1A67A

Chicken egg white cystatin wildtype, nmr, 16 structures
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
108
structure length
108
Chain Sequence
GAPVPVDENDEGLQRALQFAMAEYNRASNDKYSSRVVRVISAKRQLVSGIKYILQVEIGRTTCPKSSGDLQSCEFHDEPEMAKYTTCTFVVYSIPWLNQIKLLESKCQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structures of native phosphorylated chicken cystatin and of a recombinant unphosphorylated variant in solution.
pubmed doi rcsb
molecule tags Proteinase inhibitor
molecule keywords CYSTATIN
total genus 13
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 1998-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1a67A00
2CH9A 1FUWA 1WNHA 2O9UX 3PS8A 4IT7A 4LZIA 5EQLA 1DVDA 1G96A 4CCVA 1STFI 4N6OB 1A67A 1CEWI 2W9QA 3PYJA 4N6NB 3KFQC 4N6TA 5A0OB 1GD4A 3GAXA 1A90A 4N6UA 3LH4A 4N6LA 1MNLA 3S67A 5LC7A 4EYCA 1IV9A 3QRDA 1R4CA 3K9MC 4N6V0 4N6MA 1NB3I 1RN7A 3UL5A 1YVBI 5ELUA 1N5PA 1M9GA 1IV7A 3SVAA 3UL6A 1TIJA 1GD3A 4TX4A 1ROAA 2BO9B 3IMAB 2KXGA 1KWIA 1CYUA 1N9JA 3NX0A 3PXMA 2W9PA 1EQKA 1DVCA 3L0RA 1LXEA 3MWZA 3Q2PA 5ELJA 1FA3A 1NB5I 1N5HA 4ZM8A 1PFPA 3KSED 1MOLA 1CYVA 2OCTA 5LC6A
chains in the Genus database with same CATH superfamily
2GBXB 2W2CA 3PZWA 1B20A 1EUIC 1I2FA 1EEJA 3LTDA 3WDGB 4IIAA 3QK9A 3WOEB 1CH0A 1DYUA 3OV4A 3EHCA 3HOHA 1FGQA 2ZA4A 1B2UA 2RCDA 1RRHA 1YHQ3 3E99A 4N6LA 4L7KA 1U8CB 1JZDA 4LMIA 2CHCA 5AIHA 2PNCA 1BSEA 1VQ73 3CCS3 1IYYA 1NB3I 2HMNB 4FR9A 1I0XA 1FZUA 1M9GA 2RNTA 3J7Yd 1W2B2 3BLZA 2V1LA 4TX4A 1SIIA 4WP5A 1SJWA 1EG9B 3FF2A 3CCQ3 1SARA 1EQKA 2WGOA 5IEPA 1O7HB 1OCVA 1N9EA 1TUHA 3AHWA 5M18A 3Q2PA 2B1XB 3CD63 1GOUA 1GMRA 1LOVA 1WMPA 2Y73A 3ZFZA 1NWWA 2BMQB 3FG3A 1MOLA 5ELJA 2CWVA 2XF3A 1K9M4 1BRGA 2CH9A 2HOHA 3NM2A 1BRKA 4K1UA 1STFI 1YNVX 3ZG0A 4MMZB 1D6ZA 3MKIA 1BOXA 3CC23 3NQYA 6RNTA 4FMBA 4HZ9B 2CFLA 1BNIA 1UCIA 1HYFA 4XM4A 1M1K4 3DUKA 1I2EA 4CPKA 3SX1A 2QEX3 3UL5A 3K9MC 4WHAA 3WA2X 5ELUA 1J2BA 3BNCA 3BU4A 4GHOA 4JF8A 1S5AA 2UUGC 2CKFB 1R4YA 1RRLA 3CCL3 1LRAA 1GY5A 3EQQB 1RKYA 3CXC2 3SEDA 1VQ83 4ILFA 2XRXB 3FLJA 3IJEB 1OPYA 4R9LA 3WHOA 1NNVA 1DE3A 2CWUA 3D9RA 3X3XA 1A90A 3HZPA 3LOYA 5KP4A 5IG3A 4FMAA 1Y4KA 1X1WA 2O9UX 2PZVA 3EN1B 3GZXB 3OWYA 4BTYA 1VQM3 1PY3A 1BNGA 1E97A 1LOYA 1W6GA 4LEHA 4AKZA 2R41A 4R80A 2MC8A 3WODG 1DMQA 5I97A 4RNZA 1OUNA 2KRTA 3BB9A 1N8R4 2E2TA 1YJ93 3JUNA 1OH0A 1C7HA 1YVBI 1DMNA 4G1MB 3X3ZA 1YIJ3 1IVXA 1US1A 3NM7A 4RNTA 1IU7A 3NHXA 1TFOA 3B4OA 1W00A 3CCJ3 2M7OA 2XFSA 4BL3A 2ZDJA 2W03A 5BVBA 1C54A 4K90B 2P09A 5TGNA 1VQK3 2QIYA 2L1SA 2RGQA 2CX0A 2BNGA 1BNRA 1NO3A 4J5GA 3UNLA 2CX1A 1CYVA 1RJOA 3F40A 1ISKA 4HM6B 1DVDA 3U97A 4RBNA 1UW1A 2KF5A 1T5YA 2IMJA 1GD4A 2K0MA 1I3FA 3FF0A 1KD14 1O7WB 4HM0B 1OACA 3CCE3 2Z6BA 2CG0A 4N6V0 2LYXA 4R1KA 1K28A 2F5MA 2J8XB 3K7CA 1L5GB 2GEYA 2K54A 3FSDA 3LT8A 1IQXA 2IUJA 3VF1A 2E2VA 1RTUA 4CJNA 2F86B 3A76A 2ML6A 2W56B 3CPOA 4AKYA 3LT9A 4EBGA 3UB1A 3G4S3 1JNQA 2XSHB 3D4AA 4HZBB 2H0IA 1Q864 4MMXB 1I70A 2XFTA 1FW7A 2F98A 3KCHA 7GSPA 3JVCA 1NJI4 1NU3A 2A15A 2ZL8A 1E3VA 1OGXA 4J5KA 2OWPA 1G96A 3PCSA 2SBLA 3I553 1BSAA 1GYBA 1JV2B 5AIFA 4EW5A 3NV0A 2CG1A 4N6UA 4BL2A 5DREA 2F5WA 5EVHA 4EYCA 1MGRA 2FNQA 2ML5A 3EF8A 1JN5B 4HJLB 4H3UA 5CF1A 2F99A 4X2OA 2INXA 2IA7A 3EC9A 4STDA 1JB5A 7RNTA 2XGLA 4HM3B 4HM1B 2IYJA 3BNBA 1ROAA 2O3OA 1ULIB 1JRQA 2GU3A 3O8YA 1KQS2 3AMOB 2Z77A 5IF6A 3G713 3I563 4K1VA 1KC84 1BRJA 1JB4A 3K5TA 1U5OA 3JUMA 1PFPA 3KSED 1BUQA 1BSDA 5IERA 2HMMB 2IUKA 1D6UA 3TDGA 1ZO2A 3WOFB 1RMSA 1GOYA 4R9KA 1AQZA 1JN5A 4KFFA 3ROBA 5AYSC 3NBJA 1FGTA 5FW5A 1V57A 3ALAA 1BNSA 4KZ1A 1MNLA 1JBTA 3KIIA 1AVKA 1IV9A 2CFDA 4HAAA 1IQ8A 1UCKA 3X3YA 5AEUB 1VZZA 1SPUA 3FCSB 2Z7AA 3D3LA 1YGEA 2F4YA 2CC3A 2AAEA 3F7XA 2GU1A 1EKMA 1DVCA 4KVHA 4ORLA 3KZTA 5CK6A 1B2MA 2UX0A 1IT7A 1DETA 5FGOA 2HMLB 3V98A 2HMJB 1OHSA 3GZBA 3U1WA 2JQ5A 1B2XA 4XDVA 1GY6A 2W0QA 1I8VA 3EB8A 1BRNL 5AI1A 2AADA 3T8UA 3FG4A 1OF5A 2F56A 3FKAA 4Q53A 1N8QA 9RNTA 1V58A 1B21A 3FG1A 1ZGXA 1FUWA 3NUVA 2RBIA 1LOXA 2P0XA 3G8ZA 3S5CA 2W9PA 3F8XA 5JPPA 3KKGA 3IPTA 1RCKA 3NXJA 4RZMA 1OF5B 2XEPA 3S27A 3SXXA 2OTL3 2XSOB 2HMOB 4WYKA 5EQLA 3DZLA 3STDA 4HM8B 1RNTA 4N6OB 2OOVA 1RGGA 1AY7A 3RDEA 4R4KA 5EEOA 3BNEA 2BHMA 1QVF2 1W02A 3V92A 3EBTA 1ZS7A 6STDA 3HIGA 3KSPA 4XBTA 1O7MB 4HM2B 5AIIA 1EA2A 5BIRA 4MEIA 1RN7A 1MWTA 5KP1A 4AEQA 1UUVB 1GD3A 3OWUA 1FGMA 4NHFA 1K8A4 3N8BA 4O3VA 3N9HA 3WA3A 3CCR3 2SARA 2STDA 3SYUA 2CWTA 2W04A 1RN1A 1IVVA 3K63A 1BSBA 3HK4A 1UCJA 5AYRB 3G6E3 1MWSA 1Q40A 3F8HA 4L8PA 1RDSA 3DGOA 4DKIA 1BRHA 4EV2A 1YI23 1NDOB 3PS8A 1IDPA 1VQ53 1I2GA 2C10A 1IT8A 3LTBA 1VQN3 1A67A 4CDLA 3LXUX 1A2PA 4N6TA 4KT3B 4NPBA 5RNTA 3LYGA 3OX9A 3GRDA 5LC7A 1TU5A 4N6MA 1LQGC 1YJN3 1RSNA 5IG0A 5JBSA 1HU9A 5G1LA 2JDIH 1GS3A 3Q90A 4J9AA 2OOVC 1JJ22 3CME3 1X1YA 3WR2A 3JUQA 3H3HA 3M8CA 1VQ43 3Q3FA 1BAOA 1B2ZA 3RGAA 4QWTA 1GMQA 1RLSA 1UUGB 3AMOA 1N5HA 3H51A 2GEXA 5LC6A 3DXOA 2FGTA 4MJDA 3GSPA 4LGQA 1RN4A 1VQQA 4CCVA 5CF2A 1YGWA 2W9QA 1UI8A 1TP6A 2CFKA 5M19A 1HKXA 1W6YA 2WGQA 4HOHA 1BSCA 3SOYA 1JBRA 4BIRA 2P38A 3FGYA 2IY2A 3ZG5A 2YFJB 1RGFA 3X41A 1IV7A 1W5ZA 4O2HA 4FCZA 2WO0A 1VQP3 1WMOA 2BO9B 2YFIB 1MWUA 2BIRA 5JPUA 3MYTA 3V99A 1VQ93 2GXFA 1A2KA 2YFLB 1K734 1HZ1A 1FYSA 3DGYA 1W4NA 1FA3A 1W6CA 3CCM3 1ASKA 1STDA 3CU3A 4ZM8A 1AV4A 2R4IA 3DGLA 3G16A 3OXAA 1Q824 1RNBA 3CCV3 1TFKA 3D5GA 1IVWA 4IPBA 4EV5A 2BMRB 3PYJA 1Q814 1RGLA 3B4PA 4L8OA 5CXOA 1GSPA 2GSPA 1DMMA 1W01A 3GZRA 2OQEA 3S67A 3GZYB 3K0ZA 2E2UA 3S29A 3AHSA 5DRVA 1QAFA 4O02B 5BU4A 1BNJA 1T2HA 3VSYA 3ECFA 1RGAA 3CNMA 1TRPA 2W6JH 2YX9A 3F9SA 3HX8A 3SVAA 4X2HA 1IK3A 1FUSA 4H61A 1KWIA 1BANA 3NX0A 1BRSA 3PXMA 3SLUA 1Z1SA 1AR0A 1ZX2A 2CFWA 3L0RA 4HVNA 4J8TA 3DGMA 7STDA 1A2VA 2UGIA 4U13A 2XR8B 1PYLA 3URPA 2P05A 2GBWB 1CQSA 1WQLB 3S28A 2KAAA 3NBBA 4LZIA 4XDWA 8CHOA 3T8NA 1Q7HA 5AIGA 1B27A 1CEWI 1O7GB 3EX9A 4NREA 1PU4A 1LQMB 4WYKB 2BMOB 5HGRA 4FCJA 5IG5A 1TTOA 1QJGA 1V74A 5AEWB 2KF3A 1QALA 2CK3H 1RHLA 3UL6A 3MHEA 4XBXA 1IQYA 4HKVB 3B8LA 1JKGB 3LMLA 1FGOA 1AVLA 1CYUA 1UI7A 4HM5B 4XB5A 3RGRA 3D5IA 3PCRA 1Q42A 2BU4A 1BUJA 2CIUA 1FUTA 2ZHXB 1M904 2K3DA 1F8NA 3CPW2 2FXTA 2OTJ3 1YJW3 1UGHI 1T2IA 1G0TA 1Q40B 3BNDA 1O7NB 4EXRA 3EN8A 1K41A 1BGSA 3NQZA 1JKGA 1TRQA 1YVSA 2Q07A 2RSXA 3DGNA 4I5QA 1Q9EA 1I0VA 3LTCA 4BU4A 3JUOA 1G02A 3N54B 3A5EA 1B3SA 3QRDA 1R4CA 4GL6A 3MG2A 2I9WA 1VQ63 1TJDA 2C11A 1X1UA 1QVG2 4FCMA 4FMDA 4N3VA 1QMAA 5IW9A 5IENA 2KXGA 2B24B 5IG4A 4KFDA 3CMA3 5G1KA 1OHPA 1GMPA 3CNXA 5GSPA 1NB5I 3DH2A 2D42A 2OCTA 1SIHA 1WMNA 1UDII 3AGOA 1WNHA 3D79A 2BT3A 1W7CA 2LQVA 3I0YA 3LTAA 2XH9A 4K61A 1FGRA 2MF7A 3PGBA 4LYLB 4N6NB 5KP3A 1RCLA 1YIT3 5A0OB 1RGCA 3MSOA 5IEOA 3CC43 1E3RA 3HIIA 3LH4A 1JBSA 5M1AA 1OGZA 2Z76A 4O8SA 2WOFA 4XBYA 3LZAA 2P0MA 3KN4A 3EJVA 5G2GA 1I3IA 2Y74A 3AGNA 1WTHA 3EBYA 3IMAB 4FMCA 3X42A 4BTXA 1VQL3 1N9JA 1T3BA 1JZOA 3G0KA 4GSPA 1BU4A 1B2SA 2L4VA 1O7PB 2QA43 3CC73 4OK0A 3DMCA 2H0GA 2H0HA 4JRFA 3WMDA 3UJMA 1W2ZA 4IT7A 3MG3A 4HM7B 1BNFA 2KF6A 4OVMA 1GY7A 1OHOA 2OQEC 3KE7A 3KFQC 3BIRA 3GAXA 1RGEA 1UUWB 4HBRA 1BNEA 1Q7Y4 1D6YA 5D81A 3NBRA 1KSIA 3SOAA 2CFGA 5D82A 2CW9A 1ULJB 2HMKB 1N5PA 3Q1CA 1TIJA 1LNIA 8RNTA 3OW22 1M1XB 1SQWA 2QGUA 3T0UA 1S723 4WWUC 4GB5A 1BIRA 3B7CA 1LXEA 1GOVA 1MGWA 1RGHA 3HI7A 3MPHA 3VGNA 1MWRA 4PEJA 4I4KA 3MG1A 3JUPA 3GWRA 4LSOA 2KCDA 5CLKA 1UGIA 1QAKA 3F7SA 3RNTA 1RGKA 1LOWA 4HM4B 2XGNA 3F14A 6GSPA 4BTWA 1ROVA 4EC6A 3DY5A 1UCLA 3FH1A 2RFRA 2W56A 3FZWA 5HOHA 1JB2A 1LNHA 1LVNA 2WOHA 2D1WA 3OWSA 4RNYA 3X40A 4HYZA 1VQO3 4MMYB 3EE1A 1BVIA 2KF4A 3CCU3 5BXQA 2C4BA 3MWZA 1BRIA 4OUQA 1IVUA 3NV0B 3ER7A 4WFOA 5STDA 1X1XA 5D83A 4KFEA 3DM8A
chains in the Genus database with same CATH topology
2GBXB 2W2CA 3PZWA 3LTDA 3WDGB 4IIAA 3QK9A 3WOEB 1DYUA 3OV4A 3EHCA 1FGQA 1YHQ3 2RCDA 1RRHA 3E99A 4N6LA 4L7KA 1U8CB 4LMIA 2CHCA 5AIHA 2PNCA 1VQ73 3CCS3 1NB3I 2HMNB 4FR9A 1M9GA 3J7Yd 1W2B2 3BLZA 2V1LA 4TX4A 1SIIA 4WP5A 1SJWA 1EG9B 3FF2A 3CCQ3 1EQKA 2WGOA 5IEPA 1O7HB 1OCVA 1N9EA 1TUHA 3CD63 3Q2PA 2B1XB 2Y73A 1WMPA 1NWWA 2BMQB 3FG3A 1MOLA 5ELJA 2CWVA 2XF3A 1K9M4 2CH9A 3NM2A 4K1UA 1STFI 4MMZB 1D6ZA 3MKIA 3CC23 3NQYA 4FMBA 4HZ9B 2CFLA 4XM4A 1M1K4 3DUKA 2QEX3 3SX1A 3UL5A 3K9MC 4WHAA 3WA2X 5ELUA 1J2BA 3BNCA 4JF8A 1S5AA 2CKFB 3CCL3 1RRLA 1GY5A 3EQQB 1RKYA 3CXC2 3SEDA 1VQ83 2XRXB 3FLJA 3IJEB 1OPYA 4R9LA 2CWUA 3D9RA 3X3XA 1A90A 3HZPA 3LOYA 5KP4A 5IG3A 4FMAA 1Y4KA 2O9UX 2PZVA 3EN1B 3GZXB 3OWYA 4BTYA 1VQM3 1FUWA 1W6GA 1E97A 4AKZA 4LEHA 4R80A 2MC8A 3WODG 1DMQA 5I97A 4RNZA 1OUNA 2KRTA 3BB9A 1N8R4 2E2TA 1YJ93 3JUNA 1OH0A 1C7HA 1YVBI 1DMNA 4G1MB 3X3ZA 1YIJ3 1IVXA 1US1A 3NM7A 1IU7A 3NHXA 1TFOA 3B4OA 1W00A 3CCJ3 2M7OA 2XFSA 2ZDJA 2W03A 5BVBA 4K90B 2P09A 5TGNA 1VQK3 2QIYA 2RGQA 2BNGA 1NO3A 3UNLA 1CYVA 1RJOA 3F40A 1ISKA 4HM6B 1DVDA 3U97A 4RBNA 1UW1A 1T5YA 2IMJA 1GD4A 2K0MA 3FF0A 1KD14 1O7WB 4HM0B 1OACA 3CCE3 2Z6BA 2CG0A 4N6V0 2LYXA 4R1KA 1K28A 3K7CA 1L5GB 2GEYA 2K54A 3FSDA 3LT8A 1IQXA 2IUJA 3VF1A 2E2VA 2F86B 3A76A 2ML6A 2W56B 3CPOA 4AKYA 3LT9A 4EBGA 3UB1A 3G4S3 1JNQA 2XSHB 4HZBB 1Q864 4MMXB 2XFTA 2F98A 1NJI4 3JVCA 1NU3A 2ZL8A 2A15A 1E3VA 1OGXA 2OWPA 1G96A 3PCSA 2SBLA 3I553 1GYBA 1JV2B 5AIFA 3NV0A 2CG1A 4N6UA 5DREA 5EVHA 4EYCA 2FNQA 2ML5A 3EF8A 1JN5B 4HJLB 4H3UA 5CF1A 2F99A 4X2OA 2INXA 2IA7A 3EC9A 4STDA 1JB5A 2XGLA 4HM3B 4HM1B 3BNBA 1ROAA 2O3OA 1ULIB 1JRQA 2GU3A 3O8YA 1KQS2 3AMOB 2Z77A 5IF6A 3G713 3I563 4K1VA 1KC84 1JB4A 3K5TA 1U5OA 3JUMA 1PFPA 3KSED 1BUQA 5IERA 2HMMB 2IUKA 1D6UA 3TDGA 1ZO2A 3WOFB 4R9KA 4KFFA 1JN5A 3ROBA 5AYSC 3NBJA 1FGTA 5FW5A 3ALAA 4KZ1A 1MNLA 3KIIA 1AVKA 1IV9A 2CFDA 1IQ8A 3X3YA 5AEUB 1VZZA 1SPUA 3FCSB 2Z7AA 3D3LA 1YGEA 2CC3A 3F7XA 2GU1A 1EKMA 1DVCA 4KVHA 4ORLA 3KZTA 5CK6A 2UX0A 1IT7A 5FGOA 2HMLB 3V98A 2HMJB 1OHSA 3GZBA 3U1WA 2JQ5A 4XDVA 1GY6A 2W0QA 3EB8A 5AI1A 3T8UA 3FG4A 1OF5A 4Q53A 3FKAA 1N8QA 3FG1A 3NUVA 1LOXA 2P0XA 3G8ZA 3S5CA 2W9PA 3F8XA 5JPPA 3KKGA 3IPTA 3NXJA 4RZMA 1OF5B 2XEPA 3S27A 3SXXA 2OTL3 2XSOB 2HMOB 4WYKA 5EQLA 3DZLA 3STDA 4HM8B 2OOVA 4N6OB 3RDEA 4R4KA 5EEOA 3BNEA 2BHMA 1QVF2 1W02A 3V92A 3EBTA 6STDA 3HIGA 3KSPA 4XBTA 1O7MB 4HM2B 5AIIA 1EA2A 4MEIA 1RN7A 5KP1A 4AEQA 1UUVB 1GD3A 3OWUA 1FGMA 4NHFA 1K8A4 3N8BA 4O3VA 3N9HA 3WA3A 3CCR3 2STDA 1Q7Y4 2CWTA 2W04A 1IVVA 3K63A 3HK4A 5AYRB 3G6E3 1Q40A 3F8HA 4L8PA 3DGOA 4EV2A 1YI23 1NDOB 3PS8A 1IDPA 1VQ53 2C10A 1IT8A 3LTBA 1VQN3 1A67A 4CDLA 3LXUX 4N6TA 3LYGA 3OX9A 3GRDA 5LC7A 1TU5A 4N6MA 1YJN3 5IG0A 5JBSA 1HU9A 2JDIH 1GS3A 3Q90A 4J9AA 2OOVC 1JJ22 3CME3 3JUQA 3H3HA 3M8CA 1VQ43 3RGAA 4QWTA 3AMOA 1N5HA 3H51A 2GEXA 5LC6A 3DXOA 2FGTA 4MJDA 4LGQA 4CCVA 5CF2A 2W9QA 1UI8A 1TP6A 2CFKA 1HKXA 1W6YA 2WGQA 3SOYA 2P38A 3FGYA 2YFJB 3X41A 1IV7A 1W5ZA 4O2HA 4FCZA 2WO0A 1VQP3 1WMOA 2BO9B 2YFIB 5JPUA 3MYTA 3V99A 1VQ93 2GXFA 1A2KA 2YFLB 1K734 1W4NA 1FA3A 1W6CA 3CCM3 1ASKA 1STDA 3CU3A 4ZM8A 1AV4A 2R4IA 3DGLA 3G16A 3OXAA 1Q824 3CCV3 1TFKA 1IVWA 4IPBA 4EV5A 2BMRB 3PYJA 1Q814 4L8OA 3B4PA 5CXOA 1DMMA 1W01A 3GZRA 2OQEA 3S67A 3GZYB 3K0ZA 2E2UA 3S29A 5DRVA 1QAFA 4O02B 3VSYA 3ECFA 3HX8A 3CNMA 3SVAA 2W6JH 2YX9A 3F9SA 4X2HA 1IK3A 4H61A 1KWIA 3NX0A 3PXMA 3SLUA 1Z1SA 1AR0A 1ZX2A 2CFWA 3L0RA 4HVNA 4J8TA 3DGMA 7STDA 1A2VA 4U13A 2XR8B 2P05A 2GBWB 1CQSA 1WQLB 3S28A 3NBBA 4LZIA 4XDWA 8CHOA 3T8NA 5AIGA 1PU4A 1CEWI 1O7GB 3EX9A 4NREA 4WYKB 2BMOB 5HGRA 4FCJA 5IG5A 1QJGA 1V74A 5AEWB 1QALA 2CK3H 3UL6A 3MHEA 4XBXA 1IQYA 4HKVB 3B8LA 1JKGB 3LMLA 1FGOA 1AVLA 1CYUA 1UI7A 4HM5B 4XB5A 3RGRA 3PCRA 1Q42A 2CIUA 1M904 3CPW2 1F8NA 2FXTA 2OTJ3 1YJW3 1Q40B 3BNDA 1O7NB 4EXRA 3EN8A 1K41A 3NQZA 1JKGA 2RSXA 2Q07A 3DGNA 3LTCA 3JUOA 3N54B 3QRDA 1R4CA 4GL6A 3MG2A 2I9WA 1VQ63 2C11A 1QVG2 4FCMA 4FMDA 4N3VA 1QMAA 5IW9A 5IENA 2KXGA 2B24B 5IG4A 4KFDA 3CMA3 1OHPA 3CNXA 1NB5I 2D42A 2OCTA 1SIHA 1WMNA 1WNHA 2BT3A 1W7CA 2LQVA 3I0YA 3LTAA 2XH9A 4K61A 1FGRA 2MF7A 3PGBA 4N6NB 5KP3A 1YIT3 5A0OB 3CC43 3MSOA 5IEOA 1E3RA 3HIIA 3LH4A 1OGZA 2Z76A 4O8SA 2WOFA 4XBYA 3LZAA 2P0MA 3KN4A 3EJVA 5G2GA 2Y74A 1WTHA 3EBYA 3IMAB 4FMCA 3X42A 4BTXA 1VQL3 1N9JA 3G0KA 2L4VA 1O7PB 2QA43 3CC73 4OK0A 3DMCA 4JRFA 3WMDA 3UJMA 1W2ZA 4IT7A 3MG3A 4HM7B 4OVMA 1GY7A 1OHOA 2OQEC 3KE7A 3KFQC 3GAXA 1UUWB 4HBRA 1D6YA 5D81A 3NBRA 1KSIA 3SOAA 2CFGA 5D82A 1ULJB 2CW9A 2HMKB 1N5PA 3Q1CA 1TIJA 3OW22 1M1XB 1SQWA 2QGUA 3T0UA 1S723 4WWUC 4GB5A 3B7CA 3HI7A 1LXEA 3VGNA 3MPHA 4PEJA 4I4KA 3MG1A 3JUPA 3GWRA 4LSOA 2KCDA 5CLKA 1QAKA 3F7SA 4HM4B 2XGNA 3F14A 4BTWA 1ROVA 4EC6A 3DY5A 3FH1A 2RFRA 2W56A 3FZWA 1JB2A 1LNHA 1LVNA 2WOHA 2D1WA 3OWSA 4RNYA 3X40A 4HYZA 1VQO3 4MMYB 3EE1A 3CCU3 5BXQA 3MWZA 4WFOA 4OUQA 1IVUA 3NV0B 3ER7A 5STDA 5D83A 4KFEA 3DM8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CH9 A;  1FUW A;  1WNH A;  2O9U X;  3PS8 A;  4IT7 A;  4LZI A;  5EQL A;  1DVD A;  1G96 A;  4CCV A;  1STF I;  4N6O B;  1A67 A;  1CEW I;  2W9Q A;  3PYJ A;  4N6N B;  3KFQ C;  4N6T A;  5A0O B;  1GD4 A;  3GAX A;  1A90 A;  4N6U A;  3LH4 A;  4N6L A;  1MNL A;  3S67 A;  5LC7 A;  4EYC A;  1IV9 A;  3QRD A;  1R4C A;  3K9M C;  4N6V 0;  4N6M A;  1NB3 I;  1RN7 A;  3UL5 A;  1YVB I;  5ELU A;  1N5P A;  1M9G A;  1IV7 A;  3SVA A;  3UL6 A;  1TIJ A;  1GD3 A;  4TX4 A;  1ROA A;  2BO9 B;  3IMA B;  2KXG A;  1KWI A;  1CYU A;  1N9J A;  3NX0 A;  3PXM A;  2W9P A;  1EQK A;  1DVC A;  3L0R A;  1LXE A;  3MWZ A;  3Q2P A;  5ELJ A;  1FA3 A;  1NB5 I;  1N5H A;  4ZM8 A;  1PFP A;  3KSE D;  1MOL A;  1CYV A;  2OCT A;  5LC6 A; 
#chains in the Genus database with same CATH topology
 2GBX B;  2W2C A;  3PZW A;  1B20 A;  1EUI C;  1I2F A;  1EEJ A;  3LTD A;  3WDG B;  4IIA A;  3QK9 A;  3WOE B;  1CH0 A;  1DYU A;  3OV4 A;  3EHC A;  3HOH A;  1FGQ A;  2ZA4 A;  1B2U A;  2RCD A;  1RRH A;  1YHQ 3;  3E99 A;  4N6L A;  4L7K A;  1U8C B;  1JZD A;  4LMI A;  2CHC A;  5AIH A;  2PNC A;  1BSE A;  1VQ7 3;  3CCS 3;  1IYY A;  1NB3 I;  2HMN B;  4FR9 A;  1I0X A;  1FZU A;  1M9G A;  2RNT A;  3J7Y d;  1W2B 2;  3BLZ A;  2V1L A;  4TX4 A;  1SII A;  4WP5 A;  1SJW A;  1EG9 B;  3FF2 A;  3CCQ 3;  1SAR A;  1EQK A;  2WGO A;  5IEP A;  1O7H B;  1OCV A;  1N9E A;  1TUH A;  3AHW A;  5M18 A;  3Q2P A;  2B1X B;  3CD6 3;  1GOU A;  1GMR A;  1LOV A;  1WMP A;  2Y73 A;  3ZFZ A;  1NWW A;  2BMQ B;  3FG3 A;  1MOL A;  5ELJ A;  2CWV A;  2XF3 A;  1K9M 4;  1BRG A;  2CH9 A;  2HOH A;  3NM2 A;  1BRK A;  4K1U A;  1STF I;  1YNV X;  3ZG0 A;  4MMZ B;  1D6Z A;  3MKI A;  1BOX A;  3CC2 3;  3NQY A;  6RNT A;  4FMB A;  4HZ9 B;  2CFL A;  1BNI A;  1UCI A;  1HYF A;  4XM4 A;  1M1K 4;  3DUK A;  1I2E A;  4CPK A;  3SX1 A;  2QEX 3;  3UL5 A;  3K9M C;  4WHA A;  3WA2 X;  5ELU A;  1J2B A;  3BNC A;  3BU4 A;  4GHO A;  4JF8 A;  1S5A A;  2UUG C;  2CKF B;  1R4Y A;  1RRL A;  3CCL 3;  1LRA A;  1GY5 A;  3EQQ B;  1RKY A;  3CXC 2;  3SED A;  1VQ8 3;  4ILF A;  2XRX B;  3FLJ A;  3IJE B;  1OPY A;  4R9L A;  3WHO A;  1NNV A;  1DE3 A;  2CWU A;  3D9R A;  3X3X A;  1A90 A;  3HZP A;  3LOY A;  5KP4 A;  5IG3 A;  4FMA A;  1Y4K A;  1X1W A;  2O9U X;  2PZV A;  3EN1 B;  3GZX B;  3OWY A;  4BTY A;  1VQM 3;  1PY3 A;  1BNG A;  1E97 A;  1LOY A;  1W6G A;  4LEH A;  4AKZ A;  2R41 A;  4R80 A;  2MC8 A;  3WOD G;  1DMQ A;  5I97 A;  4RNZ A;  1OUN A;  2KRT A;  3BB9 A;  1N8R 4;  2E2T A;  1YJ9 3;  3JUN A;  1OH0 A;  1C7H A;  1YVB I;  1DMN A;  4G1M B;  3X3Z A;  1YIJ 3;  1IVX A;  1US1 A;  3NM7 A;  4RNT A;  1IU7 A;  3NHX A;  1TFO A;  3B4O A;  1W00 A;  3CCJ 3;  2M7O A;  2XFS A;  4BL3 A;  2ZDJ A;  2W03 A;  5BVB A;  1C54 A;  4K90 B;  2P09 A;  5TGN A;  1VQK 3;  2QIY A;  2L1S A;  2RGQ A;  2CX0 A;  2BNG A;  1BNR A;  1NO3 A;  4J5G A;  3UNL A;  2CX1 A;  1CYV A;  1RJO A;  3F40 A;  1ISK A;  4HM6 B;  1DVD A;  3U97 A;  4RBN A;  1UW1 A;  2KF5 A;  1T5Y A;  2IMJ A;  1GD4 A;  2K0M A;  1I3F A;  3FF0 A;  1KD1 4;  1O7W B;  4HM0 B;  1OAC A;  3CCE 3;  2Z6B A;  2CG0 A;  4N6V 0;  2LYX A;  4R1K A;  1K28 A;  2F5M A;  2J8X B;  3K7C A;  1L5G B;  2GEY A;  2K54 A;  3FSD A;  3LT8 A;  1IQX A;  2IUJ A;  3VF1 A;  2E2V A;  1RTU A;  4CJN A;  2F86 B;  3A76 A;  2ML6 A;  2W56 B;  3CPO A;  4AKY A;  3LT9 A;  4EBG A;  3UB1 A;  3G4S 3;  1JNQ A;  2XSH B;  3D4A A;  4HZB B;  2H0I A;  1Q86 4;  4MMX B;  1I70 A;  2XFT A;  1FW7 A;  2F98 A;  3KCH A;  7GSP A;  3JVC A;  1NJI 4;  1NU3 A;  2A15 A;  2ZL8 A;  1E3V A;  1OGX A;  4J5K A;  2OWP A;  1G96 A;  3PCS A;  2SBL A;  3I55 3;  1BSA A;  1GYB A;  1JV2 B;  5AIF A;  4EW5 A;  3NV0 A;  2CG1 A;  4N6U A;  4BL2 A;  5DRE A;  2F5W A;  5EVH A;  4EYC A;  1MGR A;  2FNQ A;  2ML5 A;  3EF8 A;  1JN5 B;  4HJL B;  4H3U A;  5CF1 A;  2F99 A;  4X2O A;  2INX A;  2IA7 A;  3EC9 A;  4STD A;  1JB5 A;  7RNT A;  2XGL A;  4HM3 B;  4HM1 B;  2IYJ A;  3BNB A;  1ROA A;  2O3O A;  1ULI B;  1JRQ A;  2GU3 A;  3O8Y A;  1KQS 2;  3AMO B;  2Z77 A;  5IF6 A;  3G71 3;  3I56 3;  4K1V A;  1KC8 4;  1BRJ A;  1JB4 A;  3K5T A;  1U5O A;  3JUM A;  1PFP A;  3KSE D;  1BUQ A;  1BSD A;  5IER A;  2HMM B;  2IUK A;  1D6U A;  3TDG A;  1ZO2 A;  3WOF B;  1RMS A;  1GOY A;  4R9K A;  1AQZ A;  1JN5 A;  4KFF A;  3ROB A;  5AYS C;  3NBJ A;  1FGT A;  5FW5 A;  1V57 A;  3ALA A;  1BNS A;  4KZ1 A;  1MNL A;  1JBT A;  3KII A;  1AVK A;  1IV9 A;  2CFD A;  4HAA A;  1IQ8 A;  1UCK A;  3X3Y A;  5AEU B;  1VZZ A;  1SPU A;  3FCS B;  2Z7A A;  3D3L A;  1YGE A;  2F4Y A;  2CC3 A;  2AAE A;  3F7X A;  2GU1 A;  1EKM A;  1DVC A;  4KVH A;  4ORL A;  3KZT A;  5CK6 A;  1B2M A;  2UX0 A;  1IT7 A;  1DET A;  5FGO A;  2HML B;  3V98 A;  2HMJ B;  1OHS A;  3GZB A;  3U1W A;  2JQ5 A;  1B2X A;  4XDV A;  1GY6 A;  2W0Q A;  1I8V A;  3EB8 A;  1BRN L;  5AI1 A;  2AAD A;  3T8U A;  3FG4 A;  1OF5 A;  2F56 A;  3FKA A;  4Q53 A;  1N8Q A;  9RNT A;  1V58 A;  1B21 A;  3FG1 A;  1ZGX A;  1FUW A;  3NUV A;  2RBI A;  1LOX A;  2P0X A;  3G8Z A;  3S5C A;  2W9P A;  3F8X A;  5JPP A;  3KKG A;  3IPT A;  1RCK A;  3NXJ A;  4RZM A;  1OF5 B;  2XEP A;  3S27 A;  3SXX A;  2OTL 3;  2XSO B;  2HMO B;  4WYK A;  5EQL A;  3DZL A;  3STD A;  4HM8 B;  1RNT A;  4N6O B;  2OOV A;  1RGG A;  1AY7 A;  3RDE A;  4R4K A;  5EEO A;  3BNE A;  2BHM A;  1QVF 2;  1W02 A;  3V92 A;  3EBT A;  1ZS7 A;  6STD A;  3HIG A;  3KSP A;  4XBT A;  1O7M B;  4HM2 B;  5AII A;  1EA2 A;  5BIR A;  4MEI A;  1RN7 A;  1MWT A;  5KP1 A;  4AEQ A;  1UUV B;  1GD3 A;  3OWU A;  1FGM A;  4NHF A;  1K8A 4;  3N8B A;  4O3V A;  3N9H A;  3WA3 A;  3CCR 3;  2SAR A;  2STD A;  3SYU A;  2CWT A;  2W04 A;  1RN1 A;  1IVV A;  3K63 A;  1BSB A;  3HK4 A;  1UCJ A;  5AYR B;  3G6E 3;  1MWS A;  1Q40 A;  3F8H A;  4L8P A;  1RDS A;  3DGO A;  4DKI A;  1BRH A;  4EV2 A;  1YI2 3;  1NDO B;  3PS8 A;  1IDP A;  1VQ5 3;  1I2G A;  2C10 A;  1IT8 A;  3LTB A;  1VQN 3;  1A67 A;  4CDL A;  3LXU X;  1A2P A;  4N6T A;  4KT3 B;  4NPB A;  5RNT A;  3LYG A;  3OX9 A;  3GRD A;  5LC7 A;  1TU5 A;  4N6M A;  1LQG C;  1YJN 3;  1RSN A;  5IG0 A;  5JBS A;  1HU9 A;  5G1L A;  2JDI H;  1GS3 A;  3Q90 A;  4J9A A;  2OOV C;  1JJ2 2;  3CME 3;  1X1Y A;  3WR2 A;  3JUQ A;  3H3H A;  3M8C A;  1VQ4 3;  3Q3F A;  1BAO A;  1B2Z A;  3RGA A;  4QWT A;  1GMQ A;  1RLS A;  1UUG B;  3AMO A;  1N5H A;  3H51 A;  2GEX A;  5LC6 A;  3DXO A;  2FGT A;  4MJD A;  3GSP A;  4LGQ A;  1RN4 A;  1VQQ A;  4CCV A;  5CF2 A;  1YGW A;  2W9Q A;  1UI8 A;  1TP6 A;  2CFK A;  5M19 A;  1HKX A;  1W6Y A;  2WGQ A;  4HOH A;  1BSC A;  3SOY A;  1JBR A;  4BIR A;  2P38 A;  3FGY A;  2IY2 A;  3ZG5 A;  2YFJ B;  1RGF A;  3X41 A;  1IV7 A;  1W5Z A;  4O2H A;  4FCZ A;  2WO0 A;  1VQP 3;  1WMO A;  2BO9 B;  2YFI B;  1MWU A;  2BIR A;  5JPU A;  3MYT A;  3V99 A;  1VQ9 3;  2GXF A;  1A2K A;  2YFL B;  1K73 4;  1HZ1 A;  1FYS A;  3DGY A;  1W4N A;  1FA3 A;  1W6C A;  3CCM 3;  1ASK A;  1STD A;  3CU3 A;  4ZM8 A;  1AV4 A;  2R4I A;  3DGL A;  3G16 A;  3OXA A;  1Q82 4;  1RNB A;  3CCV 3;  1TFK A;  3D5G A;  1IVW A;  4IPB A;  4EV5 A;  2BMR B;  3PYJ A;  1Q81 4;  1RGL A;  3B4P A;  4L8O A;  5CXO A;  1GSP A;  2GSP A;  1DMM A;  1W01 A;  3GZR A;  2OQE A;  3S67 A;  3GZY B;  3K0Z A;  2E2U A;  3S29 A;  3AHS A;  5DRV A;  1QAF A;  4O02 B;  5BU4 A;  1BNJ A;  1T2H A;  3VSY A;  3ECF A;  1RGA A;  3CNM A;  1TRP A;  2W6J H;  2YX9 A;  3F9S A;  3HX8 A;  3SVA A;  4X2H A;  1IK3 A;  1FUS A;  4H61 A;  1KWI A;  1BAN A;  3NX0 A;  1BRS A;  3PXM A;  3SLU A;  1Z1S A;  1AR0 A;  1ZX2 A;  2CFW A;  3L0R A;  4HVN A;  4J8T A;  3DGM A;  7STD A;  1A2V A;  2UGI A;  4U13 A;  2XR8 B;  1PYL A;  3URP A;  2P05 A;  2GBW B;  1CQS A;  1WQL B;  3S28 A;  2KAA A;  3NBB A;  4LZI A;  4XDW A;  8CHO A;  3T8N A;  1Q7H A;  5AIG A;  1B27 A;  1CEW I;  1O7G B;  3EX9 A;  4NRE A;  1PU4 A;  1LQM B;  4WYK B;  2BMO B;  5HGR A;  4FCJ A;  5IG5 A;  1TTO A;  1QJG A;  1V74 A;  5AEW B;  2KF3 A;  1QAL A;  2CK3 H;  1RHL A;  3UL6 A;  3MHE A;  4XBX A;  1IQY A;  4HKV B;  3B8L A;  1JKG B;  3LML A;  1FGO A;  1AVL A;  1CYU A;  1UI7 A;  4HM5 B;  4XB5 A;  3RGR A;  3D5I A;  3PCR A;  1Q42 A;  2BU4 A;  1BUJ A;  2CIU A;  1FUT A;  2ZHX B;  1M90 4;  2K3D A;  1F8N A;  3CPW 2;  2FXT A;  2OTJ 3;  1YJW 3;  1UGH I;  1T2I A;  1G0T A;  1Q40 B;  3BND A;  1O7N B;  4EXR A;  3EN8 A;  1K41 A;  1BGS A;  3NQZ A;  1JKG A;  1TRQ A;  1YVS A;  2Q07 A;  2RSX A;  3DGN A;  4I5Q A;  1Q9E A;  1I0V A;  3LTC A;  4BU4 A;  3JUO A;  1G02 A;  3N54 B;  3A5E A;  1B3S A;  3QRD A;  1R4C A;  4GL6 A;  3MG2 A;  2I9W A;  1VQ6 3;  1TJD A;  2C11 A;  1X1U A;  1QVG 2;  4FCM A;  4FMD A;  4N3V A;  1QMA A;  5IW9 A;  5IEN A;  2KXG A;  2B24 B;  5IG4 A;  4KFD A;  3CMA 3;  5G1K A;  1OHP A;  1GMP A;  3CNX A;  5GSP A;  1NB5 I;  3DH2 A;  2D42 A;  2OCT A;  1SIH A;  1WMN A;  1UDI I;  3AGO A;  1WNH A;  3D79 A;  2BT3 A;  1W7C A;  2LQV A;  3I0Y A;  3LTA A;  2XH9 A;  4K61 A;  1FGR A;  2MF7 A;  3PGB A;  4LYL B;  4N6N B;  5KP3 A;  1RCL A;  1YIT 3;  5A0O B;  1RGC A;  3MSO A;  5IEO A;  3CC4 3;  1E3R A;  3HII A;  3LH4 A;  1JBS A;  5M1A A;  1OGZ A;  2Z76 A;  4O8S A;  2WOF A;  4XBY A;  3LZA A;  2P0M A;  3KN4 A;  3EJV A;  5G2G A;  1I3I A;  2Y74 A;  3AGN A;  1WTH A;  3EBY A;  3IMA B;  4FMC A;  3X42 A;  4BTX A;  1VQL 3;  1N9J A;  1T3B A;  1JZO A;  3G0K A;  4GSP A;  1BU4 A;  1B2S A;  2L4V A;  1O7P B;  2QA4 3;  3CC7 3;  4OK0 A;  3DMC A;  2H0G A;  2H0H A;  4JRF A;  3WMD A;  3UJM A;  1W2Z A;  4IT7 A;  3MG3 A;  4HM7 B;  1BNF A;  2KF6 A;  4OVM A;  1GY7 A;  1OHO A;  2OQE C;  3KE7 A;  3KFQ C;  3BIR A;  3GAX A;  1RGE A;  1UUW B;  4HBR A;  1BNE A;  1Q7Y 4;  1D6Y A;  5D81 A;  3NBR A;  1KSI A;  3SOA A;  2CFG A;  5D82 A;  2CW9 A;  1ULJ B;  2HMK B;  1N5P A;  3Q1C A;  1TIJ A;  1LNI A;  8RNT A;  3OW2 2;  1M1X B;  1SQW A;  2QGU A;  3T0U A;  1S72 3;  4WWU C;  4GB5 A;  1BIR A;  3B7C A;  1LXE A;  1GOV A;  1MGW A;  1RGH A;  3HI7 A;  3MPH A;  3VGN A;  1MWR A;  4PEJ A;  4I4K A;  3MG1 A;  3JUP A;  3GWR A;  4LSO A;  2KCD A;  5CLK A;  1UGI A;  1QAK A;  3F7S A;  3RNT A;  1RGK A;  1LOW A;  4HM4 B;  2XGN A;  3F14 A;  6GSP A;  4BTW A;  1ROV A;  4EC6 A;  3DY5 A;  1UCL A;  3FH1 A;  2RFR A;  2W56 A;  3FZW A;  5HOH A;  1JB2 A;  1LNH A;  1LVN A;  2WOH A;  2D1W A;  3OWS A;  4RNY A;  3X40 A;  4HYZ A;  1VQO 3;  4MMY B;  3EE1 A;  1BVI A;  2KF4 A;  3CCU 3;  5BXQ A;  2C4B A;  3MWZ A;  1BRI A;  4OUQ A;  1IVU A;  3NV0 B;  3ER7 A;  4WFO A;  5STD A;  1X1X A;  5D83 A;  4KFE A;  3DM8 A; 
#chains in the Genus database with same CATH homology
 2GBX B;  2W2C A;  3PZW A;  3LTD A;  3WDG B;  4IIA A;  3QK9 A;  3WOE B;  1DYU A;  3OV4 A;  3EHC A;  1FGQ A;  1YHQ 3;  2RCD A;  1RRH A;  3E99 A;  4N6L A;  4L7K A;  1U8C B;  4LMI A;  2CHC A;  5AIH A;  2PNC A;  1VQ7 3;  3CCS 3;  1NB3 I;  2HMN B;  4FR9 A;  1M9G A;  3J7Y d;  1W2B 2;  3BLZ A;  2V1L A;  4TX4 A;  1SII A;  4WP5 A;  1SJW A;  1EG9 B;  3FF2 A;  3CCQ 3;  1EQK A;  2WGO A;  5IEP A;  1O7H B;  1OCV A;  1N9E A;  1TUH A;  3CD6 3;  3Q2P A;  2B1X B;  2Y73 A;  1WMP A;  1NWW A;  2BMQ B;  3FG3 A;  1MOL A;  5ELJ A;  2CWV A;  2XF3 A;  1K9M 4;  2CH9 A;  3NM2 A;  4K1U A;  1STF I;  4MMZ B;  1D6Z A;  3MKI A;  3CC2 3;  3NQY A;  4FMB A;  4HZ9 B;  2CFL A;  4XM4 A;  1M1K 4;  3DUK A;  2QEX 3;  3SX1 A;  3UL5 A;  3K9M C;  4WHA A;  3WA2 X;  5ELU A;  1J2B A;  3BNC A;  4JF8 A;  1S5A A;  2CKF B;  3CCL 3;  1RRL A;  1GY5 A;  3EQQ B;  1RKY A;  3CXC 2;  3SED A;  1VQ8 3;  2XRX B;  3FLJ A;  3IJE B;  1OPY A;  4R9L A;  2CWU A;  3D9R A;  3X3X A;  1A90 A;  3HZP A;  3LOY A;  5KP4 A;  5IG3 A;  4FMA A;  1Y4K A;  2O9U X;  2PZV A;  3EN1 B;  3GZX B;  3OWY A;  4BTY A;  1VQM 3;  1FUW A;  1W6G A;  1E97 A;  4AKZ A;  4LEH A;  4R80 A;  2MC8 A;  3WOD G;  1DMQ A;  5I97 A;  4RNZ A;  1OUN A;  2KRT A;  3BB9 A;  1N8R 4;  2E2T A;  1YJ9 3;  3JUN A;  1OH0 A;  1C7H A;  1YVB I;  1DMN A;  4G1M B;  3X3Z A;  1YIJ 3;  1IVX A;  1US1 A;  3NM7 A;  1IU7 A;  3NHX A;  1TFO A;  3B4O A;  1W00 A;  3CCJ 3;  2M7O A;  2XFS A;  2ZDJ A;  2W03 A;  5BVB A;  4K90 B;  2P09 A;  5TGN A;  1VQK 3;  2QIY A;  2RGQ A;  2BNG A;  1NO3 A;  3UNL A;  1CYV A;  1RJO A;  3F40 A;  1ISK A;  4HM6 B;  1DVD A;  3U97 A;  4RBN A;  1UW1 A;  1T5Y A;  2IMJ A;  1GD4 A;  2K0M A;  3FF0 A;  1KD1 4;  1O7W B;  4HM0 B;  1OAC A;  3CCE 3;  2Z6B A;  2CG0 A;  4N6V 0;  2LYX A;  4R1K A;  1K28 A;  3K7C A;  1L5G B;  2GEY A;  2K54 A;  3FSD A;  3LT8 A;  1IQX A;  2IUJ A;  3VF1 A;  2E2V A;  2F86 B;  3A76 A;  2ML6 A;  2W56 B;  3CPO A;  4AKY A;  3LT9 A;  4EBG A;  3UB1 A;  3G4S 3;  1JNQ A;  2XSH B;  4HZB B;  1Q86 4;  4MMX B;  2XFT A;  2F98 A;  1NJI 4;  3JVC A;  1NU3 A;  2ZL8 A;  2A15 A;  1E3V A;  1OGX A;  2OWP A;  1G96 A;  3PCS A;  2SBL A;  3I55 3;  1GYB A;  1JV2 B;  5AIF A;  3NV0 A;  2CG1 A;  4N6U A;  5DRE A;  5EVH A;  4EYC A;  2FNQ A;  2ML5 A;  3EF8 A;  1JN5 B;  4HJL B;  4H3U A;  5CF1 A;  2F99 A;  4X2O A;  2INX A;  2IA7 A;  3EC9 A;  4STD A;  1JB5 A;  2XGL A;  4HM3 B;  4HM1 B;  3BNB A;  1ROA A;  2O3O A;  1ULI B;  1JRQ A;  2GU3 A;  3O8Y A;  1KQS 2;  3AMO B;  2Z77 A;  5IF6 A;  3G71 3;  3I56 3;  4K1V A;  1KC8 4;  1JB4 A;  3K5T A;  1U5O A;  3JUM A;  1PFP A;  3KSE D;  1BUQ A;  5IER A;  2HMM B;  2IUK A;  1D6U A;  3TDG A;  1ZO2 A;  3WOF B;  4R9K A;  4KFF A;  1JN5 A;  3ROB A;  5AYS C;  3NBJ A;  1FGT A;  5FW5 A;  3ALA A;  4KZ1 A;  1MNL A;  3KII A;  1AVK A;  1IV9 A;  2CFD A;  1IQ8 A;  3X3Y A;  5AEU B;  1VZZ A;  1SPU A;  3FCS B;  2Z7A A;  3D3L A;  1YGE A;  2CC3 A;  3F7X A;  2GU1 A;  1EKM A;  1DVC A;  4KVH A;  4ORL A;  3KZT A;  5CK6 A;  2UX0 A;  1IT7 A;  5FGO A;  2HML B;  3V98 A;  2HMJ B;  1OHS A;  3GZB A;  3U1W A;  2JQ5 A;  4XDV A;  1GY6 A;  2W0Q A;  3EB8 A;  5AI1 A;  3T8U A;  3FG4 A;  1OF5 A;  4Q53 A;  3FKA A;  1N8Q A;  3FG1 A;  3NUV A;  1LOX A;  2P0X A;  3G8Z A;  3S5C A;  2W9P A;  3F8X A;  5JPP A;  3KKG A;  3IPT A;  3NXJ A;  4RZM A;  1OF5 B;  2XEP A;  3S27 A;  3SXX A;  2OTL 3;  2XSO B;  2HMO B;  4WYK A;  5EQL A;  3DZL A;  3STD A;  4HM8 B;  2OOV A;  4N6O B;  3RDE A;  4R4K A;  5EEO A;  3BNE A;  2BHM A;  1QVF 2;  1W02 A;  3V92 A;  3EBT A;  6STD A;  3HIG A;  3KSP A;  4XBT A;  1O7M B;  4HM2 B;  5AII A;  1EA2 A;  4MEI A;  1RN7 A;  5KP1 A;  4AEQ A;  1UUV B;  1GD3 A;  3OWU A;  1FGM A;  4NHF A;  1K8A 4;  3N8B A;  4O3V A;  3N9H A;  3WA3 A;  3CCR 3;  2STD A;  1Q7Y 4;  2CWT A;  2W04 A;  1IVV A;  3K63 A;  3HK4 A;  5AYR B;  3G6E 3;  1Q40 A;  3F8H A;  4L8P A;  3DGO A;  4EV2 A;  1YI2 3;  1NDO B;  3PS8 A;  1IDP A;  1VQ5 3;  2C10 A;  1IT8 A;  3LTB A;  1VQN 3;  1A67 A;  4CDL A;  3LXU X;  4N6T A;  3LYG A;  3OX9 A;  3GRD A;  5LC7 A;  1TU5 A;  4N6M A;  1YJN 3;  5IG0 A;  5JBS A;  1HU9 A;  2JDI H;  1GS3 A;  3Q90 A;  4J9A A;  2OOV C;  1JJ2 2;  3CME 3;  3JUQ A;  3H3H A;  3M8C A;  1VQ4 3;  3RGA A;  4QWT A;  3AMO A;  1N5H A;  3H51 A;  2GEX A;  5LC6 A;  3DXO A;  2FGT A;  4MJD A;  4LGQ A;  4CCV A;  5CF2 A;  2W9Q A;  1UI8 A;  1TP6 A;  2CFK A;  1HKX A;  1W6Y A;  2WGQ A;  3SOY A;  2P38 A;  3FGY A;  2YFJ B;  3X41 A;  1IV7 A;  1W5Z A;  4O2H A;  4FCZ A;  2WO0 A;  1VQP 3;  1WMO A;  2BO9 B;  2YFI B;  5JPU A;  3MYT A;  3V99 A;  1VQ9 3;  2GXF A;  1A2K A;  2YFL B;  1K73 4;  1W4N A;  1FA3 A;  1W6C A;  3CCM 3;  1ASK A;  1STD A;  3CU3 A;  4ZM8 A;  1AV4 A;  2R4I A;  3DGL A;  3G16 A;  3OXA A;  1Q82 4;  3CCV 3;  1TFK A;  1IVW A;  4IPB A;  4EV5 A;  2BMR B;  3PYJ A;  1Q81 4;  4L8O A;  3B4P A;  5CXO A;  1DMM A;  1W01 A;  3GZR A;  2OQE A;  3S67 A;  3GZY B;  3K0Z A;  2E2U A;  3S29 A;  5DRV A;  1QAF A;  4O02 B;  3VSY A;  3ECF A;  3HX8 A;  3CNM A;  3SVA A;  2W6J H;  2YX9 A;  3F9S A;  4X2H A;  1IK3 A;  4H61 A;  1KWI A;  3NX0 A;  3PXM A;  3SLU A;  1Z1S A;  1AR0 A;  1ZX2 A;  2CFW A;  3L0R A;  4HVN A;  4J8T A;  3DGM A;  7STD A;  1A2V A;  4U13 A;  2XR8 B;  2P05 A;  2GBW B;  1CQS A;  1WQL B;  3S28 A;  3NBB A;  4LZI A;  4XDW A;  8CHO A;  3T8N A;  5AIG A;  1PU4 A;  1CEW I;  1O7G B;  3EX9 A;  4NRE A;  4WYK B;  2BMO B;  5HGR A;  4FCJ A;  5IG5 A;  1QJG A;  1V74 A;  5AEW B;  1QAL A;  2CK3 H;  3UL6 A;  3MHE A;  4XBX A;  1IQY A;  4HKV B;  3B8L A;  1JKG B;  3LML A;  1FGO A;  1AVL A;  1CYU A;  1UI7 A;  4HM5 B;  4XB5 A;  3RGR A;  3PCR A;  1Q42 A;  2CIU A;  1M90 4;  3CPW 2;  1F8N A;  2FXT A;  2OTJ 3;  1YJW 3;  1Q40 B;  3BND A;  1O7N B;  4EXR A;  3EN8 A;  1K41 A;  3NQZ A;  1JKG A;  2RSX A;  2Q07 A;  3DGN A;  3LTC A;  3JUO A;  3N54 B;  3QRD A;  1R4C A;  4GL6 A;  3MG2 A;  2I9W A;  1VQ6 3;  2C11 A;  1QVG 2;  4FCM A;  4FMD A;  4N3V A;  1QMA A;  5IW9 A;  5IEN A;  2KXG A;  2B24 B;  5IG4 A;  4KFD A;  3CMA 3;  1OHP A;  3CNX A;  1NB5 I;  2D42 A;  2OCT A;  1SIH A;  1WMN A;  1WNH A;  2BT3 A;  1W7C A;  2LQV A;  3I0Y A;  3LTA A;  2XH9 A;  4K61 A;  1FGR A;  2MF7 A;  3PGB A;  4N6N B;  5KP3 A;  1YIT 3;  5A0O B;  3CC4 3;  3MSO A;  5IEO A;  1E3R A;  3HII A;  3LH4 A;  1OGZ A;  2Z76 A;  4O8S A;  2WOF A;  4XBY A;  3LZA A;  2P0M A;  3KN4 A;  3EJV A;  5G2G A;  2Y74 A;  1WTH A;  3EBY A;  3IMA B;  4FMC A;  3X42 A;  4BTX A;  1VQL 3;  1N9J A;  3G0K A;  2L4V A;  1O7P B;  2QA4 3;  3CC7 3;  4OK0 A;  3DMC A;  4JRF A;  3WMD A;  3UJM A;  1W2Z A;  4IT7 A;  3MG3 A;  4HM7 B;  4OVM A;  1GY7 A;  1OHO A;  2OQE C;  3KE7 A;  3KFQ C;  3GAX A;  1UUW B;  4HBR A;  1D6Y A;  5D81 A;  3NBR A;  1KSI A;  3SOA A;  2CFG A;  5D82 A;  1ULJ B;  2CW9 A;  2HMK B;  1N5P A;  3Q1C A;  1TIJ A;  3OW2 2;  1M1X B;  1SQW A;  2QGU A;  3T0U A;  1S72 3;  4WWU C;  4GB5 A;  3B7C A;  3HI7 A;  1LXE A;  3VGN A;  3MPH A;  4PEJ A;  4I4K A;  3MG1 A;  3JUP A;  3GWR A;  4LSO A;  2KCD A;  5CLK A;  1QAK A;  3F7S A;  4HM4 B;  2XGN A;  3F14 A;  4BTW A;  1ROV A;  4EC6 A;  3DY5 A;  3FH1 A;  2RFR A;  2W56 A;  3FZW A;  1JB2 A;  1LNH A;  1LVN A;  2WOH A;  2D1W A;  3OWS A;  4RNY A;  3X40 A;  4HYZ A;  1VQO 3;  4MMY B;  3EE1 A;  3CCU 3;  5BXQ A;  3MWZ A;  4WFO A;  4OUQ A;  1IVU A;  3NV0 B;  3ER7 A;  5STD A;  5D83 A;  4KFE A;  3DM8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...