1A67A

Chicken egg white cystatin wildtype, nmr, 16 structures
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
108
structure length
108
Chain Sequence
GAPVPVDENDEGLQRALQFAMAEYNRASNDKYSSRVVRVISAKRQLVSGIKYILQVEIGRTTCPKSSGDLQSCEFHDEPEMAKYTTCTFVVYSIPWLNQIKLLESKCQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structures of native phosphorylated chicken cystatin and of a recombinant unphosphorylated variant in solution.
pubmed doi rcsb
molecule tags Proteinase inhibitor
molecule keywords CYSTATIN
total genus 13
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 1998-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1a67A00
1GD3A 2W9PA 1STFI 3L0RA 3NX0A 4N6TA 1MNLA 4N6UA 1KWIA 3PXMA 4N6LA 2BO9B 4N6NB 3KSED 1IV9A 3UL6A 4CCVA 1CYVA 2KXGA 5LC6A 1CYUA 1FUWA 1MOLA 3PYJA 5A0OB 4ZM8A 3MWZA 3IMAB 1A90A 1YVBI 3GAXA 1WNHA 1FA3A 1IV7A 1PFPA 1TIJA 4N6V0 4LZIA 1CEWI 1R4CA 1GD4A 1ROAA 3KFQC 3LH4A 1DVCA 3PS8A 1M9GA 3QRDA 1A67A 2W9QA 2O9UX 1NB3I 1LXEA 4EYCA 1NB5I 1EQKA 1N5PA 4TX4A 5ELUA 3Q2PA 1DVDA 4N6OB 1RN7A 3K9MC 5ELJA 5EQLA 1G96A 3S67A 2OCTA 1N9JA 4N6MA 3UL5A 2CH9A 4IT7A 5LC7A 3SVAA 1N5HA
chains in the Genus database with same CATH superfamily
4X2HA 4DKIA 4HM5B 2C4BA 4N6LA 2ML6A 3KSED 2AADA 1FGQA 3B8LA 5LC6A 5TGNA 2BT3A 3U1WA 1TU5A 1WTHA 3MSOA 1Q864 1Q824 3NUVA 1DETA 4FMDA 4H3UA 1LQMB 1RNBA 3WA3A 2IUKA 4BL3A 4N3VA 3WOFB 2R4IA 2YFLB 2GSPA 6STDA 2O9UX 1TUHA 2C10A 1LXEA 1T3BA 2QIYA 4EYCA 1JN5A 1W01A 3DGOA 2CX1A 2HMMB 2F99A 4NREA 1RNTA 1VQN3 2WO0A 1W4NA 3SOAA 4GB5A 1X1YA 3ZG0A 4EC6A 1M1K4 2W03A 5EVHA 2K3DA 4HAAA 1M1XB 4HVNA 3GRDA 1MGWA 2QEX3 4GHOA 3Q3FA 4GL6A 2F98A 3GAXA 1SQWA 1ZO2A 1JJ22 1E97A 1S5AA 2OQEC 4HBRA 3D79A 1R4CA 1W2B2 2Q07A 1ZGXA 4BU4A 1HYFA 1EG9B 3BNBA 2QGUA 2BNGA 2IY2A 3GSPA 5I97A 1LQGC 1BUQA 1RGAA 3HX8A 5ELJA 3T8UA 1IVXA 3AHSA 1G96A 4KFFA 3DH2A 3WMDA 1N9JA 3NQZA 5KP1A 1TFOA 3SVAA 1YHQ3 1B2ZA 2P0XA 2W9PA 2W2CA 1UCLA 2RGQA 2OQEA 1LOWA 3BNCA 1GOUA 3NV0A 1QAKA 2UUGC 3EQQB 3BNEA 3KSPA 1UDII 3DZLA 1DMMA 5AIGA 9RNTA 3F40A 3KE7A 1JBSA 1BRHA 1NDOB 2W0QA 3K5TA 3ER7A 3A5EA 3JUOA 3URPA 3OWUA 1QALA 1UI7A 2KF5A 4LZIA 3RGRA 1CEWI 4XB5A 2MF7A 3M8CA 2W9QA 1BNFA 1IVVA 5ELUA 4K61A 1SJWA 1OHOA 1RN7A 1UGHI 1JV2B 3AGNA 5JPPA 3WA2X 3D5IA 4WFOA 2OCTA 1BGSA 2SARA 1RSNA 1G0TA 1BSDA 2ZHXB 3CD63 1AV4A 5IG3A 4N6UA 1VQM3 2BO9B 1BUJA 1KD14 1BNIA 2Z7AA 4WYKA 1GOYA 2KF3A 4XDWA 1CYUA 1O7WB 5AEWB 1HKXA 2B24B 3HZPA 2F4YA 1B2SA 4U13A 4R4KA 1O7GB 4BTWA 1IV7A 2KF6A 1I0VA 3CMA3 3CC43 1LRAA 1RGFA 1D6ZA 1MWUA 4WYKB 4RNTA 4K1UA 4PEJA 3PS8A 3Q90A 1TRQA 2CWUA 1JZDA 3X3ZA 5KP4A 1BSBA 3CU3A 5GSPA 3QK9A 3VSYA 1ULIB 5IG4A 2H0HA 1MGRA 2RSXA 2W56B 1JB4A 2V1LA 1X1WA 1V58A 2YFIB 5M18A 1VQ63 1BNGA 1I2FA 1QVG2 4BL2A 1BNSA 3G8ZA 1F8NA 2IMJA 3N9HA 4FCMA 3D9RA 2INXA 3SYUA 2JQ5A 2L4VA 1VQ93 1IV9A 3JUNA 1NU3A 5CF1A 1B2XA 5IERA 3D4AA 4G1MB 3EJVA 1YNVX 5AI1A 4BTYA 3I563 1US1A 2FXTA 1JB2A 3X40A 1WMPA 1A2PA 7STDA 1YI23 2K54A 1WNHA 1BRKA 1AR0A 1IYYA 1PU4A 1GSPA 3KN4A 6GSPA 2CFKA 3F7XA 4FMAA 1OF5A 1I2EA 1YJW3 1TRPA 3HIIA 1VZZA 4XBYA 4EV2A 1TFKA 1RJOA 1EQKA 5JBSA 1DE3A 2D1WA 1Q814 1IT7A 5HGRA 2FGTA 1FUSA 2WGQA 4EW5A 2QA43 1KC84 3AMOA 2UX0A 4GSPA 3HK4A 2ZA4A 3FG1A 3CCU3 4O8SA 1IQXA 3GZBA 1SPUA 2RFRA 1IU7A 1MOLA 1QAFA 4OVMA 1OCVA 4HKVB 2KRTA 5IW9A 1BAOA 4HOHA 3SLUA 5IEPA 4HM7B 1A90A 1C54A 1X1UA 2OTJ3 1BRSA 3EN8A 3DGLA 3PCRA 5M19A 1DVCA 1JZOA 1V57A 2Y74A 3H51A 4QWTA 2CWVA 2E2VA 2ML5A 1YJ93 1Q42A 1IVUA 3O8YA 1JKGB 2F86B 4L8OA 1YIJ3 1FW7A 2GXFA 1OUNA 2CW9A 1W02A 3ALAA 4IPBA 1V74A 3UL5A 1SIHA 5FGOA 4RBNA 3F9SA 1BU4A 1A2KA 4MMZB 1JBTA 1JN5B 5IENA 3N8BA 1I70A 1HU9A 2GEXA 5IEOA 4CCVA 2RNTA 1IQ8A 1BSCA 3PZWA 3T8NA 1GOVA 2Z76A 5BXQA 1YIT3 1CQSA 3X3XA 4KZ1A 2F5WA 2CK3H 3S29A 4BTXA 1PY3A 2Y73A 2XF3A 1TIJA 1E3VA 1RRHA 5M1AA 3CCQ3 4R80A 1S723 1FGRA 3QRDA 3EHCA 3S28A 1IVWA 3CXC2 4WHAA 1O7MB 4AEQA 4LGQA 3CPW2 3S67A 2GBXB 1RHLA 3DMCA 1B2UA 1UUVB 2PZVA 4KFEA 3G0KA 1IK3A 3OWSA 1FUTA 2YFJB 4BIRA 4HM2B 1OPYA 4CPKA 3MG1A 3ROBA 4WP5A 3CC23 1Q40B 3PXMA 3UL6A 1STDA 1IDPA 2KXGA 2CFDA 3EF8A 3GWRA 1N8R4 2STDA 3LTBA 5A0OB 4JF8A 1AQZA 1AVKA 4LEHA 3HOHA 1LOYA 1UGIA 1YGWA 1YVBI 3CPOA 3EBTA 3VF1A 3EN1B 4NHFA 5D82A 1T2HA 1UW1A 3SEDA 3FG4A 5BVBA 1LVNA 1T2IA 4KVHA 2L1SA 1J2BA 3BU4A 2A15A 1RGLA 4HYZA 5DRVA 5AYRB 2CG1A 3TDGA 3J7Yd 3G4S3 6RNTA 1MWRA 1JNQA 5CXOA 4O02B 4XDVA 4EV5A 1ULJB 1VQ53 3LZAA 2KAAA 3LT8A 2M7OA 3CCE3 1M904 3E99A 3NHXA 1OHPA 5G1LA 8CHOA 1GY7A 2B1XB 4XM4A 3NBRA 1UCIA 1BNRA 1EKMA 3X41A 2R41A 3S27A 1OF5B 1MWSA 3DUKA 2FNQA 1OACA 5EEOA 1Q40A 3G16A 2PNCA 4J5KA 1O7HB 1TP6A 2RBIA 3RNTA 1GD4A 4H61A 1RCLA 1BRIA 1M9GA 3UJMA 3DM8A 3B4PA 1ISKA 4XBXA 3G6E3 3STDA 1GS3A 4X2OA 1IQYA 1W6CA 2XGLA 2Z77A 4XBTA 3B7CA 2CG0A 8RNTA 2HMJB 4O2HA 4J5GA 3IJEB 1FGMA 1I3IA 3K63A 3CCM3 1SIIA 3CCL3 1AVLA 1D6YA 3EBYA 3EE1A 1KQS2 1OHSA 1RGCA 1RRLA 3V98A 1DMQA 4MEIA 3CNXA 1YGEA 5RNTA 2SBLA 1UCJA 1ZS7A 4EXRA 2UGIA 3GZRA 4FCZA 1GMQA 3JVCA 3D3LA 3GZYB 4I4KA 1VQK3 3G713 1R4YA 4OUQA 4STDA 3ZG5A 4MMXB 1DVDA 1UI8A 4HM3B 5IG5A 3NXJA 2BMOB 5D81A 4MJDA 2CH9A 3OXAA 3Q1CA 1RDSA 1T5YA 3NBBA 1U5OA 1VQO3 4ORLA 4KFDA 4R9KA 1OH0A 2CFWA 3FLJA 3OWYA 4FMBA 4N6TA 2GU3A 3EB8A 3FCSB 3HI7A 3S5CA 1B2MA 1GMPA 2CX0A 3CME3 1FUWA 3OW22 1VQ73 5BU4A 4ZM8A 4K90B 5D83A 1W6GA 3LXUX 3IMAB 2LYXA 3LTDA 2GEYA 3A76A 3WHOA 3CC73 1FGTA 5G1KA 1I8VA 1LOXA 1IT8A 3KFQC 1L5GB 1FGOA 1CH0A 1KSIA 2BHMA 5FW5A 1VQ83 1B20A 7RNTA 2YX9A 1B27A 3LTCA 5EQLA 3JUMA 3UB1A 1BSEA 5CF2A 3FH1A 1Y4KA 1RLSA 2H0GA 2JDIH 3JUPA 3KZTA 3NV0B 4MMYB 5LC7A 1A67A 4JRFA 3WOEB 1W00A 1BIRA 1GD3A 1Q7HA 4L7KA 3L0RA 1AY7A 3FZWA 3DY5A 1KWIA 3F8HA 5DREA 2BIRA 1D6UA 1VQP3 2K0MA 5CLKA 1RKYA 3BIRA 2XFSA 1VQL3 3VGNA 3NM7A 1G02A 2HMNB 3KIIA 1I3FA 1K28A 2Z6BA 1C7HA 4LYLB 4R9LA 3U97A 3SXXA 2ZDJA 4N6V0 4HZBB 2I9WA 3PGBA 4CJNA 1ZX2A 1UCKA 2HOHA 1NB3I 1RGEA 1RN1A 1BNEA 2WOHA 3F14A 4IIAA 4J8TA 4RNYA 1BVIA 1OGZA 1WMOA 3AHWA 3LMLA 3FKAA 4N6OB 2IA7A 4FMCA 4NPBA 4WWUC 3CCV3 1PYLA 1UUGB 1BRJA 1W5ZA 1Z1SA 2P09A 2XSOB 2IYJA 3SOYA 3DGNA 1Q7Y4 2D42A 2XFTA 5STDA 2CFLA 1STFI 2BMRB 3MYTA 1BNJA 4CDLA 1ASKA 1I2GA 1RCKA 1EA2A 1E3RA 2F56A 3LT9A 3CCR3 2F5MA 1BRGA 1I0XA 4O3VA 4K1VA 1K41A 1X1XA 3KKGA 4HM6B 3MWZA 3H3HA 5G2GA 1GY5A 3NBJA 4HM1B 5AIFA 5IF6A 2XEPA 1EEJA 2E2TA 3LYGA 3N54B 2E2UA 3ZFZA 1RN4A 3X42A 1ROAA 2J8XB 3LH4A 2KCDA 3CCS3 3B4OA 3IPTA 3MPHA 1BSAA 3K7CA 1Q9EA 2KF4A 3D5GA 3ECFA 2WGOA 3MHEA 3FSDA 5IG0A 3OV4A 3AGOA 1FYSA 3LOYA 3BNDA 4FCJA 4J9AA 4AKZA 1W6YA 1B3SA 2W04A 1N5HA 1NWWA 4HM4B 1N9EA 2H0IA 2OWPA 4OK0A 2OTL3 2C11A 4N6NB 1NJI4 2O3OA 2WOFA 3DGMA 3FGYA 1DYUA 3HIGA 1WMNA 3PYJA 1O7NB 4L8PA 1RMSA 4R1KA 5CK6A 1NO3A 3V99A 1BRNL 3V92A 1FZUA 1W7CA 1JRQA 2CFGA 3I0YA 2MC8A 1PFPA 2HMLB 1B21A 3DXOA 4AKYA 1SARA 2AAEA 3PCSA 1OGXA 3RGAA 1K8A4 2LQVA 4FR9A 1ROVA 4HM0B 3MG3A 3FG3A 4TX4A 4EBGA 3Q2PA 3K9MC 3CNMA 4N6MA 3JUQA 1RGKA 1GMRA 1TTOA 1MNLA 1K9M4 2XH9A 1CYVA 1MWTA 2W6JH 4ILFA 3AMOB 4LSOA 1JBRA 2BMQB 1EUIC 2CC3A 2GU1A 3NQYA 3T0UA 5BIRA 3I553 3GZXB 1UUWB 1O7PB 1HZ1A 1FA3A 4LMIA 2P0MA 1A2VA 1RGHA 2W56A 2CHCA 1VQQA 2P38A 3MKIA 7GSPA 2XSHB 5AYSC 4I5QA 5AEUB 4Q53A 2OOVA 1BANA 1QVF2 1U8CB 1N5PA 5KP3A 5JPUA 2XGNA 1N8QA 1RTUA 2P05A 3MG2A 3EC9A 3RDEA 4RNZA 2HMKB 3F7SA 1NB5I 2RCDA 1BOXA 2BU4A 3FF0A 1GY6A 2CIUA 3NX0A 4HJLB 4KT3B 3WR2A 2XRXB 3K0ZA 3F8XA 3WODG 2OOVC 3NM2A 4RZMA 3X3YA 2CWTA 1LNHA 3BLZA 1NNVA 5AIHA 1K734 1LOVA 1TJDA 1LNIA 1JKGA 1DMNA 2HMOB 3FF2A 4HZ9B 2IUJA 1QJGA 3DGYA 3BB9A 2CKFB 3SX1A 1GYBA 2ZL8A 1YVSA 3LTAA 1WQLB 2XR8B 3WDGB 5HOHA 3OX9A 1RGGA 1QMAA 3EX9A 3KCHA 3CCJ3 5AIIA 2GBWB 1YJN3 4IT7A 4HM8B 3UNLA 1W2ZA 1VQ43 1JB5A
chains in the Genus database with same CATH topology
4X2HA 4HM5B 4N6LA 2ML6A 3KSED 1FGQA 3B8LA 5LC6A 5TGNA 2BT3A 3U1WA 1TU5A 1WTHA 3MSOA 1Q864 1Q824 3NUVA 4FMDA 4H3UA 3WA3A 2IUKA 4N3VA 3WOFB 2R4IA 2YFLB 6STDA 2O9UX 1TUHA 2C10A 1LXEA 2QIYA 4EYCA 1JN5A 1W01A 3DGOA 2HMMB 2F99A 4NREA 1VQN3 2WO0A 1W4NA 3SOAA 4GB5A 4EC6A 1M1K4 2W03A 5EVHA 1M1XB 4HVNA 3GRDA 2QEX3 4GL6A 2F98A 3GAXA 1SQWA 1ZO2A 1JJ22 1E97A 1S5AA 2OQEC 4HBRA 1R4CA 1W2B2 2Q07A 1EG9B 3BNBA 2QGUA 2BNGA 5I97A 1BUQA 3HX8A 5ELJA 3T8UA 1IVXA 4KFFA 1G96A 3WMDA 1N9JA 3NQZA 5KP1A 1TFOA 3SVAA 1YHQ3 2P0XA 2W9PA 2W2CA 2RGQA 2OQEA 3BNCA 3NV0A 1QAKA 3EQQB 3BNEA 3KSPA 5AIGA 3DZLA 1DMMA 3F40A 3KE7A 1NDOB 2W0QA 3K5TA 3ER7A 3JUOA 3OWUA 1QALA 1UI7A 4LZIA 3RGRA 1CEWI 4XB5A 2MF7A 3M8CA 2W9QA 1IVVA 5ELUA 4K61A 1SJWA 1OHOA 1RN7A 5JPPA 1JV2B 3WA2X 4WFOA 2OCTA 3CD63 1AV4A 5IG3A 4N6UA 1VQM3 2BO9B 1KD14 2Z7AA 4WYKA 4XDWA 1CYUA 1O7WB 5AEWB 1HKXA 2B24B 3HZPA 4U13A 4R4KA 1O7GB 4BTWA 1IV7A 3CMA3 3CC43 4WYKB 1D6ZA 4K1UA 4PEJA 3PS8A 3Q90A 3X3ZA 2CWUA 5KP4A 3CU3A 3VSYA 3QK9A 1ULIB 5IG4A 2RSXA 2W56B 1JB4A 2V1LA 2YFIB 1QVG2 3G8ZA 1F8NA 2IMJA 3N9HA 4FCMA 3D9RA 2INXA 2JQ5A 2L4VA 1VQ93 1IV9A 3JUNA 1NU3A 5CF1A 5IERA 4G1MB 3EJVA 5AI1A 4BTYA 3I563 1US1A 2FXTA 1JB2A 3X40A 1WMPA 7STDA 1YI23 2K54A 1WNHA 1AR0A 1PU4A 3KN4A 2CFKA 3F7XA 4FMAA 1OF5A 1YJW3 3HIIA 4XBYA 1VZZA 4EV2A 1TFKA 1RJOA 1EQKA 5JBSA 2D1WA 1Q814 1IT7A 5HGRA 2FGTA 2WGQA 2QA43 1KC84 3AMOA 2UX0A 3HK4A 3FG1A 3CCU3 4O8SA 1IQXA 3GZBA 1SPUA 2RFRA 1IU7A 1MOLA 1QAFA 4OVMA 1OCVA 4HKVB 2KRTA 5IW9A 5IEPA 3SLUA 4HM7B 1A90A 2OTJ3 3EN8A 3DGLA 3PCRA 1DVCA 2Y74A 3H51A 4QWTA 2CWVA 2E2VA 2ML5A 1YJ93 1Q42A 1IVUA 3O8YA 1JKGB 2F86B 4L8OA 1YIJ3 2GXFA 1OUNA 2CW9A 1W02A 3ALAA 4IPBA 1V74A 3UL5A 1SIHA 5FGOA 4RBNA 3F9SA 1A2KA 4MMZB 1JN5B 5IENA 3N8BA 1HU9A 2GEXA 5IEOA 4CCVA 1IQ8A 3PZWA 5BXQA 3T8NA 2Z76A 1YIT3 1CQSA 3X3XA 4KZ1A 2CK3H 3S29A 4BTXA 2Y73A 2XF3A 1TIJA 1E3VA 1RRHA 3CCQ3 4R80A 1S723 1FGRA 3QRDA 3EHCA 3S28A 1IVWA 3CXC2 4WHAA 1O7MB 4AEQA 4LGQA 3CPW2 3S67A 2GBXB 3DMCA 1UUVB 2PZVA 4KFEA 3G0KA 1IK3A 3OWSA 2YFJB 4HM2B 1OPYA 3MG1A 3ROBA 4WP5A 3CC23 1Q40B 3PXMA 3UL6A 1STDA 1IDPA 2KXGA 2CFDA 3EF8A 3GWRA 1N8R4 2STDA 3LTBA 5A0OB 4JF8A 1AVKA 4LEHA 3CPOA 1YVBI 3EBTA 3VF1A 3EN1B 4NHFA 5D82A 1UW1A 3SEDA 3FG4A 5BVBA 1LVNA 4KVHA 1J2BA 1VQ63 2A15A 4HYZA 5DRVA 5AYRB 2CG1A 3TDGA 3G4S3 3J7Yd 1JNQA 5CXOA 4O02B 4XDVA 4EV5A 1ULJB 1VQ53 3LZAA 3CCE3 3LT8A 2M7OA 1M904 3E99A 3NHXA 1OHPA 8CHOA 1GY7A 2B1XB 4XM4A 3NBRA 1EKMA 3X41A 3S27A 1OF5B 3DUKA 2FNQA 1OACA 5EEOA 1Q40A 3G16A 2PNCA 1O7HB 1TP6A 1GD4A 4H61A 3UJMA 1M9GA 3DM8A 3B4PA 1ISKA 4XBXA 3G6E3 3STDA 1GS3A 4X2OA 1IQYA 1W6CA 2XGLA 2Z77A 4XBTA 3B7CA 2CG0A 2HMJB 4O2HA 3IJEB 1FGMA 3K63A 3CCM3 1SIIA 3CCL3 1AVLA 1D6YA 3EBYA 3EE1A 1KQS2 1OHSA 1RRLA 3V98A 1DMQA 4MEIA 3CNXA 1YGEA 2SBLA 4EXRA 3GZRA 4FCZA 3JVCA 3D3LA 3GZYB 4I4KA 1VQK3 3G713 4OUQA 4STDA 4MMXB 1DVDA 1UI8A 4HM3B 5IG5A 3NXJA 2BMOB 5D81A 4MJDA 2CH9A 3OXAA 3Q1CA 1T5YA 3NBBA 1U5OA 1VQO3 4ORLA 4KFDA 4R9KA 1OH0A 2CFWA 3FLJA 3OWYA 4FMBA 4N6TA 2GU3A 3EB8A 3FCSB 3HI7A 3S5CA 3CME3 1FUWA 3OW22 1VQ73 4ZM8A 4K90B 5D83A 1W6GA 3LXUX 3IMAB 2LYXA 3LTDA 2GEYA 3A76A 3CC73 1FGTA 1LOXA 1IT8A 3KFQC 1L5GB 1FGOA 2BHMA 1KSIA 5FW5A 1VQ83 2YX9A 3LTCA 5EQLA 3JUMA 3UB1A 5CF2A 3FH1A 1Y4KA 3JUPA 2JDIH 3KZTA 3NV0B 4MMYB 5LC7A 1A67A 4JRFA 3WOEB 1W00A 1GD3A 4L7KA 3L0RA 3FZWA 3DY5A 1KWIA 3F8HA 5DREA 1D6UA 1VQP3 2K0MA 5CLKA 1RKYA 2XFSA 1VQL3 3VGNA 3NM7A 2HMNB 3KIIA 1K28A 2Z6BA 1C7HA 4R9LA 3U97A 3SXXA 2ZDJA 4N6V0 4HZBB 2I9WA 3PGBA 1ZX2A 1NB3I 2WOHA 3F14A 4IIAA 4J8TA 4RNYA 1OGZA 1WMOA 3LMLA 3FKAA 4N6OB 2IA7A 4FMCA 4WWUC 3CCV3 1W5ZA 1Z1SA 2P09A 2XSOB 3SOYA 3DGNA 1Q7Y4 2D42A 2XFTA 5STDA 2CFLA 1STFI 2BMRB 3MYTA 4CDLA 3CCR3 1ASKA 3LT9A 1EA2A 1E3RA 4O3VA 4K1VA 1K41A 3KKGA 4HM6B 3MWZA 3H3HA 5G2GA 1GY5A 3NBJA 4HM1B 5AIFA 5IF6A 2XEPA 3LYGA 2E2TA 3N54B 2E2UA 3X42A 1ROAA 3LH4A 2KCDA 3CCS3 3B4OA 3IPTA 3MPHA 3K7CA 3ECFA 2WGOA 3MHEA 3FSDA 5IG0A 3OV4A 3LOYA 4J9AA 3BNDA 4FCJA 4AKZA 1W6YA 2W04A 1N5HA 1NWWA 4HM4B 1N9EA 2OWPA 4OK0A 2OTL3 2C11A 4N6NB 1NJI4 2O3OA 2WOFA 3DGMA 3FGYA 1DYUA 3HIGA 1WMNA 3PYJA 1O7NB 4L8PA 4R1KA 5CK6A 3V99A 1NO3A 3V92A 1W7CA 1JRQA 2CFGA 3I0YA 2MC8A 1PFPA 2HMLB 3DXOA 4AKYA 3PCSA 1OGXA 3RGAA 1K8A4 2LQVA 4FR9A 1ROVA 4HM0B 3MG3A 3FG3A 4TX4A 4EBGA 3Q2PA 3K9MC 3CNMA 4N6MA 3JUQA 1MNLA 1K9M4 2XH9A 1CYVA 2W6JH 3AMOB 4LSOA 2BMQB 2CC3A 2GU1A 3NQYA 3T0UA 3I553 3GZXB 1UUWB 1O7PB 1FA3A 4LMIA 2W56A 2P0MA 1A2VA 2CHCA 3MKIA 2P38A 2XSHB 5AYSC 5AEUB 4Q53A 2OOVA 1QVF2 1U8CB 1N5PA 5KP3A 5JPUA 2XGNA 1N8QA 2P05A 3MG2A 3EC9A 3RDEA 4RNZA 2HMKB 3F7SA 1NB5I 2RCDA 3FF0A 1GY6A 2CIUA 3NX0A 4HJLB 2XRXB 3K0ZA 3F8XA 3WODG 2OOVC 3NM2A 4RZMA 3X3YA 2CWTA 1LNHA 3BLZA 5AIHA 1K734 3FF2A 4HZ9B 1JKGA 1DMNA 2HMOB 2IUJA 1QJGA 3BB9A 2CKFB 3SX1A 1GYBA 2ZL8A 3LTAA 1WQLB 2XR8B 3WDGB 3OX9A 1QMAA 3EX9A 3CCJ3 5AIIA 2GBWB 1YJN3 4IT7A 4HM8B 3UNLA 1W2ZA 1VQ43 1JB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GD3 A;  2W9P A;  1STF I;  3L0R A;  3NX0 A;  4N6T A;  1MNL A;  4N6U A;  1KWI A;  3PXM A;  4N6L A;  2BO9 B;  4N6N B;  3KSE D;  1IV9 A;  3UL6 A;  4CCV A;  1CYV A;  2KXG A;  5LC6 A;  1CYU A;  1FUW A;  1MOL A;  3PYJ A;  5A0O B;  4ZM8 A;  3MWZ A;  3IMA B;  1A90 A;  1YVB I;  3GAX A;  1WNH A;  1FA3 A;  1IV7 A;  1PFP A;  1TIJ A;  4N6V 0;  4LZI A;  1CEW I;  1R4C A;  1GD4 A;  1ROA A;  3KFQ C;  3LH4 A;  1DVC A;  3PS8 A;  1M9G A;  3QRD A;  1A67 A;  2W9Q A;  2O9U X;  1NB3 I;  1LXE A;  4EYC A;  1NB5 I;  1EQK A;  1N5P A;  4TX4 A;  5ELU A;  3Q2P A;  1DVD A;  4N6O B;  1RN7 A;  3K9M C;  5ELJ A;  5EQL A;  1G96 A;  3S67 A;  2OCT A;  1N9J A;  4N6M A;  3UL5 A;  2CH9 A;  4IT7 A;  5LC7 A;  3SVA A;  1N5H A; 
#chains in the Genus database with same CATH topology
 4X2H A;  4DKI A;  4HM5 B;  2C4B A;  4N6L A;  2ML6 A;  3KSE D;  2AAD A;  1FGQ A;  3B8L A;  5LC6 A;  5TGN A;  2BT3 A;  3U1W A;  1TU5 A;  1WTH A;  3MSO A;  1Q86 4;  1Q82 4;  3NUV A;  1DET A;  4FMD A;  4H3U A;  1LQM B;  1RNB A;  3WA3 A;  2IUK A;  4BL3 A;  4N3V A;  3WOF B;  2R4I A;  2YFL B;  2GSP A;  6STD A;  2O9U X;  1TUH A;  2C10 A;  1LXE A;  1T3B A;  2QIY A;  4EYC A;  1JN5 A;  1W01 A;  3DGO A;  2CX1 A;  2HMM B;  2F99 A;  4NRE A;  1RNT A;  1VQN 3;  2WO0 A;  1W4N A;  3SOA A;  4GB5 A;  1X1Y A;  3ZG0 A;  4EC6 A;  1M1K 4;  2W03 A;  5EVH A;  2K3D A;  4HAA A;  1M1X B;  4HVN A;  3GRD A;  1MGW A;  2QEX 3;  4GHO A;  3Q3F A;  4GL6 A;  2F98 A;  3GAX A;  1SQW A;  1ZO2 A;  1JJ2 2;  1E97 A;  1S5A A;  2OQE C;  4HBR A;  3D79 A;  1R4C A;  1W2B 2;  2Q07 A;  1ZGX A;  4BU4 A;  1HYF A;  1EG9 B;  3BNB A;  2QGU A;  2BNG A;  2IY2 A;  3GSP A;  5I97 A;  1LQG C;  1BUQ A;  1RGA A;  3HX8 A;  5ELJ A;  3T8U A;  1IVX A;  3AHS A;  1G96 A;  4KFF A;  3DH2 A;  3WMD A;  1N9J A;  3NQZ A;  5KP1 A;  1TFO A;  3SVA A;  1YHQ 3;  1B2Z A;  2P0X A;  2W9P A;  2W2C A;  1UCL A;  2RGQ A;  2OQE A;  1LOW A;  3BNC A;  1GOU A;  3NV0 A;  1QAK A;  2UUG C;  3EQQ B;  3BNE A;  3KSP A;  1UDI I;  3DZL A;  1DMM A;  5AIG A;  9RNT A;  3F40 A;  3KE7 A;  1JBS A;  1BRH A;  1NDO B;  2W0Q A;  3K5T A;  3ER7 A;  3A5E A;  3JUO A;  3URP A;  3OWU A;  1QAL A;  1UI7 A;  2KF5 A;  4LZI A;  3RGR A;  1CEW I;  4XB5 A;  2MF7 A;  3M8C A;  2W9Q A;  1BNF A;  1IVV A;  5ELU A;  4K61 A;  1SJW A;  1OHO A;  1RN7 A;  1UGH I;  1JV2 B;  3AGN A;  5JPP A;  3WA2 X;  3D5I A;  4WFO A;  2OCT A;  1BGS A;  2SAR A;  1RSN A;  1G0T A;  1BSD A;  2ZHX B;  3CD6 3;  1AV4 A;  5IG3 A;  4N6U A;  1VQM 3;  2BO9 B;  1BUJ A;  1KD1 4;  1BNI A;  2Z7A A;  4WYK A;  1GOY A;  2KF3 A;  4XDW A;  1CYU A;  1O7W B;  5AEW B;  1HKX A;  2B24 B;  3HZP A;  2F4Y A;  1B2S A;  4U13 A;  4R4K A;  1O7G B;  4BTW A;  1IV7 A;  2KF6 A;  1I0V A;  3CMA 3;  3CC4 3;  1LRA A;  1RGF A;  1D6Z A;  1MWU A;  4WYK B;  4RNT A;  4K1U A;  4PEJ A;  3PS8 A;  3Q90 A;  1TRQ A;  2CWU A;  1JZD A;  3X3Z A;  5KP4 A;  1BSB A;  3CU3 A;  5GSP A;  3QK9 A;  3VSY A;  1ULI B;  5IG4 A;  2H0H A;  1MGR A;  2RSX A;  2W56 B;  1JB4 A;  2V1L A;  1X1W A;  1V58 A;  2YFI B;  5M18 A;  1VQ6 3;  1BNG A;  1I2F A;  1QVG 2;  4BL2 A;  1BNS A;  3G8Z A;  1F8N A;  2IMJ A;  3N9H A;  4FCM A;  3D9R A;  2INX A;  3SYU A;  2JQ5 A;  2L4V A;  1VQ9 3;  1IV9 A;  3JUN A;  1NU3 A;  5CF1 A;  1B2X A;  5IER A;  3D4A A;  4G1M B;  3EJV A;  1YNV X;  5AI1 A;  4BTY A;  3I56 3;  1US1 A;  2FXT A;  1JB2 A;  3X40 A;  1WMP A;  1A2P A;  7STD A;  1YI2 3;  2K54 A;  1WNH A;  1BRK A;  1AR0 A;  1IYY A;  1PU4 A;  1GSP A;  3KN4 A;  6GSP A;  2CFK A;  3F7X A;  4FMA A;  1OF5 A;  1I2E A;  1YJW 3;  1TRP A;  3HII A;  1VZZ A;  4XBY A;  4EV2 A;  1TFK A;  1RJO A;  1EQK A;  5JBS A;  1DE3 A;  2D1W A;  1Q81 4;  1IT7 A;  5HGR A;  2FGT A;  1FUS A;  2WGQ A;  4EW5 A;  2QA4 3;  1KC8 4;  3AMO A;  2UX0 A;  4GSP A;  3HK4 A;  2ZA4 A;  3FG1 A;  3CCU 3;  4O8S A;  1IQX A;  3GZB A;  1SPU A;  2RFR A;  1IU7 A;  1MOL A;  1QAF A;  4OVM A;  1OCV A;  4HKV B;  2KRT A;  5IW9 A;  1BAO A;  4HOH A;  3SLU A;  5IEP A;  4HM7 B;  1A90 A;  1C54 A;  1X1U A;  2OTJ 3;  1BRS A;  3EN8 A;  3DGL A;  3PCR A;  5M19 A;  1DVC A;  1JZO A;  1V57 A;  2Y74 A;  3H51 A;  4QWT A;  2CWV A;  2E2V A;  2ML5 A;  1YJ9 3;  1Q42 A;  1IVU A;  3O8Y A;  1JKG B;  2F86 B;  4L8O A;  1YIJ 3;  1FW7 A;  2GXF A;  1OUN A;  2CW9 A;  1W02 A;  3ALA A;  4IPB A;  1V74 A;  3UL5 A;  1SIH A;  5FGO A;  4RBN A;  3F9S A;  1BU4 A;  1A2K A;  4MMZ B;  1JBT A;  1JN5 B;  5IEN A;  3N8B A;  1I70 A;  1HU9 A;  2GEX A;  5IEO A;  4CCV A;  2RNT A;  1IQ8 A;  1BSC A;  3PZW A;  3T8N A;  1GOV A;  2Z76 A;  5BXQ A;  1YIT 3;  1CQS A;  3X3X A;  4KZ1 A;  2F5W A;  2CK3 H;  3S29 A;  4BTX A;  1PY3 A;  2Y73 A;  2XF3 A;  1TIJ A;  1E3V A;  1RRH A;  5M1A A;  3CCQ 3;  4R80 A;  1S72 3;  1FGR A;  3QRD A;  3EHC A;  3S28 A;  1IVW A;  3CXC 2;  4WHA A;  1O7M B;  4AEQ A;  4LGQ A;  3CPW 2;  3S67 A;  2GBX B;  1RHL A;  3DMC A;  1B2U A;  1UUV B;  2PZV A;  4KFE A;  3G0K A;  1IK3 A;  3OWS A;  1FUT A;  2YFJ B;  4BIR A;  4HM2 B;  1OPY A;  4CPK A;  3MG1 A;  3ROB A;  4WP5 A;  3CC2 3;  1Q40 B;  3PXM A;  3UL6 A;  1STD A;  1IDP A;  2KXG A;  2CFD A;  3EF8 A;  3GWR A;  1N8R 4;  2STD A;  3LTB A;  5A0O B;  4JF8 A;  1AQZ A;  1AVK A;  4LEH A;  3HOH A;  1LOY A;  1UGI A;  1YGW A;  1YVB I;  3CPO A;  3EBT A;  3VF1 A;  3EN1 B;  4NHF A;  5D82 A;  1T2H A;  1UW1 A;  3SED A;  3FG4 A;  5BVB A;  1LVN A;  1T2I A;  4KVH A;  2L1S A;  1J2B A;  3BU4 A;  2A15 A;  1RGL A;  4HYZ A;  5DRV A;  5AYR B;  2CG1 A;  3TDG A;  3J7Y d;  3G4S 3;  6RNT A;  1MWR A;  1JNQ A;  5CXO A;  4O02 B;  4XDV A;  4EV5 A;  1ULJ B;  1VQ5 3;  3LZA A;  2KAA A;  3LT8 A;  2M7O A;  3CCE 3;  1M90 4;  3E99 A;  3NHX A;  1OHP A;  5G1L A;  8CHO A;  1GY7 A;  2B1X B;  4XM4 A;  3NBR A;  1UCI A;  1BNR A;  1EKM A;  3X41 A;  2R41 A;  3S27 A;  1OF5 B;  1MWS A;  3DUK A;  2FNQ A;  1OAC A;  5EEO A;  1Q40 A;  3G16 A;  2PNC A;  4J5K A;  1O7H B;  1TP6 A;  2RBI A;  3RNT A;  1GD4 A;  4H61 A;  1RCL A;  1BRI A;  1M9G A;  3UJM A;  3DM8 A;  3B4P A;  1ISK A;  4XBX A;  3G6E 3;  3STD A;  1GS3 A;  4X2O A;  1IQY A;  1W6C A;  2XGL A;  2Z77 A;  4XBT A;  3B7C A;  2CG0 A;  8RNT A;  2HMJ B;  4O2H A;  4J5G A;  3IJE B;  1FGM A;  1I3I A;  3K63 A;  3CCM 3;  1SII A;  3CCL 3;  1AVL A;  1D6Y A;  3EBY A;  3EE1 A;  1KQS 2;  1OHS A;  1RGC A;  1RRL A;  3V98 A;  1DMQ A;  4MEI A;  3CNX A;  1YGE A;  5RNT A;  2SBL A;  1UCJ A;  1ZS7 A;  4EXR A;  2UGI A;  3GZR A;  4FCZ A;  1GMQ A;  3JVC A;  3D3L A;  3GZY B;  4I4K A;  1VQK 3;  3G71 3;  1R4Y A;  4OUQ A;  4STD A;  3ZG5 A;  4MMX B;  1DVD A;  1UI8 A;  4HM3 B;  5IG5 A;  3NXJ A;  2BMO B;  5D81 A;  4MJD A;  2CH9 A;  3OXA A;  3Q1C A;  1RDS A;  1T5Y A;  3NBB A;  1U5O A;  1VQO 3;  4ORL A;  4KFD A;  4R9K A;  1OH0 A;  2CFW A;  3FLJ A;  3OWY A;  4FMB A;  4N6T A;  2GU3 A;  3EB8 A;  3FCS B;  3HI7 A;  3S5C A;  1B2M A;  1GMP A;  2CX0 A;  3CME 3;  1FUW A;  3OW2 2;  1VQ7 3;  5BU4 A;  4ZM8 A;  4K90 B;  5D83 A;  1W6G A;  3LXU X;  3IMA B;  2LYX A;  3LTD A;  2GEY A;  3A76 A;  3WHO A;  3CC7 3;  1FGT A;  5G1K A;  1I8V A;  1LOX A;  1IT8 A;  3KFQ C;  1L5G B;  1FGO A;  1CH0 A;  1KSI A;  2BHM A;  5FW5 A;  1VQ8 3;  1B20 A;  7RNT A;  2YX9 A;  1B27 A;  3LTC A;  5EQL A;  3JUM A;  3UB1 A;  1BSE A;  5CF2 A;  3FH1 A;  1Y4K A;  1RLS A;  2H0G A;  2JDI H;  3JUP A;  3KZT A;  3NV0 B;  4MMY B;  5LC7 A;  1A67 A;  4JRF A;  3WOE B;  1W00 A;  1BIR A;  1GD3 A;  1Q7H A;  4L7K A;  3L0R A;  1AY7 A;  3FZW A;  3DY5 A;  1KWI A;  3F8H A;  5DRE A;  2BIR A;  1D6U A;  1VQP 3;  2K0M A;  5CLK A;  1RKY A;  3BIR A;  2XFS A;  1VQL 3;  3VGN A;  3NM7 A;  1G02 A;  2HMN B;  3KII A;  1I3F A;  1K28 A;  2Z6B A;  1C7H A;  4LYL B;  4R9L A;  3U97 A;  3SXX A;  2ZDJ A;  4N6V 0;  4HZB B;  2I9W A;  3PGB A;  4CJN A;  1ZX2 A;  1UCK A;  2HOH A;  1NB3 I;  1RGE A;  1RN1 A;  1BNE A;  2WOH A;  3F14 A;  4IIA A;  4J8T A;  4RNY A;  1BVI A;  1OGZ A;  1WMO A;  3AHW A;  3LML A;  3FKA A;  4N6O B;  2IA7 A;  4FMC A;  4NPB A;  4WWU C;  3CCV 3;  1PYL A;  1UUG B;  1BRJ A;  1W5Z A;  1Z1S A;  2P09 A;  2XSO B;  2IYJ A;  3SOY A;  3DGN A;  1Q7Y 4;  2D42 A;  2XFT A;  5STD A;  2CFL A;  1STF I;  2BMR B;  3MYT A;  1BNJ A;  4CDL A;  1ASK A;  1I2G A;  1RCK A;  1EA2 A;  1E3R A;  2F56 A;  3LT9 A;  3CCR 3;  2F5M A;  1BRG A;  1I0X A;  4O3V A;  4K1V A;  1K41 A;  1X1X A;  3KKG A;  4HM6 B;  3MWZ A;  3H3H A;  5G2G A;  1GY5 A;  3NBJ A;  4HM1 B;  5AIF A;  5IF6 A;  2XEP A;  1EEJ A;  2E2T A;  3LYG A;  3N54 B;  2E2U A;  3ZFZ A;  1RN4 A;  3X42 A;  1ROA A;  2J8X B;  3LH4 A;  2KCD A;  3CCS 3;  3B4O A;  3IPT A;  3MPH A;  1BSA A;  3K7C A;  1Q9E A;  2KF4 A;  3D5G A;  3ECF A;  2WGO A;  3MHE A;  3FSD A;  5IG0 A;  3OV4 A;  3AGO A;  1FYS A;  3LOY A;  3BND A;  4FCJ A;  4J9A A;  4AKZ A;  1W6Y A;  1B3S A;  2W04 A;  1N5H A;  1NWW A;  4HM4 B;  1N9E A;  2H0I A;  2OWP A;  4OK0 A;  2OTL 3;  2C11 A;  4N6N B;  1NJI 4;  2O3O A;  2WOF A;  3DGM A;  3FGY A;  1DYU A;  3HIG A;  1WMN A;  3PYJ A;  1O7N B;  4L8P A;  1RMS A;  4R1K A;  5CK6 A;  1NO3 A;  3V99 A;  1BRN L;  3V92 A;  1FZU A;  1W7C A;  1JRQ A;  2CFG A;  3I0Y A;  2MC8 A;  1PFP A;  2HML B;  1B21 A;  3DXO A;  4AKY A;  1SAR A;  2AAE A;  3PCS A;  1OGX A;  3RGA A;  1K8A 4;  2LQV A;  4FR9 A;  1ROV A;  4HM0 B;  3MG3 A;  3FG3 A;  4TX4 A;  4EBG A;  3Q2P A;  3K9M C;  3CNM A;  4N6M A;  3JUQ A;  1RGK A;  1GMR A;  1TTO A;  1MNL A;  1K9M 4;  2XH9 A;  1CYV A;  1MWT A;  2W6J H;  4ILF A;  3AMO B;  4LSO A;  1JBR A;  2BMQ B;  1EUI C;  2CC3 A;  2GU1 A;  3NQY A;  3T0U A;  5BIR A;  3I55 3;  3GZX B;  1UUW B;  1O7P B;  1HZ1 A;  1FA3 A;  4LMI A;  2P0M A;  1A2V A;  1RGH A;  2W56 A;  2CHC A;  1VQQ A;  2P38 A;  3MKI A;  7GSP A;  2XSH B;  5AYS C;  4I5Q A;  5AEU B;  4Q53 A;  2OOV A;  1BAN A;  1QVF 2;  1U8C B;  1N5P A;  5KP3 A;  5JPU A;  2XGN A;  1N8Q A;  1RTU A;  2P05 A;  3MG2 A;  3EC9 A;  3RDE A;  4RNZ A;  2HMK B;  3F7S A;  1NB5 I;  2RCD A;  1BOX A;  2BU4 A;  3FF0 A;  1GY6 A;  2CIU A;  3NX0 A;  4HJL B;  4KT3 B;  3WR2 A;  2XRX B;  3K0Z A;  3F8X A;  3WOD G;  2OOV C;  3NM2 A;  4RZM A;  3X3Y A;  2CWT A;  1LNH A;  3BLZ A;  1NNV A;  5AIH A;  1K73 4;  1LOV A;  1TJD A;  1LNI A;  1JKG A;  1DMN A;  2HMO B;  3FF2 A;  4HZ9 B;  2IUJ A;  1QJG A;  3DGY A;  3BB9 A;  2CKF B;  3SX1 A;  1GYB A;  2ZL8 A;  1YVS A;  3LTA A;  1WQL B;  2XR8 B;  3WDG B;  5HOH A;  3OX9 A;  1RGG A;  1QMA A;  3EX9 A;  3KCH A;  3CCJ 3;  5AII A;  2GBW B;  1YJN 3;  4IT7 A;  4HM8 B;  3UNL A;  1W2Z A;  1VQ4 3;  1JB5 A; 
#chains in the Genus database with same CATH homology
 4X2H A;  4HM5 B;  4N6L A;  2ML6 A;  3KSE D;  1FGQ A;  3B8L A;  5LC6 A;  5TGN A;  2BT3 A;  3U1W A;  1TU5 A;  1WTH A;  3MSO A;  1Q86 4;  1Q82 4;  3NUV A;  4FMD A;  4H3U A;  3WA3 A;  2IUK A;  4N3V A;  3WOF B;  2R4I A;  2YFL B;  6STD A;  2O9U X;  1TUH A;  2C10 A;  1LXE A;  2QIY A;  4EYC A;  1JN5 A;  1W01 A;  3DGO A;  2HMM B;  2F99 A;  4NRE A;  1VQN 3;  2WO0 A;  1W4N A;  3SOA A;  4GB5 A;  4EC6 A;  1M1K 4;  2W03 A;  5EVH A;  1M1X B;  4HVN A;  3GRD A;  2QEX 3;  4GL6 A;  2F98 A;  3GAX A;  1SQW A;  1ZO2 A;  1JJ2 2;  1E97 A;  1S5A A;  2OQE C;  4HBR A;  1R4C A;  1W2B 2;  2Q07 A;  1EG9 B;  3BNB A;  2QGU A;  2BNG A;  5I97 A;  1BUQ A;  3HX8 A;  5ELJ A;  3T8U A;  1IVX A;  4KFF A;  1G96 A;  3WMD A;  1N9J A;  3NQZ A;  5KP1 A;  1TFO A;  3SVA A;  1YHQ 3;  2P0X A;  2W9P A;  2W2C A;  2RGQ A;  2OQE A;  3BNC A;  3NV0 A;  1QAK A;  3EQQ B;  3BNE A;  3KSP A;  5AIG A;  3DZL A;  1DMM A;  3F40 A;  3KE7 A;  1NDO B;  2W0Q A;  3K5T A;  3ER7 A;  3JUO A;  3OWU A;  1QAL A;  1UI7 A;  4LZI A;  3RGR A;  1CEW I;  4XB5 A;  2MF7 A;  3M8C A;  2W9Q A;  1IVV A;  5ELU A;  4K61 A;  1SJW A;  1OHO A;  1RN7 A;  5JPP A;  1JV2 B;  3WA2 X;  4WFO A;  2OCT A;  3CD6 3;  1AV4 A;  5IG3 A;  4N6U A;  1VQM 3;  2BO9 B;  1KD1 4;  2Z7A A;  4WYK A;  4XDW A;  1CYU A;  1O7W B;  5AEW B;  1HKX A;  2B24 B;  3HZP A;  4U13 A;  4R4K A;  1O7G B;  4BTW A;  1IV7 A;  3CMA 3;  3CC4 3;  4WYK B;  1D6Z A;  4K1U A;  4PEJ A;  3PS8 A;  3Q90 A;  3X3Z A;  2CWU A;  5KP4 A;  3CU3 A;  3VSY A;  3QK9 A;  1ULI B;  5IG4 A;  2RSX A;  2W56 B;  1JB4 A;  2V1L A;  2YFI B;  1QVG 2;  3G8Z A;  1F8N A;  2IMJ A;  3N9H A;  4FCM A;  3D9R A;  2INX A;  2JQ5 A;  2L4V A;  1VQ9 3;  1IV9 A;  3JUN A;  1NU3 A;  5CF1 A;  5IER A;  4G1M B;  3EJV A;  5AI1 A;  4BTY A;  3I56 3;  1US1 A;  2FXT A;  1JB2 A;  3X40 A;  1WMP A;  7STD A;  1YI2 3;  2K54 A;  1WNH A;  1AR0 A;  1PU4 A;  3KN4 A;  2CFK A;  3F7X A;  4FMA A;  1OF5 A;  1YJW 3;  3HII A;  4XBY A;  1VZZ A;  4EV2 A;  1TFK A;  1RJO A;  1EQK A;  5JBS A;  2D1W A;  1Q81 4;  1IT7 A;  5HGR A;  2FGT A;  2WGQ A;  2QA4 3;  1KC8 4;  3AMO A;  2UX0 A;  3HK4 A;  3FG1 A;  3CCU 3;  4O8S A;  1IQX A;  3GZB A;  1SPU A;  2RFR A;  1IU7 A;  1MOL A;  1QAF A;  4OVM A;  1OCV A;  4HKV B;  2KRT A;  5IW9 A;  5IEP A;  3SLU A;  4HM7 B;  1A90 A;  2OTJ 3;  3EN8 A;  3DGL A;  3PCR A;  1DVC A;  2Y74 A;  3H51 A;  4QWT A;  2CWV A;  2E2V A;  2ML5 A;  1YJ9 3;  1Q42 A;  1IVU A;  3O8Y A;  1JKG B;  2F86 B;  4L8O A;  1YIJ 3;  2GXF A;  1OUN A;  2CW9 A;  1W02 A;  3ALA A;  4IPB A;  1V74 A;  3UL5 A;  1SIH A;  5FGO A;  4RBN A;  3F9S A;  1A2K A;  4MMZ B;  1JN5 B;  5IEN A;  3N8B A;  1HU9 A;  2GEX A;  5IEO A;  4CCV A;  1IQ8 A;  3PZW A;  5BXQ A;  3T8N A;  2Z76 A;  1YIT 3;  1CQS A;  3X3X A;  4KZ1 A;  2CK3 H;  3S29 A;  4BTX A;  2Y73 A;  2XF3 A;  1TIJ A;  1E3V A;  1RRH A;  3CCQ 3;  4R80 A;  1S72 3;  1FGR A;  3QRD A;  3EHC A;  3S28 A;  1IVW A;  3CXC 2;  4WHA A;  1O7M B;  4AEQ A;  4LGQ A;  3CPW 2;  3S67 A;  2GBX B;  3DMC A;  1UUV B;  2PZV A;  4KFE A;  3G0K A;  1IK3 A;  3OWS A;  2YFJ B;  4HM2 B;  1OPY A;  3MG1 A;  3ROB A;  4WP5 A;  3CC2 3;  1Q40 B;  3PXM A;  3UL6 A;  1STD A;  1IDP A;  2KXG A;  2CFD A;  3EF8 A;  3GWR A;  1N8R 4;  2STD A;  3LTB A;  5A0O B;  4JF8 A;  1AVK A;  4LEH A;  3CPO A;  1YVB I;  3EBT A;  3VF1 A;  3EN1 B;  4NHF A;  5D82 A;  1UW1 A;  3SED A;  3FG4 A;  5BVB A;  1LVN A;  4KVH A;  1J2B A;  1VQ6 3;  2A15 A;  4HYZ A;  5DRV A;  5AYR B;  2CG1 A;  3TDG A;  3G4S 3;  3J7Y d;  1JNQ A;  5CXO A;  4O02 B;  4XDV A;  4EV5 A;  1ULJ B;  1VQ5 3;  3LZA A;  3CCE 3;  3LT8 A;  2M7O A;  1M90 4;  3E99 A;  3NHX A;  1OHP A;  8CHO A;  1GY7 A;  2B1X B;  4XM4 A;  3NBR A;  1EKM A;  3X41 A;  3S27 A;  1OF5 B;  3DUK A;  2FNQ A;  1OAC A;  5EEO A;  1Q40 A;  3G16 A;  2PNC A;  1O7H B;  1TP6 A;  1GD4 A;  4H61 A;  3UJM A;  1M9G A;  3DM8 A;  3B4P A;  1ISK A;  4XBX A;  3G6E 3;  3STD A;  1GS3 A;  4X2O A;  1IQY A;  1W6C A;  2XGL A;  2Z77 A;  4XBT A;  3B7C A;  2CG0 A;  2HMJ B;  4O2H A;  3IJE B;  1FGM A;  3K63 A;  3CCM 3;  1SII A;  3CCL 3;  1AVL A;  1D6Y A;  3EBY A;  3EE1 A;  1KQS 2;  1OHS A;  1RRL A;  3V98 A;  1DMQ A;  4MEI A;  3CNX A;  1YGE A;  2SBL A;  4EXR A;  3GZR A;  4FCZ A;  3JVC A;  3D3L A;  3GZY B;  4I4K A;  1VQK 3;  3G71 3;  4OUQ A;  4STD A;  4MMX B;  1DVD A;  1UI8 A;  4HM3 B;  5IG5 A;  3NXJ A;  2BMO B;  5D81 A;  4MJD A;  2CH9 A;  3OXA A;  3Q1C A;  1T5Y A;  3NBB A;  1U5O A;  1VQO 3;  4ORL A;  4KFD A;  4R9K A;  1OH0 A;  2CFW A;  3FLJ A;  3OWY A;  4FMB A;  4N6T A;  2GU3 A;  3EB8 A;  3FCS B;  3HI7 A;  3S5C A;  3CME 3;  1FUW A;  3OW2 2;  1VQ7 3;  4ZM8 A;  4K90 B;  5D83 A;  1W6G A;  3LXU X;  3IMA B;  2LYX A;  3LTD A;  2GEY A;  3A76 A;  3CC7 3;  1FGT A;  1LOX A;  1IT8 A;  3KFQ C;  1L5G B;  1FGO A;  2BHM A;  1KSI A;  5FW5 A;  1VQ8 3;  2YX9 A;  3LTC A;  5EQL A;  3JUM A;  3UB1 A;  5CF2 A;  3FH1 A;  1Y4K A;  3JUP A;  2JDI H;  3KZT A;  3NV0 B;  4MMY B;  5LC7 A;  1A67 A;  4JRF A;  3WOE B;  1W00 A;  1GD3 A;  4L7K A;  3L0R A;  3FZW A;  3DY5 A;  1KWI A;  3F8H A;  5DRE A;  1D6U A;  1VQP 3;  2K0M A;  5CLK A;  1RKY A;  2XFS A;  1VQL 3;  3VGN A;  3NM7 A;  2HMN B;  3KII A;  1K28 A;  2Z6B A;  1C7H A;  4R9L A;  3U97 A;  3SXX A;  2ZDJ A;  4N6V 0;  4HZB B;  2I9W A;  3PGB A;  1ZX2 A;  1NB3 I;  2WOH A;  3F14 A;  4IIA A;  4J8T A;  4RNY A;  1OGZ A;  1WMO A;  3LML A;  3FKA A;  4N6O B;  2IA7 A;  4FMC A;  4WWU C;  3CCV 3;  1W5Z A;  1Z1S A;  2P09 A;  2XSO B;  3SOY A;  3DGN A;  1Q7Y 4;  2D42 A;  2XFT A;  5STD A;  2CFL A;  1STF I;  2BMR B;  3MYT A;  4CDL A;  3CCR 3;  1ASK A;  3LT9 A;  1EA2 A;  1E3R A;  4O3V A;  4K1V A;  1K41 A;  3KKG A;  4HM6 B;  3MWZ A;  3H3H A;  5G2G A;  1GY5 A;  3NBJ A;  4HM1 B;  5AIF A;  5IF6 A;  2XEP A;  3LYG A;  2E2T A;  3N54 B;  2E2U A;  3X42 A;  1ROA A;  3LH4 A;  2KCD A;  3CCS 3;  3B4O A;  3IPT A;  3MPH A;  3K7C A;  3ECF A;  2WGO A;  3MHE A;  3FSD A;  5IG0 A;  3OV4 A;  3LOY A;  4J9A A;  3BND A;  4FCJ A;  4AKZ A;  1W6Y A;  2W04 A;  1N5H A;  1NWW A;  4HM4 B;  1N9E A;  2OWP A;  4OK0 A;  2OTL 3;  2C11 A;  4N6N B;  1NJI 4;  2O3O A;  2WOF A;  3DGM A;  3FGY A;  1DYU A;  3HIG A;  1WMN A;  3PYJ A;  1O7N B;  4L8P A;  4R1K A;  5CK6 A;  3V99 A;  1NO3 A;  3V92 A;  1W7C A;  1JRQ A;  2CFG A;  3I0Y A;  2MC8 A;  1PFP A;  2HML B;  3DXO A;  4AKY A;  3PCS A;  1OGX A;  3RGA A;  1K8A 4;  2LQV A;  4FR9 A;  1ROV A;  4HM0 B;  3MG3 A;  3FG3 A;  4TX4 A;  4EBG A;  3Q2P A;  3K9M C;  3CNM A;  4N6M A;  3JUQ A;  1MNL A;  1K9M 4;  2XH9 A;  1CYV A;  2W6J H;  3AMO B;  4LSO A;  2BMQ B;  2CC3 A;  2GU1 A;  3NQY A;  3T0U A;  3I55 3;  3GZX B;  1UUW B;  1O7P B;  1FA3 A;  4LMI A;  2W56 A;  2P0M A;  1A2V A;  2CHC A;  3MKI A;  2P38 A;  2XSH B;  5AYS C;  5AEU B;  4Q53 A;  2OOV A;  1QVF 2;  1U8C B;  1N5P A;  5KP3 A;  5JPU A;  2XGN A;  1N8Q A;  2P05 A;  3MG2 A;  3EC9 A;  3RDE A;  4RNZ A;  2HMK B;  3F7S A;  1NB5 I;  2RCD A;  3FF0 A;  1GY6 A;  2CIU A;  3NX0 A;  4HJL B;  2XRX B;  3K0Z A;  3F8X A;  3WOD G;  2OOV C;  3NM2 A;  4RZM A;  3X3Y A;  2CWT A;  1LNH A;  3BLZ A;  5AIH A;  1K73 4;  3FF2 A;  4HZ9 B;  1JKG A;  1DMN A;  2HMO B;  2IUJ A;  1QJG A;  3BB9 A;  2CKF B;  3SX1 A;  1GYB A;  2ZL8 A;  3LTA A;  1WQL B;  2XR8 B;  3WDG B;  3OX9 A;  1QMA A;  3EX9 A;  3CCJ 3;  5AII A;  2GBW B;  1YJN 3;  4IT7 A;  4HM8 B;  3UNL A;  1W2Z A;  1VQ4 3;  1JB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...