3UB1A

Ntf2 like protein involved in plasmid conjugation
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
251
structure length
248
Chain Sequence
b'SLETQAFSFAEEFAWDYFSRYPSDTQDFVRRITKYTTEQLANEMNNGTYSDVIYTSAFYFEKYSENQVNVSVKARVRVYTPKAGQEQDQLQYDTNLVDYYLEVPIVFDKDMNMAVDALPVMTAPPEKAYFKNKEFSGTSENDADKTKKITDSVSQFFKAYYEQNQTQIDYFLVDGADIKGAGQKFSFNKIDRINIYKLSDKEFLAIVDLNVDSFGNAIKQGFNLTVVQEGDKFLVKTLEPRTSNIDLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF13-like protein
publication title The conjugation protein TcpC from Clostridium perfringens is structurally related to the type IV secretion system protein VirB8 from Gram-negative bacteria.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Transport protein
total genus 53
structure length 248
sequence length 251
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12642 TpcC Conjugative transposon protein TcpC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.540 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ub1A02
3.10.450.540 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ub1A01
3UB1A 4EC6A
chains in the Genus database with same CATH superfamily
1GD3A 1BNEA 2STDA 1K8A4 3AMOA 3X42A 2BMRB 4R9LA 1ZS7A 1CQSA 1GOYA 1BRHA 3LT9A 1BSBA 2OWPA 2YFJB 1JKGA 2H0GA 4GHOA 2MF7A 1I3FA 2M7OA 4CDLA 2HOHA 3BIRA 1JRQA 5D82A 1UCKA 1N9EA 1G02A 3FF0A 2BT3A 3AHWA 1BSAA 3F7XA 1NB3I 1JZDA 1N5HA 1L5GB 4HM0B 1US1A 1O7WB 2BO9B 3EB8A 3NBJA 4IT7A 1BNRA 3B7CA 1AQZA 2XEPA 5DRVA 4J5KA 1QVF2 3NBBA 3I563 1YJN3 3LH4A 1RKYA 5JBSA 3G16A 2RCDA 3JUOA 5EVHA 5BU4A 1BRJA 2P09A 2QIYA 3HI7A 3NBRA 2SARA 5CK6A 1PU4A 1SARA 4FCZA 4K61A 2CFDA 2O9UX 1BRKA 3UB1A 7RNTA 3G6E3 1B27A 1D6YA 1IVVA 1VQQA 2XR8B 3AHSA 3URPA 3PGBA 2XGLA 3DGNA 3D4AA 1NU3A 5ELJA 4XM4A 2QGUA 4MMZB 4H61A 3GZYB 5IEPA 1WQLB 3RDEA 4I5QA 3RGRA 8RNTA 2OTJ3 1HU9A 1OUNA 3ECFA 1LNIA 3OW22 4FCMA 1C54A 3SYUA 1TJDA 1W5ZA 1RDSA 3KSED 3D3LA 3LT8A 4HOHA 1DVDA 4BL3A 1BNGA 1IK3A 3G4S3 1RGAA 3JUNA 2YFIB 3MWZA 4CCVA 5AYSC 3RNTA 2V1LA 3SEDA 3EBYA 4J8TA 1RTUA 4O8SA 1BRIA 1OF5A 2F5MA 5D81A 1LOVA 1MWSA 3EE1A 3BU4A 1O7GB 3V98A 2CX1A 2CFKA 1DVCA 1I2FA 3K5TA 4LSOA 1RRLA 1B2SA 4HKVB 2ZHXB 3MG2A 5BXQA 1TFOA 1Q7HA 3CCQ3 3MHEA 1LOXA 2H0HA 2B24B 4ZM8A 4HM5B 2GEYA 4J9AA 3PS8A 4EV2A 2LQVA 1E3VA 3EN8A 5AYRB 3U97A 1AR0A 3T8UA 3BNDA 1YI23 3SXXA 1BVIA 2RNTA 2SBLA 3N8BA 3X3XA 5BVBA 1FGMA 1YVBI 1BNJA 3G713 1W6YA 1LOYA 1JNQA 2F5WA 1W4NA 4R9KA 1YJ93 1RCKA 4N6UA 3RGAA 1TRPA 4KZ1A 1VZZA 1IQYA 1JV2B 2CIUA 3NM2A 3CD63 3FH1A 4R4KA 1S723 3KIIA 6STDA 5CXOA 2FNQA 2RBIA 1MOLA 2W2CA 1YGWA 3CMA3 3DGYA 4WYKB 5M1AA 2FGTA 2CW9A 1JBSA 1FUWA 3FKAA 2Z6BA 3B4OA 3F40A 2OQEA 1AVKA 3F8HA 2GBWB 3G0KA 1GY7A 1EUIC 2ZL8A 6GSPA 2ZDJA 3T0UA 1FYSA 5KP1A 4N6OB 1YJW3 3LYGA 2KF3A 4R1KA 3J7Yd 3NXJA 4HM7B 3ZFZA 3MPHA 3KFQC 2CG1A 3LTBA 1RCLA 2E2TA 5KP3A 4AEQA 1Q40B 3EJVA 4QWTA 3WOFB 4FCJA 4K90B 3D9RA 3B8LA 4FMDA 5DREA 3CXC2 3CC73 1VQ63 2RSXA 3NQZA 5AIIA 1M904 4FMCA 2KXGA 4MMYB 1GD4A 3LTDA 3AGNA 4ILFA 3AGOA 1W2ZA 4N6NB 4FR9A 1I3IA 5FGOA 3GWRA 3OWYA 3CPW2 3CME3 7GSPA 1T5YA 5BIRA 3JUQA 1RGGA 2OQEC 1BOXA 1RRHA 1UUWB 2L4VA 1T3BA 3ZG0A 1UI8A 1WNHA 1ZO2A 4EV5A 1K734 1FUSA 2W56A 3CC43 2AAEA 2K0MA 2R41A 2GXFA 1W7CA 2Q07A 3FGYA 1K28A 1O7NB 3LXUX 2MC8A 2XF3A 3AMOB 2BMQB 1Z1SA 2WOHA 1VQK3 1RN7A 1UDII 1IYYA 4BU4A 4LYLB 1JKGB 1MWTA 1JBRA 4HZBB 1GMQA 4OUQA 1RN4A 3JUPA 2YFLB 1VQO3 5CF2A 1BAOA 1YVSA 1M9GA 2GBXB 4EC6A 3BLZA 1ROAA 2GEXA 3Q90A 1D6ZA 3X40A 4OK0A 4HAAA 2CKFB 5EEOA 2CC3A 1TP6A 3DGMA 3EBTA 4BTWA 3HZPA 1BNIA 1Q9EA 3DGLA 5IG3A 1RSNA 4MEIA 4STDA 3CCJ3 4XBYA 1LOWA 1RHLA 1LRAA 1ULJB 4LZIA 3E99A 1BSDA 2CFGA 5HGRA 1IDPA 2XSOB 4K1UA 1VQL3 1G0TA 3FCSB 1A67A 2P38A 3K0ZA 4JRFA 2OCTA 4NREA 4Q53A 1WTHA 2CG0A 4TX4A 2A15A 3SX1A 3WOEB 3Q2PA 4RZMA 2CH9A 1IV7A 3F8XA 1RMSA 3DGOA 2KF6A 2Z7AA 1JB5A 3GAXA 2HMKB 1W02A 3LTCA 4XB5A 5JPUA 1JB2A 1JN5A 1M1K4 1F8NA 3F9SA 1ROVA 1U5OA 2F4YA 2PNCA 3MG1A 4X2HA 2W0QA 1M1XB 3CC23 3UL5A 4EBGA 3Q3FA 4R80A 4L8OA 1BNSA 1Q7Y4 2D42A 5I97A 1LVNA 3NV0A 1X1XA 5AEWB 3T8NA 2KRTA 1IQXA 3G8ZA 3DMCA 2IUKA 3QRDA 5IG5A 4O3VA 2CX0A 1TFKA 2IA7A 1LQGC 3UNLA 3PCSA 1RGHA 1N8QA 1HKXA 1OF5B 4WWUC 1I0XA 1CH0A 2CK3H 2HMOB 2L1SA 1A2VA 5IG4A 1GY6A 3I553 5G1KA 3D5IA 4RNYA 4HM3B 2CHCA 3MKIA 1DMQA 4XDWA 1KC84 2WGOA 1BANA 3KKGA 3CCR3 1GSPA 2K3DA 1O7MB 2JDIH 1X1YA 3S29A 2LYXA 1W2B2 1SIIA 3DZLA 2BIRA 3K7CA 3SOAA 1HZ1A 1LXEA 1STFI 1FZUA 3FG4A 1CYVA 3NX0A 1AVLA 4KFFA 1V74A 1CEWI 1SJWA 4BTXA 1JB4A 1BGSA 3DH2A 2W9PA 3FG3A 3MG3A 4EXRA 1IQ8A 1RGEA 1S5AA 5LC6A 3JUMA 3CCM3 3NQYA 3KZTA 1B2ZA 4EW5A 3GZXB 4K1VA 2Y74A 4N6V0 1STDA 1VQ43 3GZRA 2F98A 1MGRA 1IVWA 4KT3B 5LC7A 4AKYA 1A90A 1LNHA 3BNEA 3Q1CA 3PZWA 3DY5A 1QVG2 3S28A 3WDGB 1BUQA 1DYUA 1KD14 4L7KA 1RNTA 1QMAA 6RNTA 1EA2A 2OOVA 5A0OB 1UGIA 3FLJA 1NB5I 3VSYA 3WMDA 3HK4A 1FW7A 1RNBA 3M8CA 4HYZA 3KSPA 1PY3A 3I0YA 3PXMA 1I2EA 1JZOA 3KE7A 4KFEA 1TUHA 9RNTA 2CFWA 5HOHA 5JPPA 1N8R4 4HM2B 5M19A 1K9M4 2D1WA 1BSEA 1OGZA 3BNCA 4MJDA 3CCV3 5ELUA 3CU3A 3KCHA 1MWRA 2ZA4A 2FXTA 4LGQA 1E3RA 3CNXA 3X3ZA 5M18A 4O02B 2CWVA 1EG9B 4WP5A 2HMJB 5AEUB 3UJMA 1DE3A 5AIFA 2RGQA 3HIGA 1NDOB 1VQ93 1OHPA 5AIHA 1VQM3 1R4YA 2BNGA 1T2HA 2GU3A 4HBRA 3WA3A 1BUJA 4OVMA 4RNTA 2INXA 1B21A 2OOVC 3EQQB 2C10A 2W03A 7STDA 1K41A 3S67A 1U8CB 5D83A 2R4IA 1EQKA 1BSCA 3MYTA 3HOHA 1G96A 2W56B 4DKIA 1UCJA 3NM7A 2WO0A 3EC9A 3ZG5A 1BU4A 4XBTA 2JQ5A 5IEOA 1SQWA 2CWUA 3LZAA 1AY7A 1PFPA 2QA43 1W6CA 1LQMB 4BTYA 3F7SA 2E2VA 4CJNA 2AADA 3NUVA 1VQP3 1UUGB 3VGNA 1ISKA 4H3UA 2WGQA 3GZBA 5RNTA 4NPBA 3LTAA 2B1XB 2QEX3 5EQLA 1GOUA 3A5EA 1V58A 2YX9A 4GSPA 3SVAA 3DM8A 1JJ22 1HYFA 1OACA 1YHQ3 3CCE3 1O7PB 1IT8A 8CHOA 1BIRA 2P0XA 1YNVX 3IPTA 1YIJ3 1EKMA 3OV4A 4EYCA 3B4PA 4J5GA 1GMRA 1QJGA 3QK9A 5FW5A 3DUKA 2XSHB 5G1LA 2PZVA 4I4KA 1OH0A 2E2UA 3WODG 3OWUA 1IVXA 1WMNA 1A2KA 1DMNA 2H0IA 2UUGC 1W6GA 3WHOA 1DETA 2HMLB 2XFSA 4HM6B 5KP4A 4RNZA 2GSPA 3FZWA 2W6JH 1I8VA 1IT7A 2IUJA 3VF1A 1RGCA 1MNLA 1JN5B 1B2MA 4GB5A 2C4BA 1BNFA 1A2PA 1FUTA 4U13A 4HM1B 3H51A 1X1WA 3H3HA 1OHSA 1ZX2A 3KN4A 3ALAA 1IU7A 4BL2A 1QAFA 3PYJA 3NV0B 2UGIA 4ORLA 1UI7A 4L8PA 1UCLA 2BHMA 5IENA 1T2IA 1PYLA 3EN1B 3NHXA 4IIAA 3HX8A 5IERA 1AV4A 2W9QA 4X2OA 5IG0A 1NJI4 3K9MC 1WMPA 2ML6A 1VQN3 1UGHI 1MGWA 1J2BA 5GSPA 1ULIB 1BRNL 4XDVA 1UW1A 3MSOA 2C11A 1Y4KA 4FMBA 3V92A 1YIT3 1TTOA 3OXAA 1E97A 1Q42A 2F99A 2KAAA 2K54A 1RJOA 1X1UA 2GU1A 1BRGA 3FF2A 4FMAA 2BU4A 1Q814 3JVCA 1SIHA 1N5PA 2F86B 1TRQA 2IMJA 3LOYA 4PEJA 1QALA 4N3VA 4WHAA 1NWWA 1RLSA 4HZ9B 4N6TA 3CCL3 1CYUA 2CWTA 4HM8B 3GSPA 1OCVA 1UUVB 3V99A 5IW9A 1FGTA 4HM4B 2ML5A 1B20A 2F56A 3EF8A 2KCDA 3EHCA 2BMOB 3SLUA 1OHOA 1KQS2 1RGFA 3EX9A 3L0RA 1TIJA 1Q824 1W00A 1I70A 1V57A 5G2GA 3FG1A 4CPKA 3STDA 2Z76A 2P05A 2I9WA 1FGRA 2XH9A 4RBNA 1GYBA 3CPOA 3PCRA 3ROBA 1YGEA 1UCIA 2IYJA 1B2XA 1OPYA 2IY2A 3S27A 1JBTA 1VQ53 2W04A 2HMMB 1N9JA 1NNVA 2O3OA 3CCS3 3IJEB 2Z77A 1W01A 5STDA 4G1MB 4WYKA 3OX9A 1SPUA 3F14A 4WFOA 5AI1A 1MWUA 1B3SA 4GL6A 4IPBA 2RFRA 2KF5A 2OTL3 3UL6A 1DMMA 3A76A 3DXOA 4LMIA 5IF6A 1RGLA 2XGNA 3K63A 1FA3A 3D79A 3X41A 1IVUA 1TU5A 3OWSA 4HVNA 4BIRA 5CF1A 1KSIA 1Q864 4XBXA 1I2GA 1I0VA 3BNBA 1WMOA 1BRSA 2J8XB 2UX0A 1EEJA 3HIIA 1D6UA 4JF8A 4O2HA 5AIGA 1Q40A 1NO3A 1VQ83 5TGNA 1QAKA 1C7HA 4N6MA 3CNMA 4MMXB 3IMAB 1VQ73 1ASKA 1FGQA 4N6LA 3S5CA 1O7HB 1GMPA 3ER7A 3TDGA 1ZGXA 4KFDA 1GOVA 2HMNB 1R4CA 1OGXA 3WR2A 3N9HA 2XRXB 4HJLB 3N54B 2P0MA 3X3YA 1B2UA 5CLKA 2Y73A 1KWIA 1GS3A 2KF4A 1GY5A 3BB9A 3D5GA 3SOYA 4NHFA 2WOFA 4KVHA 4AKZA 1IV9A 3WA2X 2CFLA 2XFTA 3CCU3 3LMLA 3U1WA 1RGKA 1RN1A 3GRDA 3FSDA 4LEHA 1FGOA 3O8YA
chains in the Genus database with same CATH topology
1GD3A 2STDA 1K8A4 3AMOA 3X42A 2BMRB 4R9LA 1CQSA 3LT9A 2OWPA 2YFJB 1JKGA 2MF7A 2M7OA 4CDLA 1JRQA 5D82A 1N9EA 3FF0A 2BT3A 3F7XA 1NB3I 1N5HA 1L5GB 4HM0B 1US1A 1O7WB 2BO9B 3EB8A 3NBJA 4IT7A 3B7CA 2XEPA 5DRVA 1QVF2 3NBBA 3I563 1YJN3 3LH4A 1RKYA 5JBSA 3G16A 2RCDA 3JUOA 5EVHA 2P09A 2QIYA 3HI7A 3NBRA 5CK6A 1PU4A 4FCZA 4K61A 2CFDA 2O9UX 3UB1A 3G6E3 1D6YA 1IVVA 2XR8B 3PGBA 2XGLA 3DGNA 1NU3A 5ELJA 4XM4A 2QGUA 4MMZB 4H61A 3GZYB 5IEPA 1WQLB 3RDEA 3RGRA 2OTJ3 1HU9A 1OUNA 3ECFA 3OW22 4FCMA 1W5ZA 3KSED 3D3LA 3LT8A 1DVDA 1IK3A 3G4S3 3JUNA 2YFIB 3MWZA 4CCVA 5AYSC 2V1LA 3SEDA 3EBYA 4J8TA 4O8SA 1OF5A 5D81A 3EE1A 1O7GB 3V98A 2CFKA 1DVCA 3K5TA 4LSOA 1RRLA 4HKVB 3MG2A 5BXQA 1TFOA 3CCQ3 3MHEA 1LOXA 2B24B 4ZM8A 4HM5B 2GEYA 4J9AA 3PS8A 4EV2A 2LQVA 1E3VA 3EN8A 5AYRB 3U97A 1AR0A 3T8UA 3BNDA 1YI23 3SXXA 1A90A 2SBLA 3N8BA 5BVBA 3X3XA 3G713 1FGMA 1YVBI 1W6YA 1JNQA 4R9KA 1W4NA 1YJ93 4N6UA 3RGAA 4KZ1A 1VZZA 1IQYA 1JV2B 2CIUA 3NM2A 3CD63 3FH1A 4R4KA 1S723 3KIIA 6STDA 5CXOA 2FNQA 1MOLA 2W2CA 3CMA3 4WYKB 2FGTA 2CW9A 1FUWA 3FKAA 2Z6BA 3B4OA 3F40A 2OQEA 1AVKA 3F8HA 2GBWB 3G0KA 1GY7A 2ZL8A 2ZDJA 3T0UA 5KP1A 4N6OB 1YJW3 3LYGA 3J7Yd 4R1KA 3NXJA 4HM7B 3MPHA 3KFQC 2CG1A 3LTBA 2E2TA 5KP3A 4AEQA 1Q40B 3EJVA 4QWTA 3WOFB 4FCJA 4K90B 3D9RA 3B8LA 4FMDA 5DREA 3CXC2 3CC73 1VQ63 2RSXA 3NQZA 5AIIA 1M904 4FMCA 2KXGA 4MMYB 1GD4A 3LTDA 1W2ZA 4N6NB 4FR9A 5FGOA 3GWRA 3OWYA 3CPW2 3CME3 1T5YA 3JUQA 2OQEC 1RRHA 1UUWB 2L4VA 1UI8A 1WNHA 1ZO2A 4EV5A 1K734 2W56A 3CC43 3FGYA 2K0MA 2GXFA 1W7CA 2Q07A 3LXUX 1K28A 1O7NB 2MC8A 2XF3A 3AMOB 2BMQB 1Z1SA 2WOHA 1VQK3 1RN7A 1JKGB 4HZBB 4OUQA 3JUPA 2YFLB 1VQO3 5CF2A 1M9GA 2GBXB 4EC6A 3BLZA 1ROAA 2GEXA 3Q90A 1D6ZA 3X40A 4OK0A 2CKFB 5EEOA 2CC3A 1TP6A 3DGMA 3EBTA 4BTWA 3HZPA 3DGLA 5IG3A 3CCJ3 4MEIA 4STDA 4XBYA 1ULJB 4LZIA 3E99A 2CFGA 5HGRA 1IDPA 2XSOB 4K1UA 1VQL3 3FCSB 1A67A 2P38A 3K0ZA 4JRFA 2OCTA 4NREA 4Q53A 1WTHA 2CG0A 4TX4A 2A15A 3SX1A 3WOEB 3Q2PA 4RZMA 2CH9A 1IV7A 3F8XA 3DGOA 3GAXA 2Z7AA 1JB5A 3LTCA 2HMKB 1W02A 4XB5A 5JPUA 1JB2A 1JN5A 1M1K4 1F8NA 3F9SA 1ROVA 1U5OA 2PNCA 3MG1A 4X2HA 2W0QA 1M1XB 3CC23 3UL5A 4EBGA 4R80A 4L8OA 1Q7Y4 2D42A 5I97A 1LVNA 3NV0A 5AEWB 3T8NA 2KRTA 1IQXA 3G8ZA 3DMCA 2IUKA 3QRDA 5IG5A 4O3VA 1TFKA 2IA7A 3UNLA 3PCSA 1N8QA 1HKXA 1OF5B 4WWUC 2CK3H 5IG4A 2HMOB 1A2VA 1GY6A 3I553 4RNYA 4HM3B 2CHCA 3MKIA 1DMQA 4XDWA 1KC84 2WGOA 3CCR3 3KKGA 1O7MB 2JDIH 3S29A 1W2B2 2LYXA 1SIIA 3DZLA 3K7CA 3SOAA 1LXEA 1STFI 3FG4A 1CYVA 3NX0A 1AVLA 4KFFA 1V74A 1CEWI 1SJWA 4BTXA 1JB4A 4EXRA 2W9PA 3FG3A 3MG3A 1IQ8A 5LC6A 1S5AA 3JUMA 3CCM3 3NQYA 3KZTA 3GZXB 4K1VA 2Y74A 4N6V0 1STDA 1VQ43 3GZRA 2F98A 1IVWA 5LC7A 4AKYA 1LNHA 3BNEA 3Q1CA 3PZWA 3DY5A 1QVG2 3S28A 3WDGB 1BUQA 1DYUA 1KD14 4L7KA 1QMAA 1EA2A 2OOVA 5A0OB 3FLJA 1NB5I 3VSYA 3WMDA 3HK4A 3M8CA 4HYZA 3KSPA 3I0YA 3PXMA 3KE7A 4KFEA 1TUHA 2CFWA 5JPPA 1N8R4 4HM2B 1K9M4 2D1WA 1OGZA 3BNCA 4MJDA 3CCV3 5ELUA 3CU3A 4LGQA 2FXTA 3X3ZA 1E3RA 3CNXA 4O02B 2CWVA 1EG9B 4WP5A 2HMJB 5AEUB 3UJMA 5AIFA 2RGQA 3HIGA 1NDOB 1VQ93 1OHPA 5AIHA 1VQM3 2BNGA 2GU3A 4HBRA 3WA3A 4OVMA 2INXA 2OOVC 3EQQB 2C10A 2W03A 7STDA 1K41A 3S67A 1U8CB 5D83A 2R4IA 1EQKA 3MYTA 1G96A 2W56B 3NM7A 2WO0A 3EC9A 4XBTA 2JQ5A 5IEOA 1SQWA 2CWUA 3LZAA 1PFPA 2QA43 1W6CA 4BTYA 3F7SA 2E2VA 1VQP3 3NUVA 3VGNA 1ISKA 4H3UA 2WGQA 3GZBA 3LTAA 2B1XB 2QEX3 5EQLA 2YX9A 3SVAA 3DM8A 1JJ22 1OACA 1YHQ3 3CCE3 1O7PB 1IT8A 8CHOA 2P0XA 3IPTA 1YIJ3 1EKMA 3OV4A 4EYCA 3B4PA 1QJGA 3QK9A 5FW5A 3DUKA 2XSHB 2PZVA 4I4KA 1OH0A 2E2UA 3WODG 3OWUA 1IVXA 1A2KA 1DMNA 1WMNA 1W6GA 2XFSA 2HMLB 4HM6B 5KP4A 4RNZA 3FZWA 2W6JH 1IT7A 2IUJA 3VF1A 1MNLA 1JN5B 4GB5A 4U13A 4HM1B 3H51A 3H3HA 1OHSA 1ZX2A 3KN4A 3ALAA 1IU7A 1QAFA 3PYJA 3NV0B 4ORLA 1UI7A 4L8PA 2BHMA 5IENA 3EN1B 3NHXA 4IIAA 3HX8A 5IERA 1AV4A 2W9QA 4X2OA 5IG0A 1NJI4 3K9MC 1WMPA 2ML6A 1VQN3 1J2BA 1ULIB 4XDVA 1UW1A 3MSOA 2C11A 1Y4KA 4FMBA 3V92A 1YIT3 3OXAA 1E97A 1Q42A 2F99A 2K54A 1RJOA 2GU1A 3FF2A 4FMAA 1Q814 3JVCA 1SIHA 1N5PA 2F86B 3LOYA 2IMJA 4PEJA 1QALA 4N3VA 4WHAA 1NWWA 4N6TA 4HZ9B 3CCL3 1CYUA 2CWTA 4HM8B 1OCVA 1UUVB 3V99A 5IW9A 1FGTA 4HM4B 2ML5A 3EF8A 2KCDA 3EHCA 2BMOB 3SLUA 1OHOA 1KQS2 3EX9A 3L0RA 1TIJA 1Q824 1W00A 5G2GA 3FG1A 3STDA 2Z76A 2P05A 2I9WA 1FGRA 2XH9A 4RBNA 1GYBA 3CPOA 3PCRA 3ROBA 1YGEA 1OPYA 3S27A 1VQ53 2W04A 2HMMB 1N9JA 2O3OA 3CCS3 3IJEB 2Z77A 1W01A 5STDA 4G1MB 4WYKA 3OX9A 1SPUA 3F14A 4WFOA 5AI1A 4GL6A 4IPBA 2RFRA 2OTL3 3UL6A 1DMMA 3A76A 3DXOA 4LMIA 5IF6A 2XGNA 3K63A 1FA3A 3X41A 1TU5A 1IVUA 3OWSA 4HVNA 5CF1A 1KSIA 1Q864 4XBXA 3BNBA 1WMOA 2UX0A 3HIIA 4JF8A 4O2HA 5AIGA 1D6UA 1Q40A 1NO3A 1VQ83 5TGNA 1QAKA 1C7HA 4N6MA 3CNMA 4MMXB 3IMAB 1VQ73 1ASKA 1FGQA 4N6LA 3S5CA 1O7HB 3ER7A 3TDGA 4KFDA 2HMNB 1R4CA 1OGXA 3N9HA 2XRXB 4HJLB 3N54B 2P0MA 3X3YA 5CLKA 2Y73A 1KWIA 1GS3A 1GY5A 3BB9A 3SOYA 4NHFA 2WOFA 4KVHA 4AKZA 1IV9A 3WA2X 2CFLA 2XFTA 3CCU3 3LMLA 3U1WA 4LEHA 3GRDA 3FSDA 1FGOA 3O8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UB1 A;  4EC6 A; 
#chains in the Genus database with same CATH topology
 1GD3 A;  1BNE A;  2STD A;  1K8A 4;  3AMO A;  3X42 A;  2BMR B;  4R9L A;  1ZS7 A;  1CQS A;  1GOY A;  1BRH A;  3LT9 A;  1BSB A;  2OWP A;  2YFJ B;  1JKG A;  2H0G A;  4GHO A;  2MF7 A;  1I3F A;  2M7O A;  4CDL A;  2HOH A;  3BIR A;  1JRQ A;  5D82 A;  1UCK A;  1N9E A;  1G02 A;  3FF0 A;  2BT3 A;  3AHW A;  1BSA A;  3F7X A;  1NB3 I;  1JZD A;  1N5H A;  1L5G B;  4HM0 B;  1US1 A;  1O7W B;  2BO9 B;  3EB8 A;  3NBJ A;  4IT7 A;  1BNR A;  3B7C A;  1AQZ A;  2XEP A;  5DRV A;  4J5K A;  1QVF 2;  3NBB A;  3I56 3;  1YJN 3;  3LH4 A;  1RKY A;  5JBS A;  3G16 A;  2RCD A;  3JUO A;  5EVH A;  5BU4 A;  1BRJ A;  2P09 A;  2QIY A;  3HI7 A;  3NBR A;  2SAR A;  5CK6 A;  1PU4 A;  1SAR A;  4FCZ A;  4K61 A;  2CFD A;  2O9U X;  1BRK A;  3UB1 A;  7RNT A;  3G6E 3;  1B27 A;  1D6Y A;  1IVV A;  1VQQ A;  2XR8 B;  3AHS A;  3URP A;  3PGB A;  2XGL A;  3DGN A;  3D4A A;  1NU3 A;  5ELJ A;  4XM4 A;  2QGU A;  4MMZ B;  4H61 A;  3GZY B;  5IEP A;  1WQL B;  3RDE A;  4I5Q A;  3RGR A;  8RNT A;  2OTJ 3;  1HU9 A;  1OUN A;  3ECF A;  1LNI A;  3OW2 2;  4FCM A;  1C54 A;  3SYU A;  1TJD A;  1W5Z A;  1RDS A;  3KSE D;  3D3L A;  3LT8 A;  4HOH A;  1DVD A;  4BL3 A;  1BNG A;  1IK3 A;  3G4S 3;  1RGA A;  3JUN A;  2YFI B;  3MWZ A;  4CCV A;  5AYS C;  3RNT A;  2V1L A;  3SED A;  3EBY A;  4J8T A;  1RTU A;  4O8S A;  1BRI A;  1OF5 A;  2F5M A;  5D81 A;  1LOV A;  1MWS A;  3EE1 A;  3BU4 A;  1O7G B;  3V98 A;  2CX1 A;  2CFK A;  1DVC A;  1I2F A;  3K5T A;  4LSO A;  1RRL A;  1B2S A;  4HKV B;  2ZHX B;  3MG2 A;  5BXQ A;  1TFO A;  1Q7H A;  3CCQ 3;  3MHE A;  1LOX A;  2H0H A;  2B24 B;  4ZM8 A;  4HM5 B;  2GEY A;  4J9A A;  3PS8 A;  4EV2 A;  2LQV A;  1E3V A;  3EN8 A;  5AYR B;  3U97 A;  1AR0 A;  3T8U A;  3BND A;  1YI2 3;  3SXX A;  1BVI A;  2RNT A;  2SBL A;  3N8B A;  3X3X A;  5BVB A;  1FGM A;  1YVB I;  1BNJ A;  3G71 3;  1W6Y A;  1LOY A;  1JNQ A;  2F5W A;  1W4N A;  4R9K A;  1YJ9 3;  1RCK A;  4N6U A;  3RGA A;  1TRP A;  4KZ1 A;  1VZZ A;  1IQY A;  1JV2 B;  2CIU A;  3NM2 A;  3CD6 3;  3FH1 A;  4R4K A;  1S72 3;  3KII A;  6STD A;  5CXO A;  2FNQ A;  2RBI A;  1MOL A;  2W2C A;  1YGW A;  3CMA 3;  3DGY A;  4WYK B;  5M1A A;  2FGT A;  2CW9 A;  1JBS A;  1FUW A;  3FKA A;  2Z6B A;  3B4O A;  3F40 A;  2OQE A;  1AVK A;  3F8H A;  2GBW B;  3G0K A;  1GY7 A;  1EUI C;  2ZL8 A;  6GSP A;  2ZDJ A;  3T0U A;  1FYS A;  5KP1 A;  4N6O B;  1YJW 3;  3LYG A;  2KF3 A;  4R1K A;  3J7Y d;  3NXJ A;  4HM7 B;  3ZFZ A;  3MPH A;  3KFQ C;  2CG1 A;  3LTB A;  1RCL A;  2E2T A;  5KP3 A;  4AEQ A;  1Q40 B;  3EJV A;  4QWT A;  3WOF B;  4FCJ A;  4K90 B;  3D9R A;  3B8L A;  4FMD A;  5DRE A;  3CXC 2;  3CC7 3;  1VQ6 3;  2RSX A;  3NQZ A;  5AII A;  1M90 4;  4FMC A;  2KXG A;  4MMY B;  1GD4 A;  3LTD A;  3AGN A;  4ILF A;  3AGO A;  1W2Z A;  4N6N B;  4FR9 A;  1I3I A;  5FGO A;  3GWR A;  3OWY A;  3CPW 2;  3CME 3;  7GSP A;  1T5Y A;  5BIR A;  3JUQ A;  1RGG A;  2OQE C;  1BOX A;  1RRH A;  1UUW B;  2L4V A;  1T3B A;  3ZG0 A;  1UI8 A;  1WNH A;  1ZO2 A;  4EV5 A;  1K73 4;  1FUS A;  2W56 A;  3CC4 3;  2AAE A;  2K0M A;  2R41 A;  2GXF A;  1W7C A;  2Q07 A;  3FGY A;  1K28 A;  1O7N B;  3LXU X;  2MC8 A;  2XF3 A;  3AMO B;  2BMQ B;  1Z1S A;  2WOH A;  1VQK 3;  1RN7 A;  1UDI I;  1IYY A;  4BU4 A;  4LYL B;  1JKG B;  1MWT A;  1JBR A;  4HZB B;  1GMQ A;  4OUQ A;  1RN4 A;  3JUP A;  2YFL B;  1VQO 3;  5CF2 A;  1BAO A;  1YVS A;  1M9G A;  2GBX B;  4EC6 A;  3BLZ A;  1ROA A;  2GEX A;  3Q90 A;  1D6Z A;  3X40 A;  4OK0 A;  4HAA A;  2CKF B;  5EEO A;  2CC3 A;  1TP6 A;  3DGM A;  3EBT A;  4BTW A;  3HZP A;  1BNI A;  1Q9E A;  3DGL A;  5IG3 A;  1RSN A;  4MEI A;  4STD A;  3CCJ 3;  4XBY A;  1LOW A;  1RHL A;  1LRA A;  1ULJ B;  4LZI A;  3E99 A;  1BSD A;  2CFG A;  5HGR A;  1IDP A;  2XSO B;  4K1U A;  1VQL 3;  1G0T A;  3FCS B;  1A67 A;  2P38 A;  3K0Z A;  4JRF A;  2OCT A;  4NRE A;  4Q53 A;  1WTH A;  2CG0 A;  4TX4 A;  2A15 A;  3SX1 A;  3WOE B;  3Q2P A;  4RZM A;  2CH9 A;  1IV7 A;  3F8X A;  1RMS A;  3DGO A;  2KF6 A;  2Z7A A;  1JB5 A;  3GAX A;  2HMK B;  1W02 A;  3LTC A;  4XB5 A;  5JPU A;  1JB2 A;  1JN5 A;  1M1K 4;  1F8N A;  3F9S A;  1ROV A;  1U5O A;  2F4Y A;  2PNC A;  3MG1 A;  4X2H A;  2W0Q A;  1M1X B;  3CC2 3;  3UL5 A;  4EBG A;  3Q3F A;  4R80 A;  4L8O A;  1BNS A;  1Q7Y 4;  2D42 A;  5I97 A;  1LVN A;  3NV0 A;  1X1X A;  5AEW B;  3T8N A;  2KRT A;  1IQX A;  3G8Z A;  3DMC A;  2IUK A;  3QRD A;  5IG5 A;  4O3V A;  2CX0 A;  1TFK A;  2IA7 A;  1LQG C;  3UNL A;  3PCS A;  1RGH A;  1N8Q A;  1HKX A;  1OF5 B;  4WWU C;  1I0X A;  1CH0 A;  2CK3 H;  2HMO B;  2L1S A;  1A2V A;  5IG4 A;  1GY6 A;  3I55 3;  5G1K A;  3D5I A;  4RNY A;  4HM3 B;  2CHC A;  3MKI A;  1DMQ A;  4XDW A;  1KC8 4;  2WGO A;  1BAN A;  3KKG A;  3CCR 3;  1GSP A;  2K3D A;  1O7M B;  2JDI H;  1X1Y A;  3S29 A;  2LYX A;  1W2B 2;  1SII A;  3DZL A;  2BIR A;  3K7C A;  3SOA A;  1HZ1 A;  1LXE A;  1STF I;  1FZU A;  3FG4 A;  1CYV A;  3NX0 A;  1AVL A;  4KFF A;  1V74 A;  1CEW I;  1SJW A;  4BTX A;  1JB4 A;  1BGS A;  3DH2 A;  2W9P A;  3FG3 A;  3MG3 A;  4EXR A;  1IQ8 A;  1RGE A;  1S5A A;  5LC6 A;  3JUM A;  3CCM 3;  3NQY A;  3KZT A;  1B2Z A;  4EW5 A;  3GZX B;  4K1V A;  2Y74 A;  4N6V 0;  1STD A;  1VQ4 3;  3GZR A;  2F98 A;  1MGR A;  1IVW A;  4KT3 B;  5LC7 A;  4AKY A;  1A90 A;  1LNH A;  3BNE A;  3Q1C A;  3PZW A;  3DY5 A;  1QVG 2;  3S28 A;  3WDG B;  1BUQ A;  1DYU A;  1KD1 4;  4L7K A;  1RNT A;  1QMA A;  6RNT A;  1EA2 A;  2OOV A;  5A0O B;  1UGI A;  3FLJ A;  1NB5 I;  3VSY A;  3WMD A;  3HK4 A;  1FW7 A;  1RNB A;  3M8C A;  4HYZ A;  3KSP A;  1PY3 A;  3I0Y A;  3PXM A;  1I2E A;  1JZO A;  3KE7 A;  4KFE A;  1TUH A;  9RNT A;  2CFW A;  5HOH A;  5JPP A;  1N8R 4;  4HM2 B;  5M19 A;  1K9M 4;  2D1W A;  1BSE A;  1OGZ A;  3BNC A;  4MJD A;  3CCV 3;  5ELU A;  3CU3 A;  3KCH A;  1MWR A;  2ZA4 A;  2FXT A;  4LGQ A;  1E3R A;  3CNX A;  3X3Z A;  5M18 A;  4O02 B;  2CWV A;  1EG9 B;  4WP5 A;  2HMJ B;  5AEU B;  3UJM A;  1DE3 A;  5AIF A;  2RGQ A;  3HIG A;  1NDO B;  1VQ9 3;  1OHP A;  5AIH A;  1VQM 3;  1R4Y A;  2BNG A;  1T2H A;  2GU3 A;  4HBR A;  3WA3 A;  1BUJ A;  4OVM A;  4RNT A;  2INX A;  1B21 A;  2OOV C;  3EQQ B;  2C10 A;  2W03 A;  7STD A;  1K41 A;  3S67 A;  1U8C B;  5D83 A;  2R4I A;  1EQK A;  1BSC A;  3MYT A;  3HOH A;  1G96 A;  2W56 B;  4DKI A;  1UCJ A;  3NM7 A;  2WO0 A;  3EC9 A;  3ZG5 A;  1BU4 A;  4XBT A;  2JQ5 A;  5IEO A;  1SQW A;  2CWU A;  3LZA A;  1AY7 A;  1PFP A;  2QA4 3;  1W6C A;  1LQM B;  4BTY A;  3F7S A;  2E2V A;  4CJN A;  2AAD A;  3NUV A;  1VQP 3;  1UUG B;  3VGN A;  1ISK A;  4H3U A;  2WGQ A;  3GZB A;  5RNT A;  4NPB A;  3LTA A;  2B1X B;  2QEX 3;  5EQL A;  1GOU A;  3A5E A;  1V58 A;  2YX9 A;  4GSP A;  3SVA A;  3DM8 A;  1JJ2 2;  1HYF A;  1OAC A;  1YHQ 3;  3CCE 3;  1O7P B;  1IT8 A;  8CHO A;  1BIR A;  2P0X A;  1YNV X;  3IPT A;  1YIJ 3;  1EKM A;  3OV4 A;  4EYC A;  3B4P A;  4J5G A;  1GMR A;  1QJG A;  3QK9 A;  5FW5 A;  3DUK A;  2XSH B;  5G1L A;  2PZV A;  4I4K A;  1OH0 A;  2E2U A;  3WOD G;  3OWU A;  1IVX A;  1WMN A;  1A2K A;  1DMN A;  2H0I A;  2UUG C;  1W6G A;  3WHO A;  1DET A;  2HML B;  2XFS A;  4HM6 B;  5KP4 A;  4RNZ A;  2GSP A;  3FZW A;  2W6J H;  1I8V A;  1IT7 A;  2IUJ A;  3VF1 A;  1RGC A;  1MNL A;  1JN5 B;  1B2M A;  4GB5 A;  2C4B A;  1BNF A;  1A2P A;  1FUT A;  4U13 A;  4HM1 B;  3H51 A;  1X1W A;  3H3H A;  1OHS A;  1ZX2 A;  3KN4 A;  3ALA A;  1IU7 A;  4BL2 A;  1QAF A;  3PYJ A;  3NV0 B;  2UGI A;  4ORL A;  1UI7 A;  4L8P A;  1UCL A;  2BHM A;  5IEN A;  1T2I A;  1PYL A;  3EN1 B;  3NHX A;  4IIA A;  3HX8 A;  5IER A;  1AV4 A;  2W9Q A;  4X2O A;  5IG0 A;  1NJI 4;  3K9M C;  1WMP A;  2ML6 A;  1VQN 3;  1UGH I;  1MGW A;  1J2B A;  5GSP A;  1ULI B;  1BRN L;  4XDV A;  1UW1 A;  3MSO A;  2C11 A;  1Y4K A;  4FMB A;  3V92 A;  1YIT 3;  1TTO A;  3OXA A;  1E97 A;  1Q42 A;  2F99 A;  2KAA A;  2K54 A;  1RJO A;  1X1U A;  2GU1 A;  1BRG A;  3FF2 A;  4FMA A;  2BU4 A;  1Q81 4;  3JVC A;  1SIH A;  1N5P A;  2F86 B;  1TRQ A;  2IMJ A;  3LOY A;  4PEJ A;  1QAL A;  4N3V A;  4WHA A;  1NWW A;  1RLS A;  4HZ9 B;  4N6T A;  3CCL 3;  1CYU A;  2CWT A;  4HM8 B;  3GSP A;  1OCV A;  1UUV B;  3V99 A;  5IW9 A;  1FGT A;  4HM4 B;  2ML5 A;  1B20 A;  2F56 A;  3EF8 A;  2KCD A;  3EHC A;  2BMO B;  3SLU A;  1OHO A;  1KQS 2;  1RGF A;  3EX9 A;  3L0R A;  1TIJ A;  1Q82 4;  1W00 A;  1I70 A;  1V57 A;  5G2G A;  3FG1 A;  4CPK A;  3STD A;  2Z76 A;  2P05 A;  2I9W A;  1FGR A;  2XH9 A;  4RBN A;  1GYB A;  3CPO A;  3PCR A;  3ROB A;  1YGE A;  1UCI A;  2IYJ A;  1B2X A;  1OPY A;  2IY2 A;  3S27 A;  1JBT A;  1VQ5 3;  2W04 A;  2HMM B;  1N9J A;  1NNV A;  2O3O A;  3CCS 3;  3IJE B;  2Z77 A;  1W01 A;  5STD A;  4G1M B;  4WYK A;  3OX9 A;  1SPU A;  3F14 A;  4WFO A;  5AI1 A;  1MWU A;  1B3S A;  4GL6 A;  4IPB A;  2RFR A;  2KF5 A;  2OTL 3;  3UL6 A;  1DMM A;  3A76 A;  3DXO A;  4LMI A;  5IF6 A;  1RGL A;  2XGN A;  3K63 A;  1FA3 A;  3D79 A;  3X41 A;  1IVU A;  1TU5 A;  3OWS A;  4HVN A;  4BIR A;  5CF1 A;  1KSI A;  1Q86 4;  4XBX A;  1I2G A;  1I0V A;  3BNB A;  1WMO A;  1BRS A;  2J8X B;  2UX0 A;  1EEJ A;  3HII A;  1D6U A;  4JF8 A;  4O2H A;  5AIG A;  1Q40 A;  1NO3 A;  1VQ8 3;  5TGN A;  1QAK A;  1C7H A;  4N6M A;  3CNM A;  4MMX B;  3IMA B;  1VQ7 3;  1ASK A;  1FGQ A;  4N6L A;  3S5C A;  1O7H B;  1GMP A;  3ER7 A;  3TDG A;  1ZGX A;  4KFD A;  1GOV A;  2HMN B;  1R4C A;  1OGX A;  3WR2 A;  3N9H A;  2XRX B;  4HJL B;  3N54 B;  2P0M A;  3X3Y A;  1B2U A;  5CLK A;  2Y73 A;  1KWI A;  1GS3 A;  2KF4 A;  1GY5 A;  3BB9 A;  3D5G A;  3SOY A;  4NHF A;  2WOF A;  4KVH A;  4AKZ A;  1IV9 A;  3WA2 X;  2CFL A;  2XFT A;  3CCU 3;  3LML A;  3U1W A;  1RGK A;  1RN1 A;  3GRD A;  3FSD A;  4LEH A;  1FGO A;  3O8Y A; 
#chains in the Genus database with same CATH homology
 1GD3 A;  2STD A;  1K8A 4;  3AMO A;  3X42 A;  2BMR B;  4R9L A;  1CQS A;  3LT9 A;  2OWP A;  2YFJ B;  1JKG A;  2MF7 A;  2M7O A;  4CDL A;  1JRQ A;  5D82 A;  1N9E A;  3FF0 A;  2BT3 A;  3F7X A;  1NB3 I;  1N5H A;  1L5G B;  4HM0 B;  1US1 A;  1O7W B;  2BO9 B;  3EB8 A;  3NBJ A;  4IT7 A;  3B7C A;  2XEP A;  5DRV A;  1QVF 2;  3NBB A;  3I56 3;  1YJN 3;  3LH4 A;  1RKY A;  5JBS A;  3G16 A;  2RCD A;  3JUO A;  5EVH A;  2P09 A;  2QIY A;  3HI7 A;  3NBR A;  5CK6 A;  1PU4 A;  4FCZ A;  4K61 A;  2CFD A;  2O9U X;  3UB1 A;  3G6E 3;  1D6Y A;  1IVV A;  2XR8 B;  3PGB A;  2XGL A;  3DGN A;  1NU3 A;  5ELJ A;  4XM4 A;  2QGU A;  4MMZ B;  4H61 A;  3GZY B;  5IEP A;  1WQL B;  3RDE A;  3RGR A;  2OTJ 3;  1HU9 A;  1OUN A;  3ECF A;  3OW2 2;  4FCM A;  1W5Z A;  3KSE D;  3D3L A;  3LT8 A;  1DVD A;  1IK3 A;  3G4S 3;  3JUN A;  2YFI B;  3MWZ A;  4CCV A;  5AYS C;  2V1L A;  3SED A;  3EBY A;  4J8T A;  4O8S A;  1OF5 A;  5D81 A;  3EE1 A;  1O7G B;  3V98 A;  2CFK A;  1DVC A;  3K5T A;  4LSO A;  1RRL A;  4HKV B;  3MG2 A;  5BXQ A;  1TFO A;  3CCQ 3;  3MHE A;  1LOX A;  2B24 B;  4ZM8 A;  4HM5 B;  2GEY A;  4J9A A;  3PS8 A;  4EV2 A;  2LQV A;  1E3V A;  3EN8 A;  5AYR B;  3U97 A;  1AR0 A;  3T8U A;  3BND A;  1YI2 3;  3SXX A;  1A90 A;  2SBL A;  3N8B A;  5BVB A;  3X3X A;  3G71 3;  1FGM A;  1YVB I;  1W6Y A;  1JNQ A;  4R9K A;  1W4N A;  1YJ9 3;  4N6U A;  3RGA A;  4KZ1 A;  1VZZ A;  1IQY A;  1JV2 B;  2CIU A;  3NM2 A;  3CD6 3;  3FH1 A;  4R4K A;  1S72 3;  3KII A;  6STD A;  5CXO A;  2FNQ A;  1MOL A;  2W2C A;  3CMA 3;  4WYK B;  2FGT A;  2CW9 A;  1FUW A;  3FKA A;  2Z6B A;  3B4O A;  3F40 A;  2OQE A;  1AVK A;  3F8H A;  2GBW B;  3G0K A;  1GY7 A;  2ZL8 A;  2ZDJ A;  3T0U A;  5KP1 A;  4N6O B;  1YJW 3;  3LYG A;  3J7Y d;  4R1K A;  3NXJ A;  4HM7 B;  3MPH A;  3KFQ C;  2CG1 A;  3LTB A;  2E2T A;  5KP3 A;  4AEQ A;  1Q40 B;  3EJV A;  4QWT A;  3WOF B;  4FCJ A;  4K90 B;  3D9R A;  3B8L A;  4FMD A;  5DRE A;  3CXC 2;  3CC7 3;  1VQ6 3;  2RSX A;  3NQZ A;  5AII A;  1M90 4;  4FMC A;  2KXG A;  4MMY B;  1GD4 A;  3LTD A;  1W2Z A;  4N6N B;  4FR9 A;  5FGO A;  3GWR A;  3OWY A;  3CPW 2;  3CME 3;  1T5Y A;  3JUQ A;  2OQE C;  1RRH A;  1UUW B;  2L4V A;  1UI8 A;  1WNH A;  1ZO2 A;  4EV5 A;  1K73 4;  2W56 A;  3CC4 3;  3FGY A;  2K0M A;  2GXF A;  1W7C A;  2Q07 A;  3LXU X;  1K28 A;  1O7N B;  2MC8 A;  2XF3 A;  3AMO B;  2BMQ B;  1Z1S A;  2WOH A;  1VQK 3;  1RN7 A;  1JKG B;  4HZB B;  4OUQ A;  3JUP A;  2YFL B;  1VQO 3;  5CF2 A;  1M9G A;  2GBX B;  4EC6 A;  3BLZ A;  1ROA A;  2GEX A;  3Q90 A;  1D6Z A;  3X40 A;  4OK0 A;  2CKF B;  5EEO A;  2CC3 A;  1TP6 A;  3DGM A;  3EBT A;  4BTW A;  3HZP A;  3DGL A;  5IG3 A;  3CCJ 3;  4MEI A;  4STD A;  4XBY A;  1ULJ B;  4LZI A;  3E99 A;  2CFG A;  5HGR A;  1IDP A;  2XSO B;  4K1U A;  1VQL 3;  3FCS B;  1A67 A;  2P38 A;  3K0Z A;  4JRF A;  2OCT A;  4NRE A;  4Q53 A;  1WTH A;  2CG0 A;  4TX4 A;  2A15 A;  3SX1 A;  3WOE B;  3Q2P A;  4RZM A;  2CH9 A;  1IV7 A;  3F8X A;  3DGO A;  3GAX A;  2Z7A A;  1JB5 A;  3LTC A;  2HMK B;  1W02 A;  4XB5 A;  5JPU A;  1JB2 A;  1JN5 A;  1M1K 4;  1F8N A;  3F9S A;  1ROV A;  1U5O A;  2PNC A;  3MG1 A;  4X2H A;  2W0Q A;  1M1X B;  3CC2 3;  3UL5 A;  4EBG A;  4R80 A;  4L8O A;  1Q7Y 4;  2D42 A;  5I97 A;  1LVN A;  3NV0 A;  5AEW B;  3T8N A;  2KRT A;  1IQX A;  3G8Z A;  3DMC A;  2IUK A;  3QRD A;  5IG5 A;  4O3V A;  1TFK A;  2IA7 A;  3UNL A;  3PCS A;  1N8Q A;  1HKX A;  1OF5 B;  4WWU C;  2CK3 H;  5IG4 A;  2HMO B;  1A2V A;  1GY6 A;  3I55 3;  4RNY A;  4HM3 B;  2CHC A;  3MKI A;  1DMQ A;  4XDW A;  1KC8 4;  2WGO A;  3CCR 3;  3KKG A;  1O7M B;  2JDI H;  3S29 A;  1W2B 2;  2LYX A;  1SII A;  3DZL A;  3K7C A;  3SOA A;  1LXE A;  1STF I;  3FG4 A;  1CYV A;  3NX0 A;  1AVL A;  4KFF A;  1V74 A;  1CEW I;  1SJW A;  4BTX A;  1JB4 A;  4EXR A;  2W9P A;  3FG3 A;  3MG3 A;  1IQ8 A;  5LC6 A;  1S5A A;  3JUM A;  3CCM 3;  3NQY A;  3KZT A;  3GZX B;  4K1V A;  2Y74 A;  4N6V 0;  1STD A;  1VQ4 3;  3GZR A;  2F98 A;  1IVW A;  5LC7 A;  4AKY A;  1LNH A;  3BNE A;  3Q1C A;  3PZW A;  3DY5 A;  1QVG 2;  3S28 A;  3WDG B;  1BUQ A;  1DYU A;  1KD1 4;  4L7K A;  1QMA A;  1EA2 A;  2OOV A;  5A0O B;  3FLJ A;  1NB5 I;  3VSY A;  3WMD A;  3HK4 A;  3M8C A;  4HYZ A;  3KSP A;  3I0Y A;  3PXM A;  3KE7 A;  4KFE A;  1TUH A;  2CFW A;  5JPP A;  1N8R 4;  4HM2 B;  1K9M 4;  2D1W A;  1OGZ A;  3BNC A;  4MJD A;  3CCV 3;  5ELU A;  3CU3 A;  4LGQ A;  2FXT A;  3X3Z A;  1E3R A;  3CNX A;  4O02 B;  2CWV A;  1EG9 B;  4WP5 A;  2HMJ B;  5AEU B;  3UJM A;  5AIF A;  2RGQ A;  3HIG A;  1NDO B;  1VQ9 3;  1OHP A;  5AIH A;  1VQM 3;  2BNG A;  2GU3 A;  4HBR A;  3WA3 A;  4OVM A;  2INX A;  2OOV C;  3EQQ B;  2C10 A;  2W03 A;  7STD A;  1K41 A;  3S67 A;  1U8C B;  5D83 A;  2R4I A;  1EQK A;  3MYT A;  1G96 A;  2W56 B;  3NM7 A;  2WO0 A;  3EC9 A;  4XBT A;  2JQ5 A;  5IEO A;  1SQW A;  2CWU A;  3LZA A;  1PFP A;  2QA4 3;  1W6C A;  4BTY A;  3F7S A;  2E2V A;  1VQP 3;  3NUV A;  3VGN A;  1ISK A;  4H3U A;  2WGQ A;  3GZB A;  3LTA A;  2B1X B;  2QEX 3;  5EQL A;  2YX9 A;  3SVA A;  3DM8 A;  1JJ2 2;  1OAC A;  1YHQ 3;  3CCE 3;  1O7P B;  1IT8 A;  8CHO A;  2P0X A;  3IPT A;  1YIJ 3;  1EKM A;  3OV4 A;  4EYC A;  3B4P A;  1QJG A;  3QK9 A;  5FW5 A;  3DUK A;  2XSH B;  2PZV A;  4I4K A;  1OH0 A;  2E2U A;  3WOD G;  3OWU A;  1IVX A;  1A2K A;  1DMN A;  1WMN A;  1W6G A;  2XFS A;  2HML B;  4HM6 B;  5KP4 A;  4RNZ A;  3FZW A;  2W6J H;  1IT7 A;  2IUJ A;  3VF1 A;  1MNL A;  1JN5 B;  4GB5 A;  4U13 A;  4HM1 B;  3H51 A;  3H3H A;  1OHS A;  1ZX2 A;  3KN4 A;  3ALA A;  1IU7 A;  1QAF A;  3PYJ A;  3NV0 B;  4ORL A;  1UI7 A;  4L8P A;  2BHM A;  5IEN A;  3EN1 B;  3NHX A;  4IIA A;  3HX8 A;  5IER A;  1AV4 A;  2W9Q A;  4X2O A;  5IG0 A;  1NJI 4;  3K9M C;  1WMP A;  2ML6 A;  1VQN 3;  1J2B A;  1ULI B;  4XDV A;  1UW1 A;  3MSO A;  2C11 A;  1Y4K A;  4FMB A;  3V92 A;  1YIT 3;  3OXA A;  1E97 A;  1Q42 A;  2F99 A;  2K54 A;  1RJO A;  2GU1 A;  3FF2 A;  4FMA A;  1Q81 4;  3JVC A;  1SIH A;  1N5P A;  2F86 B;  3LOY A;  2IMJ A;  4PEJ A;  1QAL A;  4N3V A;  4WHA A;  1NWW A;  4N6T A;  4HZ9 B;  3CCL 3;  1CYU A;  2CWT A;  4HM8 B;  1OCV A;  1UUV B;  3V99 A;  5IW9 A;  1FGT A;  4HM4 B;  2ML5 A;  3EF8 A;  2KCD A;  3EHC A;  2BMO B;  3SLU A;  1OHO A;  1KQS 2;  3EX9 A;  3L0R A;  1TIJ A;  1Q82 4;  1W00 A;  5G2G A;  3FG1 A;  3STD A;  2Z76 A;  2P05 A;  2I9W A;  1FGR A;  2XH9 A;  4RBN A;  1GYB A;  3CPO A;  3PCR A;  3ROB A;  1YGE A;  1OPY A;  3S27 A;  1VQ5 3;  2W04 A;  2HMM B;  1N9J A;  2O3O A;  3CCS 3;  3IJE B;  2Z77 A;  1W01 A;  5STD A;  4G1M B;  4WYK A;  3OX9 A;  1SPU A;  3F14 A;  4WFO A;  5AI1 A;  4GL6 A;  4IPB A;  2RFR A;  2OTL 3;  3UL6 A;  1DMM A;  3A76 A;  3DXO A;  4LMI A;  5IF6 A;  2XGN A;  3K63 A;  1FA3 A;  3X41 A;  1TU5 A;  1IVU A;  3OWS A;  4HVN A;  5CF1 A;  1KSI A;  1Q86 4;  4XBX A;  3BNB A;  1WMO A;  2UX0 A;  3HII A;  4JF8 A;  4O2H A;  5AIG A;  1D6U A;  1Q40 A;  1NO3 A;  1VQ8 3;  5TGN A;  1QAK A;  1C7H A;  4N6M A;  3CNM A;  4MMX B;  3IMA B;  1VQ7 3;  1ASK A;  1FGQ A;  4N6L A;  3S5C A;  1O7H B;  3ER7 A;  3TDG A;  4KFD A;  2HMN B;  1R4C A;  1OGX A;  3N9H A;  2XRX B;  4HJL B;  3N54 B;  2P0M A;  3X3Y A;  5CLK A;  2Y73 A;  1KWI A;  1GS3 A;  1GY5 A;  3BB9 A;  3SOY A;  4NHF A;  2WOF A;  4KVH A;  4AKZ A;  1IV9 A;  3WA2 X;  2CFL A;  2XFT A;  3CCU 3;  3LML A;  3U1W A;  4LEH A;  3GRD A;  3FSD A;  1FGO A;  3O8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...