;  1IVV A;  1OHP A;  1FA3 A;  3PCR A;  3MSO A;  4MJD A;  1IV7 A;  1O7H B;  1YIJ 3;  5IG4 A;  1S5A A;  1W02 A;  2D42 A;  1KD1 4;  2W04 A;  3NHX A;  2PZV A;  4RNZ A;  1Q7Y 4;  1A67 A;  5JPP A;  1N8R 4;  5KP3 A;  1QJG A;  3F8H A;  3SLU A;  3UB1 A;  1BUQ A;  1UW1 A;  2CH9 A;  3KN4 A;  1JKG A;  1WMN A;  2INX A;  1Z1S A;  3Q2P A;  2ZDJ A;  4GB5 A;  3EC9 A;  4HYZ A;  4AEQ A;  2FXT A;  1TFO A;  1KQS 2;  4FMD A;  2YFI B;  1F8N A;  4LGQ A;  2C11 A;  4XB5 A;  1J2B A;  4WWU C;  3UNL A;  3LOY A;  1W6G A;  3K9M C;  3CME 3;  3WOD G;  1K9M 4;  4N6V 0;  1VZZ A;  4J9A A;  1RRL A;  3NX0 A;  3KKG A;  2XF3 A;  1OH0 A;  4RNY A;  2P0M A;  5CF2 A;  2CK3 H;  2OCT A;  1GYB A;  3AMO A;  4OUQ A;  8CHO A;  1QVF 2;  2E2T A;  1FGO A;  2CG0 A;  5DRV A;  1NB5 I;  4STD A;  3X40 A;  3EBT A;  1K73 4;  3CC4 3;  3I55 3;  3CCS 3;  1E3R A;  2MC8 A;  1DMM A;  2XSH B;  4XBX A;  5HGR A;  1STD A;  4O2H A;  1U8C B;  2BT3 A;  5AYR B;  5KP1 A;  4BTW A;  3S67 A;  3STD A;  4HBR A;  1DMQ A;  3BNE A;  1JN5 B;  3VF1 A;  1IQ8 A;  3D9R A;  3OWS A;  3LTB A;  3SED A;  2WO0 A;  3S27 A;  1AR0 A;  2PNC A;  4AKZ A;  1IV9 A;  5STD A;  1WTH A;  3WDG B;  5CLK A;  1JJ2 2;  3X41 A;  1OF5 B;  3B7C A;  4LZI A;  4KFD A;  1IK3 A;  1IT7 A;  2GEY A;  1O7G B;  2CWT A;  2BMR B;  3DXO A;  3F14 A;  1WQL B;  1M1K 4;  3EF8 A;  2OQE A;  5LC6 A;  3K0Z A;  4HM6 B;  3X3X A;  1ROA A;  1U5O A;  3MYT A;  4TX4 A;  2OTL 3;  3UL6 A;  3MG1 A;  3NBJ A;  1EKM A;  2UX0 A;  4U13 A;  3PGB A;  3S29 A;  1JKG B;  2B1X B;  3WOE B;  1LNH A;  1UI8 A;  1W4N A;  3FG4 A;  2F99 A;  3PCS A;  1QAF A;  1PU4 A;  2XEP A;  1KSI A;  2WGO A;  1STF I;  4FMB A;  3GZX B;  2QA4 3;  3S28 A;  2XRX B;  5D81 A;  2W9P A;  1GY5 A;  2XR8 B;  3BND A;  3MHE A;  1YJ9 3;  5BVB A;  2YFJ B;  3Q1C A;  1VQ8 3;  3NQZ A;  1M1X B;  3LH4 A;  3S5C A;  4FCZ A;  3CCQ 3;  1NO3 A;  3CCL 3;  2E2U A;  1LVN A;  5JBS A;  3PS8 A;  3L0R A;  4EBG A;  1QAK A;  1EA2 A;  3EBY A;  3M8C A;  4N6O B;  3BLZ A;  3NBB A;  2P05 A;  1DYU A;  1JN5 A;  3HX8 A;  1ASK A;  1K8A 4;  1Y4K A;  3NXJ A;  3DGN A;  3EE1 A;  4H3U A;  1Q81 4;  3G4S 3;  3VGN A;  5IER A;  5CXO A;  3CCE 3;  1VQ4 3;  3CPO A;  3CMA 3;  3IMA B;  3F7S A;  3G16 A;  4NHF A;  1QMA A;  3CU3 A;  2STD A;  2QEX 3;  3WOF B;  3WA3 A;  1EQK A;  1NU3 A;  3HIG A;  3GZY B;  4N6T A;  1R4C A;  2C10 A;  3X3Z A;  1LXE A;  4QWT A;  5EQL A;  4BTY A;  5AIF A;  1A2V A;  2RGQ A;  3KZT A;  1RKY A;  4NRE A;  1VQ6 3;  4HM1 B;  1NWW A;  4MMX B;  1AVK A;  4WYK A;  1O7P B;  3JUN A;  1W6C A;  2QIY A;  5AII A;  2P0X A;  1MNL A;  3H3H A;  1TIJ A;  1YJN 3;  1HKX A;  2L4V A;  1W2Z A;  5IEP A;  2W0Q A;  4HM8 B;  3CCU 3;  3IPT A;  2WOH A;  3HII A;  3CCJ 3;  3H51 A;  3LML A;  3QRD A;  5IEN A;  1VQK 3;  1D6Y A;  4IT7 A;  2KCD A;  5AEU B;  3VSY A;  4K90 B;  1SJW A;  1MOL A;  2FNQ A;  1IVU A;  3JUO A;  3NM7 A;  3N54 B;  1ISK A;  2KRT A;  3GAX A;  1W6Y A;  3DGL A;  3DY5 A;  6STD A;  1FGT A;  2GXF A;  2ML5 A;  5G2G A;  1OCV A;  2OOV C;  1YHQ 3;  5IW9 A;  5ELJ A;  3OW2 2;  3UL5 A;  1HU9 A;  2WOF A;  4PEJ A;  1YJW 3;  3RGA A;  1W00 A;  5DRE A;  3ER7 A;  3DMC A;  4WP5 A;  1T5Y A;  1V74 A;  1W2B 2;  5I97 A;  2IA7 A;  2F98 A;  3X42 A;  1NJI 4;  3DM8 A;  1N9J A;  2FGT A;  2YX9 A;  1YVB I;  3B8L A;  3HZP A;  2B24 B;  4XBY A;  4WHA A;  5IG0 A;  1AVL A;  1IVX A;  4EXR A;  1FGR A;  2XH9 A;  2Z6B A;  1W5Z A;  2RSX A;  2Q07 A;  2KXG A;  3CCM 3;  1FUW A;  4CDL A;  3ECF A;  5AEW B;  3RGR A;  5IG5 A;  1IQY A;  1ROV A;  3BNC A;  2Y73 A;  1OAC A;  4K61 A;  1VQN 3;  2XFT A;  4R1K A;  3DUK A;  2RFR A;  1OGX A;  3EB8 A;  2RCD A;  3PZW A;  2GEX A;  1VQL 3;  3MG2 A;  1ZX2 A;  4LMI A;  3CPW 2;  2HMM B;  4IIA A;  5AIG A;  1QVG 2;  3ALA A;  3LYG A;  3HI7 A;  3MG3 A;  3WA2 X;  4EC6 A;  1O7W B;  3K7C A;  1VQ9 3;  3T0U A;  3GRD A;  1A90 A;  3B4P A;  3FGY A;  3CNM A;  4WYK B;  3G71 3;  1CQS A;  1WNH A;  4O8S A;  1ULJ B;  1YI2 3;  1E3V A;  3FZW A;  4G1M B;  4HM5 B;  1SQW A;  2HMJ B;  1TU5 A;  1EG9 B;  1LOX A;  2K0M A;  2CWU A;  3FCS B;  2ZL8 A;  1Q40 A;  1GS3 A;  3LTA A;  3FG3 A;  3MKI A;  4JF8 A;  5CF1 A;  3PYJ A;  2CFG A;  1JB4 A;  3FG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...