3UB1A

Ntf2 like protein involved in plasmid conjugation
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
251
structure length
248
Chain Sequence
SLETQAFSFAEEFAWDYFSRYPSDTQDFVRRITKYTTEQLANEMNNGTYSDVIYTSAFYFEKYSENQVNVSVKARVRVYTPKAGQEQDQLQYDTNLVDYYLEVPIVFDKDMNMAVDALPVMTAPPEKAYFKNKEFSGTSENDADKTKKITDSVSQFFKAYYEQNQTQIDYFLVDGADIKGAGQKFSFNKIDRINIYKLSDKEFLAIVDLNVDSFGNAIKQGFNLTVVQEGDKFLVKTLEPRTSNIDLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF13-like protein
publication title The conjugation protein TcpC from Clostridium perfringens is structurally related to the type IV secretion system protein VirB8 from Gram-negative bacteria.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Transport protein
total genus 53
structure length 248
sequence length 251
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12642 TpcC Conjugative transposon protein TcpC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.540 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ub1A02
3.10.450.540 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ub1A01
4EC6A 3UB1A
chains in the Genus database with same CATH superfamily
3GRDA 1K28A 5I97A 1JBTA 1RMSA 4BU4A 1RLSA 1KSIA 3Q3FA 1D6YA 1JB2A 4LSOA 2CC3A 1B27A 3X3ZA 1C7HA 1EKMA 4HM4B 3HIGA 2QA43 1Q864 2Y73A 4WYKA 4GL6A 1W6YA 1DVDA 3H51A 2KXGA 2INXA 1LOVA 1SQWA 1A2PA 2XRXB 1WTHA 2BHMA 4H61A 4HM2B 1WQLB 3BNEA 2D42A 5D83A 4CJNA 1FW7A 2E2TA 2HMNB 1FGRA 1OHPA 3AGNA 3GZBA 2A15A 1SPUA 3CC43 2BT3A 1T2HA 4MMZB 5LC7A 1KWIA 1HYFA 3DGYA 1B2XA 1RN1A 4XBYA 3WMDA 4HZBB 4HYZA 3MG2A 5ELJA 2CIUA 2D1WA 2KF5A 3F8XA 3X3YA 1RN7A 2OTL3 3WOFB 1LOYA 1WMOA 5RNTA 1EEJA 1TIJA 4J9AA 2R41A 1DMQA 1GOYA 3E99A 3KKGA 4FMCA 2CH9A 1GOVA 1QAKA 2RNTA 3N8BA 3OW22 3BNBA 1EA2A 3LT8A 4GSPA 4CCVA 1I0VA 1TTOA 1WNHA 4N6V0 5EEOA 3G4S3 3EQQB 1QAFA 4HM8B 4H3UA 3CCM3 4WWUC 1K9M4 1RHLA 2BIRA 3AHSA 4HVNA 5FGOA 1JRQA 2SARA 3D79A 1BNSA 1CEWI 1GSPA 3IPTA 3UNLA 3CME3 4N6NB 2XFSA 1BVIA 2C11A 2H0IA 3URPA 5JPPA 1BGSA 1I70A 4I5QA 1RKYA 3LTAA 2WO0A 1NJI4 3EE1A 4R1KA 5AI1A 3NQZA 1C54A 2BO9B 1BRGA 4CPKA 1JN5B 1YIJ3 1RTUA 1Q42A 5CXOA 3K0ZA 4K1VA 1BNFA 3GZRA 4LYLB 4N6OB 1D6UA 2HMKB 2IUKA 1IQYA 3FGYA 1KQS2 2CG0A 6GSPA 7RNTA 3JVCA 1I2FA 3SLUA 2OQEA 1STDA 3G16A 5IERA 3OWSA 1IQ8A 2YX9A 6STDA 3AGOA 3WDGB 3NXJA 1GYBA 3MSOA 2RBIA 1W5ZA 1YVBI 3K5TA 2B1XB 1CQSA 1LQGC 3DGOA 1IT7A 3Q2PA 4XBXA 1BNGA 1I3FA 1TFOA 1TJDA 3GAXA 4RNTA 1Q7HA 2JQ5A 2ML6A 4NREA 1MOLA 2C10A 4BL3A 1GD4A 4K1UA 1UI7A 1B2MA 5TGNA 3QK9A 3QRDA 5BIRA 3CCU3 3ALAA 4QWTA 1G02A 3MG1A 1TRPA 2RSXA 1IYYA 1B2ZA 3A5EA 1X1UA 3N9HA 1AR0A 1U8CB 4X2OA 5AYRB 3F14A 1O7WB 4XDWA 2P05A 2F99A 2MF7A 1W7CA 1IK3A 3O8YA 1K8A4 4X2HA 4HM6B 1BUJA 3FZWA 1RNBA 2WGQA 1W2B2 1DMMA 2Z76A 4R9LA 1D6ZA 1JKGA 5AEWB 2GU1A 3CC23 1GMQA 1RGLA 3EF8A 2CHCA 3EB8A 3X40A 1EUIC 4LGQA 4IT7A 2H0GA 3B7CA 3JUOA 3JUQA 4FCMA 4BTXA 1VQK3 3NX0A 3WA2X 1B3SA 3FG3A 2F5WA 3LH4A 4DKIA 4HBRA 3JUPA 1T2IA 4EV5A 1T3BA 4KFFA 1UCLA 2XSHB 1NU3A 1TU5A 1YVSA 2M7OA 1QVG2 3K7CA 2Z7AA 5IEPA 3LTBA 4K90B 4J5KA 5CK6A 1UDII 4IIAA 1LRAA 4TX4A 2IA7A 3S5CA 1GOUA 2W0QA 3DGLA 3ROBA 2QEX3 1VQQA 2OOVC 3S27A 1DE3A 1ROAA 1YJW3 4HM0B 2R4IA 5IEOA 1YJ93 3CCL3 1MGWA 4BIRA 3GSPA 3KZTA 2MC8A 3CXC2 1RGHA 2KAAA 2HMJB 1N5HA 1QJGA 1RGFA 1V74A 3DXOA 2Z77A 1LOWA 2XFTA 5AIIA 1BSEA 1W6CA 2O3OA 3X41A 4WYKB 3EN8A 4G1MB 2L4VA 1IVVA 1Q824 3TDGA 2W04A 4EV2A 4EXRA 5KP1A 4OVMA 1W02A 3OWYA 4FMBA 4KZ1A 1JBRA 1MWRA 3DZLA 3RNTA 1O7NB 1AVLA 3KCHA 2F56A 1BOXA 2STDA 3MHEA 4HZ9B 4R80A 2OTJ3 2Y74A 1O7PB 1US1A 3FF2A 3I0YA 2CWUA 1OACA 3BNCA 3LYGA 4HM5B 4N6MA 3T8UA 3IJEB 2HMMB 4XBTA 3CMA3 3OWUA 1BSAA 3X42A 1N8QA 1BRSA 1JB5A 3B4OA 3NM7A 1R4CA 5FW5A 1B2UA 4I4KA 3SOAA 3M8CA 3V92A 1OCVA 4IPBA 3LMLA 2O9UX 2RFRA 1N5PA 2KF3A 2YFJB 1GMRA 3SVAA 4Q53A 1HZ1A 1OPYA 1FGTA 1LXEA 3DUKA 1VQ93 1YGWA 5A0OB 1GD3A 4NHFA 2RGQA 2W56B 1Z1SA 2P0XA 2XF3A 1HKXA 1MGRA 4RNYA 1O7MB 3WOEB 3HX8A 1E97A 5BU4A 2LYXA 2UX0A 1I0XA 2P09A 1AV4A 1BAOA 3BNDA 4N3VA 7STDA 1OUNA 1IV7A 3ER7A 5HGRA 3CNMA 3FSDA 7GSPA 3EX9A 2CWVA 3ECFA 4KFEA 4AKZA 3I563 1VQ53 3J7Yd 1Q40A 3LZAA 1ZS7A 3F40A 1BRKA 1I3IA 2CX0A 3CNXA 3LOYA 1KC84 1PFPA 2GEYA 1JJ22 1LNHA 1TFKA 4MJDA 5EQLA 3NUVA 5G1KA 1BSBA 1JZOA 4ILFA 1BANA 3STDA 1SIHA 2GSPA 4BTWA 2C4BA 1V58A 1OH0A 3LXUX 3GWRA 1WMNA 4JF8A 3I553 1JN5A 5BXQA 3EN1B 5G1LA 1TRQA 2XR8B 4KVHA 1DETA 1UI8A 2P38A 4MMYB 3Q1CA 6RNTA 1S5AA 1X1YA 3D3LA 3K63A 4XDVA 1FUWA 1HU9A 3JUMA 4PEJA 1ROVA 4HM3B 1JB4A 1RDSA 3G713 3LTCA 4BL2A 1VQ73 1MWSA 3JUNA 5EVHA 3KE7A 1VQM3 4KFDA 4EYCA 1W01A 2GXFA 2K3DA 4L8PA 3MYTA 3CCQ3 5CLKA 1B20A 4LZIA 3WR2A 1BSCA 1UCIA 2KCDA 1FGOA 1OF5A 1LNIA 1LQMB 2J8XB 2UUGC 4OK0A 1VQO3 1E3VA 3RDEA 1RSNA 4HOHA 3FCSB 1OGXA 1O7HB 3NV0B 1T5YA 1YGEA 1IV9A 1JBSA 1TUHA 3PGBA 3OXAA 2WOFA 5HOHA 1BIRA 1O7GB 5KP3A 1MWTA 3PZWA 1BNJA 3AMOA 3NBBA 1ZO2A 1JKGB 1VQN3 3D4AA 5IF6A 3KFQC 1DVCA 2CFKA 4ORLA 5DREA 2W6JH 3SX1A 2GBWB 2IY2A 3NBRA 1F8NA 5CF2A 2XH9A 1FGQA 1V57A 2ZA4A 3NBJA 3DY5A 1RCKA 1IVUA 3VSYA 1RGAA 3WHOA 5M1AA 2KRTA 3UJMA 1STFI 1W00A 3FG1A 3CCV3 4MMXB 2W9QA 3CCE3 1UUGB 1X1XA 3DGMA 3DGNA 3PYJA 1E3RA 2K0MA 2FNQA 3EHCA 4GB5A 1M1XB 4XM4A 2ZL8A 1UGHI 3HIIA 2XGNA 3WA3A 1JZDA 1I8VA 4GHOA 4EW5A 1NWWA 2BMOB 1PU4A 1UUWB 4RZMA 2KF4A 1VQP3 1VQ83 1BSDA 1RGKA 1ISKA 1M9GA 1Q9EA 2AAEA 1U5OA 8CHOA 3CPW2 3CPOA 1FUSA 3B4PA 1IQXA 4N6TA 4OUQA 5G2GA 3EJVA 3BB9A 4AKYA 1NO3A 1DYUA 2ZHXB 5IG5A 3D5IA 3D5GA 1BRJA 3F8HA 3RGAA 1A2KA 1CYVA 1Q814 3UL6A 9RNTA 1M904 3DM8A 4FCJA 1IVXA 2OOVA 3WODG 3G6E3 1M1K4 2IMJA 1VZZA 3CCS3 4L8OA 3PCSA 1OHSA 4NPBA 3F7SA 3VGNA 3PS8A 2CK3H 1GY5A 1NB3I 3L0RA 4FR9A 4R9KA 4EBGA 1YIT3 2W9PA 1G96A 1I2GA 5M18A 5GSPA 1QVF2 2AADA 3SEDA 1K41A 1AQZA 1RGCA 1BRIA 1BNIA 3FLJA 1YHQ3 2HOHA 1Q7Y4 3PXMA 2B24B 2XEPA 1RJOA 3N54B 3CD63 2GEXA 1PYLA 3NQYA 2GBXB 1IU7A 1I2EA 1L5GB 3X3XA 4KT3B 3BU4A 1ULJB 1GMPA 5AIFA 1UW1A 1UCKA 1B21A 1X1WA 1Y4KA 2F98A 2CX1A 1NNVA 3F7XA 2BU4A 2W03A 1ASKA 3GZYB 2XGLA 2E2UA 1FUTA 1W6GA 1RCLA 1MNLA 1FA3A 3RGRA 4MEIA 3DMCA 1UCJA 1RN4A 1EG9B 3SOYA 1DMNA 1GY6A 2XSOB 3KSPA 4U13A 5D81A 5CF1A 2HMLB 3T0UA 1ZX2A 1RNTA 1SIIA 2OCTA 2YFIB 3AHWA 1RRHA 2CWTA 2HMOB 3IMAB 1LOXA 2W56A 1YNVX 5STDA 1BNRA 4O2HA 1BUQA 1Q40B 4L7KA 4O02B 5IG0A 1ULIB 4J8TA 3UB1A 3U1WA 5IG3A 1A67A 1LVNA 3MWZA 2SBLA 1QALA 2CG1A 5IW9A 1BNEA 1UUVB 2CFDA 2OQEC 1BRHA 2OWPA 4JRFA 4K61A 3ZG5A 1YJN3 4HJLB 2WOHA 3OV4A 2BMQB 3DH2A 5BVBA 1KD14 2FXTA 3FKAA 2Q07A 3KSED 2BMRB 3BLZA 2BNGA 4N6UA 2GU3A 4STDA 2F5MA 4XB5A 2CFWA 3MPHA 2I9WA 3HK4A 1B2SA 4FMDA 5D82A 5JBSA 3H3HA 2CFGA 2H0HA 3EBTA 3CCR3 1WMPA 2ZDJA 5DRVA 2E2VA 2W2CA 1BRNL 4HM1B 3S28A 3V98A 1OHOA 2F4YA 1J2BA 2IUJA 5AYSC 1RGGA 5ELUA 2KF6A 1TP6A 2JDIH 4LEHA 2F86B 2L1SA 1NB5I 3CU3A 2ML5A 3NM2A 1FYSA 1S723 2PZVA 1UGIA 1OF5B 2YFLB 3D9RA 3K9MC 2V1LA 1JV2B 3LT9A 1OGZA 3SYUA 3NHXA 4WFOA 1RGEA 3F9SA 5JPUA 3OX9A 3EBYA 3FH1A 2CW9A 3FG4A 3HI7A 4J5GA 1SARA 1RRLA 3PCRA 4AEQA 5M19A 3CC73 1VQL3 1CYUA 2CFLA 2PNCA 1IVWA 1VQ43 4ZM8A 4CDLA 3T8NA 5AEUB 1W4NA 3EC9A 3HOHA 1N9EA 3AMOB 4WHAA 1ZGXA 3HZPA 4R4KA 1G0TA 2FGTA 2Z6BA 3S67A 3NV0A 3Q90A 2UGIA 1EQKA 1AVKA 4FCZA 4HM7B 3CCJ3 4LMIA 1A90A 3MKIA 5LC6A 4BTYA 1BU4A 3LTDA 2WGOA 5IENA 1VQ63 4RNZA 2LQVA 8RNTA 1QMAA 5KP4A 3GZXB 3ZG0A 1IDPA 1N9JA 1SJWA 3U97A 3G0KA 2CKFB 2RCDA 3B8LA 3VF1A 3MG3A 1PY3A 1GY7A 1GS3A 2QGUA 3A76A 4EC6A 1R4YA 1AY7A 1A2VA 3KIIA 5AIHA 1YI23 1W2ZA 1FGMA 5AIGA 4RBNA 3S29A 1JNQA 3KN4A 3BIRA 1MWUA 1FZUA 3V99A 4N6LA 1IT8A 4O3VA 3SXXA 4WP5A 3UL5A 4FMAA 4HKVB 1K734 3FF0A 2K54A 3ZFZA 5IG4A 1NDOB 2IYJA 2QIYA 1N8R4 4O8SA 4HAAA 1CH0A 2P0MA 3G8ZA
chains in the Genus database with same CATH topology
3GRDA 1K28A 5I97A 1KSIA 4LSOA 1D6YA 1JB2A 2CC3A 3X3ZA 1C7HA 1EKMA 4HM4B 3HIGA 2QA43 1Q864 2Y73A 4WYKA 4GL6A 1W6YA 1DVDA 3H51A 2KXGA 2INXA 1SQWA 2XRXB 1WTHA 2BHMA 4H61A 4HM2B 1WQLB 3BNEA 2D42A 5D83A 2E2TA 2HMNB 1FGRA 1OHPA 3GZBA 2A15A 1SPUA 3CC43 2BT3A 4MMZB 5LC7A 1KWIA 4XBYA 3WMDA 4HZBB 4HYZA 3MG2A 5ELJA 2CIUA 2D1WA 3F8XA 3X3YA 1RN7A 2OTL3 3WOFB 1WMOA 1TIJA 4J9AA 3KKGA 1DMQA 3E99A 4FMCA 2CH9A 1QAKA 3N8BA 3OW22 3BNBA 1EA2A 3LT8A 4CCVA 4N6V0 1WNHA 5EEOA 3G4S3 3EQQB 1QAFA 4HM8B 4H3UA 3CCM3 4WWUC 1K9M4 4HVNA 5FGOA 1JRQA 1CEWI 3CME3 3IPTA 3UNLA 4N6NB 2XFSA 2C11A 5JPPA 1RKYA 3LTAA 2WO0A 1NJI4 3EE1A 4R1KA 5AI1A 3NQZA 2BO9B 1JN5B 1YIJ3 1Q42A 5CXOA 3K0ZA 4K1VA 3GZRA 4N6OB 1D6UA 2HMKB 2IUKA 1IQYA 3FGYA 1KQS2 2CG0A 3JVCA 3SLUA 2OQEA 1STDA 3G16A 5IERA 3OWSA 1IQ8A 2YX9A 6STDA 3WDGB 3NXJA 1GYBA 3MSOA 1W5ZA 1YVBI 3K5TA 2B1XB 1CQSA 3DGOA 1IT7A 3Q2PA 4XBXA 1TFOA 3GAXA 2JQ5A 2ML6A 4NREA 1MOLA 2C10A 1GD4A 4K1UA 1UI7A 5TGNA 3QK9A 3QRDA 3CCU3 3ALAA 4QWTA 3MG1A 2RSXA 3N9HA 1AR0A 1U8CB 4X2OA 5AYRB 3F14A 1O7WB 4XDWA 2P05A 2F99A 2MF7A 1W7CA 1IK3A 3O8YA 1K8A4 4X2HA 4HM6B 3FZWA 2WGQA 1W2B2 1DMMA 2Z76A 4R9LA 1D6ZA 1JKGA 5AEWB 2GU1A 3CC23 3EF8A 2CHCA 3EB8A 3X40A 4LGQA 4IT7A 4FCMA 3B7CA 3JUOA 3JUQA 4BTXA 1VQK3 3NX0A 3WA2X 3FG3A 3LH4A 4HBRA 3JUPA 4EV5A 4KFFA 2XSHB 1NU3A 1TU5A 2M7OA 1QVG2 3K7CA 2Z7AA 5IEPA 3LTBA 4K90B 5CK6A 4IIAA 4TX4A 2IA7A 3S5CA 2W0QA 3DGLA 3ROBA 2QEX3 2OOVC 3S27A 1ROAA 1YJW3 4HM0B 2R4IA 5IEOA 1YJ93 3CCL3 2MC8A 3KZTA 3CXC2 2HMJB 1N5HA 1QJGA 1V74A 3DXOA 2Z77A 2XFTA 5AIIA 1W6CA 2O3OA 3X41A 4WYKB 3EN8A 4G1MB 2L4VA 1IVVA 1Q824 3TDGA 2W04A 4EV2A 4EXRA 5KP1A 4OVMA 1W02A 3OWYA 4FMBA 4KZ1A 3DZLA 1O7NB 1AVLA 2STDA 3MHEA 4HZ9B 4R80A 2OTJ3 2Y74A 1O7PB 1US1A 3FF2A 3I0YA 2CWUA 1OACA 3BNCA 3LYGA 4HM5B 4N6MA 3T8UA 3IJEB 2HMMB 4XBTA 3CMA3 3OWUA 3X42A 1N8QA 1JB5A 3B4OA 3NM7A 1R4CA 5FW5A 4I4KA 3SOAA 3M8CA 3V92A 1OCVA 4IPBA 3LMLA 2O9UX 2RFRA 1N5PA 2YFJB 3SVAA 4Q53A 1OPYA 1VQ93 1FGTA 1LXEA 3DUKA 5A0OB 1GD3A 4NHFA 2RGQA 2W56B 1Z1SA 2P0XA 2XF3A 1HKXA 4RNYA 1O7MB 3WOEB 3HX8A 1E97A 2LYXA 2UX0A 2P09A 1AV4A 3BNDA 4N3VA 7STDA 1OUNA 1IV7A 3ER7A 5HGRA 3CNMA 3FSDA 1VQ53 3EX9A 2CWVA 3ECFA 4KFEA 4AKZA 3I563 3J7Yd 1Q40A 3LZAA 3F40A 3CNXA 3LOYA 1KC84 1PFPA 2GEYA 1JJ22 1LNHA 1TFKA 4MJDA 5EQLA 3NUVA 3STDA 1SIHA 4BTWA 1OH0A 3LXUX 3GWRA 1WMNA 4JF8A 3I553 1JN5A 5BXQA 3EN1B 2XR8B 4KVHA 1UI8A 2P38A 4MMYB 3Q1CA 1S5AA 4XDVA 3D3LA 3K63A 1FUWA 1HU9A 3JUMA 4PEJA 1ROVA 4HM3B 1JB4A 3G713 3LTCA 1VQ73 3JUNA 5EVHA 3KE7A 1VQM3 4KFDA 4EYCA 1W01A 2GXFA 4L8PA 3CCQ3 3MYTA 5CLKA 4LZIA 2KCDA 1FGOA 1OF5A 4OK0A 1VQO3 1E3VA 3RDEA 3FCSB 1OGXA 1O7HB 3NV0B 1T5YA 1YGEA 1IV9A 1TUHA 3PGBA 3OXAA 2WOFA 1O7GB 5KP3A 3PZWA 3AMOA 3NBBA 1ZO2A 1JKGB 1VQN3 5IF6A 3KFQC 1DVCA 2CFKA 4ORLA 5DREA 2W6JH 3SX1A 2GBWB 3NBRA 5CF2A 1F8NA 2XH9A 1FGQA 3NBJA 3DY5A 1IVUA 3VSYA 2KRTA 3UJMA 1STFI 1W00A 3FG1A 3CCV3 4MMXB 2W9QA 3CCE3 3DGMA 3DGNA 3PYJA 1E3RA 2K0MA 2FNQA 3EHCA 4GB5A 1M1XB 4XM4A 2ZL8A 3HIIA 2XGNA 3WA3A 1NWWA 2BMOB 1PU4A 1UUWB 4RZMA 1VQP3 1VQ83 1ISKA 1M9GA 8CHOA 1U5OA 3CPW2 3CPOA 3B4PA 1IQXA 4N6TA 4OUQA 5G2GA 3EJVA 3BB9A 4AKYA 1NO3A 1DYUA 5IG5A 3F8HA 3RGAA 1A2KA 1CYVA 1Q814 3UL6A 1M904 3DM8A 4FCJA 1IVXA 2OOVA 3WODG 3G6E3 1M1K4 2IMJA 1VZZA 3CCS3 4L8OA 3PCSA 1OHSA 3F7SA 3VGNA 3PS8A 2CK3H 1GY5A 1NB3I 3L0RA 4FR9A 4R9KA 4EBGA 1YIT3 2W9PA 1G96A 3SEDA 1K41A 3FLJA 1YHQ3 1Q7Y4 3PXMA 2B24B 2XEPA 1RJOA 3N54B 3CD63 2GEXA 3NQYA 2GBXB 1IU7A 1L5GB 3X3XA 1ULJB 5AIFA 1UW1A 1Y4KA 2F98A 3F7XA 2W03A 1ASKA 3GZYB 2XGLA 2E2UA 1W6GA 1MNLA 1FA3A 3RGRA 4MEIA 3DMCA 1EG9B 3SOYA 1DMNA 1GY6A 2XSOB 3KSPA 4U13A 5D81A 5CF1A 2HMLB 3T0UA 1ZX2A 1SIIA 2OCTA 2YFIB 1RRHA 2CWTA 2HMOB 3IMAB 1LOXA 2W56A 5STDA 4O2HA 1BUQA 1Q40B 4L7KA 4O02B 5IG0A 1ULIB 4J8TA 3UB1A 3U1WA 5IG3A 1A67A 1LVNA 3MWZA 2SBLA 1QALA 2CG1A 5IW9A 1UUVB 2CFDA 2OQEC 2OWPA 4JRFA 4K61A 1YJN3 4HJLB 2WOHA 3OV4A 2BMQB 5BVBA 1KD14 2FXTA 3FKAA 2Q07A 3KSED 2BMRB 3BLZA 2BNGA 4N6UA 2GU3A 4STDA 4XB5A 2CFWA 3MPHA 2I9WA 3HK4A 4FMDA 5D82A 5JBSA 3H3HA 2CFGA 3EBTA 3CCR3 2ZDJA 1WMPA 5DRVA 2E2VA 2W2CA 4HM1B 3S28A 3V98A 1OHOA 1J2BA 2IUJA 5AYSC 5ELUA 1TP6A 2JDIH 4LEHA 2F86B 1NB5I 3CU3A 2ML5A 3NM2A 1S723 2PZVA 2YFLB 1OF5B 3D9RA 3K9MC 3LT9A 2V1LA 1JV2B 1QVF2 1OGZA 3NHXA 4WFOA 5JPUA 3F9SA 3OX9A 3EBYA 3FH1A 2CW9A 3FG4A 3HI7A 1RRLA 3PCRA 4AEQA 3CC73 1VQL3 1CYUA 2CFLA 2PNCA 1IVWA 1VQ43 4ZM8A 4CDLA 3T8NA 5AEUB 1W4NA 3EC9A 1N9EA 3AMOB 4WHAA 3HZPA 4R4KA 2FGTA 2Z6BA 3S67A 3NV0A 3Q90A 1EQKA 1AVKA 4FCZA 4HM7B 3CCJ3 4LMIA 1A90A 3MKIA 5LC6A 4BTYA 3LTDA 2WGOA 5IENA 1VQ63 4RNZA 2LQVA 1QMAA 5KP4A 3GZXB 1IDPA 1N9JA 1SJWA 3U97A 3G0KA 2CKFB 2RCDA 3B8LA 3VF1A 3MG3A 1GY7A 1GS3A 2QGUA 3A76A 4EC6A 1A2VA 3KIIA 5AIHA 1YI23 1W2ZA 1FGMA 5AIGA 4RBNA 3S29A 1JNQA 3KN4A 3V99A 4N6LA 1IT8A 4O3VA 3SXXA 4WP5A 3UL5A 4FMAA 4HKVB 1K734 3FF0A 2K54A 5IG4A 1NDOB 2QIYA 1N8R4 4O8SA 2P0MA 3G8ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EC6 A;  3UB1 A; 
#chains in the Genus database with same CATH topology
 3GRD A;  1K28 A;  5I97 A;  1JBT A;  1RMS A;  4BU4 A;  1RLS A;  1KSI A;  3Q3F A;  1D6Y A;  1JB2 A;  4LSO A;  2CC3 A;  1B27 A;  3X3Z A;  1C7H A;  1EKM A;  4HM4 B;  3HIG A;  2QA4 3;  1Q86 4;  2Y73 A;  4WYK A;  4GL6 A;  1W6Y A;  1DVD A;  3H51 A;  2KXG A;  2INX A;  1LOV A;  1SQW A;  1A2P A;  2XRX B;  1WTH A;  2BHM A;  4H61 A;  4HM2 B;  1WQL B;  3BNE A;  2D42 A;  5D83 A;  4CJN A;  1FW7 A;  2E2T A;  2HMN B;  1FGR A;  1OHP A;  3AGN A;  3GZB A;  2A15 A;  1SPU A;  3CC4 3;  2BT3 A;  1T2H A;  4MMZ B;  5LC7 A;  1KWI A;  1HYF A;  3DGY A;  1B2X A;  1RN1 A;  4XBY A;  3WMD A;  4HZB B;  4HYZ A;  3MG2 A;  5ELJ A;  2CIU A;  2D1W A;  2KF5 A;  3F8X A;  3X3Y A;  1RN7 A;  2OTL 3;  3WOF B;  1LOY A;  1WMO A;  5RNT A;  1EEJ A;  1TIJ A;  4J9A A;  2R41 A;  1DMQ A;  1GOY A;  3E99 A;  3KKG A;  4FMC A;  2CH9 A;  1GOV A;  1QAK A;  2RNT A;  3N8B A;  3OW2 2;  3BNB A;  1EA2 A;  3LT8 A;  4GSP A;  4CCV A;  1I0V A;  1TTO A;  1WNH A;  4N6V 0;  5EEO A;  3G4S 3;  3EQQ B;  1QAF A;  4HM8 B;  4H3U A;  3CCM 3;  4WWU C;  1K9M 4;  1RHL A;  2BIR A;  3AHS A;  4HVN A;  5FGO A;  1JRQ A;  2SAR A;  3D79 A;  1BNS A;  1CEW I;  1GSP A;  3IPT A;  3UNL A;  3CME 3;  4N6N B;  2XFS A;  1BVI A;  2C11 A;  2H0I A;  3URP A;  5JPP A;  1BGS A;  1I70 A;  4I5Q A;  1RKY A;  3LTA A;  2WO0 A;  1NJI 4;  3EE1 A;  4R1K A;  5AI1 A;  3NQZ A;  1C54 A;  2BO9 B;  1BRG A;  4CPK A;  1JN5 B;  1YIJ 3;  1RTU A;  1Q42 A;  5CXO A;  3K0Z A;  4K1V A;  1BNF A;  3GZR A;  4LYL B;  4N6O B;  1D6U A;  2HMK B;  2IUK A;  1IQY A;  3FGY A;  1KQS 2;  2CG0 A;  6GSP A;  7RNT A;  3JVC A;  1I2F A;  3SLU A;  2OQE A;  1STD A;  3G16 A;  5IER A;  3OWS A;  1IQ8 A;  2YX9 A;  6STD A;  3AGO A;  3WDG B;  3NXJ A;  1GYB A;  3MSO A;  2RBI A;  1W5Z A;  1YVB I;  3K5T A;  2B1X B;  1CQS A;  1LQG C;  3DGO A;  1IT7 A;  3Q2P A;  4XBX A;  1BNG A;  1I3F A;  1TFO A;  1TJD A;  3GAX A;  4RNT A;  1Q7H A;  2JQ5 A;  2ML6 A;  4NRE A;  1MOL A;  2C10 A;  4BL3 A;  1GD4 A;  4K1U A;  1UI7 A;  1B2M A;  5TGN A;  3QK9 A;  3QRD A;  5BIR A;  3CCU 3;  3ALA A;  4QWT A;  1G02 A;  3MG1 A;  1TRP A;  2RSX A;  1IYY A;  1B2Z A;  3A5E A;  1X1U A;  3N9H A;  1AR0 A;  1U8C B;  4X2O A;  5AYR B;  3F14 A;  1O7W B;  4XDW A;  2P05 A;  2F99 A;  2MF7 A;  1W7C A;  1IK3 A;  3O8Y A;  1K8A 4;  4X2H A;  4HM6 B;  1BUJ A;  3FZW A;  1RNB A;  2WGQ A;  1W2B 2;  1DMM A;  2Z76 A;  4R9L A;  1D6Z A;  1JKG A;  5AEW B;  2GU1 A;  3CC2 3;  1GMQ A;  1RGL A;  3EF8 A;  2CHC A;  3EB8 A;  3X40 A;  1EUI C;  4LGQ A;  4IT7 A;  2H0G A;  3B7C A;  3JUO A;  3JUQ A;  4FCM A;  4BTX A;  1VQK 3;  3NX0 A;  3WA2 X;  1B3S A;  3FG3 A;  2F5W A;  3LH4 A;  4DKI A;  4HBR A;  3JUP A;  1T2I A;  4EV5 A;  1T3B A;  4KFF A;  1UCL A;  2XSH B;  1NU3 A;  1TU5 A;  1YVS A;  2M7O A;  1QVG 2;  3K7C A;  2Z7A A;  5IEP A;  3LTB A;  4K90 B;  4J5K A;  5CK6 A;  1UDI I;  4IIA A;  1LRA A;  4TX4 A;  2IA7 A;  3S5C A;  1GOU A;  2W0Q A;  3DGL A;  3ROB A;  2QEX 3;  1VQQ A;  2OOV C;  3S27 A;  1DE3 A;  1ROA A;  1YJW 3;  4HM0 B;  2R4I A;  5IEO A;  1YJ9 3;  3CCL 3;  1MGW A;  4BIR A;  3GSP A;  3KZT A;  2MC8 A;  3CXC 2;  1RGH A;  2KAA A;  2HMJ B;  1N5H A;  1QJG A;  1RGF A;  1V74 A;  3DXO A;  2Z77 A;  1LOW A;  2XFT A;  5AII A;  1BSE A;  1W6C A;  2O3O A;  3X41 A;  4WYK B;  3EN8 A;  4G1M B;  2L4V A;  1IVV A;  1Q82 4;  3TDG A;  2W04 A;  4EV2 A;  4EXR A;  5KP1 A;  4OVM A;  1W02 A;  3OWY A;  4FMB A;  4KZ1 A;  1JBR A;  1MWR A;  3DZL A;  3RNT A;  1O7N B;  1AVL A;  3KCH A;  2F56 A;  1BOX A;  2STD A;  3MHE A;  4HZ9 B;  4R80 A;  2OTJ 3;  2Y74 A;  1O7P B;  1US1 A;  3FF2 A;  3I0Y A;  2CWU A;  1OAC A;  3BNC A;  3LYG A;  4HM5 B;  4N6M A;  3T8U A;  3IJE B;  2HMM B;  4XBT A;  3CMA 3;  3OWU A;  1BSA A;  3X42 A;  1N8Q A;  1BRS A;  1JB5 A;  3B4O A;  3NM7 A;  1R4C A;  5FW5 A;  1B2U A;  4I4K A;  3SOA A;  3M8C A;  3V92 A;  1OCV A;  4IPB A;  3LML A;  2O9U X;  2RFR A;  1N5P A;  2KF3 A;  2YFJ B;  1GMR A;  3SVA A;  4Q53 A;  1HZ1 A;  1OPY A;  1FGT A;  1LXE A;  3DUK A;  1VQ9 3;  1YGW A;  5A0O B;  1GD3 A;  4NHF A;  2RGQ A;  2W56 B;  1Z1S A;  2P0X A;  2XF3 A;  1HKX A;  1MGR A;  4RNY A;  1O7M B;  3WOE B;  3HX8 A;  1E97 A;  5BU4 A;  2LYX A;  2UX0 A;  1I0X A;  2P09 A;  1AV4 A;  1BAO A;  3BND A;  4N3V A;  7STD A;  1OUN A;  1IV7 A;  3ER7 A;  5HGR A;  3CNM A;  3FSD A;  7GSP A;  3EX9 A;  2CWV A;  3ECF A;  4KFE A;  4AKZ A;  3I56 3;  1VQ5 3;  3J7Y d;  1Q40 A;  3LZA A;  1ZS7 A;  3F40 A;  1BRK A;  1I3I A;  2CX0 A;  3CNX A;  3LOY A;  1KC8 4;  1PFP A;  2GEY A;  1JJ2 2;  1LNH A;  1TFK A;  4MJD A;  5EQL A;  3NUV A;  5G1K A;  1BSB A;  1JZO A;  4ILF A;  1BAN A;  3STD A;  1SIH A;  2GSP A;  4BTW A;  2C4B A;  1V58 A;  1OH0 A;  3LXU X;  3GWR A;  1WMN A;  4JF8 A;  3I55 3;  1JN5 A;  5BXQ A;  3EN1 B;  5G1L A;  1TRQ A;  2XR8 B;  4KVH A;  1DET A;  1UI8 A;  2P38 A;  4MMY B;  3Q1C A;  6RNT A;  1S5A A;  1X1Y A;  3D3L A;  3K63 A;  4XDV A;  1FUW A;  1HU9 A;  3JUM A;  4PEJ A;  1ROV A;  4HM3 B;  1JB4 A;  1RDS A;  3G71 3;  3LTC A;  4BL2 A;  1VQ7 3;  1MWS A;  3JUN A;  5EVH A;  3KE7 A;  1VQM 3;  4KFD A;  4EYC A;  1W01 A;  2GXF A;  2K3D A;  4L8P A;  3MYT A;  3CCQ 3;  5CLK A;  1B20 A;  4LZI A;  3WR2 A;  1BSC A;  1UCI A;  2KCD A;  1FGO A;  1OF5 A;  1LNI A;  1LQM B;  2J8X B;  2UUG C;  4OK0 A;  1VQO 3;  1E3V A;  3RDE A;  1RSN A;  4HOH A;  3FCS B;  1OGX A;  1O7H B;  3NV0 B;  1T5Y A;  1YGE A;  1IV9 A;  1JBS A;  1TUH A;  3PGB A;  3OXA A;  2WOF A;  5HOH A;  1BIR A;  1O7G B;  5KP3 A;  1MWT A;  3PZW A;  1BNJ A;  3AMO A;  3NBB A;  1ZO2 A;  1JKG B;  1VQN 3;  3D4A A;  5IF6 A;  3KFQ C;  1DVC A;  2CFK A;  4ORL A;  5DRE A;  2W6J H;  3SX1 A;  2GBW B;  2IY2 A;  3NBR A;  1F8N A;  5CF2 A;  2XH9 A;  1FGQ A;  1V57 A;  2ZA4 A;  3NBJ A;  3DY5 A;  1RCK A;  1IVU A;  3VSY A;  1RGA A;  3WHO A;  5M1A A;  2KRT A;  3UJM A;  1STF I;  1W00 A;  3FG1 A;  3CCV 3;  4MMX B;  2W9Q A;  3CCE 3;  1UUG B;  1X1X A;  3DGM A;  3DGN A;  3PYJ A;  1E3R A;  2K0M A;  2FNQ A;  3EHC A;  4GB5 A;  1M1X B;  4XM4 A;  2ZL8 A;  1UGH I;  3HII A;  2XGN A;  3WA3 A;  1JZD A;  1I8V A;  4GHO A;  4EW5 A;  1NWW A;  2BMO B;  1PU4 A;  1UUW B;  4RZM A;  2KF4 A;  1VQP 3;  1VQ8 3;  1BSD A;  1RGK A;  1ISK A;  1M9G A;  1Q9E A;  2AAE A;  1U5O A;  8CHO A;  3CPW 2;  3CPO A;  1FUS A;  3B4P A;  1IQX A;  4N6T A;  4OUQ A;  5G2G A;  3EJV A;  3BB9 A;  4AKY A;  1NO3 A;  1DYU A;  2ZHX B;  5IG5 A;  3D5I A;  3D5G A;  1BRJ A;  3F8H A;  3RGA A;  1A2K A;  1CYV A;  1Q81 4;  3UL6 A;  9RNT A;  1M90 4;  3DM8 A;  4FCJ A;  1IVX A;  2OOV A;  3WOD G;  3G6E 3;  1M1K 4;  2IMJ A;  1VZZ A;  3CCS 3;  4L8O A;  3PCS A;  1OHS A;  4NPB A;  3F7S A;  3VGN A;  3PS8 A;  2CK3 H;  1GY5 A;  1NB3 I;  3L0R A;  4FR9 A;  4R9K A;  4EBG A;  1YIT 3;  2W9P A;  1G96 A;  1I2G A;  5M18 A;  5GSP A;  1QVF 2;  2AAD A;  3SED A;  1K41 A;  1AQZ A;  1RGC A;  1BRI A;  1BNI A;  3FLJ A;  1YHQ 3;  2HOH A;  1Q7Y 4;  3PXM A;  2B24 B;  2XEP A;  1RJO A;  3N54 B;  3CD6 3;  2GEX A;  1PYL A;  3NQY A;  2GBX B;  1IU7 A;  1I2E A;  1L5G B;  3X3X A;  4KT3 B;  3BU4 A;  1ULJ B;  1GMP A;  5AIF A;  1UW1 A;  1UCK A;  1B21 A;  1X1W A;  1Y4K A;  2F98 A;  2CX1 A;  1NNV A;  3F7X A;  2BU4 A;  2W03 A;  1ASK A;  3GZY B;  2XGL A;  2E2U A;  1FUT A;  1W6G A;  1RCL A;  1MNL A;  1FA3 A;  3RGR A;  4MEI A;  3DMC A;  1UCJ A;  1RN4 A;  1EG9 B;  3SOY A;  1DMN A;  1GY6 A;  2XSO B;  3KSP A;  4U13 A;  5D81 A;  5CF1 A;  2HML B;  3T0U A;  1ZX2 A;  1RNT A;  1SII A;  2OCT A;  2YFI B;  3AHW A;  1RRH A;  2CWT A;  2HMO B;  3IMA B;  1LOX A;  2W56 A;  1YNV X;  5STD A;  1BNR A;  4O2H A;  1BUQ A;  1Q40 B;  4L7K A;  4O02 B;  5IG0 A;  1ULI B;  4J8T A;  3UB1 A;  3U1W A;  5IG3 A;  1A67 A;  1LVN A;  3MWZ A;  2SBL A;  1QAL A;  2CG1 A;  5IW9 A;  1BNE A;  1UUV B;  2CFD A;  2OQE C;  1BRH A;  2OWP A;  4JRF A;  4K61 A;  3ZG5 A;  1YJN 3;  4HJL B;  2WOH A;  3OV4 A;  2BMQ B;  3DH2 A;  5BVB A;  1KD1 4;  2FXT A;  3FKA A;  2Q07 A;  3KSE D;  2BMR B;  3BLZ A;  2BNG A;  4N6U A;  2GU3 A;  4STD A;  2F5M A;  4XB5 A;  2CFW A;  3MPH A;  2I9W A;  3HK4 A;  1B2S A;  4FMD A;  5D82 A;  5JBS A;  3H3H A;  2CFG A;  2H0H A;  3EBT A;  3CCR 3;  1WMP A;  2ZDJ A;  5DRV A;  2E2V A;  2W2C A;  1BRN L;  4HM1 B;  3S28 A;  3V98 A;  1OHO A;  2F4Y A;  1J2B A;  2IUJ A;  5AYS C;  1RGG A;  5ELU A;  2KF6 A;  1TP6 A;  2JDI H;  4LEH A;  2F86 B;  2L1S A;  1NB5 I;  3CU3 A;  2ML5 A;  3NM2 A;  1FYS A;  1S72 3;  2PZV A;  1UGI A;  1OF5 B;  2YFL B;  3D9R A;  3K9M C;  2V1L A;  1JV2 B;  3LT9 A;  1OGZ A;  3SYU A;  3NHX A;  4WFO A;  1RGE A;  3F9S A;  5JPU A;  3OX9 A;  3EBY A;  3FH1 A;  2CW9 A;  3FG4 A;  3HI7 A;  4J5G A;  1SAR A;  1RRL A;  3PCR A;  4AEQ A;  5M19 A;  3CC7 3;  1VQL 3;  1CYU A;  2CFL A;  2PNC A;  1IVW A;  1VQ4 3;  4ZM8 A;  4CDL A;  3T8N A;  5AEU B;  1W4N A;  3EC9 A;  3HOH A;  1N9E A;  3AMO B;  4WHA A;  1ZGX A;  3HZP A;  4R4K A;  1G0T A;  2FGT A;  2Z6B A;  3S67 A;  3NV0 A;  3Q90 A;  2UGI A;  1EQK A;  1AVK A;  4FCZ A;  4HM7 B;  3CCJ 3;  4LMI A;  1A90 A;  3MKI A;  5LC6 A;  4BTY A;  1BU4 A;  3LTD A;  2WGO A;  5IEN A;  1VQ6 3;  4RNZ A;  2LQV A;  8RNT A;  1QMA A;  5KP4 A;  3GZX B;  3ZG0 A;  1IDP A;  1N9J A;  1SJW A;  3U97 A;  3G0K A;  2CKF B;  2RCD A;  3B8L A;  3VF1 A;  3MG3 A;  1PY3 A;  1GY7 A;  1GS3 A;  2QGU A;  3A76 A;  4EC6 A;  1R4Y A;  1AY7 A;  1A2V A;  3KII A;  5AIH A;  1YI2 3;  1W2Z A;  1FGM A;  5AIG A;  4RBN A;  3S29 A;  1JNQ A;  3KN4 A;  3BIR A;  1MWU A;  1FZU A;  3V99 A;  4N6L A;  1IT8 A;  4O3V A;  3SXX A;  4WP5 A;  3UL5 A;  4FMA A;  4HKV B;  1K73 4;  3FF0 A;  2K54 A;  3ZFZ A;  5IG4 A;  1NDO B;  2IYJ A;  2QIY A;  1N8R 4;  4O8S A;  4HAA A;  1CH0 A;  2P0M A;  3G8Z A; 
#chains in the Genus database with same CATH homology
 3GRD A;  1K28 A;  5I97 A;  1KSI A;  4LSO A;  1D6Y A;  1JB2 A;  2CC3 A;  3X3Z A;  1C7H A;  1EKM A;  4HM4 B;  3HIG A;  2QA4 3;  1Q86 4;  2Y73 A;  4WYK A;  4GL6 A;  1W6Y A;  1DVD A;  3H51 A;  2KXG A;  2INX A;  1SQW A;  2XRX B;  1WTH A;  2BHM A;  4H61 A;  4HM2 B;  1WQL B;  3BNE A;  2D42 A;  5D83 A;  2E2T A;  2HMN B;  1FGR A;  1OHP A;  3GZB A;  2A15 A;  1SPU A;  3CC4 3;  2BT3 A;  4MMZ B;  5LC7 A;  1KWI A;  4XBY A;  3WMD A;  4HZB B;  4HYZ A;  3MG2 A;  5ELJ A;  2CIU A;  2D1W A;  3F8X A;  3X3Y A;  1RN7 A;  2OTL 3;  3WOF B;  1WMO A;  1TIJ A;  4J9A A;  3KKG A;  1DMQ A;  3E99 A;  4FMC A;  2CH9 A;  1QAK A;  3N8B A;  3OW2 2;  3BNB A;  1EA2 A;  3LT8 A;  4CCV A;  4N6V 0;  1WNH A;  5EEO A;  3G4S 3;  3EQQ B;  1QAF A;  4HM8 B;  4H3U A;  3CCM 3;  4WWU C;  1K9M 4;  4HVN A;  5FGO A;  1JRQ A;  1CEW I;  3CME 3;  3IPT A;  3UNL A;  4N6N B;  2XFS A;  2C11 A;  5JPP A;  1RKY A;  3LTA A;  2WO0 A;  1NJI 4;  3EE1 A;  4R1K A;  5AI1 A;  3NQZ A;  2BO9 B;  1JN5 B;  1YIJ 3;  1Q42 A;  5CXO A;  3K0Z A;  4K1V A;  3GZR A;  4N6O B;  1D6U A;  2HMK B;  2IUK A;  1IQY A;  3FGY A;  1KQS 2;  2CG0 A;  3JVC A;  3SLU A;  2OQE A;  1STD A;  3G16 A;  5IER A;  3OWS A;  1IQ8 A;  2YX9 A;  6STD A;  3WDG B;  3NXJ A;  1GYB A;  3MSO A;  1W5Z A;  1YVB I;  3K5T A;  2B1X B;  1CQS A;  3DGO A;  1IT7 A;  3Q2P A;  4XBX A;  1TFO A;  3GAX A;  2JQ5 A;  2ML6 A;  4NRE A;  1MOL A;  2C10 A;  1GD4 A;  4K1U A;  1UI7 A;  5TGN A;  3QK9 A;  3QRD A;  3CCU 3;  3ALA A;  4QWT A;  3MG1 A;  2RSX A;  3N9H A;  1AR0 A;  1U8C B;  4X2O A;  5AYR B;  3F14 A;  1O7W B;  4XDW A;  2P05 A;  2F99 A;  2MF7 A;  1W7C A;  1IK3 A;  3O8Y A;  1K8A 4;  4X2H A;  4HM6 B;  3FZW A;  2WGQ A;  1W2B 2;  1DMM A;  2Z76 A;  4R9L A;  1D6Z A;  1JKG A;  5AEW B;  2GU1 A;  3CC2 3;  3EF8 A;  2CHC A;  3EB8 A;  3X40 A;  4LGQ A;  4IT7 A;  4FCM A;  3B7C A;  3JUO A;  3JUQ A;  4BTX A;  1VQK 3;  3NX0 A;  3WA2 X;  3FG3 A;  3LH4 A;  4HBR A;  3JUP A;  4EV5 A;  4KFF A;  2XSH B;  1NU3 A;  1TU5 A;  2M7O A;  1QVG 2;  3K7C A;  2Z7A A;  5IEP A;  3LTB A;  4K90 B;  5CK6 A;  4IIA A;  4TX4 A;  2IA7 A;  3S5C A;  2W0Q A;  3DGL A;  3ROB A;  2QEX 3;  2OOV C;  3S27 A;  1ROA A;  1YJW 3;  4HM0 B;  2R4I A;  5IEO A;  1YJ9 3;  3CCL 3;  2MC8 A;  3KZT A;  3CXC 2;  2HMJ B;  1N5H A;  1QJG A;  1V74 A;  3DXO A;  2Z77 A;  2XFT A;  5AII A;  1W6C A;  2O3O A;  3X41 A;  4WYK B;  3EN8 A;  4G1M B;  2L4V A;  1IVV A;  1Q82 4;  3TDG A;  2W04 A;  4EV2 A;  4EXR A;  5KP1 A;  4OVM A;  1W02 A;  3OWY A;  4FMB A;  4KZ1 A;  3DZL A;  1O7N B;  1AVL A;  2STD A;  3MHE A;  4HZ9 B;  4R80 A;  2OTJ 3;  2Y74 A;  1O7P B;  1US1 A;  3FF2 A;  3I0Y A;  2CWU A;  1OAC A;  3BNC A;  3LYG A;  4HM5 B;  4N6M A;  3T8U A;  3IJE B;  2HMM B;  4XBT A;  3CMA 3;  3OWU A;  3X42 A;  1N8Q A;  1JB5 A;  3B4O A;  3NM7 A;  1R4C A;  5FW5 A;  4I4K A;  3SOA A;  3M8C A;  3V92 A;  1OCV A;  4IPB A;  3LML A;  2O9U X;  2RFR A;  1N5P A;  2YFJ B;  3SVA A;  4Q53 A;  1OPY A;  1VQ9 3;  1FGT A;  1LXE A;  3DUK A;  5A0O B;  1GD3 A;  4NHF A;  2RGQ A;  2W56 B;  1Z1S A;  2P0X A;  2XF3 A;  1HKX A;  4RNY A;  1O7M B;  3WOE B;  3HX8 A;  1E97 A;  2LYX A;  2UX0 A;  2P09 A;  1AV4 A;  3BND A;  4N3V A;  7STD A;  1OUN A;  1IV7 A;  3ER7 A;  5HGR A;  3CNM A;  3FSD A;  1VQ5 3;  3EX9 A;  2CWV A;  3ECF A;  4KFE A;  4AKZ A;  3I56 3;  3J7Y d;  1Q40 A;  3LZA A;  3F40 A;  3CNX A;  3LOY A;  1KC8 4;  1PFP A;  2GEY A;  1JJ2 2;  1LNH A;  1TFK A;  4MJD A;  5EQL A;  3NUV A;  3STD A;  1SIH A;  4BTW A;  1OH0 A;  3LXU X;  3GWR A;  1WMN A;  4JF8 A;  3I55 3;  1JN5 A;  5BXQ A;  3EN1 B;  2XR8 B;  4KVH A;  1UI8 A;  2P38 A;  4MMY B;  3Q1C A;  1S5A A;  4XDV A;  3D3L A;  3K63 A;  1FUW A;  1HU9 A;  3JUM A;  4PEJ A;  1ROV A;  4HM3 B;  1JB4 A;  3G71 3;  3LTC A;  1VQ7 3;  3JUN A;  5EVH A;  3KE7 A;  1VQM 3;  4KFD A;  4EYC A;  1W01 A;  2GXF A;  4L8P A;  3CCQ 3;  3MYT A;  5CLK A;  4LZI A;  2KCD A;  1FGO A;  1OF5 A;  4OK0 A;  1VQO 3;  1E3V A;  3RDE A;  3FCS B;  1OGX A;  1O7H B;  3NV0 B;  1T5Y A;  1YGE A;  1IV9 A;  1TUH A;  3PGB A;  3OXA A;  2WOF A;  1O7G B;  5KP3 A;  3PZW A;  3AMO A;  3NBB A;  1ZO2 A;  1JKG B;  1VQN 3;  5IF6 A;  3KFQ C;  1DVC A;  2CFK A;  4ORL A;  5DRE A;  2W6J H;  3SX1 A;  2GBW B;  3NBR A;  5CF2 A;  1F8N A;  2XH9 A;  1FGQ A;  3NBJ A;  3DY5 A;  1IVU A;  3VSY A;  2KRT A;  3UJM A;  1STF I;  1W00 A;  3FG1 A;  3CCV 3;  4MMX B;  2W9Q A;  3CCE 3;  3DGM A;  3DGN A;  3PYJ A;  1E3R A;  2K0M A;  2FNQ A;  3EHC A;  4GB5 A;  1M1X B;  4XM4 A;  2ZL8 A;  3HII A;  2XGN A;  3WA3 A;  1NWW A;  2BMO B;  1PU4 A;  1UUW B;  4RZM A;  1VQP 3;  1VQ8 3;  1ISK A;  1M9G A;  8CHO A;  1U5O A;  3CPW 2;  3CPO A;  3B4P A;  1IQX A;  4N6T A;  4OUQ A;  5G2G A;  3EJV A;  3BB9 A;  4AKY A;  1NO3 A;  1DYU A;  5IG5 A;  3F8H A;  3RGA A;  1A2K A;  1CYV A;  1Q81 4;  3UL6 A;  1M90 4;  3DM8 A;  4FCJ A;  1IVX A;  2OOV A;  3WOD G;  3G6E 3;  1M1K 4;  2IMJ A;  1VZZ A;  3CCS 3;  4L8O A;  3PCS A;  1OHS A;  3F7S A;  3VGN A;  3PS8 A;  2CK3 H;  1GY5 A;  1NB3 I;  3L0R A;  4FR9 A;  4R9K A;  4EBG A;  1YIT 3;  2W9P A;  1G96 A;  3SED A;  1K41 A;  3FLJ A;  1YHQ 3;  1Q7Y 4;  3PXM A;  2B24 B;  2XEP A;  1RJO A;  3N54 B;  3CD6 3;  2GEX A;  3NQY A;  2GBX B;  1IU7 A;  1L5G B;  3X3X A;  1ULJ B;  5AIF A;  1UW1 A;  1Y4K A;  2F98 A;  3F7X A;  2W03 A;  1ASK A;  3GZY B;  2XGL A;  2E2U A;  1W6G A;  1MNL A;  1FA3 A;  3RGR A;  4MEI A;  3DMC A;  1EG9 B;  3SOY A;  1DMN A;  1GY6 A;  2XSO B;  3KSP A;  4U13 A;  5D81 A;  5CF1 A;  2HML B;  3T0U A;  1ZX2 A;  1SII A;  2OCT A;  2YFI B;  1RRH A;  2CWT A;  2HMO B;  3IMA B;  1LOX A;  2W56 A;  5STD A;  4O2H A;  1BUQ A;  1Q40 B;  4L7K A;  4O02 B;  5IG0 A;  1ULI B;  4J8T A;  3UB1 A;  3U1W A;  5IG3 A;  1A67 A;  1LVN A;  3MWZ A;  2SBL A;  1QAL A;  2CG1 A;  5IW9 A;  1UUV B;  2CFD A;  2OQE C;  2OWP A;  4JRF A;  4K61 A;  1YJN 3;  4HJL B;  2WOH A;  3OV4 A;  2BMQ B;  5BVB A;  1KD1 4;  2FXT A;  3FKA A;  2Q07 A;  3KSE D;  2BMR B;  3BLZ A;  2BNG A;  4N6U A;  2GU3 A;  4STD A;  4XB5 A;  2CFW A;  3MPH A;  2I9W A;  3HK4 A;  4FMD A;  5D82 A;  5JBS A;  3H3H A;  2CFG A;  3EBT A;  3CCR 3;  2ZDJ A;  1WMP A;  5DRV A;  2E2V A;  2W2C A;  4HM1 B;  3S28 A;  3V98 A;  1OHO A;  1J2B A;  2IUJ A;  5AYS C;  5ELU A;  1TP6 A;  2JDI H;  4LEH A;  2F86 B;  1NB5 I;  3CU3 A;  2ML5 A;  3NM2 A;  1S72 3;  2PZV A;  2YFL B;  1OF5 B;  3D9R A;  3K9M C;  3LT9 A;  2V1L A;  1JV2 B;  1QVF 2;  1OGZ A;  3NHX A;  4WFO A;  5JPU A;  3F9S A;  3OX9 A;  3EBY A;  3FH1 A;  2CW9 A;  3FG4 A;  3HI7 A;  1RRL A;  3PCR A;  4AEQ A;  3CC7 3;  1VQL 3;  1CYU A;  2CFL A;  2PNC A;  1IVW A;  1VQ4 3;  4ZM8 A;  4CDL A;  3T8N A;  5AEU B;  1W4N A;  3EC9 A;  1N9E A;  3AMO B;  4WHA A;  3HZP A;  4R4K A;  2FGT A;  2Z6B A;  3S67 A;  3NV0 A;  3Q90 A;  1EQK A;  1AVK A;  4FCZ A;  4HM7 B;  3CCJ 3;  4LMI A;  1A90 A;  3MKI A;  5LC6 A;  4BTY A;  3LTD A;  2WGO A;  5IEN A;  1VQ6 3;  4RNZ A;  2LQV A;  1QMA A;  5KP4 A;  3GZX B;  1IDP A;  1N9J A;  1SJW A;  3U97 A;  3G0K A;  2CKF B;  2RCD A;  3B8L A;  3VF1 A;  3MG3 A;  1GY7 A;  1GS3 A;  2QGU A;  3A76 A;  4EC6 A;  1A2V A;  3KII A;  5AIH A;  1YI2 3;  1W2Z A;  1FGM A;  5AIG A;  4RBN A;  3S29 A;  1JNQ A;  3KN4 A;  3V99 A;  4N6L A;  1IT8 A;  4O3V A;  3SXX A;  4WP5 A;  3UL5 A;  4FMA A;  4HKV B;  1K73 4;  3FF0 A;  2K54 A;  5IG4 A;  1NDO B;  2QIY A;  1N8R 4;  4O8S A;  2P0M A;  3G8Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...