3UB1A

Ntf2 like protein involved in plasmid conjugation
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
251
structure length
248
Chain Sequence
SLETQAFSFAEEFAWDYFSRYPSDTQDFVRRITKYTTEQLANEMNNGTYSDVIYTSAFYFEKYSENQVNVSVKARVRVYTPKAGQEQDQLQYDTNLVDYYLEVPIVFDKDMNMAVDALPVMTAPPEKAYFKNKEFSGTSENDADKTKKITDSVSQFFKAYYEQNQTQIDYFLVDGADIKGAGQKFSFNKIDRINIYKLSDKEFLAIVDLNVDSFGNAIKQGFNLTVVQEGDKFLVKTLEPRTSNIDLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The conjugation protein TcpC from Clostridium perfringens is structurally related to the type IV secretion system protein VirB8 from Gram-negative bacteria.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Transport protein
molecule keywords ORF13-like protein
total genus 53
structure length 248
sequence length 251
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12642 TpcC Conjugative transposon protein TcpC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.540 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ub1A02
3.10.450.540 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ub1A01
3UB1A 4EC6A
chains in the Genus database with same CATH superfamily
1DMNA 1A90A 3ECFA 1GY7A 2PZVA 4LMIA 4O2HA 5AIGA 2QGUA 1UI8A 1OF5B 1ULIB 1LNHA 1WTHA 1GD3A 1C54A 1LOVA 3PGBA 3LTBA 2C10A 2YFIB 4HM0B 1I0XA 3VF1A 1PU4A 1Y4KA 1W2ZA 1O7NB 4WYKB 3IJEB 2P05A 3X3YA 1BSEA 4PEJA 2GSPA 5GSPA 5A0OB 1QAKA 4CPKA 4N6MA 1TRPA 3KE7A 1GOUA 1MWSA 2INXA 1UUWB 1IVVA 1CYVA 2CX1A 3ER7A 1LVNA 3F8XA 3FG4A 3KSED 1UUGB 1FGQA 5ELJA 3BNCA 4CCVA 3NQZA 1CEWI 4RNYA 1PY3A 4BU4A 2W9PA 3A5EA 1ASKA 3LXUX 4N6UA 3MPHA 3G8ZA 1S723 3BNEA 4Q53A 2BMQB 2HOHA 1YIJ3 1B3SA 2OQEA 2XF3A 1I2GA 1NU3A 1GYBA 3I563 3HIIA 2YFJB 4HM1B 1ZS7A 4IT7A 4HM3B 3PCSA 4L8OA 1NB5I 1OH0A 2I9WA 4RBNA 1E97A 1FGTA 1W7CA 2GEXA 3LT9A 5G2GA 2CC3A 6RNTA 1YJ93 1X1XA 3FCSB 3OXAA 1N5PA 4FR9A 2O9UX 1T2HA 4AKZA 2E2VA 5JPPA 3NBBA 1BRSA 1RJOA 2SARA 1I8VA 1JV2B 4WYKA 1US1A 3JUNA 5IW9A 5IG5A 1TP6A 4HM8B 3O8YA 4MJDA 5IG0A 2F56A 3GZYB 2K0MA 4R80A 1MOLA 1UCLA 1FYSA 4HZBB 1EQKA 1EA2A 1GY5A 3JVCA 2XH9A 3LZAA 2ZA4A 2CFLA 1NO3A 3LOYA 4HM2B 4STDA 4I5QA 1UW1A 5TGNA 4U13A 3S28A 7RNTA 3WMDA 3F7XA 1BNRA 4N6V0 3VSYA 2W2CA 1OGZA 3WOFB 4XM4A 1BANA 1BRGA 1K41A 2E2TA 2W6JH 3MKIA 3CXC2 1OF5A 1ROVA 3AHWA 3DXOA 2HMLB 2HMKB 2W04A 2BHMA 3D79A 2H0IA 1BRNL 1Q864 1W4NA 4HM7B 3CC73 5LC6A 3X42A 3BU4A 4J9AA 4O8SA 2FXTA 3IMAB 3Q1CA 1X1YA 3DH2A 5AYRB 1OUNA 1B2ZA 1OPYA 2B24B 2CH9A 1BSAA 2GEYA 3K7CA 4HKVB 5IENA 2OCTA 4MMXB 1OGXA 4LEHA 1V58A 3WA2X 5BIRA 3DZLA 3AGOA 1NNVA 4FMAA 1Q824 2SBLA 3V92A 4J5KA 3CCM3 2MF7A 1RGAA 1HYFA 1WMOA 1IV7A 3K9MC 3RDEA 2F5MA 3CCU3 3Q90A 3LYGA 1O7MB 3SYUA 1EUIC 4BL2A 1B20A 1N8QA 2KF6A 2CKFB 1VZZA 3B7CA 4IPBA 1BNSA 3PYJA 2CHCA 1R4YA 4R9LA 2GBWB 2W9QA 5I97A 1RCLA 2QIYA 1GMRA 1AR0A 2KF3A 4LGQA 5ELUA 1RMSA 1QVF2 3FG3A 3NV0A 1E3RA 1EKMA 1RSNA 2IYJA 4RNTA 1BRIA 1HKXA 1QJGA 3JUQA 1MWTA 2CFWA 3NBRA 1UUVB 1VQQA 3HZPA 1PFPA 4MMYB 3STDA 1RDSA 3A76A 1STFI 2CIUA 1BNIA 2ZHXB 3N9HA 4AKYA 1FA3A 2Y74A 3B4OA 3WOEB 1O7WB 1BIRA 2CWTA 4FCZA 4WFOA 5CLKA 1VQP3 4J5GA 1NB3I 3WA3A 3BNDA 3AMOA 3H3HA 1D6UA 2BO9B 3CCJ3 1SARA 1GOYA 2RNTA 1GSPA 4WHAA 1D6ZA 1TJDA 1RN1A 2P09A 2XR8B 3GAXA 3SXXA 3HX8A 1I0VA 2STDA 1JB5A 3SX1A 3MSOA 5STDA 1LOXA 3X40A 2JQ5A 4R4KA 5G1KA 1JBRA 1RNTA 2YX9A 1RRHA 1A2VA 2OQEC 3D9RA 1BRHA 1A2PA 5M1AA 1RNBA 3CCR3 1GOVA 3OWUA 2W03A 5DRVA 2BT3A 2IA7A 1GS3A 2IMJA 1YI23 3E99A 4GHOA 1OCVA 1RGCA 3F40A 2C11A 2H0HA 2UX0A 1RGKA 3F7SA 2CWUA 1Q7Y4 1M1K4 1FUSA 1FGOA 1MNLA 1YGEA 2CW9A 5JPUA 1RKYA 3L0RA 2W56A 1TU5A 1Q9EA 5EVHA 1FUTA 1LOWA 2BNGA 1IDPA 1B21A 1LXEA 1Q40B 2XSHB 3PCRA 5AIIA 3I0YA 3EJVA 1MGWA 1FUWA 1N5HA 3FGYA 1JKGB 3NQYA 4R9KA 1IK3A 4WWUC 3ZG5A 1K8A4 1VQ63 4EXRA 1I3FA 3WODG 3LTCA 2WOFA 2Z77A 3PXMA 1RGFA 4MMZB 2RBIA 4N6OB 2WOHA 2RSXA 1ROAA 4GB5A 1KD14 2AADA 5M19A 1LQMB 1ISKA 4EV2A 1ULJB 1IQXA 3CU3A 1MWRA 4H61A 2MC8A 3NM2A 1I70A 4XBYA 3URPA 3VGNA 4BTWA 1Q42A 1EG9B 4HZ9B 2BIRA 1STDA 1UCIA 3KKGA 5DREA 4KFEA 1WMPA 1HU9A 2LYXA 3KIIA 4BTYA 1K734 1SIIA 3UL5A 4TX4A 1HZ1A 3FG1A 3OV4A 4N6TA 3HIGA 4H3UA 2Z6BA 1E3VA 1LQGC 3J7Yd 2OOVC 1ZGXA 2F99A 4XDWA 3S27A 1YVSA 4FCMA 3CMA3 1N9EA 1RGGA 4HJLB 3CCL3 1AY7A 3EN1B 4G1MB 4J8TA 2D42A 2K54A 1N9JA 4GSPA 1AQZA 1X1UA 3S67A 1VQ83 2A15A 4XB5A 3CPW2 1J2BA 1G0TA 1JB2A 3UB1A 1IQYA 2F98A 3MG1A 1V74A 1YJW3 1S5AA 1WNHA 1BUJA 1O7GB 1W6GA 2Z7AA 2P0MA 3X3XA 3CNMA 1DE3A 3ROBA 1LRAA 4HM6B 2CK3H 1RGHA 1SJWA 1YNVX 1NJI4 1RHLA 1JB4A 1YIT3 1IVWA 2L4VA 1JBTA 3BIRA 3KSPA 3ZG0A 1L5GB 2ZL8A 1JN5A 1GMPA 1YGWA 2BMRB 4BTXA 4CDLA 1VQ43 5CF1A 1Q814 3OWYA 3KZTA 2IUKA 2WGOA 3BLZA 4EC6A 4XDVA 1SQWA 6GSPA 4N6NB 7STDA 6STDA 5AIFA 1RGEA 3WHOA 1QMAA 1WMNA 4X2OA 5HOHA 3EQQB 3RGRA 2GXFA 3FZWA 3SVAA 4GL6A 1JJ22 1X1WA 5IEOA 1VQO3 2R4IA 4FMBA 1FZUA 1BSDA 1RN4A 2ML5A 3QK9A 4NHFA 3MWZA 4L8PA 4OVMA 3LTAA 2KAAA 2H0GA 1ZO2A 5D83A 5IEPA 3UJMA 1JKGA 1UCKA 3H51A 2CG0A 5KP3A 3ZFZA 5D81A 4O3VA 7GSPA 3I553 4X2HA 1W02A 2K3DA 2AAEA 2PNCA 2HMNB 2W56B 3JUMA 5IERA 4K61A 3EBYA 1CQSA 2C4BA 3DUKA 1NDOB 3CCE3 3RGAA 1JRQA 3F8HA 4BIRA 4KFDA 1VQ73 3EHCA 2O3OA 4KT3B 3SLUA 2KCDA 5JBSA 1V57A 1AV4A 3NXJA 1AVLA 3MHEA 1BVIA 1JN5B 2CFGA 1MWUA 1I3IA 2BMOB 1OHPA 1U8CB 3DM8A 2WGQA 4HM5B 5BXQA 5IG4A 1A67A 2RGQA 1FGRA 2XSOB 4KZ1A 1UI7A 3ALAA 3D3LA 2CFDA 4KVHA 1W00A 4LZIA 1T2IA 3EC9A 4MEIA 4ILFA 2W0QA 4FMCA 1RN7A 1RRLA 2HMOB 3LMLA 1YVBI 1G02A 2CX0A 3GWRA 3AMOB 4RNZA 4HOHA 5LC7A 1F8NA 3NM7A 2Q07A 2UGIA 4LSOA 1OACA 1TIJA 3LH4A 2GU3A 3F9SA 3X41A 2HMJB 4DKIA 3LT8A 9RNTA 1TTOA 3D5GA 1WQLB 1T5YA 1TFOA 1DMMA 1BNFA 1O7HB 2L1SA 3EN8A 4I4KA 4JF8A 5BU4A 8RNTA 4OK0A 1TFKA 5M18A 1BAOA 3HOHA 5KP1A 1DETA 1B2MA 1RLSA 3JUPA 3G16A 4EBGA 1Z1SA 1GY6A 4L7KA 1QVG2 1UDII 1R4CA 3JUOA 1B2UA 1FW7A 2XFTA 3CCS3 2Y73A 2YFLB 1W2B2 1W6CA 1G96A 1TUHA 1JNQA 1UCJA 3DGYA 3GRDA 3G4S3 3B4PA 4QWTA 3CNXA 1KC84 3G0KA 2IY2A 1BRKA 3RNTA 1M1XB 3M8CA 5KP4A 1N8R4 2JDIH 1RGLA 2Z76A 3F14A 3GZRA 2FGTA 4WP5A 1TRQA 2E2UA 3GSPA 4K90B 3WR2A 3B8LA 4EYCA 4OUQA 1U5OA 5BVBA 2IUJA 4R1KA 3HK4A 2ML6A 2KF4A 4JRFA 3T0UA 4HAAA 5IF6A 1CYUA 1DVCA 1A2KA 3TDGA 1BNEA 5AYSC 1C7HA 3FF2A 3FH1A 2RFRA 1IU7A 2V1LA 2P0XA 4FMDA 5AEWB 3SEDA 2J8XB 3U1WA 1VQ93 2ZDJA 4LYLB 3IPTA 2D1WA 2LQVA 4HVNA 3FKAA 3G6E3 1BOXA 1GD4A 2M7OA 4XBTA 4NREA 3DMCA 1AVKA 1BNGA 3T8UA 3K5TA 5IG3A 4RZMA 3U97A 1T3BA 1BGSA 1NWWA 1UGHI 3KN4A 4HBRA 4ZM8A 1IT8A 5HGRA 5AEUB 8CHOA 1IVUA 3V99A 4KFFA 3BB9A 4BL3A 3QRDA 2KF5A 1ZX2A 1KWIA 2XGNA 4NPBA 3NBJA 3OWSA 2F4YA 1IV9A 1JZOA 2GBXB 4CJNA 4HYZA 3CME3 3K63A 3MYTA 5FGOA 3OX9A 1W5ZA 3DGMA 3NHXA 4IIAA 2OTJ3 1SPUA 5CXOA 1I2EA 5FW5A 2P38A 2XFSA 2CWVA 3DGOA 3N8BA 2FNQA 3AGNA 3S29A 1VQ53 1DMQA 1K9M4 3K0ZA 2KXGA 1Q7HA 3NV0B 3Q3FA 1D6YA 2KRTA 3KFQC 3WDGB 1BU4A 3FLJA 3UNLA 3EBTA 3AHSA 3EE1A 2F86B 3SOYA 3T8NA 1VQN3 1KSIA 3OW22 2QEX3 1OHOA 2F5WA 3NUVA 3X3ZA 1QAFA 3SOAA 1VQK3 1B27A 1BSCA 1LOYA 1I2FA 1RTUA 3MG2A 5RNTA 1IYYA 4XBXA 4K1VA 2XGLA 2WO0A 1DVDA 1YHQ3 2OWPA 3HI7A 3EX9A 2HMMB 1VQL3 4K1UA 2RCDA 3CC23 1UGIA 1LNIA 3CD63 3NX0A 2XEPA 1JBSA 2QA43 1OHSA 3Q2PA 3EB8A 1FGMA 3DY5A 3DGNA 1IQ8A 1SIHA 5CK6A 2BU4A 1EEJA 1B2XA 4EW5A 1CH0A 4O02B 1IT7A 1M9GA 2CG1A 1BNJA 1Q40A 3EF8A 3V98A 5EQLA 1MGRA 3FF0A 3MG3A 4FCJA 1KQS2 5D82A 1BSBA 5AI1A 2B1XB 4HM4B 5CF2A 1JZDA 2GU1A 3PS8A 4EV5A 3D5IA 4AEQA 4N6LA 2OOVA 3CC43 3BNBA 4N3VA 2XRXB 1BRJA 3G713 1B2SA 3CCQ3 3DGLA 1BUQA 3N54B 3FSDA 2UUGC 1IVXA 3CCV3 3LTDA 1PYLA 3D4AA 3S5CA 1YJN3 1M904 5AIHA 3GZXB 1VQM3 1GMQA 1O7PB 5EEOA 3UL6A 5G1LA 3GZBA 2CFKA 1K28A 1DYUA 4ORLA 1RCKA 1QALA 2R41A 3CPOA 3KCHA 1W01A 1W6YA 3PZWA 2OTL3
chains in the Genus database with same CATH topology
1DMNA 1A90A 3ECFA 1GY7A 2PZVA 4LMIA 4O2HA 5AIGA 2QGUA 1UI8A 1OF5B 1ULIB 1LNHA 1WTHA 1GD3A 3PGBA 3LTBA 2C10A 2YFIB 4HM0B 3VF1A 1PU4A 1Y4KA 1W2ZA 1O7NB 4WYKB 3IJEB 2P05A 3X3YA 5A0OB 4PEJA 1QAKA 4N6MA 3KE7A 2INXA 1UUWB 1IVVA 1CYVA 3ER7A 3F8XA 1LVNA 3FG4A 3KSED 5ELJA 4CCVA 1FGQA 3BNCA 3NQZA 1CEWI 4RNYA 2W9PA 3LXUX 1ASKA 4N6UA 3MPHA 3G8ZA 1S723 3BNEA 4Q53A 2BMQB 1YIJ3 2OQEA 2XF3A 1NU3A 1GYBA 3I563 3HIIA 2YFJB 4HM1B 4IT7A 4HM3B 3PCSA 4L8OA 1NB5I 1OH0A 2I9WA 4RBNA 1E97A 1FGTA 1W7CA 2GEXA 3LT9A 5G2GA 2CC3A 1YJ93 3FCSB 3OXAA 1N5PA 4FR9A 2O9UX 4AKZA 5JPPA 2E2VA 3NBBA 1RJOA 1JV2B 4WYKA 1US1A 3JUNA 5IW9A 5IG5A 1TP6A 4HM8B 3O8YA 4MJDA 5IG0A 3GZYB 2K0MA 4R80A 1MOLA 4HZBB 1EQKA 1EA2A 1GY5A 3JVCA 2XH9A 3LZAA 2CFLA 1NO3A 3LOYA 4HM2B 4STDA 1UW1A 5TGNA 4U13A 3S28A 3WMDA 3F7XA 4N6V0 3VSYA 2W2CA 1OGZA 3WOFB 4XM4A 1K41A 2E2TA 2W6JH 3MKIA 1OF5A 1ROVA 3DXOA 2HMLB 2HMKB 2W04A 2BHMA 1Q864 1W4NA 4HM7B 3CC73 5LC6A 3X42A 4O8SA 4J9AA 2FXTA 3IMAB 3Q1CA 5AYRB 1OUNA 1OPYA 2B24B 2CH9A 2GEYA 3K7CA 4HKVB 5IENA 2OCTA 4MMXB 1OGXA 4LEHA 3WA2X 3DZLA 4FMAA 1Q824 2SBLA 3V92A 3CCM3 2MF7A 1WMOA 1IV7A 3K9MC 3RDEA 3CCU3 3Q90A 3LYGA 1O7MB 1N8QA 2CKFB 1VZZA 3B7CA 4IPBA 3PYJA 2CHCA 4R9LA 2GBWB 2W9QA 5I97A 2QIYA 1AR0A 1QVF2 4LGQA 5ELUA 3FG3A 3NV0A 1E3RA 1EKMA 1HKXA 1QJGA 3JUQA 2CFWA 3NBRA 1UUVB 3HZPA 1PFPA 4MMYB 3STDA 3A76A 1STFI 2CIUA 3N9HA 4AKYA 1FA3A 2Y74A 3B4OA 3WOEB 1O7WB 2CWTA 4FCZA 4WFOA 5CLKA 1VQP3 1NB3I 3WA3A 3BNDA 3AMOA 3H3HA 1D6UA 2BO9B 3CCJ3 4WHAA 1D6ZA 2P09A 2XR8B 3GAXA 3SXXA 3HX8A 2STDA 1JB5A 3SX1A 3MSOA 5STDA 1LOXA 3X40A 2JQ5A 4R4KA 2YX9A 1RRHA 1A2VA 2OQEC 3D9RA 3CCR3 3OWUA 2W03A 5DRVA 2BT3A 2IA7A 1GS3A 2IMJA 1YI23 3E99A 1OCVA 3F40A 2C11A 2UX0A 3F7SA 2CWUA 1Q7Y4 1M1K4 1MNLA 1FGOA 2CW9A 1YGEA 5JPUA 1RKYA 3L0RA 2W56A 1TU5A 5EVHA 2BNGA 1IDPA 1Q40B 1LXEA 2XSHB 3PCRA 5AIIA 3I0YA 3EJVA 1FUWA 1N5HA 3FGYA 1JKGB 3NQYA 4R9KA 1IK3A 4WWUC 1K8A4 1VQ63 4EXRA 3WODG 3LTCA 2WOFA 2Z77A 3PXMA 4MMZB 4N6OB 2WOHA 2RSXA 1ROAA 4GB5A 1KD14 1ISKA 4EV2A 1ULJB 1IQXA 3CU3A 4H61A 2MC8A 3NM2A 4XBYA 3VGNA 4BTWA 1Q42A 1EG9B 4HZ9B 1STDA 3KKGA 5DREA 4KFEA 1WMPA 1HU9A 2LYXA 3KIIA 4BTYA 1K734 1SIIA 3UL5A 4TX4A 3FG1A 3OV4A 4N6TA 3HIGA 4H3UA 2Z6BA 1E3VA 3J7Yd 2OOVC 2F99A 3S27A 4XDWA 3CMA3 4FCMA 1N9EA 4HJLB 3CCL3 3EN1B 4G1MB 4J8TA 2D42A 2K54A 1N9JA 3S67A 1J2BA 2A15A 4XB5A 3CPW2 1JB2A 3UB1A 1IQYA 2F98A 3MG1A 1V74A 1YJW3 1S5AA 1WNHA 1O7GB 1W6GA 2Z7AA 2P0MA 3X3XA 3CNMA 3ROBA 4HM6B 2CK3H 1SJWA 1NJI4 1JB4A 1YIT3 1IVWA 2L4VA 3KSPA 1L5GB 2ZL8A 1JN5A 2BMRB 4BTXA 4CDLA 1VQ43 5CF1A 1Q814 3OWYA 3KZTA 2IUKA 2WGOA 3BLZA 4EC6A 4XDVA 1SQWA 4N6NB 7STDA 6STDA 5AIFA 1QMAA 1WMNA 4X2OA 3EQQB 3RGRA 2GXFA 3FZWA 3SVAA 4GL6A 1JJ22 5IEOA 1VQO3 2R4IA 4FMBA 2ML5A 3QK9A 4NHFA 3MWZA 4L8PA 4OVMA 3LTAA 1ZO2A 5D83A 5IEPA 3UJMA 1JKGA 3H51A 2CG0A 5KP3A 5D81A 4O3VA 3I553 4X2HA 1W02A 2PNCA 2HMNB 2W56B 3JUMA 5IERA 4K61A 3EBYA 1CQSA 3DUKA 1NDOB 3CCE3 3RGAA 1JRQA 3F8HA 4KFDA 1VQ73 3EHCA 2O3OA 3SLUA 2KCDA 5JBSA 1AV4A 3NXJA 1AVLA 3MHEA 1JN5B 2CFGA 1VQ83 2BMOB 1OHPA 1U8CB 3DM8A 2WGQA 4HM5B 5BXQA 5IG4A 1A67A 2RGQA 1FGRA 2XSOB 4KZ1A 1UI7A 3ALAA 3D3LA 2CFDA 4KVHA 1W00A 4LZIA 3EC9A 4MEIA 2W0QA 4FMCA 1RN7A 1RRLA 2HMOB 3LMLA 1YVBI 3GWRA 3AMOB 4RNZA 5LC7A 1F8NA 3NM7A 2Q07A 4LSOA 1OACA 1TIJA 3LH4A 2GU3A 3F9SA 3X41A 2HMJB 3LT8A 1WQLB 1T5YA 1TFOA 1DMMA 1O7HB 3EN8A 4I4KA 4JF8A 4OK0A 1TFKA 5KP1A 3JUPA 3G16A 4EBGA 1Z1SA 1GY6A 4L7KA 1QVG2 1R4CA 3JUOA 2XFTA 3CCS3 2Y73A 2YFLB 1W2B2 1W6CA 1G96A 1TUHA 1JNQA 3GRDA 3G4S3 3B4PA 4QWTA 3CNXA 1KC84 3G0KA 1M1XB 3M8CA 5KP4A 1N8R4 2JDIH 2Z76A 3F14A 3GZRA 2FGTA 4WP5A 2E2UA 4K90B 3B8LA 4EYCA 4OUQA 1U5OA 5BVBA 2IUJA 4R1KA 3HK4A 2ML6A 4JRFA 3T0UA 5IF6A 1CYUA 1DVCA 1A2KA 3TDGA 5AYSC 1C7HA 3FF2A 3FH1A 2RFRA 1IU7A 2V1LA 2P0XA 4FMDA 5AEWB 3SEDA 3U1WA 1VQ93 2ZDJA 3IPTA 2D1WA 2LQVA 4HVNA 3FKAA 3G6E3 1GD4A 2M7OA 4XBTA 4NREA 3DMCA 1AVKA 3T8UA 3K5TA 5IG3A 4RZMA 3U97A 3KN4A 1NWWA 4ZM8A 4HBRA 3CXC2 5AEUB 1IT8A 5HGRA 8CHOA 1IVUA 3V99A 4KFFA 3BB9A 3QRDA 1ZX2A 1KWIA 2XGNA 3NBJA 3OWSA 1IV9A 2GBXB 4HYZA 3CME3 3K63A 3MYTA 5FGOA 3OX9A 1W5ZA 3DGMA 3NHXA 4IIAA 2OTJ3 1SPUA 5CXOA 5FW5A 2P38A 2XFSA 2CWVA 3DGOA 3N8BA 2FNQA 3S29A 1VQ53 1DMQA 1K9M4 3K0ZA 2KXGA 3NV0B 1D6YA 2KRTA 3KFQC 3WDGB 3FLJA 3UNLA 3EBTA 3EE1A 2F86B 3SOYA 3T8NA 1VQN3 1KSIA 3OW22 2QEX3 1OHOA 3NUVA 3X3ZA 1QAFA 3SOAA 1VQK3 3MG2A 4XBXA 4K1VA 2XGLA 2WO0A 1DVDA 1YHQ3 2OWPA 3HI7A 3EX9A 2HMMB 1VQL3 4K1UA 2RCDA 3CC23 3CD63 3NX0A 2XEPA 2QA43 1OHSA 3Q2PA 3EB8A 1FGMA 3DY5A 3DGNA 1IQ8A 1SIHA 5CK6A 4O02B 1IT7A 1M9GA 2CG1A 1Q40A 3EF8A 3V98A 5EQLA 3FF0A 4FCJA 3MG3A 1KQS2 5D82A 5AI1A 2B1XB 4HM4B 5CF2A 2GU1A 3PS8A 4EV5A 4AEQA 4N6LA 2OOVA 3CC43 3BNBA 4N3VA 2XRXB 3G713 3CCQ3 3DGLA 1BUQA 3N54B 3FSDA 1IVXA 3CCV3 3LTDA 1YJN3 3S5CA 1M904 5AIHA 3GZXB 1VQM3 1O7PB 5EEOA 3UL6A 3GZBA 2CFKA 1K28A 1DYUA 4ORLA 1QALA 3CPOA 1W01A 1W6YA 3PZWA 2OTL3
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UB1 A;  4EC6 A; 
#chains in the Genus database with same CATH topology
 1DMN A;  1A90 A;  3ECF A;  1GY7 A;  2PZV A;  4LMI A;  4O2H A;  5AIG A;  2QGU A;  1UI8 A;  1OF5 B;  1ULI B;  1LNH A;  1WTH A;  1GD3 A;  1C54 A;  1LOV A;  3PGB A;  3LTB A;  2C10 A;  2YFI B;  4HM0 B;  1I0X A;  3VF1 A;  1PU4 A;  1Y4K A;  1W2Z A;  1O7N B;  4WYK B;  3IJE B;  2P05 A;  3X3Y A;  1BSE A;  4PEJ A;  2GSP A;  5GSP A;  5A0O B;  1QAK A;  4CPK A;  4N6M A;  1TRP A;  3KE7 A;  1GOU A;  1MWS A;  2INX A;  1UUW B;  1IVV A;  1CYV A;  2CX1 A;  3ER7 A;  1LVN A;  3F8X A;  3FG4 A;  3KSE D;  1UUG B;  1FGQ A;  5ELJ A;  3BNC A;  4CCV A;  3NQZ A;  1CEW I;  4RNY A;  1PY3 A;  4BU4 A;  2W9P A;  3A5E A;  1ASK A;  3LXU X;  4N6U A;  3MPH A;  3G8Z A;  1S72 3;  3BNE A;  4Q53 A;  2BMQ B;  2HOH A;  1YIJ 3;  1B3S A;  2OQE A;  2XF3 A;  1I2G A;  1NU3 A;  1GYB A;  3I56 3;  3HII A;  2YFJ B;  4HM1 B;  1ZS7 A;  4IT7 A;  4HM3 B;  3PCS A;  4L8O A;  1NB5 I;  1OH0 A;  2I9W A;  4RBN A;  1E97 A;  1FGT A;  1W7C A;  2GEX A;  3LT9 A;  5G2G A;  2CC3 A;  6RNT A;  1YJ9 3;  1X1X A;  3FCS B;  3OXA A;  1N5P A;  4FR9 A;  2O9U X;  1T2H A;  4AKZ A;  2E2V A;  5JPP A;  3NBB A;  1BRS A;  1RJO A;  2SAR A;  1I8V A;  1JV2 B;  4WYK A;  1US1 A;  3JUN A;  5IW9 A;  5IG5 A;  1TP6 A;  4HM8 B;  3O8Y A;  4MJD A;  5IG0 A;  2F56 A;  3GZY B;  2K0M A;  4R80 A;  1MOL A;  1UCL A;  1FYS A;  4HZB B;  1EQK A;  1EA2 A;  1GY5 A;  3JVC A;  2XH9 A;  3LZA A;  2ZA4 A;  2CFL A;  1NO3 A;  3LOY A;  4HM2 B;  4STD A;  4I5Q A;  1UW1 A;  5TGN A;  4U13 A;  3S28 A;  7RNT A;  3WMD A;  3F7X A;  1BNR A;  4N6V 0;  3VSY A;  2W2C A;  1OGZ A;  3WOF B;  4XM4 A;  1BAN A;  1BRG A;  1K41 A;  2E2T A;  2W6J H;  3MKI A;  3CXC 2;  1OF5 A;  1ROV A;  3AHW A;  3DXO A;  2HML B;  2HMK B;  2W04 A;  2BHM A;  3D79 A;  2H0I A;  1BRN L;  1Q86 4;  1W4N A;  4HM7 B;  3CC7 3;  5LC6 A;  3X42 A;  3BU4 A;  4J9A A;  4O8S A;  2FXT A;  3IMA B;  3Q1C A;  1X1Y A;  3DH2 A;  5AYR B;  1OUN A;  1B2Z A;  1OPY A;  2B24 B;  2CH9 A;  1BSA A;  2GEY A;  3K7C A;  4HKV B;  5IEN A;  2OCT A;  4MMX B;  1OGX A;  4LEH A;  1V58 A;  3WA2 X;  5BIR A;  3DZL A;  3AGO A;  1NNV A;  4FMA A;  1Q82 4;  2SBL A;  3V92 A;  4J5K A;  3CCM 3;  2MF7 A;  1RGA A;  1HYF A;  1WMO A;  1IV7 A;  3K9M C;  3RDE A;  2F5M A;  3CCU 3;  3Q90 A;  3LYG A;  1O7M B;  3SYU A;  1EUI C;  4BL2 A;  1B20 A;  1N8Q A;  2KF6 A;  2CKF B;  1VZZ A;  3B7C A;  4IPB A;  1BNS A;  3PYJ A;  2CHC A;  1R4Y A;  4R9L A;  2GBW B;  2W9Q A;  5I97 A;  1RCL A;  2QIY A;  1GMR A;  1AR0 A;  2KF3 A;  4LGQ A;  5ELU A;  1RMS A;  1QVF 2;  3FG3 A;  3NV0 A;  1E3R A;  1EKM A;  1RSN A;  2IYJ A;  4RNT A;  1BRI A;  1HKX A;  1QJG A;  3JUQ A;  1MWT A;  2CFW A;  3NBR A;  1UUV B;  1VQQ A;  3HZP A;  1PFP A;  4MMY B;  3STD A;  1RDS A;  3A76 A;  1STF I;  2CIU A;  1BNI A;  2ZHX B;  3N9H A;  4AKY A;  1FA3 A;  2Y74 A;  3B4O A;  3WOE B;  1O7W B;  1BIR A;  2CWT A;  4FCZ A;  4WFO A;  5CLK A;  1VQP 3;  4J5G A;  1NB3 I;  3WA3 A;  3BND A;  3AMO A;  3H3H A;  1D6U A;  2BO9 B;  3CCJ 3;  1SAR A;  1GOY A;  2RNT A;  1GSP A;  4WHA A;  1D6Z A;  1TJD A;  1RN1 A;  2P09 A;  2XR8 B;  3GAX A;  3SXX A;  3HX8 A;  1I0V A;  2STD A;  1JB5 A;  3SX1 A;  3MSO A;  5STD A;  1LOX A;  3X40 A;  2JQ5 A;  4R4K A;  5G1K A;  1JBR A;  1RNT A;  2YX9 A;  1RRH A;  1A2V A;  2OQE C;  3D9R A;  1BRH A;  1A2P A;  5M1A A;  1RNB A;  3CCR 3;  1GOV A;  3OWU A;  2W03 A;  5DRV A;  2BT3 A;  2IA7 A;  1GS3 A;  2IMJ A;  1YI2 3;  3E99 A;  4GHO A;  1OCV A;  1RGC A;  3F40 A;  2C11 A;  2H0H A;  2UX0 A;  1RGK A;  3F7S A;  2CWU A;  1Q7Y 4;  1M1K 4;  1FUS A;  1FGO A;  1MNL A;  1YGE A;  2CW9 A;  5JPU A;  1RKY A;  3L0R A;  2W56 A;  1TU5 A;  1Q9E A;  5EVH A;  1FUT A;  1LOW A;  2BNG A;  1IDP A;  1B21 A;  1LXE A;  1Q40 B;  2XSH B;  3PCR A;  5AII A;  3I0Y A;  3EJV A;  1MGW A;  1FUW A;  1N5H A;  3FGY A;  1JKG B;  3NQY A;  4R9K A;  1IK3 A;  4WWU C;  3ZG5 A;  1K8A 4;  1VQ6 3;  4EXR A;  1I3F A;  3WOD G;  3LTC A;  2WOF A;  2Z77 A;  3PXM A;  1RGF A;  4MMZ B;  2RBI A;  4N6O B;  2WOH A;  2RSX A;  1ROA A;  4GB5 A;  1KD1 4;  2AAD A;  5M19 A;  1LQM B;  1ISK A;  4EV2 A;  1ULJ B;  1IQX A;  3CU3 A;  1MWR A;  4H61 A;  2MC8 A;  3NM2 A;  1I70 A;  4XBY A;  3URP A;  3VGN A;  4BTW A;  1Q42 A;  1EG9 B;  4HZ9 B;  2BIR A;  1STD A;  1UCI A;  3KKG A;  5DRE A;  4KFE A;  1WMP A;  1HU9 A;  2LYX A;  3KII A;  4BTY A;  1K73 4;  1SII A;  3UL5 A;  4TX4 A;  1HZ1 A;  3FG1 A;  3OV4 A;  4N6T A;  3HIG A;  4H3U A;  2Z6B A;  1E3V A;  1LQG C;  3J7Y d;  2OOV C;  1ZGX A;  2F99 A;  4XDW A;  3S27 A;  1YVS A;  4FCM A;  3CMA 3;  1N9E A;  1RGG A;  4HJL B;  3CCL 3;  1AY7 A;  3EN1 B;  4G1M B;  4J8T A;  2D42 A;  2K54 A;  1N9J A;  4GSP A;  1AQZ A;  1X1U A;  3S67 A;  1VQ8 3;  2A15 A;  4XB5 A;  3CPW 2;  1J2B A;  1G0T A;  1JB2 A;  3UB1 A;  1IQY A;  2F98 A;  3MG1 A;  1V74 A;  1YJW 3;  1S5A A;  1WNH A;  1BUJ A;  1O7G B;  1W6G A;  2Z7A A;  2P0M A;  3X3X A;  3CNM A;  1DE3 A;  3ROB A;  1LRA A;  4HM6 B;  2CK3 H;  1RGH A;  1SJW A;  1YNV X;  1NJI 4;  1RHL A;  1JB4 A;  1YIT 3;  1IVW A;  2L4V A;  1JBT A;  3BIR A;  3KSP A;  3ZG0 A;  1L5G B;  2ZL8 A;  1JN5 A;  1GMP A;  1YGW A;  2BMR B;  4BTX A;  4CDL A;  1VQ4 3;  5CF1 A;  1Q81 4;  3OWY A;  3KZT A;  2IUK A;  2WGO A;  3BLZ A;  4EC6 A;  4XDV A;  1SQW A;  6GSP A;  4N6N B;  7STD A;  6STD A;  5AIF A;  1RGE A;  3WHO A;  1QMA A;  1WMN A;  4X2O A;  5HOH A;  3EQQ B;  3RGR A;  2GXF A;  3FZW A;  3SVA A;  4GL6 A;  1JJ2 2;  1X1W A;  5IEO A;  1VQO 3;  2R4I A;  4FMB A;  1FZU A;  1BSD A;  1RN4 A;  2ML5 A;  3QK9 A;  4NHF A;  3MWZ A;  4L8P A;  4OVM A;  3LTA A;  2KAA A;  2H0G A;  1ZO2 A;  5D83 A;  5IEP A;  3UJM A;  1JKG A;  1UCK A;  3H51 A;  2CG0 A;  5KP3 A;  3ZFZ A;  5D81 A;  4O3V A;  7GSP A;  3I55 3;  4X2H A;  1W02 A;  2K3D A;  2AAE A;  2PNC A;  2HMN B;  2W56 B;  3JUM A;  5IER A;  4K61 A;  3EBY A;  1CQS A;  2C4B A;  3DUK A;  1NDO B;  3CCE 3;  3RGA A;  1JRQ A;  3F8H A;  4BIR A;  4KFD A;  1VQ7 3;  3EHC A;  2O3O A;  4KT3 B;  3SLU A;  2KCD A;  5JBS A;  1V57 A;  1AV4 A;  3NXJ A;  1AVL A;  3MHE A;  1BVI A;  1JN5 B;  2CFG A;  1MWU A;  1I3I A;  2BMO B;  1OHP A;  1U8C B;  3DM8 A;  2WGQ A;  4HM5 B;  5BXQ A;  5IG4 A;  1A67 A;  2RGQ A;  1FGR A;  2XSO B;  4KZ1 A;  1UI7 A;  3ALA A;  3D3L A;  2CFD A;  4KVH A;  1W00 A;  4LZI A;  1T2I A;  3EC9 A;  4MEI A;  4ILF A;  2W0Q A;  4FMC A;  1RN7 A;  1RRL A;  2HMO B;  3LML A;  1YVB I;  1G02 A;  2CX0 A;  3GWR A;  3AMO B;  4RNZ A;  4HOH A;  5LC7 A;  1F8N A;  3NM7 A;  2Q07 A;  2UGI A;  4LSO A;  1OAC A;  1TIJ A;  3LH4 A;  2GU3 A;  3F9S A;  3X41 A;  2HMJ B;  4DKI A;  3LT8 A;  9RNT A;  1TTO A;  3D5G A;  1WQL B;  1T5Y A;  1TFO A;  1DMM A;  1BNF A;  1O7H B;  2L1S A;  3EN8 A;  4I4K A;  4JF8 A;  5BU4 A;  8RNT A;  4OK0 A;  1TFK A;  5M18 A;  1BAO A;  3HOH A;  5KP1 A;  1DET A;  1B2M A;  1RLS A;  3JUP A;  3G16 A;  4EBG A;  1Z1S A;  1GY6 A;  4L7K A;  1QVG 2;  1UDI I;  1R4C A;  3JUO A;  1B2U A;  1FW7 A;  2XFT A;  3CCS 3;  2Y73 A;  2YFL B;  1W2B 2;  1W6C A;  1G96 A;  1TUH A;  1JNQ A;  1UCJ A;  3DGY A;  3GRD A;  3G4S 3;  3B4P A;  4QWT A;  3CNX A;  1KC8 4;  3G0K A;  2IY2 A;  1BRK A;  3RNT A;  1M1X B;  3M8C A;  5KP4 A;  1N8R 4;  2JDI H;  1RGL A;  2Z76 A;  3F14 A;  3GZR A;  2FGT A;  4WP5 A;  1TRQ A;  2E2U A;  3GSP A;  4K90 B;  3WR2 A;  3B8L A;  4EYC A;  4OUQ A;  1U5O A;  5BVB A;  2IUJ A;  4R1K A;  3HK4 A;  2ML6 A;  2KF4 A;  4JRF A;  3T0U A;  4HAA A;  5IF6 A;  1CYU A;  1DVC A;  1A2K A;  3TDG A;  1BNE A;  5AYS C;  1C7H A;  3FF2 A;  3FH1 A;  2RFR A;  1IU7 A;  2V1L A;  2P0X A;  4FMD A;  5AEW B;  3SED A;  2J8X B;  3U1W A;  1VQ9 3;  2ZDJ A;  4LYL B;  3IPT A;  2D1W A;  2LQV A;  4HVN A;  3FKA A;  3G6E 3;  1BOX A;  1GD4 A;  2M7O A;  4XBT A;  4NRE A;  3DMC A;  1AVK A;  1BNG A;  3T8U A;  3K5T A;  5IG3 A;  4RZM A;  3U97 A;  1T3B A;  1BGS A;  1NWW A;  1UGH I;  3KN4 A;  4HBR A;  4ZM8 A;  1IT8 A;  5HGR A;  5AEU B;  8CHO A;  1IVU A;  3V99 A;  4KFF A;  3BB9 A;  4BL3 A;  3QRD A;  2KF5 A;  1ZX2 A;  1KWI A;  2XGN A;  4NPB A;  3NBJ A;  3OWS A;  2F4Y A;  1IV9 A;  1JZO A;  2GBX B;  4CJN A;  4HYZ A;  3CME 3;  3K63 A;  3MYT A;  5FGO A;  3OX9 A;  1W5Z A;  3DGM A;  3NHX A;  4IIA A;  2OTJ 3;  1SPU A;  5CXO A;  1I2E A;  5FW5 A;  2P38 A;  2XFS A;  2CWV A;  3DGO A;  3N8B A;  2FNQ A;  3AGN A;  3S29 A;  1VQ5 3;  1DMQ A;  1K9M 4;  3K0Z A;  2KXG A;  1Q7H A;  3NV0 B;  3Q3F A;  1D6Y A;  2KRT A;  3KFQ C;  3WDG B;  1BU4 A;  3FLJ A;  3UNL A;  3EBT A;  3AHS A;  3EE1 A;  2F86 B;  3SOY A;  3T8N A;  1VQN 3;  1KSI A;  3OW2 2;  2QEX 3;  1OHO A;  2F5W A;  3NUV A;  3X3Z A;  1QAF A;  3SOA A;  1VQK 3;  1B27 A;  1BSC A;  1LOY A;  1I2F A;  1RTU A;  3MG2 A;  5RNT A;  1IYY A;  4XBX A;  4K1V A;  2XGL A;  2WO0 A;  1DVD A;  1YHQ 3;  2OWP A;  3HI7 A;  3EX9 A;  2HMM B;  1VQL 3;  4K1U A;  2RCD A;  3CC2 3;  1UGI A;  1LNI A;  3CD6 3;  3NX0 A;  2XEP A;  1JBS A;  2QA4 3;  1OHS A;  3Q2P A;  3EB8 A;  1FGM A;  3DY5 A;  3DGN A;  1IQ8 A;  1SIH A;  5CK6 A;  2BU4 A;  1EEJ A;  1B2X A;  4EW5 A;  1CH0 A;  4O02 B;  1IT7 A;  1M9G A;  2CG1 A;  1BNJ A;  1Q40 A;  3EF8 A;  3V98 A;  5EQL A;  1MGR A;  3FF0 A;  3MG3 A;  4FCJ A;  1KQS 2;  5D82 A;  1BSB A;  5AI1 A;  2B1X B;  4HM4 B;  5CF2 A;  1JZD A;  2GU1 A;  3PS8 A;  4EV5 A;  3D5I A;  4AEQ A;  4N6L A;  2OOV A;  3CC4 3;  3BNB A;  4N3V A;  2XRX B;  1BRJ A;  3G71 3;  1B2S A;  3CCQ 3;  3DGL A;  1BUQ A;  3N54 B;  3FSD A;  2UUG C;  1IVX A;  3CCV 3;  3LTD A;  1PYL A;  3D4A A;  3S5C A;  1YJN 3;  1M90 4;  5AIH A;  3GZX B;  1VQM 3;  1GMQ A;  1O7P B;  5EEO A;  3UL6 A;  5G1L A;  3GZB A;  2CFK A;  1K28 A;  1DYU A;  4ORL A;  1RCK A;  1QAL A;  2R41 A;  3CPO A;  3KCH A;  1W01 A;  1W6Y A;  3PZW A;  2OTL 3; 
#chains in the Genus database with same CATH homology
 1DMN A;  1A90 A;  3ECF A;  1GY7 A;  2PZV A;  4LMI A;  4O2H A;  5AIG A;  2QGU A;  1UI8 A;  1OF5 B;  1ULI B;  1LNH A;  1WTH A;  1GD3 A;  3PGB A;  3LTB A;  2C10 A;  2YFI B;  4HM0 B;  3VF1 A;  1PU4 A;  1Y4K A;  1W2Z A;  1O7N B;  4WYK B;  3IJE B;  2P05 A;  3X3Y A;  5A0O B;  4PEJ A;  1QAK A;  4N6M A;  3KE7 A;  2INX A;  1UUW B;  1IVV A;  1CYV A;  3ER7 A;  3F8X A;  1LVN A;  3FG4 A;  3KSE D;  5ELJ A;  4CCV A;  1FGQ A;  3BNC A;  3NQZ A;  1CEW I;  4RNY A;  2W9P A;  3LXU X;  1ASK A;  4N6U A;  3MPH A;  3G8Z A;  1S72 3;  3BNE A;  4Q53 A;  2BMQ B;  1YIJ 3;  2OQE A;  2XF3 A;  1NU3 A;  1GYB A;  3I56 3;  3HII A;  2YFJ B;  4HM1 B;  4IT7 A;  4HM3 B;  3PCS A;  4L8O A;  1NB5 I;  1OH0 A;  2I9W A;  4RBN A;  1E97 A;  1FGT A;  1W7C A;  2GEX A;  3LT9 A;  5G2G A;  2CC3 A;  1YJ9 3;  3FCS B;  3OXA A;  1N5P A;  4FR9 A;  2O9U X;  4AKZ A;  5JPP A;  2E2V A;  3NBB A;  1RJO A;  1JV2 B;  4WYK A;  1US1 A;  3JUN A;  5IW9 A;  5IG5 A;  1TP6 A;  4HM8 B;  3O8Y A;  4MJD A;  5IG0 A;  3GZY B;  2K0M A;  4R80 A;  1MOL A;  4HZB B;  1EQK A;  1EA2 A;  1GY5 A;  3JVC A;  2XH9 A;  3LZA A;  2CFL A;  1NO3 A;  3LOY A;  4HM2 B;  4STD A;  1UW1 A;  5TGN A;  4U13 A;  3S28 A;  3WMD A;  3F7X A;  4N6V 0;  3VSY A;  2W2C A;  1OGZ A;  3WOF B;  4XM4 A;  1K41 A;  2E2T A;  2W6J H;  3MKI A;  1OF5 A;  1ROV A;  3DXO A;  2HML B;  2HMK B;  2W04 A;  2BHM A;  1Q86 4;  1W4N A;  4HM7 B;  3CC7 3;  5LC6 A;  3X42 A;  4O8S A;  4J9A A;  2FXT A;  3IMA B;  3Q1C A;  5AYR B;  1OUN A;  1OPY A;  2B24 B;  2CH9 A;  2GEY A;  3K7C A;  4HKV B;  5IEN A;  2OCT A;  4MMX B;  1OGX A;  4LEH A;  3WA2 X;  3DZL A;  4FMA A;  1Q82 4;  2SBL A;  3V92 A;  3CCM 3;  2MF7 A;  1WMO A;  1IV7 A;  3K9M C;  3RDE A;  3CCU 3;  3Q90 A;  3LYG A;  1O7M B;  1N8Q A;  2CKF B;  1VZZ A;  3B7C A;  4IPB A;  3PYJ A;  2CHC A;  4R9L A;  2GBW B;  2W9Q A;  5I97 A;  2QIY A;  1AR0 A;  1QVF 2;  4LGQ A;  5ELU A;  3FG3 A;  3NV0 A;  1E3R A;  1EKM A;  1HKX A;  1QJG A;  3JUQ A;  2CFW A;  3NBR A;  1UUV B;  3HZP A;  1PFP A;  4MMY B;  3STD A;  3A76 A;  1STF I;  2CIU A;  3N9H A;  4AKY A;  1FA3 A;  2Y74 A;  3B4O A;  3WOE B;  1O7W B;  2CWT A;  4FCZ A;  4WFO A;  5CLK A;  1VQP 3;  1NB3 I;  3WA3 A;  3BND A;  3AMO A;  3H3H A;  1D6U A;  2BO9 B;  3CCJ 3;  4WHA A;  1D6Z A;  2P09 A;  2XR8 B;  3GAX A;  3SXX A;  3HX8 A;  2STD A;  1JB5 A;  3SX1 A;  3MSO A;  5STD A;  1LOX A;  3X40 A;  2JQ5 A;  4R4K A;  2YX9 A;  1RRH A;  1A2V A;  2OQE C;  3D9R A;  3CCR 3;  3OWU A;  2W03 A;  5DRV A;  2BT3 A;  2IA7 A;  1GS3 A;  2IMJ A;  1YI2 3;  3E99 A;  1OCV A;  3F40 A;  2C11 A;  2UX0 A;  3F7S A;  2CWU A;  1Q7Y 4;  1M1K 4;  1MNL A;  1FGO A;  2CW9 A;  1YGE A;  5JPU A;  1RKY A;  3L0R A;  2W56 A;  1TU5 A;  5EVH A;  2BNG A;  1IDP A;  1Q40 B;  1LXE A;  2XSH B;  3PCR A;  5AII A;  3I0Y A;  3EJV A;  1FUW A;  1N5H A;  3FGY A;  1JKG B;  3NQY A;  4R9K A;  1IK3 A;  4WWU C;  1K8A 4;  1VQ6 3;  4EXR A;  3WOD G;  3LTC A;  2WOF A;  2Z77 A;  3PXM A;  4MMZ B;  4N6O B;  2WOH A;  2RSX A;  1ROA A;  4GB5 A;  1KD1 4;  1ISK A;  4EV2 A;  1ULJ B;  1IQX A;  3CU3 A;  4H61 A;  2MC8 A;  3NM2 A;  4XBY A;  3VGN A;  4BTW A;  1Q42 A;  1EG9 B;  4HZ9 B;  1STD A;  3KKG A;  5DRE A;  4KFE A;  1WMP A;  1HU9 A;  2LYX A;  3KII A;  4BTY A;  1K73 4;  1SII A;  3UL5 A;  4TX4 A;  3FG1 A;  3OV4 A;  4N6T A;  3HIG A;  4H3U A;  2Z6B A;  1E3V A;  3J7Y d;  2OOV C;  2F99 A;  3S27 A;  4XDW A;  3CMA 3;  4FCM A;  1N9E A;  4HJL B;  3CCL 3;  3EN1 B;  4G1M B;  4J8T A;  2D42 A;  2K54 A;  1N9J A;  3S67 A;  1J2B A;  2A15 A;  4XB5 A;  3CPW 2;  1JB2 A;  3UB1 A;  1IQY A;  2F98 A;  3MG1 A;  1V74 A;  1YJW 3;  1S5A A;  1WNH A;  1O7G B;  1W6G A;  2Z7A A;  2P0M A;  3X3X A;  3CNM A;  3ROB A;  4HM6 B;  2CK3 H;  1SJW A;  1NJI 4;  1JB4 A;  1YIT 3;  1IVW A;  2L4V A;  3KSP A;  1L5G B;  2ZL8 A;  1JN5 A;  2BMR B;  4BTX A;  4CDL A;  1VQ4 3;  5CF1 A;  1Q81 4;  3OWY A;  3KZT A;  2IUK A;  2WGO A;  3BLZ A;  4EC6 A;  4XDV A;  1SQW A;  4N6N B;  7STD A;  6STD A;  5AIF A;  1QMA A;  1WMN A;  4X2O A;  3EQQ B;  3RGR A;  2GXF A;  3FZW A;  3SVA A;  4GL6 A;  1JJ2 2;  5IEO A;  1VQO 3;  2R4I A;  4FMB A;  2ML5 A;  3QK9 A;  4NHF A;  3MWZ A;  4L8P A;  4OVM A;  3LTA A;  1ZO2 A;  5D83 A;  5IEP A;  3UJM A;  1JKG A;  3H51 A;  2CG0 A;  5KP3 A;  5D81 A;  4O3V A;  3I55 3;  4X2H A;  1W02 A;  2PNC A;  2HMN B;  2W56 B;  3JUM A;  5IER A;  4K61 A;  3EBY A;  1CQS A;  3DUK A;  1NDO B;  3CCE 3;  3RGA A;  1JRQ A;  3F8H A;  4KFD A;  1VQ7 3;  3EHC A;  2O3O A;  3SLU A;  2KCD A;  5JBS A;  1AV4 A;  3NXJ A;  1AVL A;  3MHE A;  1JN5 B;  2CFG A;  1VQ8 3;  2BMO B;  1OHP A;  1U8C B;  3DM8 A;  2WGQ A;  4HM5 B;  5BXQ A;  5IG4 A;  1A67 A;  2RGQ A;  1FGR A;  2XSO B;  4KZ1 A;  1UI7 A;  3ALA A;  3D3L A;  2CFD A;  4KVH A;  1W00 A;  4LZI A;  3EC9 A;  4MEI A;  2W0Q A;  4FMC A;  1RN7 A;  1RRL A;  2HMO B;  3LML A;  1YVB I;  3GWR A;  3AMO B;  4RNZ A;  5LC7 A;  1F8N A;  3NM7 A;  2Q07 A;  4LSO A;  1OAC A;  1TIJ A;  3LH4 A;  2GU3 A;  3F9S A;  3X41 A;  2HMJ B;  3LT8 A;  1WQL B;  1T5Y A;  1TFO A;  1DMM A;  1O7H B;  3EN8 A;  4I4K A;  4JF8 A;  4OK0 A;  1TFK A;  5KP1 A;  3JUP A;  3G16 A;  4EBG A;  1Z1S A;  1GY6 A;  4L7K A;  1QVG 2;  1R4C A;  3JUO A;  2XFT A;  3CCS 3;  2Y73 A;  2YFL B;  1W2B 2;  1W6C A;  1G96 A;  1TUH A;  1JNQ A;  3GRD A;  3G4S 3;  3B4P A;  4QWT A;  3CNX A;  1KC8 4;  3G0K A;  1M1X B;  3M8C A;  5KP4 A;  1N8R 4;  2JDI H;  2Z76 A;  3F14 A;  3GZR A;  2FGT A;  4WP5 A;  2E2U A;  4K90 B;  3B8L A;  4EYC A;  4OUQ A;  1U5O A;  5BVB A;  2IUJ A;  4R1K A;  3HK4 A;  2ML6 A;  4JRF A;  3T0U A;  5IF6 A;  1CYU A;  1DVC A;  1A2K A;  3TDG A;  5AYS C;  1C7H A;  3FF2 A;  3FH1 A;  2RFR A;  1IU7 A;  2V1L A;  2P0X A;  4FMD A;  5AEW B;  3SED A;  3U1W A;  1VQ9 3;  2ZDJ A;  3IPT A;  2D1W A;  2LQV A;  4HVN A;  3FKA A;  3G6E 3;  1GD4 A;  2M7O A;  4XBT A;  4NRE A;  3DMC A;  1AVK A;  3T8U A;  3K5T A;  5IG3 A;  4RZM A;  3U97 A;  3KN4 A;  1NWW A;  4ZM8 A;  4HBR A;  3CXC 2;  5AEU B;  1IT8 A;  5HGR A;  8CHO A;  1IVU A;  3V99 A;  4KFF A;  3BB9 A;  3QRD A;  1ZX2 A;  1KWI A;  2XGN A;  3NBJ A;  3OWS A;  1IV9 A;  2GBX B;  4HYZ A;  3CME 3;  3K63 A;  3MYT A;  5FGO A;  3OX9 A;  1W5Z A;  3DGM A;  3NHX A;  4IIA A;  2OTJ 3;  1SPU A;  5CXO A;  5FW5 A;  2P38 A;  2XFS A;  2CWV A;  3DGO A;  3N8B A;  2FNQ A;  3S29 A;  1VQ5 3;  1DMQ A;  1K9M 4;  3K0Z A;  2KXG A;  3NV0 B;  1D6Y A;  2KRT A;  3KFQ C;  3WDG B;  3FLJ A;  3UNL A;  3EBT A;  3EE1 A;  2F86 B;  3SOY A;  3T8N A;  1VQN 3;  1KSI A;  3OW2 2;  2QEX 3;  1OHO A;  3NUV A;  3X3Z A;  1QAF A;  3SOA A;  1VQK 3;  3MG2 A;  4XBX A;  4K1V A;  2XGL A;  2WO0 A;  1DVD A;  1YHQ 3;  2OWP A;  3HI7 A;  3EX9 A;  2HMM B;  1VQL 3;  4K1U A;  2RCD A;  3CC2 3;  3CD6 3;  3NX0 A;  2XEP A;  2QA4 3;  1OHS A;  3Q2P A;  3EB8 A;  1FGM A;  3DY5 A;  3DGN A;  1IQ8 A;  1SIH A;  5CK6 A;  4O02 B;  1IT7 A;  1M9G A;  2CG1 A;  1Q40 A;  3EF8 A;  3V98 A;  5EQL A;  3FF0 A;  4FCJ A;  3MG3 A;  1KQS 2;  5D82 A;  5AI1 A;  2B1X B;  4HM4 B;  5CF2 A;  2GU1 A;  3PS8 A;  4EV5 A;  4AEQ A;  4N6L A;  2OOV A;  3CC4 3;  3BNB A;  4N3V A;  2XRX B;  3G71 3;  3CCQ 3;  3DGL A;  1BUQ A;  3N54 B;  3FSD A;  1IVX A;  3CCV 3;  3LTD A;  1YJN 3;  3S5C A;  1M90 4;  5AIH A;  3GZX B;  1VQM 3;  1O7P B;  5EEO A;  3UL6 A;  3GZB A;  2CFK A;  1K28 A;  1DYU A;  4ORL A;  1QAL A;  3CPO A;  1W01 A;  1W6Y A;  3PZW A;  2OTL 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...