3UB1A

Ntf2 like protein involved in plasmid conjugation
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
251
structure length
248
Chain Sequence
SLETQAFSFAEEFAWDYFSRYPSDTQDFVRRITKYTTEQLANEMNNGTYSDVIYTSAFYFEKYSENQVNVSVKARVRVYTPKAGQEQDQLQYDTNLVDYYLEVPIVFDKDMNMAVDALPVMTAPPEKAYFKNKEFSGTSENDADKTKKITDSVSQFFKAYYEQNQTQIDYFLVDGADIKGAGQKFSFNKIDRINIYKLSDKEFLAIVDLNVDSFGNAIKQGFNLTVVQEGDKFLVKTLEPRTSNIDLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF13-like protein
publication title The conjugation protein TcpC from Clostridium perfringens is structurally related to the type IV secretion system protein VirB8 from Gram-negative bacteria.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Transport protein
total genus 53
structure length 248
sequence length 251
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12642 TpcC Conjugative transposon protein TcpC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.540 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ub1A02
3.10.450.540 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ub1A01
4EC6A 3UB1A
chains in the Genus database with same CATH superfamily
1FGTA 4EXRA 3OWUA 3UL6A 3CCR3 2W03A 3DGMA 5KP1A 3KSED 1ZX2A 1AVKA 2ZL8A 2MF7A 4KVHA 2WOHA 3F7SA 2C10A 1WMNA 3ZG0A 1CQSA 3G8ZA 3FSDA 3VGNA 2Q07A 1K8A4 1BAOA 3EHCA 2K0MA 3A5EA 3OWYA 4FCJA 1OF5B 2ZHXB 4XB5A 1B2ZA 1TU5A 3V98A 3HOHA 4HKVB 1JRQA 1IQYA 1MGWA 3EC9A 2V1LA 2OOVA 1FA3A 1BRHA 1JZDA 4HM4B 5HOHA 1DETA 1CH0A 2HMKB 3MG2A 2W6JH 3SX1A 5IF6A 1JBRA 1BSCA 3HX8A 1I2GA 3EB8A 1W6CA 2A15A 3KE7A 1IQ8A 1MWUA 3PS8A 5AIFA 2OTJ3 2E2TA 2ML5A 1JB5A 3CD63 4BL3A 4R9LA 1TFOA 4GB5A 2CKFB 2Y73A 3PCRA 1FW7A 1T5YA 1RRLA 3MKIA 3MYTA 1VQL3 1LQMB 2GBXB 2QGUA 1VQQA 1G02A 1OF5A 2YFJB 3DM8A 3GAXA 4N6LA 1IQXA 1DYUA 1GD3A 3N54B 2GXFA 2BT3A 3LTDA 1W5ZA 1UUVB 1Q7HA 3RGAA 2CFLA 1STDA 3FLJA 4O2HA 1W2B2 1FUWA 2KF4A 3NBJA 1O7NB 4CJNA 1EEJA 1Q40B 2BU4A 1UCJA 2BIRA 2IMJA 3F9SA 4TX4A 4U13A 3UJMA 1Q824 4FMCA 1V57A 1E3VA 5HGRA 2CIUA 2SBLA 5JPPA 3FG1A 1GYBA 1I2FA 1VQ73 3G713 1AV4A 2XH9A 3IMAB 1VQ43 2CFKA 3LZAA 1KSIA 3HIGA 4CCVA 1Q42A 3WA3A 3D5GA 4N6UA 1N9EA 1RJOA 1UUGB 2XRXB 3MSOA 5JPUA 3SEDA 1NNVA 2P38A 1OUNA 1T2HA 5G1LA 2F4YA 3MHEA 1VQP3 1T2IA 3NM7A 1RN7A 3J7Yd 5IERA 5ELJA 3O8YA 3H51A 3LTCA 1UW1A 2XFTA 3DH2A 1TJDA 2IUKA 1VZZA 3WMDA 1TTOA 5KP4A 3URPA 3ER7A 2KRTA 2FXTA 1AR0A 1RSNA 3S28A 1KC84 2H0HA 3KFQC 1Z1SA 1DE3A 1KQS2 1RHLA 3G6E3 1AQZA 2Z6BA 1JNQA 4KT3B 3HK4A 4BU4A 2XF3A 2H0GA 1NB3I 4FMAA 3D3LA 3Q1CA 5EVHA 5TGNA 7STDA 1BRNL 3FF0A 4I4KA 2CG1A 3VSYA 1RNTA 4XBTA 1NWWA 1NB5I 3LH4A 5G2GA 2F86B 3CNMA 5AEWB 5BIRA 4FMBA 1IV7A 1BGSA 1OH0A 4HZ9B 3JUNA 3KN4A 1NU3A 2D42A 1YIJ3 4HM2B 3X41A 1YHQ3 1RGEA 1CEWI 2CX1A 3WOFB 3D5IA 3LT8A 3QK9A 3MWZA 3CPW2 2R41A 3QRDA 3D9RA 1V74A 1YGWA 1IK3A 1KD14 3NX0A 4R4KA 5IEPA 3BU4A 3ZG5A 2CWTA 2OCTA 1I0VA 4EC6A 1VQ53 1TIJA 1GS3A 5I97A 1EUIC 3BB9A 3OX9A 5AI1A 6STDA 1JB4A 2KXGA 2XGNA 3F14A 3LXUX 5IW9A 3CXC2 3WA2X 2D1WA 3EN8A 4NREA 2F5MA 2ML6A 4N3VA 1RGAA 4KZ1A 5D81A 3B8LA 2KF6A 1BU4A 3OW22 2Z7AA 1A67A 1RLSA 4N6NB 4CPKA 4RNTA 1RTUA 3X42A 4KFEA 4WFOA 4WHAA 3WR2A 2AADA 1VQ83 1VQ93 1QJGA 2P09A 1SQWA 4L7KA 1IVUA 1B3SA 4R9KA 1IT8A 1RDSA 3WOEB 4K61A 2W56B 1B2SA 1MWRA 3JUOA 5LC6A 2RCDA 2E2UA 1NDOB 1AY7A 1MWSA 5AIHA 1JN5B 3A76A 3IPTA 3GSPA 4XDVA 1M904 2ZA4A 3B7CA 5STDA 4CDLA 3OV4A 1BUJA 1GY6A 2IUJA 4LEHA 3EX9A 2OQEC 1WNHA 4LSOA 1O7WB 1R4CA 1JJ22 1US1A 3NBRA 1NO3A 5CLKA 2Z76A 1QAFA 1UDII 1UCIA 4I5QA 4MMYB 5A0OB 1M1K4 1UGHI 1HYFA 3S5CA 4AKZA 3DZLA 4AEQA 1CYVA 2JQ5A 4STDA 1BNJA 2UX0A 1D6YA 1FZUA 2I9WA 2W2CA 2HMNB 2WO0A 2C11A 3KIIA 3S67A 4AKYA 1G96A 1C7HA 3ECFA 4MJDA 4XBXA 1ASKA 1DMQA 4QWTA 1N5HA 3B4PA 3CCU3 1SARA 1BRIA 3KSPA 4IIAA 1VQK3 2P05A 3H3HA 3U1WA 2CK3H 1I0XA 5AEUB 1SIIA 3HI7A 4HBRA 1X1UA 3N9HA 1JZOA 1O7HB 3NV0B 2B1XB 3PYJA 1GMRA 3BNBA 1S5AA 3F7XA 4O8SA 4FCMA 1B27A 5M19A 5KP3A 2RGQA 3X3XA 3CNXA 2UGIA 1WTHA 3PCSA 1RGFA 4IT7A 1YVBI 3CC43 2UUGC 2OQEA 1SIHA 3CCL3 1GMQA 1ROVA 3AGOA 1OHOA 1FGQA 4G1MB 2CFGA 3EJVA 4OUQA 3MPHA 4RNYA 1BNGA 3BNCA 4WYKB 1QVF2 3MG3A 3GZYB 3PZWA 3EF8A 3EBTA 1K734 5RNTA 2W0QA 2ZDJA 3EN1B 3ZFZA 2E2VA 4HOHA 3V92A 1BNSA 1TFKA 4N6V0 1SPUA 1K9M4 2R4IA 1V58A 3NV0A 3CMA3 1IVVA 3WDGB 3FKAA 3SYUA 5IG5A 1BSEA 1JKGB 1Q40A 3SVAA 1QALA 2L4VA 3T8UA 3FCSB 3N8BA 2K3DA 3SOYA 2HMOB 5M18A 4WP5A 1KWIA 2HMMB 1LOVA 3X3ZA 1D6ZA 4HYZA 4ORLA 4NHFA 2XR8B 4BTWA 1I3IA 3AHWA 3OXAA 4HVNA 4DKIA 1BNEA 2WOFA 4FCZA 1A2PA 3RDEA 4J9AA 5EEOA 1M9GA 1JV2B 3LYGA 1STFI 1LOWA 5JBSA 4HAAA 1IT7A 1O7PB 1GOYA 3FG3A 2YFIB 5D83A 1LNIA 2CW9A 2FNQA 1FGRA 3CPOA 3IJEB 1BUQA 4BIRA 4H3UA 2M7OA 3HZPA 3CCS3 1T3BA 3V99A 4HM1B 1RGKA 1K28A 2W04A 3KKGA 2O3OA 2J8XB 1I70A 1MOLA 3CME3 1Q7Y4 3B4OA 3DGYA 1EQKA 1X1XA 3EE1A 3SOAA 3GWRA 1WMOA 3JVCA 1ULJB 3KZTA 1B2UA 1DMNA 7GSPA 5AIGA 4BTXA 2OTL3 2L1SA 3S29A 3AMOB 3NUVA 1UI8A 3UNLA 1BSBA 2HMJB 3GZXB 5BVBA 1BANA 1B21A 1DVDA 2RBIA 4J5GA 5CXOA 3K63A 5BU4A 4K1UA 3L0RA 2OWPA 2CH9A 1IYYA 3I563 1LNHA 4LYLB 5IEOA 1GOVA 3CCQ3 3JUMA 4R80A 3FF2A 1YJN3 2YFLB 3CU3A 1NJI4 2P0MA 4XM4A 1UUWB 2F98A 3NXJA 1VQN3 1ZO2A 1GOUA 1WMPA 2HOHA 2SARA 3UB1A 1IDPA 1RGHA 1IV9A 1I3FA 1A90A 5AYRB 3DMCA 3G0KA 3FGYA 3CCJ3 3I553 1E97A 1OACA 3F40A 1BRGA 1BSAA 1Y4KA 2CHCA 1RGGA 2HMLB 1C54A 3K9MC 1ISKA 3DGOA 3ROBA 1RN1A 2QA43 3AMOA 1BRKA 4LMIA 3BNDA 1GSPA 4HM8B 2BO9B 5D82A 1K41A 1QVG2 1B20A 1TP6A 1D6UA 1OHPA 2KF3A 4HM7B 3RNTA 3LMLA 4IPBA 1EA2A 1LVNA 6RNTA 2CC3A 4J5KA 4EBGA 1Q814 4N6TA 3PGBA 3I0YA 4HM3B 1EG9B 4N6MA 4EV5A 4LZIA 4N6OB 2BMRB 2YX9A 1PY3A 1UCLA 4K90B 4RBNA 1BVIA 1GMPA 2LQVA 3NHXA 3VF1A 3DXOA 3MG1A 1SJWA 1FUSA 4X2HA 1MNLA 4X2OA 5FGOA 7RNTA 1PU4A 1RGCA 2F56A 2W9PA 3NQYA 2RSXA 1I2EA 2B24B 2XSHB 2F5WA 2Y74A 1VQO3 2KAAA 3M8CA 5AIIA 3ALAA 4Q53A 1YVSA 1RCKA 2LYXA 2QIYA 2PZVA 4GSPA 2BMOB 3CCE3 2RNTA 1EKMA 4EV2A 2W56A 5EQLA 3T0UA 4BTYA 2CX0A 3Q3FA 2W9QA 1Q864 1YI23 1UGIA 1JN5A 5AYSC 2IA7A 1GY5A 3Q90A 3T8NA 2STDA 1TRQA 1JB2A 1W01A 3WHOA 1HU9A 1TUHA 3G16A 4OK0A 5IENA 2PNCA 1HZ1A 4GHOA 1FUTA 1L5GB 4XBYA 1RKYA 1X1YA 2C4BA 1W2ZA 3JUQA 4NPBA 1W00A 3WODG 3K0ZA 5BXQA 1PYLA 3BIRA 3NQZA 4HM6B 1UCKA 2K54A 3FZWA 1N8R4 1DMMA 1LRAA 3GRDA 5CF1A 2KCDA 1B2MA 3G4S3 2H0IA 3RGRA 3AGNA 1Q9EA 2O9UX 4LGQA 3UL5A 2GBWB 8RNTA 1YGEA 3D4AA 4FR9A 4O02B 3E99A 1BOXA 4H61A 4RZMA 3X3YA 4JF8A 3GZBA 5GSPA 2Z77A 2GEXA 3LTBA 1IVWA 3CC23 3SLUA 5IG3A 1MWTA 2CFDA 1LXEA 3EBYA 3TDGA 5IG0A 2WGQA 2QEX3 2BMQB 1N9JA 1GD4A 1ULIB 1IU7A 1UI7A 5M1AA 2GSPA 5IG4A 2KF5A 1OHSA 2JDIH 3OWSA 3F8HA 1M1XB 3CCM3 5DRVA 1A2VA 1AVLA 1IVXA 4ILFA 1RMSA 4GL6A 1OGZA 2GU1A 3S27A 2XEPA 1OPYA 1RCLA 1O7MB 4WYKA 1RNBA 3FH1A 1TRPA 2GEYA 1W6GA 3LTAA 5G1KA 1I8VA 5CF2A 2BNGA 2IYJA 1DVCA 1BNIA 1S723 4KFDA 1WQLB 2AAEA 3CCV3 4XDWA 1BSDA 5LC7A 3BNEA 1VQM3 1LOYA 1YIT3 3LT9A 1J2BA 4WWUC 1U8CB 2WGOA 3DGLA 3JUPA 2BHMA 1HKXA 1N8QA 3D79A 1ZS7A 4K1VA 1JKGA 4EYCA 3KCHA 4J8TA 1LOXA 1W02A 1F8NA 2RFRA 4L8OA 1RN4A 4O3VA 3SXXA 4R1KA 1N5PA 2CG0A 3NM2A 1G0TA 1O7GB 4OVMA 1YJW3 1GY7A 3K5TA 2CWVA 3DY5A 3X40A 1FGMA 2F99A 9RNTA 4JRFA 4PEJA 2XSOB 3FG4A 1OCVA 2XGLA 1BNFA 1BNRA 2XFSA 3CC73 2INXA 3PXMA 1W7CA 3LOYA 5DREA 1FYSA 1BRSA 4BL2A 4FMDA 1JBSA 8CHOA 1R4YA 1QAKA 4RNZA 5ELUA 2IY2A 5CK6A 1CYUA 3K7CA 1A2KA 3HIIA 1FGOA 3AHSA 1YNVX 4ZM8A 1ZGXA 3DGNA 3NBBA 3Q2PA 2OOVC 2GU3A 3U97A 1PFPA 1RGLA 3EQQB 4EW5A 2FGTA 3GZRA 1B2XA 1BIRA 4L8PA 1W4NA 4HM5B 4MEIA 2CFWA 4HM0B 1X1WA 1YJ93 1RRHA 2CWUA 3BLZA 4HZBB 1W6YA 4HJLB 1VQ63 1E3RA 1OGXA 3F8XA 5FW5A 3STDA 1MGRA 1LQGC 4MMZB 4KFFA 4MMXB 1ROAA 1U5OA 1JBTA 6GSPA 3DUKA 2P0XA 1BRJA 2MC8A 1QMAA
chains in the Genus database with same CATH topology
1FGTA 4EXRA 3OWUA 3UL6A 3CCR3 2W03A 3DGMA 5KP1A 3KSED 1ZX2A 1AVKA 2ZL8A 2MF7A 4KVHA 2WOHA 3F7SA 2C10A 1WMNA 1CQSA 3G8ZA 3FSDA 3VGNA 2Q07A 1K8A4 3EHCA 2K0MA 3OWYA 4FCJA 1OF5B 4XB5A 1TU5A 3V98A 4HKVB 1JRQA 1IQYA 3EC9A 2V1LA 2OOVA 1FA3A 4HM4B 2HMKB 3MG2A 2W6JH 3SX1A 5IF6A 3HX8A 3EB8A 1W6CA 2A15A 3KE7A 1IQ8A 3PS8A 5AIFA 2OTJ3 2E2TA 2ML5A 1JB5A 3CD63 4R9LA 1TFOA 4GB5A 2CKFB 2Y73A 3PCRA 1T5YA 1RRLA 3MKIA 3MYTA 1VQL3 2GBXB 2QGUA 1OF5A 2YFJB 3GAXA 3DM8A 4N6LA 3SOYA 1IQXA 1DYUA 1GD3A 3N54B 2GXFA 2BT3A 3LTDA 1W5ZA 1UUVB 3RGAA 2CFLA 1STDA 3FLJA 4O2HA 1W2B2 1FUWA 3NBJA 1O7NB 1Q40B 3F9SA 3UJMA 4U13A 2IMJA 1Q824 4TX4A 4FMCA 1E3VA 5HGRA 2CIUA 2SBLA 5JPPA 3FG1A 1GYBA 1VQ73 3G713 1AV4A 2XH9A 3IMAB 1VQ43 2CFKA 3LZAA 1KSIA 3HIGA 4CCVA 1Q42A 3WA3A 4N6UA 1N9EA 1RJOA 2XRXB 3MSOA 5JPUA 3SEDA 2P38A 1OUNA 3MHEA 1VQP3 3NM7A 1RN7A 3J7Yd 5IERA 5ELJA 3O8YA 3H51A 3LTCA 1UW1A 2XFTA 2IUKA 1VZZA 3WMDA 5KP4A 3ER7A 2KRTA 2FXTA 1AR0A 3S28A 1KC84 3KFQC 1Z1SA 1KQS2 3G6E3 2Z6BA 1JNQA 3HK4A 2XF3A 1NB3I 4FMAA 3D3LA 3Q1CA 5EVHA 5TGNA 7STDA 3FF0A 4I4KA 2CG1A 3VSYA 4XBTA 1NWWA 1NB5I 3LH4A 5G2GA 2F86B 3CNMA 5AEWB 4FMBA 1IV7A 1OH0A 4HZ9B 3JUNA 3KN4A 1NU3A 2D42A 1YIJ3 4HM2B 3X41A 1YHQ3 1CEWI 3WOFB 3LT8A 3QK9A 3MWZA 3CPW2 3QRDA 3D9RA 1V74A 1KD14 1IK3A 3NX0A 4R4KA 5IEPA 2CWTA 2OCTA 4EC6A 1VQ53 1TIJA 1GS3A 5I97A 3OX9A 3BB9A 5AI1A 6STDA 1JB4A 2KXGA 2XGNA 3F14A 3LXUX 5IW9A 3CXC2 3WA2X 2D1WA 3EN8A 4NREA 2ML6A 4N3VA 4KZ1A 5D81A 3B8LA 3OW22 2Z7AA 1A67A 4N6NB 3X42A 4KFEA 4WFOA 4WHAA 1VQ83 1VQ93 1QJGA 2P09A 1SQWA 4L7KA 1IVUA 4R9KA 1IT8A 3WOEB 4K61A 2W56B 5LC6A 3JUOA 2RCDA 2E2UA 1NDOB 5AIHA 1JN5B 3A76A 3IPTA 4XDVA 1M904 3B7CA 5STDA 4CDLA 3OV4A 1GY6A 2IUJA 4LEHA 3EX9A 2OQEC 1WNHA 4LSOA 1O7WB 1R4CA 1JJ22 1US1A 3NBRA 1NO3A 5CLKA 2Z76A 1QAFA 5A0OB 4MMYB 1M1K4 3S5CA 4AKZA 3DZLA 4AEQA 1CYVA 2JQ5A 4STDA 2UX0A 1D6YA 2I9WA 2W2CA 2HMNB 2WO0A 2C11A 3KIIA 3S67A 4AKYA 1G96A 1C7HA 3ECFA 4MJDA 4XBXA 1ASKA 1DMQA 4QWTA 1N5HA 3B4PA 3CCU3 3KSPA 4IIAA 1VQK3 2P05A 3H3HA 3U1WA 2CK3H 5AEUB 1SIIA 3HI7A 4HBRA 3N9HA 1O7HB 3NV0B 2B1XB 3PYJA 3BNBA 1S5AA 3F7XA 4O8SA 4FCMA 5KP3A 2RGQA 3X3XA 3CNXA 3PCSA 1WTHA 4IT7A 1YVBI 3CC43 2OQEA 1SIHA 3CCL3 1ROVA 4G1MB 1OHOA 1FGQA 4OUQA 2CFGA 3EJVA 4RNYA 3MPHA 5IENA 3BNCA 4WYKB 1QVF2 3MG3A 3GZYB 3PZWA 3EF8A 3EBTA 1K734 2W0QA 2ZDJA 3EN1B 2E2VA 3V92A 1TFKA 4N6V0 1SPUA 1K9M4 2R4IA 3NV0A 3CMA3 1IVVA 3WDGB 3FKAA 5IG5A 1JKGB 1Q40A 3SVAA 1QALA 2L4VA 3T8UA 3FCSB 3N8BA 2HMOB 4WP5A 1KWIA 2HMMB 3X3ZA 1D6ZA 4HYZA 4ORLA 4NHFA 2XR8B 4BTWA 4HVNA 3OXAA 2WOFA 4FCZA 3RDEA 4J9AA 5EEOA 1M9GA 1JV2B 3LYGA 1STFI 5JBSA 1IT7A 1O7PB 3FG3A 2YFIB 5D83A 2CW9A 2FNQA 1FGRA 3CPOA 3IJEB 1BUQA 4H3UA 2M7OA 3HZPA 3CCS3 3V99A 4HM1B 1K28A 2W04A 3KKGA 2O3OA 3CME3 1MOLA 1Q7Y4 3B4OA 1EQKA 3EE1A 3SOAA 3GWRA 1WMOA 3JVCA 1ULJB 3KZTA 1DMNA 5AIGA 4BTXA 2OTL3 3S29A 3AMOB 3NUVA 1UI8A 3UNLA 2HMJB 3GZXB 5BVBA 1DVDA 5CXOA 3K63A 4K1UA 3L0RA 2OWPA 2CH9A 3I563 1LNHA 5IEOA 3CCQ3 3JUMA 4R80A 3FF2A 1YJN3 2YFLB 3CU3A 1NJI4 2P0MA 4XM4A 1UUWB 2F98A 3NXJA 1VQN3 1ZO2A 1WMPA 3UB1A 1IDPA 1IV9A 1A90A 5AYRB 3DMCA 3G0KA 3FGYA 3CCJ3 3I553 1E97A 1OACA 3F40A 1Y4KA 2CHCA 2HMLB 3K9MC 1ISKA 3DGOA 3ROBA 2QA43 3AMOA 4LMIA 3BNDA 4HM8B 2BO9B 5D82A 1K41A 1QVG2 1TP6A 1D6UA 1OHPA 4HM7B 3LMLA 4IPBA 1EA2A 1LVNA 2CC3A 4EBGA 1Q814 4N6TA 3PGBA 3I0YA 4HM3B 1EG9B 4N6MA 4EV5A 4LZIA 4N6OB 2BMRB 2YX9A 4K90B 4RBNA 3VF1A 2LQVA 3NHXA 3DXOA 3MG1A 1SJWA 4X2HA 1MNLA 4X2OA 5FGOA 1PU4A 2W9PA 3NQYA 2RSXA 2Y74A 2B24B 2XSHB 1VQO3 3M8CA 5AIIA 3ALAA 4Q53A 2LYXA 2QIYA 2PZVA 2BMOB 3CCE3 1EKMA 4EV2A 2W56A 5EQLA 3T0UA 4BTYA 2W9QA 1Q864 1YI23 1JN5A 5AYSC 2IA7A 1GY5A 3Q90A 3T8NA 2STDA 1W01A 1JB2A 1HU9A 1TUHA 3G16A 4OK0A 2PNCA 1L5GB 4XBYA 1RKYA 3JUQA 1W2ZA 3WODG 1W00A 5BXQA 3K0ZA 4HM6B 3NQZA 2K54A 3FZWA 1N8R4 1DMMA 3GRDA 5CF1A 2KCDA 3G4S3 3RGRA 2O9UX 4LGQA 3UL5A 2GBWB 1YGEA 4FR9A 4O02B 3E99A 4H61A 4RZMA 3X3YA 4JF8A 3GZBA 2Z77A 2GEXA 3LTBA 1IVWA 3CC23 3SLUA 5IG3A 2CFDA 1LXEA 3EBYA 3TDGA 5IG0A 2WGQA 2QEX3 2BMQB 1N9JA 1GD4A 1ULIB 1IU7A 1UI7A 5IG4A 1OHSA 2JDIH 3OWSA 3F8HA 1M1XB 3CCM3 5DRVA 1A2VA 1AVLA 1IVXA 4GL6A 1OGZA 2GU1A 3S27A 2XEPA 1OPYA 1O7MB 4WYKA 3FH1A 2GEYA 3LTAA 1W6GA 5CF2A 2BNGA 1DVCA 1S723 4KFDA 1WQLB 3CCV3 4XDWA 5LC7A 3BNEA 1VQM3 1YIT3 3LT9A 1J2BA 4WWUC 1U8CB 2WGOA 3DGLA 3JUPA 2BHMA 1HKXA 1N8QA 4K1VA 1JKGA 4EYCA 4J8TA 1LOXA 1W02A 1F8NA 2RFRA 4L8OA 4O3VA 3SXXA 4R1KA 1N5PA 2CG0A 3NM2A 1O7GB 4OVMA 1YJW3 1GY7A 3K5TA 2CWVA 3DY5A 3X40A 1FGMA 2F99A 4JRFA 4PEJA 2XSOB 3FG4A 1OCVA 2XGLA 2XFSA 3CC73 2INXA 3PXMA 1W7CA 3LOYA 5DREA 4FMDA 8CHOA 1QAKA 4RNZA 5ELUA 5CK6A 1CYUA 3K7CA 1A2KA 3HIIA 1FGOA 4ZM8A 3DGNA 3NBBA 3Q2PA 2OOVC 2GU3A 3U97A 1PFPA 3EQQB 2FGTA 3GZRA 4L8PA 1W4NA 4HM5B 4MEIA 2CFWA 4HM0B 1YJ93 1RRHA 2CWUA 3BLZA 4HZBB 1W6YA 4HJLB 1VQ63 1E3RA 1OGXA 3F8XA 5FW5A 3STDA 4MMZB 4KFFA 4MMXB 1ROAA 1U5OA 3DUKA 2P0XA 2MC8A 1QMAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EC6 A;  3UB1 A; 
#chains in the Genus database with same CATH topology
 1FGT A;  4EXR A;  3OWU A;  3UL6 A;  3CCR 3;  2W03 A;  3DGM A;  5KP1 A;  3KSE D;  1ZX2 A;  1AVK A;  2ZL8 A;  2MF7 A;  4KVH A;  2WOH A;  3F7S A;  2C10 A;  1WMN A;  3ZG0 A;  1CQS A;  3G8Z A;  3FSD A;  3VGN A;  2Q07 A;  1K8A 4;  1BAO A;  3EHC A;  2K0M A;  3A5E A;  3OWY A;  4FCJ A;  1OF5 B;  2ZHX B;  4XB5 A;  1B2Z A;  1TU5 A;  3V98 A;  3HOH A;  4HKV B;  1JRQ A;  1IQY A;  1MGW A;  3EC9 A;  2V1L A;  2OOV A;  1FA3 A;  1BRH A;  1JZD A;  4HM4 B;  5HOH A;  1DET A;  1CH0 A;  2HMK B;  3MG2 A;  2W6J H;  3SX1 A;  5IF6 A;  1JBR A;  1BSC A;  3HX8 A;  1I2G A;  3EB8 A;  1W6C A;  2A15 A;  3KE7 A;  1IQ8 A;  1MWU A;  3PS8 A;  5AIF A;  2OTJ 3;  2E2T A;  2ML5 A;  1JB5 A;  3CD6 3;  4BL3 A;  4R9L A;  1TFO A;  4GB5 A;  2CKF B;  2Y73 A;  3PCR A;  1FW7 A;  1T5Y A;  1RRL A;  3MKI A;  3MYT A;  1VQL 3;  1LQM B;  2GBX B;  2QGU A;  1VQQ A;  1G02 A;  1OF5 A;  2YFJ B;  3DM8 A;  3GAX A;  4N6L A;  1IQX A;  1DYU A;  1GD3 A;  3N54 B;  2GXF A;  2BT3 A;  3LTD A;  1W5Z A;  1UUV B;  1Q7H A;  3RGA A;  2CFL A;  1STD A;  3FLJ A;  4O2H A;  1W2B 2;  1FUW A;  2KF4 A;  3NBJ A;  1O7N B;  4CJN A;  1EEJ A;  1Q40 B;  2BU4 A;  1UCJ A;  2BIR A;  2IMJ A;  3F9S A;  4TX4 A;  4U13 A;  3UJM A;  1Q82 4;  4FMC A;  1V57 A;  1E3V A;  5HGR A;  2CIU A;  2SBL A;  5JPP A;  3FG1 A;  1GYB A;  1I2F A;  1VQ7 3;  3G71 3;  1AV4 A;  2XH9 A;  3IMA B;  1VQ4 3;  2CFK A;  3LZA A;  1KSI A;  3HIG A;  4CCV A;  1Q42 A;  3WA3 A;  3D5G A;  4N6U A;  1N9E A;  1RJO A;  1UUG B;  2XRX B;  3MSO A;  5JPU A;  3SED A;  1NNV A;  2P38 A;  1OUN A;  1T2H A;  5G1L A;  2F4Y A;  3MHE A;  1VQP 3;  1T2I A;  3NM7 A;  1RN7 A;  3J7Y d;  5IER A;  5ELJ A;  3O8Y A;  3H51 A;  3LTC A;  1UW1 A;  2XFT A;  3DH2 A;  1TJD A;  2IUK A;  1VZZ A;  3WMD A;  1TTO A;  5KP4 A;  3URP A;  3ER7 A;  2KRT A;  2FXT A;  1AR0 A;  1RSN A;  3S28 A;  1KC8 4;  2H0H A;  3KFQ C;  1Z1S A;  1DE3 A;  1KQS 2;  1RHL A;  3G6E 3;  1AQZ A;  2Z6B A;  1JNQ A;  4KT3 B;  3HK4 A;  4BU4 A;  2XF3 A;  2H0G A;  1NB3 I;  4FMA A;  3D3L A;  3Q1C A;  5EVH A;  5TGN A;  7STD A;  1BRN L;  3FF0 A;  4I4K A;  2CG1 A;  3VSY A;  1RNT A;  4XBT A;  1NWW A;  1NB5 I;  3LH4 A;  5G2G A;  2F86 B;  3CNM A;  5AEW B;  5BIR A;  4FMB A;  1IV7 A;  1BGS A;  1OH0 A;  4HZ9 B;  3JUN A;  3KN4 A;  1NU3 A;  2D42 A;  1YIJ 3;  4HM2 B;  3X41 A;  1YHQ 3;  1RGE A;  1CEW I;  2CX1 A;  3WOF B;  3D5I A;  3LT8 A;  3QK9 A;  3MWZ A;  3CPW 2;  2R41 A;  3QRD A;  3D9R A;  1V74 A;  1YGW A;  1IK3 A;  1KD1 4;  3NX0 A;  4R4K A;  5IEP A;  3BU4 A;  3ZG5 A;  2CWT A;  2OCT A;  1I0V A;  4EC6 A;  1VQ5 3;  1TIJ A;  1GS3 A;  5I97 A;  1EUI C;  3BB9 A;  3OX9 A;  5AI1 A;  6STD A;  1JB4 A;  2KXG A;  2XGN A;  3F14 A;  3LXU X;  5IW9 A;  3CXC 2;  3WA2 X;  2D1W A;  3EN8 A;  4NRE A;  2F5M A;  2ML6 A;  4N3V A;  1RGA A;  4KZ1 A;  5D81 A;  3B8L A;  2KF6 A;  1BU4 A;  3OW2 2;  2Z7A A;  1A67 A;  1RLS A;  4N6N B;  4CPK A;  4RNT A;  1RTU A;  3X42 A;  4KFE A;  4WFO A;  4WHA A;  3WR2 A;  2AAD A;  1VQ8 3;  1VQ9 3;  1QJG A;  2P09 A;  1SQW A;  4L7K A;  1IVU A;  1B3S A;  4R9K A;  1IT8 A;  1RDS A;  3WOE B;  4K61 A;  2W56 B;  1B2S A;  1MWR A;  3JUO A;  5LC6 A;  2RCD A;  2E2U A;  1NDO B;  1AY7 A;  1MWS A;  5AIH A;  1JN5 B;  3A76 A;  3IPT A;  3GSP A;  4XDV A;  1M90 4;  2ZA4 A;  3B7C A;  5STD A;  4CDL A;  3OV4 A;  1BUJ A;  1GY6 A;  2IUJ A;  4LEH A;  3EX9 A;  2OQE C;  1WNH A;  4LSO A;  1O7W B;  1R4C A;  1JJ2 2;  1US1 A;  3NBR A;  1NO3 A;  5CLK A;  2Z76 A;  1QAF A;  1UDI I;  1UCI A;  4I5Q A;  4MMY B;  5A0O B;  1M1K 4;  1UGH I;  1HYF A;  3S5C A;  4AKZ A;  3DZL A;  4AEQ A;  1CYV A;  2JQ5 A;  4STD A;  1BNJ A;  2UX0 A;  1D6Y A;  1FZU A;  2I9W A;  2W2C A;  2HMN B;  2WO0 A;  2C11 A;  3KII A;  3S67 A;  4AKY A;  1G96 A;  1C7H A;  3ECF A;  4MJD A;  4XBX A;  1ASK A;  1DMQ A;  4QWT A;  1N5H A;  3B4P A;  3CCU 3;  1SAR A;  1BRI A;  3KSP A;  4IIA A;  1VQK 3;  2P05 A;  3H3H A;  3U1W A;  2CK3 H;  1I0X A;  5AEU B;  1SII A;  3HI7 A;  4HBR A;  1X1U A;  3N9H A;  1JZO A;  1O7H B;  3NV0 B;  2B1X B;  3PYJ A;  1GMR A;  3BNB A;  1S5A A;  3F7X A;  4O8S A;  4FCM A;  1B27 A;  5M19 A;  5KP3 A;  2RGQ A;  3X3X A;  3CNX A;  2UGI A;  1WTH A;  3PCS A;  1RGF A;  4IT7 A;  1YVB I;  3CC4 3;  2UUG C;  2OQE A;  1SIH A;  3CCL 3;  1GMQ A;  1ROV A;  3AGO A;  1OHO A;  1FGQ A;  4G1M B;  2CFG A;  3EJV A;  4OUQ A;  3MPH A;  4RNY A;  1BNG A;  3BNC A;  4WYK B;  1QVF 2;  3MG3 A;  3GZY B;  3PZW A;  3EF8 A;  3EBT A;  1K73 4;  5RNT A;  2W0Q A;  2ZDJ A;  3EN1 B;  3ZFZ A;  2E2V A;  4HOH A;  3V92 A;  1BNS A;  1TFK A;  4N6V 0;  1SPU A;  1K9M 4;  2R4I A;  1V58 A;  3NV0 A;  3CMA 3;  1IVV A;  3WDG B;  3FKA A;  3SYU A;  5IG5 A;  1BSE A;  1JKG B;  1Q40 A;  3SVA A;  1QAL A;  2L4V A;  3T8U A;  3FCS B;  3N8B A;  2K3D A;  3SOY A;  2HMO B;  5M18 A;  4WP5 A;  1KWI A;  2HMM B;  1LOV A;  3X3Z A;  1D6Z A;  4HYZ A;  4ORL A;  4NHF A;  2XR8 B;  4BTW A;  1I3I A;  3AHW A;  3OXA A;  4HVN A;  4DKI A;  1BNE A;  2WOF A;  4FCZ A;  1A2P A;  3RDE A;  4J9A A;  5EEO A;  1M9G A;  1JV2 B;  3LYG A;  1STF I;  1LOW A;  5JBS A;  4HAA A;  1IT7 A;  1O7P B;  1GOY A;  3FG3 A;  2YFI B;  5D83 A;  1LNI A;  2CW9 A;  2FNQ A;  1FGR A;  3CPO A;  3IJE B;  1BUQ A;  4BIR A;  4H3U A;  2M7O A;  3HZP A;  3CCS 3;  1T3B A;  3V99 A;  4HM1 B;  1RGK A;  1K28 A;  2W04 A;  3KKG A;  2O3O A;  2J8X B;  1I70 A;  1MOL A;  3CME 3;  1Q7Y 4;  3B4O A;  3DGY A;  1EQK A;  1X1X A;  3EE1 A;  3SOA A;  3GWR A;  1WMO A;  3JVC A;  1ULJ B;  3KZT A;  1B2U A;  1DMN A;  7GSP A;  5AIG A;  4BTX A;  2OTL 3;  2L1S A;  3S29 A;  3AMO B;  3NUV A;  1UI8 A;  3UNL A;  1BSB A;  2HMJ B;  3GZX B;  5BVB A;  1BAN A;  1B21 A;  1DVD A;  2RBI A;  4J5G A;  5CXO A;  3K63 A;  5BU4 A;  4K1U A;  3L0R A;  2OWP A;  2CH9 A;  1IYY A;  3I56 3;  1LNH A;  4LYL B;  5IEO A;  1GOV A;  3CCQ 3;  3JUM A;  4R80 A;  3FF2 A;  1YJN 3;  2YFL B;  3CU3 A;  1NJI 4;  2P0M A;  4XM4 A;  1UUW B;  2F98 A;  3NXJ A;  1VQN 3;  1ZO2 A;  1GOU A;  1WMP A;  2HOH A;  2SAR A;  3UB1 A;  1IDP A;  1RGH A;  1IV9 A;  1I3F A;  1A90 A;  5AYR B;  3DMC A;  3G0K A;  3FGY A;  3CCJ 3;  3I55 3;  1E97 A;  1OAC A;  3F40 A;  1BRG A;  1BSA A;  1Y4K A;  2CHC A;  1RGG A;  2HML B;  1C54 A;  3K9M C;  1ISK A;  3DGO A;  3ROB A;  1RN1 A;  2QA4 3;  3AMO A;  1BRK A;  4LMI A;  3BND A;  1GSP A;  4HM8 B;  2BO9 B;  5D82 A;  1K41 A;  1QVG 2;  1B20 A;  1TP6 A;  1D6U A;  1OHP A;  2KF3 A;  4HM7 B;  3RNT A;  3LML A;  4IPB A;  1EA2 A;  1LVN A;  6RNT A;  2CC3 A;  4J5K A;  4EBG A;  1Q81 4;  4N6T A;  3PGB A;  3I0Y A;  4HM3 B;  1EG9 B;  4N6M A;  4EV5 A;  4LZI A;  4N6O B;  2BMR B;  2YX9 A;  1PY3 A;  1UCL A;  4K90 B;  4RBN A;  1BVI A;  1GMP A;  2LQV A;  3NHX A;  3VF1 A;  3DXO A;  3MG1 A;  1SJW A;  1FUS A;  4X2H A;  1MNL A;  4X2O A;  5FGO A;  7RNT A;  1PU4 A;  1RGC A;  2F56 A;  2W9P A;  3NQY A;  2RSX A;  1I2E A;  2B24 B;  2XSH B;  2F5W A;  2Y74 A;  1VQO 3;  2KAA A;  3M8C A;  5AII A;  3ALA A;  4Q53 A;  1YVS A;  1RCK A;  2LYX A;  2QIY A;  2PZV A;  4GSP A;  2BMO B;  3CCE 3;  2RNT A;  1EKM A;  4EV2 A;  2W56 A;  5EQL A;  3T0U A;  4BTY A;  2CX0 A;  3Q3F A;  2W9Q A;  1Q86 4;  1YI2 3;  1UGI A;  1JN5 A;  5AYS C;  2IA7 A;  1GY5 A;  3Q90 A;  3T8N A;  2STD A;  1TRQ A;  1JB2 A;  1W01 A;  3WHO A;  1HU9 A;  1TUH A;  3G16 A;  4OK0 A;  5IEN A;  2PNC A;  1HZ1 A;  4GHO A;  1FUT A;  1L5G B;  4XBY A;  1RKY A;  1X1Y A;  2C4B A;  1W2Z A;  3JUQ A;  4NPB A;  1W00 A;  3WOD G;  3K0Z A;  5BXQ A;  1PYL A;  3BIR A;  3NQZ A;  4HM6 B;  1UCK A;  2K54 A;  3FZW A;  1N8R 4;  1DMM A;  1LRA A;  3GRD A;  5CF1 A;  2KCD A;  1B2M A;  3G4S 3;  2H0I A;  3RGR A;  3AGN A;  1Q9E A;  2O9U X;  4LGQ A;  3UL5 A;  2GBW B;  8RNT A;  1YGE A;  3D4A A;  4FR9 A;  4O02 B;  3E99 A;  1BOX A;  4H61 A;  4RZM A;  3X3Y A;  4JF8 A;  3GZB A;  5GSP A;  2Z77 A;  2GEX A;  3LTB A;  1IVW A;  3CC2 3;  3SLU A;  5IG3 A;  1MWT A;  2CFD A;  1LXE A;  3EBY A;  3TDG A;  5IG0 A;  2WGQ A;  2QEX 3;  2BMQ B;  1N9J A;  1GD4 A;  1ULI B;  1IU7 A;  1UI7 A;  5M1A A;  2GSP A;  5IG4 A;  2KF5 A;  1OHS A;  2JDI H;  3OWS A;  3F8H A;  1M1X B;  3CCM 3;  5DRV A;  1A2V A;  1AVL A;  1IVX A;  4ILF A;  1RMS A;  4GL6 A;  1OGZ A;  2GU1 A;  3S27 A;  2XEP A;  1OPY A;  1RCL A;  1O7M B;  4WYK A;  1RNB A;  3FH1 A;  1TRP A;  2GEY A;  1W6G A;  3LTA A;  5G1K A;  1I8V A;  5CF2 A;  2BNG A;  2IYJ A;  1DVC A;  1BNI A;  1S72 3;  4KFD A;  1WQL B;  2AAE A;  3CCV 3;  4XDW A;  1BSD A;  5LC7 A;  3BNE A;  1VQM 3;  1LOY A;  1YIT 3;  3LT9 A;  1J2B A;  4WWU C;  1U8C B;  2WGO A;  3DGL A;  3JUP A;  2BHM A;  1HKX A;  1N8Q A;  3D79 A;  1ZS7 A;  4K1V A;  1JKG A;  4EYC A;  3KCH A;  4J8T A;  1LOX A;  1W02 A;  1F8N A;  2RFR A;  4L8O A;  1RN4 A;  4O3V A;  3SXX A;  4R1K A;  1N5P A;  2CG0 A;  3NM2 A;  1G0T A;  1O7G B;  4OVM A;  1YJW 3;  1GY7 A;  3K5T A;  2CWV A;  3DY5 A;  3X40 A;  1FGM A;  2F99 A;  9RNT A;  4JRF A;  4PEJ A;  2XSO B;  3FG4 A;  1OCV A;  2XGL A;  1BNF A;  1BNR A;  2XFS A;  3CC7 3;  2INX A;  3PXM A;  1W7C A;  3LOY A;  5DRE A;  1FYS A;  1BRS A;  4BL2 A;  4FMD A;  1JBS A;  8CHO A;  1R4Y A;  1QAK A;  4RNZ A;  5ELU A;  2IY2 A;  5CK6 A;  1CYU A;  3K7C A;  1A2K A;  3HII A;  1FGO A;  3AHS A;  1YNV X;  4ZM8 A;  1ZGX A;  3DGN A;  3NBB A;  3Q2P A;  2OOV C;  2GU3 A;  3U97 A;  1PFP A;  1RGL A;  3EQQ B;  4EW5 A;  2FGT A;  3GZR A;  1B2X A;  1BIR A;  4L8P A;  1W4N A;  4HM5 B;  4MEI A;  2CFW A;  4HM0 B;  1X1W A;  1YJ9 3;  1RRH A;  2CWU A;  3BLZ A;  4HZB B;  1W6Y A;  4HJL B;  1VQ6 3;  1E3R A;  1OGX A;  3F8X A;  5FW5 A;  3STD A;  1MGR A;  1LQG C;  4MMZ B;  4KFF A;  4MMX B;  1ROA A;  1U5O A;  1JBT A;  6GSP A;  3DUK A;  2P0X A;  1BRJ A;  2MC8 A;  1QMA A; 
#chains in the Genus database with same CATH homology
 1FGT A;  4EXR A;  3OWU A;  3UL6 A;  3CCR 3;  2W03 A;  3DGM A;  5KP1 A;  3KSE D;  1ZX2 A;  1AVK A;  2ZL8 A;  2MF7 A;  4KVH A;  2WOH A;  3F7S A;  2C10 A;  1WMN A;  1CQS A;  3G8Z A;  3FSD A;  3VGN A;  2Q07 A;  1K8A 4;  3EHC A;  2K0M A;  3OWY A;  4FCJ A;  1OF5 B;  4XB5 A;  1TU5 A;  3V98 A;  4HKV B;  1JRQ A;  1IQY A;  3EC9 A;  2V1L A;  2OOV A;  1FA3 A;  4HM4 B;  2HMK B;  3MG2 A;  2W6J H;  3SX1 A;  5IF6 A;  3HX8 A;  3EB8 A;  1W6C A;  2A15 A;  3KE7 A;  1IQ8 A;  3PS8 A;  5AIF A;  2OTJ 3;  2E2T A;  2ML5 A;  1JB5 A;  3CD6 3;  4R9L A;  1TFO A;  4GB5 A;  2CKF B;  2Y73 A;  3PCR A;  1T5Y A;  1RRL A;  3MKI A;  3MYT A;  1VQL 3;  2GBX B;  2QGU A;  1OF5 A;  2YFJ B;  3GAX A;  3DM8 A;  4N6L A;  3SOY A;  1IQX A;  1DYU A;  1GD3 A;  3N54 B;  2GXF A;  2BT3 A;  3LTD A;  1W5Z A;  1UUV B;  3RGA A;  2CFL A;  1STD A;  3FLJ A;  4O2H A;  1W2B 2;  1FUW A;  3NBJ A;  1O7N B;  1Q40 B;  3F9S A;  3UJM A;  4U13 A;  2IMJ A;  1Q82 4;  4TX4 A;  4FMC A;  1E3V A;  5HGR A;  2CIU A;  2SBL A;  5JPP A;  3FG1 A;  1GYB A;  1VQ7 3;  3G71 3;  1AV4 A;  2XH9 A;  3IMA B;  1VQ4 3;  2CFK A;  3LZA A;  1KSI A;  3HIG A;  4CCV A;  1Q42 A;  3WA3 A;  4N6U A;  1N9E A;  1RJO A;  2XRX B;  3MSO A;  5JPU A;  3SED A;  2P38 A;  1OUN A;  3MHE A;  1VQP 3;  3NM7 A;  1RN7 A;  3J7Y d;  5IER A;  5ELJ A;  3O8Y A;  3H51 A;  3LTC A;  1UW1 A;  2XFT A;  2IUK A;  1VZZ A;  3WMD A;  5KP4 A;  3ER7 A;  2KRT A;  2FXT A;  1AR0 A;  3S28 A;  1KC8 4;  3KFQ C;  1Z1S A;  1KQS 2;  3G6E 3;  2Z6B A;  1JNQ A;  3HK4 A;  2XF3 A;  1NB3 I;  4FMA A;  3D3L A;  3Q1C A;  5EVH A;  5TGN A;  7STD A;  3FF0 A;  4I4K A;  2CG1 A;  3VSY A;  4XBT A;  1NWW A;  1NB5 I;  3LH4 A;  5G2G A;  2F86 B;  3CNM A;  5AEW B;  4FMB A;  1IV7 A;  1OH0 A;  4HZ9 B;  3JUN A;  3KN4 A;  1NU3 A;  2D42 A;  1YIJ 3;  4HM2 B;  3X41 A;  1YHQ 3;  1CEW I;  3WOF B;  3LT8 A;  3QK9 A;  3MWZ A;  3CPW 2;  3QRD A;  3D9R A;  1V74 A;  1KD1 4;  1IK3 A;  3NX0 A;  4R4K A;  5IEP A;  2CWT A;  2OCT A;  4EC6 A;  1VQ5 3;  1TIJ A;  1GS3 A;  5I97 A;  3OX9 A;  3BB9 A;  5AI1 A;  6STD A;  1JB4 A;  2KXG A;  2XGN A;  3F14 A;  3LXU X;  5IW9 A;  3CXC 2;  3WA2 X;  2D1W A;  3EN8 A;  4NRE A;  2ML6 A;  4N3V A;  4KZ1 A;  5D81 A;  3B8L A;  3OW2 2;  2Z7A A;  1A67 A;  4N6N B;  3X42 A;  4KFE A;  4WFO A;  4WHA A;  1VQ8 3;  1VQ9 3;  1QJG A;  2P09 A;  1SQW A;  4L7K A;  1IVU A;  4R9K A;  1IT8 A;  3WOE B;  4K61 A;  2W56 B;  5LC6 A;  3JUO A;  2RCD A;  2E2U A;  1NDO B;  5AIH A;  1JN5 B;  3A76 A;  3IPT A;  4XDV A;  1M90 4;  3B7C A;  5STD A;  4CDL A;  3OV4 A;  1GY6 A;  2IUJ A;  4LEH A;  3EX9 A;  2OQE C;  1WNH A;  4LSO A;  1O7W B;  1R4C A;  1JJ2 2;  1US1 A;  3NBR A;  1NO3 A;  5CLK A;  2Z76 A;  1QAF A;  5A0O B;  4MMY B;  1M1K 4;  3S5C A;  4AKZ A;  3DZL A;  4AEQ A;  1CYV A;  2JQ5 A;  4STD A;  2UX0 A;  1D6Y A;  2I9W A;  2W2C A;  2HMN B;  2WO0 A;  2C11 A;  3KII A;  3S67 A;  4AKY A;  1G96 A;  1C7H A;  3ECF A;  4MJD A;  4XBX A;  1ASK A;  1DMQ A;  4QWT A;  1N5H A;  3B4P A;  3CCU 3;  3KSP A;  4IIA A;  1VQK 3;  2P05 A;  3H3H A;  3U1W A;  2CK3 H;  5AEU B;  1SII A;  3HI7 A;  4HBR A;  3N9H A;  1O7H B;  3NV0 B;  2B1X B;  3PYJ A;  3BNB A;  1S5A A;  3F7X A;  4O8S A;  4FCM A;  5KP3 A;  2RGQ A;  3X3X A;  3CNX A;  3PCS A;  1WTH A;  4IT7 A;  1YVB I;  3CC4 3;  2OQE A;  1SIH A;  3CCL 3;  1ROV A;  4G1M B;  1OHO A;  1FGQ A;  4OUQ A;  2CFG A;  3EJV A;  4RNY A;  3MPH A;  5IEN A;  3BNC A;  4WYK B;  1QVF 2;  3MG3 A;  3GZY B;  3PZW A;  3EF8 A;  3EBT A;  1K73 4;  2W0Q A;  2ZDJ A;  3EN1 B;  2E2V A;  3V92 A;  1TFK A;  4N6V 0;  1SPU A;  1K9M 4;  2R4I A;  3NV0 A;  3CMA 3;  1IVV A;  3WDG B;  3FKA A;  5IG5 A;  1JKG B;  1Q40 A;  3SVA A;  1QAL A;  2L4V A;  3T8U A;  3FCS B;  3N8B A;  2HMO B;  4WP5 A;  1KWI A;  2HMM B;  3X3Z A;  1D6Z A;  4HYZ A;  4ORL A;  4NHF A;  2XR8 B;  4BTW A;  4HVN A;  3OXA A;  2WOF A;  4FCZ A;  3RDE A;  4J9A A;  5EEO A;  1M9G A;  1JV2 B;  3LYG A;  1STF I;  5JBS A;  1IT7 A;  1O7P B;  3FG3 A;  2YFI B;  5D83 A;  2CW9 A;  2FNQ A;  1FGR A;  3CPO A;  3IJE B;  1BUQ A;  4H3U A;  2M7O A;  3HZP A;  3CCS 3;  3V99 A;  4HM1 B;  1K28 A;  2W04 A;  3KKG A;  2O3O A;  3CME 3;  1MOL A;  1Q7Y 4;  3B4O A;  1EQK A;  3EE1 A;  3SOA A;  3GWR A;  1WMO A;  3JVC A;  1ULJ B;  3KZT A;  1DMN A;  5AIG A;  4BTX A;  2OTL 3;  3S29 A;  3AMO B;  3NUV A;  1UI8 A;  3UNL A;  2HMJ B;  3GZX B;  5BVB A;  1DVD A;  5CXO A;  3K63 A;  4K1U A;  3L0R A;  2OWP A;  2CH9 A;  3I56 3;  1LNH A;  5IEO A;  3CCQ 3;  3JUM A;  4R80 A;  3FF2 A;  1YJN 3;  2YFL B;  3CU3 A;  1NJI 4;  2P0M A;  4XM4 A;  1UUW B;  2F98 A;  3NXJ A;  1VQN 3;  1ZO2 A;  1WMP A;  3UB1 A;  1IDP A;  1IV9 A;  1A90 A;  5AYR B;  3DMC A;  3G0K A;  3FGY A;  3CCJ 3;  3I55 3;  1E97 A;  1OAC A;  3F40 A;  1Y4K A;  2CHC A;  2HML B;  3K9M C;  1ISK A;  3DGO A;  3ROB A;  2QA4 3;  3AMO A;  4LMI A;  3BND A;  4HM8 B;  2BO9 B;  5D82 A;  1K41 A;  1QVG 2;  1TP6 A;  1D6U A;  1OHP A;  4HM7 B;  3LML A;  4IPB A;  1EA2 A;  1LVN A;  2CC3 A;  4EBG A;  1Q81 4;  4N6T A;  3PGB A;  3I0Y A;  4HM3 B;  1EG9 B;  4N6M A;  4EV5 A;  4LZI A;  4N6O B;  2BMR B;  2YX9 A;  4K90 B;  4RBN A;  3VF1 A;  2LQV A;  3NHX A;  3DXO A;  3MG1 A;  1SJW A;  4X2H A;  1MNL A;  4X2O A;  5FGO A;  1PU4 A;  2W9P A;  3NQY A;  2RSX A;  2Y74 A;  2B24 B;  2XSH B;  1VQO 3;  3M8C A;  5AII A;  3ALA A;  4Q53 A;  2LYX A;  2QIY A;  2PZV A;  2BMO B;  3CCE 3;  1EKM A;  4EV2 A;  2W56 A;  5EQL A;  3T0U A;  4BTY A;  2W9Q A;  1Q86 4;  1YI2 3;  1JN5 A;  5AYS C;  2IA7 A;  1GY5 A;  3Q90 A;  3T8N A;  2STD A;  1W01 A;  1JB2 A;  1HU9 A;  1TUH A;  3G16 A;  4OK0 A;  2PNC A;  1L5G B;  4XBY A;  1RKY A;  3JUQ A;  1W2Z A;  3WOD G;  1W00 A;  5BXQ A;  3K0Z A;  4HM6 B;  3NQZ A;  2K54 A;  3FZW A;  1N8R 4;  1DMM A;  3GRD A;  5CF1 A;  2KCD A;  3G4S 3;  3RGR A;  2O9U X;  4LGQ A;  3UL5 A;  2GBW B;  1YGE A;  4FR9 A;  4O02 B;  3E99 A;  4H61 A;  4RZM A;  3X3Y A;  4JF8 A;  3GZB A;  2Z77 A;  2GEX A;  3LTB A;  1IVW A;  3CC2 3;  3SLU A;  5IG3 A;  2CFD A;  1LXE A;  3EBY A;  3TDG A;  5IG0 A;  2WGQ A;  2QEX 3;  2BMQ B;  1N9J A;  1GD4 A;  1ULI B;  1IU7 A;  1UI7 A;  5IG4 A;  1OHS A;  2JDI H;  3OWS A;  3F8H A;  1M1X B;  3CCM 3;  5DRV A;  1A2V A;  1AVL A;  1IVX A;  4GL6 A;  1OGZ A;  2GU1 A;  3S27 A;  2XEP A;  1OPY A;  1O7M B;  4WYK A;  3FH1 A;  2GEY A;  3LTA A;  1W6G A;  5CF2 A;  2BNG A;  1DVC A;  1S72 3;  4KFD A;  1WQL B;  3CCV 3;  4XDW A;  5LC7 A;  3BNE A;  1VQM 3;  1YIT 3;  3LT9 A;  1J2B A;  4WWU C;  1U8C B;  2WGO A;  3DGL A;  3JUP A;  2BHM A;  1HKX A;  1N8Q A;  4K1V A;  1JKG A;  4EYC A;  4J8T A;  1LOX A;  1W02 A;  1F8N A;  2RFR A;  4L8O A;  4O3V A;  3SXX A;  4R1K A;  1N5P A;  2CG0 A;  3NM2 A;  1O7G B;  4OVM A;  1YJW 3;  1GY7 A;  3K5T A;  2CWV A;  3DY5 A;  3X40 A;  1FGM A;  2F99 A;  4JRF A;  4PEJ A;  2XSO B;  3FG4 A;  1OCV A;  2XGL A;  2XFS A;  3CC7 3;  2INX A;  3PXM A;  1W7C A;  3LOY A;  5DRE A;  4FMD A;  8CHO A;  1QAK A;  4RNZ A;  5ELU A;  5CK6 A;  1CYU A;  3K7C A;  1A2K A;  3HII A;  1FGO A;  4ZM8 A;  3DGN A;  3NBB A;  3Q2P A;  2OOV C;  2GU3 A;  3U97 A;  1PFP A;  3EQQ B;  2FGT A;  3GZR A;  4L8P A;  1W4N A;  4HM5 B;  4MEI A;  2CFW A;  4HM0 B;  1YJ9 3;  1RRH A;  2CWU A;  3BLZ A;  4HZB B;  1W6Y A;  4HJL B;  1VQ6 3;  1E3R A;  1OGX A;  3F8X A;  5FW5 A;  3STD A;  4MMZ B;  4KFF A;  4MMX B;  1ROA A;  1U5O A;  3DUK A;  2P0X A;  2MC8 A;  1QMA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...