1A67A

Chicken egg white cystatin wildtype, nmr, 16 structures
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
108
structure length
108
Chain Sequence
GAPVPVDENDEGLQRALQFAMAEYNRASNDKYSSRVVRVISAKRQLVSGIKYILQVEIGRTTCPKSSGDLQSCEFHDEPEMAKYTTCTFVVYSIPWLNQIKLLESKCQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYSTATIN
publication title The structures of native phosphorylated chicken cystatin and of a recombinant unphosphorylated variant in solution.
pubmed doi rcsb
molecule tags Proteinase inhibitor
total genus 13
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 1998-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1a67A00
1WNHA 1GD3A 1CEWI 1TIJA 1CYUA 1M9GA 5LC7A 1NB5I 2W9PA 5EQLA 1IV9A 5ELJA 4ZM8A 2BO9B 2CH9A 4TX4A 1FUWA 3SVAA 1PFPA 2OCTA 1N5HA 1GD4A 3S67A 3NX0A 3IMAB 2W9QA 4N6LA 3UL5A 4N6MA 3PYJA 1FA3A 1EQKA 3QRDA 1N5PA 3KFQC 1ROAA 4N6OB 3K9MC 1CYVA 3GAXA 4LZIA 3LH4A 3UL6A 3Q2PA 1A67A 1DVCA 5ELUA 3PS8A 1G96A 3KSED 3MWZA 1A90A 4N6UA 4N6NB 1MNLA 4N6V0 2KXGA 1MOLA 4N6TA 1STFI 1N9JA 4EYCA 1RN7A 4IT7A 1KWIA 2O9UX 1DVDA 5A0OB 1NB3I 3PXMA 5LC6A 1YVBI 3L0RA 4CCVA 1LXEA 1IV7A 1R4CA
chains in the Genus database with same CATH superfamily
4R9KA 1FW7A 2OOVA 1WNHA 3NUVA 1YGEA 1NDOB 3EN1B 4KFEA 1JV2B 4BTWA 1LOXA 1OCVA 1ZS7A 3GRDA 4LYLB 1VQK3 4STDA 7GSPA 4LMIA 2C10A 1RDSA 3Q1CA 3CCV3 3AGOA 4ZM8A 1BNGA 1AR0A 1E3RA 2BO9B 2E2TA 2P05A 4CDLA 3CCE3 1TRPA 1UGIA 1NNVA 1OF5A 2RSXA 1RGFA 3OV4A 3B4PA 3SVAA 2GEXA 2OCTA 1W02A 1KD14 1JN5B 1RTUA 2FGTA 2W0QA 4OVMA 4BIRA 1JZOA 2CX1A 3FG1A 1W6GA 3FG3A 4BTXA 1HYFA 3BU4A 2PZVA 2CKFB 4L8PA 1BNRA 1BNIA 1QMAA 2CX0A 3FSDA 5KP3A 1X1YA 3D3LA 1UCLA 2ML5A 1RSNA 3T8NA 3I563 1VQQA 1D6YA 2JDIH 3UL5A 4U13A 1TFKA 1O7WB 2GXFA 4HM7B 5AYRB 3TDGA 2BMOB 2YFIB 2J8XB 2BHMA 1OH0A 3V99A 2A15A 1FA3A 3IPTA 3G8ZA 3MSOA 3LTCA 4FCMA 3KE7A 1US1A 3WOFB 1OGXA 3PCRA 3AHSA 3JUMA 3QRDA 7RNTA 3S5CA 1I0XA 1CQSA 2BNGA 2W6JH 2CIUA 3NQZA 4EC6A 4CPKA 2UGIA 1YVSA 3QK9A 2WGQA 3S29A 3WR2A 4HM4B 5FW5A 1BSBA 2Z7AA 1CYVA 5IEOA 2P0XA 1O7MB 3UL6A 2ZA4A 1FUWA 1ULJB 4X2HA 1M1K4 1RGCA 2XF3A 4MMZB 2CFDA 3WOEB 3F7SA 2FNQA 4HOHA 3NHXA 1HZ1A 5IG0A 1FGOA 3HIGA 4RNZA 3U97A 2CFWA 3A5EA 1A67A 1VQO3 4J9AA 5IW9A 1BNJA 3CC43 1Q42A 2CFKA 3SYUA 4HBRA 2BIRA 5AEUB 3JVCA 1AV4A 4AEQA 2LYXA 2MC8A 2F4YA 3FG4A 3CU3A 1GS3A 2XFTA 3AMOB 3LOYA 1B20A 3MWZA 3N54B 1DE3A 4O8SA 1MNLA 4N6V0 4EW5A 3OW22 2CWVA 3DH2A 4XM4A 1B27A 1JBSA 2D1WA 3RNTA 2QEX3 1JKGA 3DY5A 3MYTA 4WYKB 4X2OA 1STFI 2JQ5A 1IQXA 1YJ93 3SOAA 1QAKA 3G4S3 1SQWA 1FGQA 3NV0A 5IF6A 1S5AA 1DYUA 1RNBA 3GZXB 1B21A 3D79A 4FMDA 1Q824 1OGZA 1IVVA 3JUQA 4K1VA 2XR8B 1ZGXA 2Y74A 3G6E3 5DRVA 3ROBA 1BRHA 4JRFA 4KT3B 1BNFA 1C7HA 1I8VA 2GBWB 3LT8A 4GL6A 3RGRA 8CHOA 4HM6B 1IYYA 4FCJA 5CXOA 1B2XA 1BRIA 3CCM3 2IUKA 1W01A 1CEWI 3MG3A 1IVXA 4I5QA 3HOHA 2QA43 1LQMB 2CW9A 3FF0A 3KIIA 1NB5I 2K3DA 1ZX2A 3LXUX 1AVKA 1WMNA 3CC23 1EA2A 1JBTA 5IG5A 1BANA 3F14A 1RMSA 3WDGB 1FUTA 1YI23 1F8NA 5EVHA 2W56A 3BLZA 3DGLA 1BRNL 1Q7HA 3CPOA 2W03A 2Y73A 3B4OA 9RNTA 1G0TA 4IIAA 1FUSA 1ULIB 2I9WA 3K7CA 1DMQA 1I2EA 2B1XB 3JUPA 1NWWA 1N8R4 1U8CB 2RBIA 1W2ZA 3S67A 3NX0A 3G713 2XSHB 1GOUA 1WTHA 5BXQA 4BTYA 3DMCA 2KF6A 3D4AA 1TP6A 2CK3H 1RLSA 2KCDA 1X1WA 2P0MA 3NXJA 1RGGA 3I0YA 4N6MA 1IU7A 5G1LA 2IUJA 3HX8A 3PYJA 1LRAA 2WOHA 5BVBA 3FKAA 1GOVA 1IK3A 5BIRA 1BSEA 1RGLA 3DZLA 4J5GA 3PZWA 3KKGA 2M7OA 3T0UA 4RNYA 1DMNA 3T8UA 3KFQC 2OWPA 2K0MA 2BMRB 2OQEC 1BUJA 3SEDA 1LVNA 3ZG0A 1V57A 1RNTA 3DGOA 3CMA3 2AAEA 3DGNA 1JB5A 2KRTA 2E2VA 3V92A 1OPYA 1B2ZA 1SJWA 4GB5A 3GAXA 1PU4A 5CF2A 1W00A 2H0HA 1YGWA 3H51A 3LH4A 3H3HA 1STDA 1KSIA 1EUIC 1RCKA 1BOXA 3A76A 4J5KA 1BUQA 3DM8A 2XGLA 4GSPA 2P09A 2GEYA 3Q2PA 3X41A 4EV2A 3CCJ3 1I2GA 2MF7A 4HM1B 4HZBB 1DETA 1MWUA 5ELUA 1UI7A 1X1UA 1GY7A 5STDA 3PS8A 1M904 3EQQB 4NPBA 4XBXA 1S723 3UB1A 1RRLA 1TFOA 5AI1A 1AVLA 3CCR3 1W2B2 1UCIA 3F7XA 1IVWA 1LNHA 1LQGC 2KXGA 1Q40A 3BNDA 5AEWB 1YNVX 4FR9A 4HM2B 1IQ8A 1MWSA 3EJVA 2RFRA 4FMBA 3ECFA 4HM3B 4HZ9B 1X1XA 1VQ53 3HIIA 1OHPA 3IJEB 2Z77A 3CPW2 4KFFA 4I4KA 1LNIA 3K0ZA 3LYGA 3N9HA 4OK0A 1W6YA 3CCU3 4AKYA 1GOYA 2WO0A 1NB3I 3GWRA 1LOWA 3M8CA 3OX9A 1R4YA 1YVBI 1V74A 3AHWA 6GSPA 1BNEA 2YFJB 4CCVA 3FGYA 4ILFA 2INXA 3WHOA 1IT7A 1BSAA 2BMQB 1UUWB 2OQEA 1OF5B 3NM7A 4R9LA 1Q864 1VQ63 1C54A 2C11A 5AIGA 3BIRA 1BRSA 1TIJA 3EX9A 4LSOA 1CYUA 1MWRA 1GY6A 1JB4A 2CFLA 2WGOA 1RGAA 1K734 1IV9A 4XB5A 5ELJA 8RNTA 1VQN3 3VGNA 1AY7A 3MG2A 5D82A 1QVF2 4TX4A 3ER7A 4HYZA 5IENA 1Q7Y4 3Q90A 1WQLB 5AIIA 3F8XA 2FXTA 2ZL8A 2ZDJA 1NO3A 1AQZA 3EBYA 3KZTA 1CH0A 3X42A 1I2FA 2D42A 1GD4A 3STDA 2KF5A 2W9QA 3IMAB 3U1WA 5AIHA 1EKMA 1IT8A 1HU9A 1VQL3 1BSDA 2IYJA 2QIYA 4WHAA 1IVUA 1U5OA 3E99A 3FZWA 3LT9A 2F99A 2IA7A 1JN5A 2STDA 3J7Yd 3X3YA 3FF2A 1RHLA 2F98A 1EG9B 1K41A 1YIT3 1E97A 2KAAA 1FGTA 1Z1SA 1SIIA 3EN8A 5IG4A 1W5ZA 1LOVA 2K54A 3G16A 3V98A 4KZ1A 1N5PA 3KN4A 1IDPA 2R41A 4KVHA 2YFLB 4MEIA 5CLKA 2RGQA 1I70A 4N6OB 1KC84 5D83A 2IMJA 2HMNB 5FGOA 2GSPA 2CG0A 1RN1A 4BL3A 1GYBA 1WMOA 3F9SA 3OWSA 1UCJA 1LOYA 4K1UA 1W6CA 3KSPA 4XBTA 1TU5A 3HI7A 1L5GB 2B24B 3N8BA 1RCLA 4MJDA 1T5YA 4H3UA 4MMXB 3NBRA 3VSYA 3JUOA 2Z6BA 1TTOA 1E3VA 3Q3FA 1JJ22 1UUVB 2CG1A 2HMOB 4MMYB 3B8LA 4WP5A 1FGRA 1OHSA 1Q9EA 3CME3 1JKGB 2KF4A 2L4VA 1A2KA 1VZZA 1SPUA 3G0KA 4R1KA 3D5GA 3EC9A 4JF8A 1RGEA 1GMQA 1BRGA 2R4IA 3JUNA 1OACA 4AKZA 1MGRA 3AGNA 3CNXA 3EF8A 3NV0B 1N8QA 1A90A 1UDII 4N6UA 4N6NB 3EE1A 3NQYA 6RNTA 2CWTA 3RDEA 1BU4A 1HKXA 1RJOA 2GBXB 4HKVB 4WWUC 4XDWA 1ZO2A 3SX1A 4EXRA 1RRHA 5KP1A 3CCS3 2GU1A 4O2HA 3FH1A 5I97A 1BAOA 1MOLA 3FCSB 4N6TA 4R4KA 3SLUA 3LZAA 2YX9A 1DMMA 1BIRA 1K9M4 2CHCA 1N9JA 3AMOA 1OHOA 4XBYA 1O7HB 2OTL3 1RN7A 2AADA 4IT7A 4LGQA 2RCDA 1KWIA 2CC3A 2O9UX 4L8OA 1G02A 1GMPA 1T3BA 4PEJA 4BU4A 1DVDA 1OUNA 2UX0A 3FLJA 1GSPA 1MWTA 4R80A 1K8A4 2O3OA 4Q53A 5LC6A 3SXXA 2V1LA 4WYKA 3WODG 1D6ZA 3PCSA 3MKIA 1W4NA 1LXEA 1BNSA 3BNCA 3CNMA 3DXOA 4RZMA 5M19A 1I0VA 3SOYA 3BNEA 1GD3A 1K28A 1W7CA 3WMDA 1BRKA 2W56B 1UW1A 1JRQA 3LTBA 4ORLA 3D5IA 4RNTA 3S27A 2ZHXB 4G1MB 1M9GA 5LC7A 3GZYB 2W9PA 1Q814 4J8TA 5EQLA 1YJN3 1ROVA 1WMPA 1NU3A 2RNTA 5M18A 5IEPA 1IQYA 1PY3A 2CH9A 2F86B 1RKYA 1ISKA 4WFOA 4NREA 3KCHA 3LTAA 4NHFA 1MGWA 1UGHI 3LMLA 1JB2A 3NBBA 1N9EA 2E2UA 4OUQA 5M1AA 3ZG5A 5IERA 1SIHA 1PFPA 1Y4KA 5BU4A 3OXAA 2HMMB 2OTJ3 3F40A 4K90B 3K5TA 2CFGA 1RGKA 3D9RA 1QJGA 3MPHA 1N5HA 3X40A 1YIJ3 3EHCA 3UJMA 1PYLA 4HM8B 1NJI4 1KQS2 1JNQA 5CK6A 1GMRA 2HOHA 3CXC2 2HMJB 4BL2A 1GY5A 4DKIA 4N6LA 5DREA 2H0IA 5G2GA 2Z76A 2PNCA 5EEOA 4EBGA 1JZDA 3GZRA 1VQ83 3GZBA 2SBLA 5AYSC 1ASKA 1SARA 3HK4A 4XDVA 3CCQ3 4FMCA 2XH9A 3DUKA 5AIFA 4HM5B 4O02B 5RNTA 1VQ93 1QALA 1I3FA 1EQKA 3S28A 3BNBA 1TRQA 3OWUA 5D81A 4RBNA 1JBRA 1A2VA 2OOVC 3DGMA 5HOHA 1UCKA 2F5WA 1ROAA 2P38A 3K9MC 2HMKB 3CCL3 1FYSA 2C4BA 3B7CA 4FCZA 5GSPA 5TGNA 5CF1A 1VQM3 5JPUA 3CC73 3PGBA 1FZUA 3X3XA 4K61A 2LQVA 3EB8A 4LZIA 1UI8A 3NBJA 2W04A 2XFSA 4L7KA 5IG3A 1QAFA 2BT3A 7STDA 2Q07A 2F56A 3VF1A 2XSOB 4QWTA 3WA2X 1BVIA 1V58A 1FGMA 3MHEA 4EV5A 1EEJA 1DVCA 2XRXB 1BGSA 1Q40B 1B2SA 3O8YA 2XGNA 4GHOA 2L1SA 4HAAA 4IPBA 3RGAA 3URPA 1B2MA 2BU4A 2W2CA 1A2PA 1J2BA 1G96A 3DGYA 1B3SA 3GSPA 3KSED 1M1XB 3MG1A 1D6UA 4CJNA 3I553 1T2HA 2WOFA 4HM0B 4N3VA 1O7PB 3BB9A 5KP4A 5G1KA 1YHQ3 1BRJA 1RGHA 3CD63 1RN4A 2QGUA 1TJDA 1YJW3 1O7NB 2H0GA 2XEPA 1UUGB 5HGRA 3WA3A 4O3VA 1O7GB 3NM2A 1T2IA 3HZPA 1B2UA 2ML6A 2HMLB 3K63A 5JBSA 1VQ73 2KF3A 4FMAA 4HVNA 4EYCA 2IY2A 1BSCA 2UUGC 4HJLB 3F8HA 3LTDA 1QVG2 2CWUA 4KFDA 3ZFZA 3X3ZA 2F5MA 5A0OB 4H61A 1I3IA 1VQ43 5JPPA 3OWYA 6STDA 2GU3A 3ALAA 3PXMA 1VQP3 3L0RA 4LEHA 1TUHA 3UNLA 2SARA 1IV7A 3EBTA 1R4CA
chains in the Genus database with same CATH topology
4R9KA 2OOVA 1WNHA 3NUVA 1YGEA 1NDOB 3EN1B 4KFEA 1JV2B 4BTWA 1LOXA 1OCVA 3GRDA 1VQK3 4STDA 4LMIA 2C10A 3Q1CA 3CCV3 4ZM8A 1E3RA 1AR0A 2BO9B 4CDLA 2E2TA 2P05A 3CCE3 1OF5A 2RSXA 3OV4A 3B4PA 3SVAA 2GEXA 2OCTA 1W02A 1KD14 1JN5B 4OVMA 2FGTA 2W0QA 3FG1A 1W6GA 3FG3A 4BTXA 2PZVA 2CKFB 4L8PA 3FSDA 1QMAA 5KP3A 3D3LA 3I563 2ML5A 3T8NA 2JDIH 1D6YA 3UL5A 4U13A 1TFKA 1O7WB 2GXFA 4HM7B 5AYRB 3TDGA 2BMOB 2YFIB 2BHMA 1OH0A 3V99A 2A15A 1FA3A 3IPTA 3G8ZA 3MSOA 3LTCA 4FCMA 3KE7A 1US1A 3WOFB 1OGXA 3PCRA 3QRDA 3JUMA 3S5CA 1CQSA 2BNGA 2W6JH 2CIUA 3NQZA 4EC6A 3QK9A 2WGQA 3S29A 4HM4B 5FW5A 2Z7AA 1CYVA 5IEOA 2P0XA 1O7MB 3UL6A 1ULJB 4X2HA 1M1K4 2XF3A 4MMZB 3WOEB 2CFDA 3F7SA 2FNQA 3NHXA 5IG0A 1FGOA 3HIGA 4RNZA 3U97A 2CFWA 1A67A 1VQO3 4J9AA 5IW9A 3CC43 1Q42A 2CFKA 4HBRA 5AEUB 3JVCA 1AV4A 4AEQA 2LYXA 2MC8A 3FG4A 3CU3A 1GS3A 2XFTA 3AMOB 3LOYA 3MWZA 3N54B 4O8SA 1MNLA 4N6V0 3OW22 2CWVA 4XM4A 2D1WA 2QEX3 1JKGA 3DY5A 3MYTA 4WYKB 4X2OA 1STFI 2JQ5A 1IQXA 1YJ93 3SOAA 1QAKA 3G4S3 1SQWA 1FGQA 3NV0A 5IF6A 1S5AA 1DYUA 3GZXB 4FMDA 1Q824 1OGZA 1IVVA 3JUQA 4K1VA 2XR8B 2Y74A 3G6E3 5DRVA 3ROBA 4JRFA 1C7HA 2GBWB 3LT8A 8CHOA 4GL6A 3RGRA 4HM6B 4FCJA 5CXOA 3CCM3 2IUKA 1W01A 1CEWI 3MG3A 1IVXA 2QA43 2CW9A 3FF0A 3KIIA 1NB5I 1ZX2A 3LXUX 1AVKA 1WMNA 3CC23 1EA2A 5IG5A 3F14A 3WDGB 1YI23 1F8NA 5EVHA 2W56A 3BLZA 3DGLA 3CPOA 2W03A 2Y73A 3B4OA 4IIAA 1ULIB 2I9WA 3K7CA 1DMQA 2B1XB 3JUPA 1N8R4 1NWWA 1U8CB 1W2ZA 3S67A 3NX0A 3G713 2XSHB 1WTHA 5BXQA 4BTYA 3DMCA 1TP6A 2CK3H 2KCDA 2P0MA 3NXJA 3I0YA 4N6MA 1IU7A 2IUJA 3HX8A 3PYJA 2WOHA 5BVBA 3FKAA 1IK3A 3DZLA 3PZWA 3KKGA 2M7OA 3T0UA 4RNYA 1DMNA 3T8UA 3KFQC 2OWPA 2K0MA 2BMRB 2OQEC 3SEDA 1LVNA 3CMA3 3DGOA 3DGNA 1JB5A 2KRTA 2E2VA 3V92A 1OPYA 1SJWA 4GB5A 3GAXA 1PU4A 5CF2A 1W00A 3H51A 3LH4A 3H3HA 1STDA 1KSIA 3A76A 1BUQA 3DM8A 2XGLA 2P09A 2GEYA 3Q2PA 4EV2A 3CCJ3 2MF7A 4HM1B 4HZBB 5ELUA 1UI7A 1GY7A 5STDA 3PS8A 1M904 3EQQB 4XBXA 1S723 3UB1A 1RRLA 1TFOA 5AI1A 1AVLA 3CCR3 1W2B2 3F7XA 1IVWA 1LNHA 2KXGA 1Q40A 3BNDA 5AEWB 4FR9A 4HM2B 1IQ8A 3EJVA 2RFRA 4FMBA 3ECFA 4HM3B 4HZ9B 1VQ53 3HIIA 1OHPA 3IJEB 2Z77A 3CPW2 4KFFA 4I4KA 3K0ZA 3LYGA 3N9HA 4OK0A 1W6YA 3CCU3 4AKYA 2WO0A 1NB3I 3GWRA 3M8CA 3OX9A 1YVBI 1V74A 2YFJB 4CCVA 3FGYA 2INXA 1IT7A 2BMQB 1UUWB 2OQEA 1OF5B 3NM7A 4R9LA 1Q864 1VQ63 2C11A 5AIGA 1TIJA 3EX9A 4LSOA 1CYUA 1GY6A 1JB4A 2CFLA 2WGOA 1K734 1IV9A 4XB5A 5ELJA 1VQN3 3VGNA 5D82A 3MG2A 1QVF2 4TX4A 3ER7A 4HYZA 5IENA 1Q7Y4 3Q90A 1WQLB 5AIIA 3F8XA 2FXTA 2ZL8A 2ZDJA 1NO3A 3EBYA 3KZTA 3X42A 2D42A 1GD4A 3STDA 3IMAB 2W9QA 3U1WA 5AIHA 1EKMA 1IT8A 1HU9A 1VQL3 2QIYA 4WHAA 1IVUA 1U5OA 3E99A 3FZWA 3LT9A 2F99A 2IA7A 1JN5A 2STDA 3J7Yd 3X3YA 3FF2A 2F98A 1EG9B 1K41A 1YIT3 1E97A 1FGTA 1Z1SA 1SIIA 3EN8A 5IG4A 1W5ZA 2K54A 3G16A 3V98A 4KZ1A 1N5PA 3KN4A 1IDPA 4KVHA 2YFLB 4MEIA 5CLKA 2RGQA 4N6OB 1KC84 5D83A 2IMJA 2HMNB 5FGOA 2CG0A 1GYBA 1WMOA 3F9SA 3OWSA 4K1UA 4XBTA 1W6CA 3KSPA 1TU5A 3HI7A 1L5GB 2B24B 3N8BA 4MJDA 1T5YA 4H3UA 4MMXB 3NBRA 3VSYA 3JUOA 2Z6BA 1E3VA 1JJ22 1UUVB 2CG1A 2HMOB 4MMYB 3B8LA 4WP5A 1FGRA 1OHSA 3CME3 1JKGB 2L4VA 1A2KA 1VZZA 1SPUA 3G0KA 4R1KA 3EC9A 4JF8A 2R4IA 3JUNA 1OACA 4AKZA 3CNXA 3EF8A 3NV0B 1N8QA 1A90A 4N6UA 4N6NB 3EE1A 3NQYA 2CWTA 3RDEA 1HKXA 2GBXB 1RJOA 4HKVB 4WWUC 5I97A 4XDWA 1ZO2A 3SX1A 4EXRA 1RRHA 5KP1A 3CCS3 2GU1A 4O2HA 3FH1A 1MOLA 4N6TA 3FCSB 4R4KA 3SLUA 3LZAA 2YX9A 1DMMA 1K9M4 2CHCA 1N9JA 3AMOA 1OHOA 4XBYA 1O7HB 2OTL3 1RN7A 4IT7A 4LGQA 2RCDA 1KWIA 2CC3A 2O9UX 4L8OA 4PEJA 1DVDA 1OUNA 2UX0A 3FLJA 1K8A4 4R80A 2O3OA 4Q53A 5LC6A 3SXXA 2V1LA 4WYKA 3WODG 1D6ZA 3PCSA 3MKIA 1W4NA 1LXEA 3BNCA 3CNMA 3DXOA 4RZMA 3SOYA 3BNEA 1GD3A 1K28A 1W7CA 3WMDA 2W56B 1UW1A 1JRQA 3LTBA 4ORLA 3S27A 4G1MB 1M9GA 5LC7A 3GZYB 2W9PA 1Q814 4J8TA 5EQLA 1YJN3 1ROVA 1WMPA 1NU3A 5IEPA 1IQYA 2CH9A 2F86B 1RKYA 1ISKA 4WFOA 4NREA 3LTAA 4NHFA 5HGRA 3X3XA 1FUWA 3LMLA 1JB2A 3NBBA 1N9EA 2E2UA 4OUQA 5IERA 1SIHA 1PFPA 1Y4KA 3OXAA 2HMMB 2OTJ3 3F40A 4K90B 3K5TA 2CFGA 3D9RA 1QJGA 3MPHA 1N5HA 3X40A 1YIJ3 3EHCA 3UJMA 1NJI4 4HM8B 1KQS2 1JNQA 5CK6A 3CXC2 2HMJB 1GY5A 4N6LA 5DREA 5G2GA 2Z76A 2PNCA 5EEOA 4EBGA 3GZRA 1VQ83 3GZBA 2SBLA 5AYSC 1ASKA 4XDVA 3HK4A 3CCQ3 4FMCA 2XH9A 3DUKA 5AIFA 4HM5B 4O02B 1VQ93 1QALA 1EQKA 3S28A 3BNBA 3OWUA 5D81A 4RBNA 1A2VA 2OOVC 3DGMA 1ROAA 2P38A 3K9MC 2HMKB 3CCL3 3B7CA 4FCZA 5TGNA 5CF1A 1VQM3 5JPUA 3CC73 3PGBA 4K61A 2LQVA 3EB8A 4LZIA 1UI8A 3NBJA 2W04A 2XFSA 4L7KA 5IG3A 1QAFA 2BT3A 7STDA 2Q07A 3VF1A 2XSOB 4QWTA 3WA2X 1FGMA 3MHEA 4EV5A 2XRXB 1DVCA 3O8YA 1Q40B 3X41A 2XGNA 3RGAA 1J2BA 4IPBA 2W2CA 1G96A 3MG1A 3KSED 1M1XB 1D6UA 3I553 2WOFA 4HM0B 4N3VA 1O7PB 3BB9A 5KP4A 1YHQ3 3CD63 2QGUA 1YJW3 1O7NB 2XEPA 3WA3A 4O3VA 1O7GB 3NM2A 3HZPA 1VQ73 2ML6A 3K63A 2HMLB 5JBSA 4FMAA 4HVNA 4EYCA 4HJLB 3F8HA 3LTDA 1QVG2 2CWUA 4KFDA 3X3ZA 5A0OB 1VQ43 4H61A 5JPPA 3OWYA 6STDA 2GU3A 3ALAA 3PXMA 1VQP3 3L0RA 4LEHA 1TUHA 3UNLA 1IV7A 3EBTA 1R4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WNH A;  1GD3 A;  1CEW I;  1TIJ A;  1CYU A;  1M9G A;  5LC7 A;  1NB5 I;  2W9P A;  5EQL A;  1IV9 A;  5ELJ A;  4ZM8 A;  2BO9 B;  2CH9 A;  4TX4 A;  1FUW A;  3SVA A;  1PFP A;  2OCT A;  1N5H A;  1GD4 A;  3S67 A;  3NX0 A;  3IMA B;  2W9Q A;  4N6L A;  3UL5 A;  4N6M A;  3PYJ A;  1FA3 A;  1EQK A;  3QRD A;  1N5P A;  3KFQ C;  1ROA A;  4N6O B;  3K9M C;  1CYV A;  3GAX A;  4LZI A;  3LH4 A;  3UL6 A;  3Q2P A;  1A67 A;  1DVC A;  5ELU A;  3PS8 A;  1G96 A;  3KSE D;  3MWZ A;  1A90 A;  4N6U A;  4N6N B;  1MNL A;  4N6V 0;  2KXG A;  1MOL A;  4N6T A;  1STF I;  1N9J A;  4EYC A;  1RN7 A;  4IT7 A;  1KWI A;  2O9U X;  1DVD A;  5A0O B;  1NB3 I;  3PXM A;  5LC6 A;  1YVB I;  3L0R A;  4CCV A;  1LXE A;  1IV7 A;  1R4C A; 
#chains in the Genus database with same CATH topology
 4R9K A;  1FW7 A;  2OOV A;  1WNH A;  3NUV A;  1YGE A;  1NDO B;  3EN1 B;  4KFE A;  1JV2 B;  4BTW A;  1LOX A;  1OCV A;  1ZS7 A;  3GRD A;  4LYL B;  1VQK 3;  4STD A;  7GSP A;  4LMI A;  2C10 A;  1RDS A;  3Q1C A;  3CCV 3;  3AGO A;  4ZM8 A;  1BNG A;  1AR0 A;  1E3R A;  2BO9 B;  2E2T A;  2P05 A;  4CDL A;  3CCE 3;  1TRP A;  1UGI A;  1NNV A;  1OF5 A;  2RSX A;  1RGF A;  3OV4 A;  3B4P A;  3SVA A;  2GEX A;  2OCT A;  1W02 A;  1KD1 4;  1JN5 B;  1RTU A;  2FGT A;  2W0Q A;  4OVM A;  4BIR A;  1JZO A;  2CX1 A;  3FG1 A;  1W6G A;  3FG3 A;  4BTX A;  1HYF A;  3BU4 A;  2PZV A;  2CKF B;  4L8P A;  1BNR A;  1BNI A;  1QMA A;  2CX0 A;  3FSD A;  5KP3 A;  1X1Y A;  3D3L A;  1UCL A;  2ML5 A;  1RSN A;  3T8N A;  3I56 3;  1VQQ A;  1D6Y A;  2JDI H;  3UL5 A;  4U13 A;  1TFK A;  1O7W B;  2GXF A;  4HM7 B;  5AYR B;  3TDG A;  2BMO B;  2YFI B;  2J8X B;  2BHM A;  1OH0 A;  3V99 A;  2A15 A;  1FA3 A;  3IPT A;  3G8Z A;  3MSO A;  3LTC A;  4FCM A;  3KE7 A;  1US1 A;  3WOF B;  1OGX A;  3PCR A;  3AHS A;  3JUM A;  3QRD A;  7RNT A;  3S5C A;  1I0X A;  1CQS A;  2BNG A;  2W6J H;  2CIU A;  3NQZ A;  4EC6 A;  4CPK A;  2UGI A;  1YVS A;  3QK9 A;  2WGQ A;  3S29 A;  3WR2 A;  4HM4 B;  5FW5 A;  1BSB A;  2Z7A A;  1CYV A;  5IEO A;  2P0X A;  1O7M B;  3UL6 A;  2ZA4 A;  1FUW A;  1ULJ B;  4X2H A;  1M1K 4;  1RGC A;  2XF3 A;  4MMZ B;  2CFD A;  3WOE B;  3F7S A;  2FNQ A;  4HOH A;  3NHX A;  1HZ1 A;  5IG0 A;  1FGO A;  3HIG A;  4RNZ A;  3U97 A;  2CFW A;  3A5E A;  1A67 A;  1VQO 3;  4J9A A;  5IW9 A;  1BNJ A;  3CC4 3;  1Q42 A;  2CFK A;  3SYU A;  4HBR A;  2BIR A;  5AEU B;  3JVC A;  1AV4 A;  4AEQ A;  2LYX A;  2MC8 A;  2F4Y A;  3FG4 A;  3CU3 A;  1GS3 A;  2XFT A;  3AMO B;  3LOY A;  1B20 A;  3MWZ A;  3N54 B;  1DE3 A;  4O8S A;  1MNL A;  4N6V 0;  4EW5 A;  3OW2 2;  2CWV A;  3DH2 A;  4XM4 A;  1B27 A;  1JBS A;  2D1W A;  3RNT A;  2QEX 3;  1JKG A;  3DY5 A;  3MYT A;  4WYK B;  4X2O A;  1STF I;  2JQ5 A;  1IQX A;  1YJ9 3;  3SOA A;  1QAK A;  3G4S 3;  1SQW A;  1FGQ A;  3NV0 A;  5IF6 A;  1S5A A;  1DYU A;  1RNB A;  3GZX B;  1B21 A;  3D79 A;  4FMD A;  1Q82 4;  1OGZ A;  1IVV A;  3JUQ A;  4K1V A;  2XR8 B;  1ZGX A;  2Y74 A;  3G6E 3;  5DRV A;  3ROB A;  1BRH A;  4JRF A;  4KT3 B;  1BNF A;  1C7H A;  1I8V A;  2GBW B;  3LT8 A;  4GL6 A;  3RGR A;  8CHO A;  4HM6 B;  1IYY A;  4FCJ A;  5CXO A;  1B2X A;  1BRI A;  3CCM 3;  2IUK A;  1W01 A;  1CEW I;  3MG3 A;  1IVX A;  4I5Q A;  3HOH A;  2QA4 3;  1LQM B;  2CW9 A;  3FF0 A;  3KII A;  1NB5 I;  2K3D A;  1ZX2 A;  3LXU X;  1AVK A;  1WMN A;  3CC2 3;  1EA2 A;  1JBT A;  5IG5 A;  1BAN A;  3F14 A;  1RMS A;  3WDG B;  1FUT A;  1YI2 3;  1F8N A;  5EVH A;  2W56 A;  3BLZ A;  3DGL A;  1BRN L;  1Q7H A;  3CPO A;  2W03 A;  2Y73 A;  3B4O A;  9RNT A;  1G0T A;  4IIA A;  1FUS A;  1ULI B;  2I9W A;  3K7C A;  1DMQ A;  1I2E A;  2B1X B;  3JUP A;  1NWW A;  1N8R 4;  1U8C B;  2RBI A;  1W2Z A;  3S67 A;  3NX0 A;  3G71 3;  2XSH B;  1GOU A;  1WTH A;  5BXQ A;  4BTY A;  3DMC A;  2KF6 A;  3D4A A;  1TP6 A;  2CK3 H;  1RLS A;  2KCD A;  1X1W A;  2P0M A;  3NXJ A;  1RGG A;  3I0Y A;  4N6M A;  1IU7 A;  5G1L A;  2IUJ A;  3HX8 A;  3PYJ A;  1LRA A;  2WOH A;  5BVB A;  3FKA A;  1GOV A;  1IK3 A;  5BIR A;  1BSE A;  1RGL A;  3DZL A;  4J5G A;  3PZW A;  3KKG A;  2M7O A;  3T0U A;  4RNY A;  1DMN A;  3T8U A;  3KFQ C;  2OWP A;  2K0M A;  2BMR B;  2OQE C;  1BUJ A;  3SED A;  1LVN A;  3ZG0 A;  1V57 A;  1RNT A;  3DGO A;  3CMA 3;  2AAE A;  3DGN A;  1JB5 A;  2KRT A;  2E2V A;  3V92 A;  1OPY A;  1B2Z A;  1SJW A;  4GB5 A;  3GAX A;  1PU4 A;  5CF2 A;  1W00 A;  2H0H A;  1YGW A;  3H51 A;  3LH4 A;  3H3H A;  1STD A;  1KSI A;  1EUI C;  1RCK A;  1BOX A;  3A76 A;  4J5K A;  1BUQ A;  3DM8 A;  2XGL A;  4GSP A;  2P09 A;  2GEY A;  3Q2P A;  3X41 A;  4EV2 A;  3CCJ 3;  1I2G A;  2MF7 A;  4HM1 B;  4HZB B;  1DET A;  1MWU A;  5ELU A;  1UI7 A;  1X1U A;  1GY7 A;  5STD A;  3PS8 A;  1M90 4;  3EQQ B;  4NPB A;  4XBX A;  1S72 3;  3UB1 A;  1RRL A;  1TFO A;  5AI1 A;  1AVL A;  3CCR 3;  1W2B 2;  1UCI A;  3F7X A;  1IVW A;  1LNH A;  1LQG C;  2KXG A;  1Q40 A;  3BND A;  5AEW B;  1YNV X;  4FR9 A;  4HM2 B;  1IQ8 A;  1MWS A;  3EJV A;  2RFR A;  4FMB A;  3ECF A;  4HM3 B;  4HZ9 B;  1X1X A;  1VQ5 3;  3HII A;  1OHP A;  3IJE B;  2Z77 A;  3CPW 2;  4KFF A;  4I4K A;  1LNI A;  3K0Z A;  3LYG A;  3N9H A;  4OK0 A;  1W6Y A;  3CCU 3;  4AKY A;  1GOY A;  2WO0 A;  1NB3 I;  3GWR A;  1LOW A;  3M8C A;  3OX9 A;  1R4Y A;  1YVB I;  1V74 A;  3AHW A;  6GSP A;  1BNE A;  2YFJ B;  4CCV A;  3FGY A;  4ILF A;  2INX A;  3WHO A;  1IT7 A;  1BSA A;  2BMQ B;  1UUW B;  2OQE A;  1OF5 B;  3NM7 A;  4R9L A;  1Q86 4;  1VQ6 3;  1C54 A;  2C11 A;  5AIG A;  3BIR A;  1BRS A;  1TIJ A;  3EX9 A;  4LSO A;  1CYU A;  1MWR A;  1GY6 A;  1JB4 A;  2CFL A;  2WGO A;  1RGA A;  1K73 4;  1IV9 A;  4XB5 A;  5ELJ A;  8RNT A;  1VQN 3;  3VGN A;  1AY7 A;  3MG2 A;  5D82 A;  1QVF 2;  4TX4 A;  3ER7 A;  4HYZ A;  5IEN A;  1Q7Y 4;  3Q90 A;  1WQL B;  5AII A;  3F8X A;  2FXT A;  2ZL8 A;  2ZDJ A;  1NO3 A;  1AQZ A;  3EBY A;  3KZT A;  1CH0 A;  3X42 A;  1I2F A;  2D42 A;  1GD4 A;  3STD A;  2KF5 A;  2W9Q A;  3IMA B;  3U1W A;  5AIH A;  1EKM A;  1IT8 A;  1HU9 A;  1VQL 3;  1BSD A;  2IYJ A;  2QIY A;  4WHA A;  1IVU A;  1U5O A;  3E99 A;  3FZW A;  3LT9 A;  2F99 A;  2IA7 A;  1JN5 A;  2STD A;  3J7Y d;  3X3Y A;  3FF2 A;  1RHL A;  2F98 A;  1EG9 B;  1K41 A;  1YIT 3;  1E97 A;  2KAA A;  1FGT A;  1Z1S A;  1SII A;  3EN8 A;  5IG4 A;  1W5Z A;  1LOV A;  2K54 A;  3G16 A;  3V98 A;  4KZ1 A;  1N5P A;  3KN4 A;  1IDP A;  2R41 A;  4KVH A;  2YFL B;  4MEI A;  5CLK A;  2RGQ A;  1I70 A;  4N6O B;  1KC8 4;  5D83 A;  2IMJ A;  2HMN B;  5FGO A;  2GSP A;  2CG0 A;  1RN1 A;  4BL3 A;  1GYB A;  1WMO A;  3F9S A;  3OWS A;  1UCJ A;  1LOY A;  4K1U A;  1W6C A;  3KSP A;  4XBT A;  1TU5 A;  3HI7 A;  1L5G B;  2B24 B;  3N8B A;  1RCL A;  4MJD A;  1T5Y A;  4H3U A;  4MMX B;  3NBR A;  3VSY A;  3JUO A;  2Z6B A;  1TTO A;  1E3V A;  3Q3F A;  1JJ2 2;  1UUV B;  2CG1 A;  2HMO B;  4MMY B;  3B8L A;  4WP5 A;  1FGR A;  1OHS A;  1Q9E A;  3CME 3;  1JKG B;  2KF4 A;  2L4V A;  1A2K A;  1VZZ A;  1SPU A;  3G0K A;  4R1K A;  3D5G A;  3EC9 A;  4JF8 A;  1RGE A;  1GMQ A;  1BRG A;  2R4I A;  3JUN A;  1OAC A;  4AKZ A;  1MGR A;  3AGN A;  3CNX A;  3EF8 A;  3NV0 B;  1N8Q A;  1A90 A;  1UDI I;  4N6U A;  4N6N B;  3EE1 A;  3NQY A;  6RNT A;  2CWT A;  3RDE A;  1BU4 A;  1HKX A;  1RJO A;  2GBX B;  4HKV B;  4WWU C;  4XDW A;  1ZO2 A;  3SX1 A;  4EXR A;  1RRH A;  5KP1 A;  3CCS 3;  2GU1 A;  4O2H A;  3FH1 A;  5I97 A;  1BAO A;  1MOL A;  3FCS B;  4N6T A;  4R4K A;  3SLU A;  3LZA A;  2YX9 A;  1DMM A;  1BIR A;  1K9M 4;  2CHC A;  1N9J A;  3AMO A;  1OHO A;  4XBY A;  1O7H B;  2OTL 3;  1RN7 A;  2AAD A;  4IT7 A;  4LGQ A;  2RCD A;  1KWI A;  2CC3 A;  2O9U X;  4L8O A;  1G02 A;  1GMP A;  1T3B A;  4PEJ A;  4BU4 A;  1DVD A;  1OUN A;  2UX0 A;  3FLJ A;  1GSP A;  1MWT A;  4R80 A;  1K8A 4;  2O3O A;  4Q53 A;  5LC6 A;  3SXX A;  2V1L A;  4WYK A;  3WOD G;  1D6Z A;  3PCS A;  3MKI A;  1W4N A;  1LXE A;  1BNS A;  3BNC A;  3CNM A;  3DXO A;  4RZM A;  5M19 A;  1I0V A;  3SOY A;  3BNE A;  1GD3 A;  1K28 A;  1W7C A;  3WMD A;  1BRK A;  2W56 B;  1UW1 A;  1JRQ A;  3LTB A;  4ORL A;  3D5I A;  4RNT A;  3S27 A;  2ZHX B;  4G1M B;  1M9G A;  5LC7 A;  3GZY B;  2W9P A;  1Q81 4;  4J8T A;  5EQL A;  1YJN 3;  1ROV A;  1WMP A;  1NU3 A;  2RNT A;  5M18 A;  5IEP A;  1IQY A;  1PY3 A;  2CH9 A;  2F86 B;  1RKY A;  1ISK A;  4WFO A;  4NRE A;  3KCH A;  3LTA A;  4NHF A;  1MGW A;  1UGH I;  3LML A;  1JB2 A;  3NBB A;  1N9E A;  2E2U A;  4OUQ A;  5M1A A;  3ZG5 A;  5IER A;  1SIH A;  1PFP A;  1Y4K A;  5BU4 A;  3OXA A;  2HMM B;  2OTJ 3;  3F40 A;  4K90 B;  3K5T A;  2CFG A;  1RGK A;  3D9R A;  1QJG A;  3MPH A;  1N5H A;  3X40 A;  1YIJ 3;  3EHC A;  3UJM A;  1PYL A;  4HM8 B;  1NJI 4;  1KQS 2;  1JNQ A;  5CK6 A;  1GMR A;  2HOH A;  3CXC 2;  2HMJ B;  4BL2 A;  1GY5 A;  4DKI A;  4N6L A;  5DRE A;  2H0I A;  5G2G A;  2Z76 A;  2PNC A;  5EEO A;  4EBG A;  1JZD A;  3GZR A;  1VQ8 3;  3GZB A;  2SBL A;  5AYS C;  1ASK A;  1SAR A;  3HK4 A;  4XDV A;  3CCQ 3;  4FMC A;  2XH9 A;  3DUK A;  5AIF A;  4HM5 B;  4O02 B;  5RNT A;  1VQ9 3;  1QAL A;  1I3F A;  1EQK A;  3S28 A;  3BNB A;  1TRQ A;  3OWU A;  5D81 A;  4RBN A;  1JBR A;  1A2V A;  2OOV C;  3DGM A;  5HOH A;  1UCK A;  2F5W A;  1ROA A;  2P38 A;  3K9M C;  2HMK B;  3CCL 3;  1FYS A;  2C4B A;  3B7C A;  4FCZ A;  5GSP A;  5TGN A;  5CF1 A;  1VQM 3;  5JPU A;  3CC7 3;  3PGB A;  1FZU A;  3X3X A;  4K61 A;  2LQV A;  3EB8 A;  4LZI A;  1UI8 A;  3NBJ A;  2W04 A;  2XFS A;  4L7K A;  5IG3 A;  1QAF A;  2BT3 A;  7STD A;  2Q07 A;  2F56 A;  3VF1 A;  2XSO B;  4QWT A;  3WA2 X;  1BVI A;  1V58 A;  1FGM A;  3MHE A;  4EV5 A;  1EEJ A;  1DVC A;  2XRX B;  1BGS A;  1Q40 B;  1B2S A;  3O8Y A;  2XGN A;  4GHO A;  2L1S A;  4HAA A;  4IPB A;  3RGA A;  3URP A;  1B2M A;  2BU4 A;  2W2C A;  1A2P A;  1J2B A;  1G96 A;  3DGY A;  1B3S A;  3GSP A;  3KSE D;  1M1X B;  3MG1 A;  1D6U A;  4CJN A;  3I55 3;  1T2H A;  2WOF A;  4HM0 B;  4N3V A;  1O7P B;  3BB9 A;  5KP4 A;  5G1K A;  1YHQ 3;  1BRJ A;  1RGH A;  3CD6 3;  1RN4 A;  2QGU A;  1TJD A;  1YJW 3;  1O7N B;  2H0G A;  2XEP A;  1UUG B;  5HGR A;  3WA3 A;  4O3V A;  1O7G B;  3NM2 A;  1T2I A;  3HZP A;  1B2U A;  2ML6 A;  2HML B;  3K63 A;  5JBS A;  1VQ7 3;  2KF3 A;  4FMA A;  4HVN A;  4EYC A;  2IY2 A;  1BSC A;  2UUG C;  4HJL B;  3F8H A;  3LTD A;  1QVG 2;  2CWU A;  4KFD A;  3ZFZ A;  3X3Z A;  2F5M A;  5A0O B;  4H61 A;  1I3I A;  1VQ4 3;  5JPP A;  3OWY A;  6STD A;  2GU3 A;  3ALA A;  3PXM A;  1VQP 3;  3L0R A;  4LEH A;  1TUH A;  3UNL A;  2SAR A;  1IV7 A;  3EBT A;  1R4C A; 
#chains in the Genus database with same CATH homology
 4R9K A;  2OOV A;  1WNH A;  3NUV A;  1YGE A;  1NDO B;  3EN1 B;  4KFE A;  1JV2 B;  4BTW A;  1LOX A;  1OCV A;  3GRD A;  1VQK 3;  4STD A;  4LMI A;  2C10 A;  3Q1C A;  3CCV 3;  4ZM8 A;  1E3R A;  1AR0 A;  2BO9 B;  4CDL A;  2E2T A;  2P05 A;  3CCE 3;  1OF5 A;  2RSX A;  3OV4 A;  3B4P A;  3SVA A;  2GEX A;  2OCT A;  1W02 A;  1KD1 4;  1JN5 B;  4OVM A;  2FGT A;  2W0Q A;  3FG1 A;  1W6G A;  3FG3 A;  4BTX A;  2PZV A;  2CKF B;  4L8P A;  3FSD A;  1QMA A;  5KP3 A;  3D3L A;  3I56 3;  2ML5 A;  3T8N A;  2JDI H;  1D6Y A;  3UL5 A;  4U13 A;  1TFK A;  1O7W B;  2GXF A;  4HM7 B;  5AYR B;  3TDG A;  2BMO B;  2YFI B;  2BHM A;  1OH0 A;  3V99 A;  2A15 A;  1FA3 A;  3IPT A;  3G8Z A;  3MSO A;  3LTC A;  4FCM A;  3KE7 A;  1US1 A;  3WOF B;  1OGX A;  3PCR A;  3QRD A;  3JUM A;  3S5C A;  1CQS A;  2BNG A;  2W6J H;  2CIU A;  3NQZ A;  4EC6 A;  3QK9 A;  2WGQ A;  3S29 A;  4HM4 B;  5FW5 A;  2Z7A A;  1CYV A;  5IEO A;  2P0X A;  1O7M B;  3UL6 A;  1ULJ B;  4X2H A;  1M1K 4;  2XF3 A;  4MMZ B;  3WOE B;  2CFD A;  3F7S A;  2FNQ A;  3NHX A;  5IG0 A;  1FGO A;  3HIG A;  4RNZ A;  3U97 A;  2CFW A;  1A67 A;  1VQO 3;  4J9A A;  5IW9 A;  3CC4 3;  1Q42 A;  2CFK A;  4HBR A;  5AEU B;  3JVC A;  1AV4 A;  4AEQ A;  2LYX A;  2MC8 A;  3FG4 A;  3CU3 A;  1GS3 A;  2XFT A;  3AMO B;  3LOY A;  3MWZ A;  3N54 B;  4O8S A;  1MNL A;  4N6V 0;  3OW2 2;  2CWV A;  4XM4 A;  2D1W A;  2QEX 3;  1JKG A;  3DY5 A;  3MYT A;  4WYK B;  4X2O A;  1STF I;  2JQ5 A;  1IQX A;  1YJ9 3;  3SOA A;  1QAK A;  3G4S 3;  1SQW A;  1FGQ A;  3NV0 A;  5IF6 A;  1S5A A;  1DYU A;  3GZX B;  4FMD A;  1Q82 4;  1OGZ A;  1IVV A;  3JUQ A;  4K1V A;  2XR8 B;  2Y74 A;  3G6E 3;  5DRV A;  3ROB A;  4JRF A;  1C7H A;  2GBW B;  3LT8 A;  8CHO A;  4GL6 A;  3RGR A;  4HM6 B;  4FCJ A;  5CXO A;  3CCM 3;  2IUK A;  1W01 A;  1CEW I;  3MG3 A;  1IVX A;  2QA4 3;  2CW9 A;  3FF0 A;  3KII A;  1NB5 I;  1ZX2 A;  3LXU X;  1AVK A;  1WMN A;  3CC2 3;  1EA2 A;  5IG5 A;  3F14 A;  3WDG B;  1YI2 3;  1F8N A;  5EVH A;  2W56 A;  3BLZ A;  3DGL A;  3CPO A;  2W03 A;  2Y73 A;  3B4O A;  4IIA A;  1ULI B;  2I9W A;  3K7C A;  1DMQ A;  2B1X B;  3JUP A;  1N8R 4;  1NWW A;  1U8C B;  1W2Z A;  3S67 A;  3NX0 A;  3G71 3;  2XSH B;  1WTH A;  5BXQ A;  4BTY A;  3DMC A;  1TP6 A;  2CK3 H;  2KCD A;  2P0M A;  3NXJ A;  3I0Y A;  4N6M A;  1IU7 A;  2IUJ A;  3HX8 A;  3PYJ A;  2WOH A;  5BVB A;  3FKA A;  1IK3 A;  3DZL A;  3PZW A;  3KKG A;  2M7O A;  3T0U A;  4RNY A;  1DMN A;  3T8U A;  3KFQ C;  2OWP A;  2K0M A;  2BMR B;  2OQE C;  3SED A;  1LVN A;  3CMA 3;  3DGO A;  3DGN A;  1JB5 A;  2KRT A;  2E2V A;  3V92 A;  1OPY A;  1SJW A;  4GB5 A;  3GAX A;  1PU4 A;  5CF2 A;  1W00 A;  3H51 A;  3LH4 A;  3H3H A;  1STD A;  1KSI A;  3A76 A;  1BUQ A;  3DM8 A;  2XGL A;  2P09 A;  2GEY A;  3Q2P A;  4EV2 A;  3CCJ 3;  2MF7 A;  4HM1 B;  4HZB B;  5ELU A;  1UI7 A;  1GY7 A;  5STD A;  3PS8 A;  1M90 4;  3EQQ B;  4XBX A;  1S72 3;  3UB1 A;  1RRL A;  1TFO A;  5AI1 A;  1AVL A;  3CCR 3;  1W2B 2;  3F7X A;  1IVW A;  1LNH A;  2KXG A;  1Q40 A;  3BND A;  5AEW B;  4FR9 A;  4HM2 B;  1IQ8 A;  3EJV A;  2RFR A;  4FMB A;  3ECF A;  4HM3 B;  4HZ9 B;  1VQ5 3;  3HII A;  1OHP A;  3IJE B;  2Z77 A;  3CPW 2;  4KFF A;  4I4K A;  3K0Z A;  3LYG A;  3N9H A;  4OK0 A;  1W6Y A;  3CCU 3;  4AKY A;  2WO0 A;  1NB3 I;  3GWR A;  3M8C A;  3OX9 A;  1YVB I;  1V74 A;  2YFJ B;  4CCV A;  3FGY A;  2INX A;  1IT7 A;  2BMQ B;  1UUW B;  2OQE A;  1OF5 B;  3NM7 A;  4R9L A;  1Q86 4;  1VQ6 3;  2C11 A;  5AIG A;  1TIJ A;  3EX9 A;  4LSO A;  1CYU A;  1GY6 A;  1JB4 A;  2CFL A;  2WGO A;  1K73 4;  1IV9 A;  4XB5 A;  5ELJ A;  1VQN 3;  3VGN A;  5D82 A;  3MG2 A;  1QVF 2;  4TX4 A;  3ER7 A;  4HYZ A;  5IEN A;  1Q7Y 4;  3Q90 A;  1WQL B;  5AII A;  3F8X A;  2FXT A;  2ZL8 A;  2ZDJ A;  1NO3 A;  3EBY A;  3KZT A;  3X42 A;  2D42 A;  1GD4 A;  3STD A;  3IMA B;  2W9Q A;  3U1W A;  5AIH A;  1EKM A;  1IT8 A;  1HU9 A;  1VQL 3;  2QIY A;  4WHA A;  1IVU A;  1U5O A;  3E99 A;  3FZW A;  3LT9 A;  2F99 A;  2IA7 A;  1JN5 A;  2STD A;  3J7Y d;  3X3Y A;  3FF2 A;  2F98 A;  1EG9 B;  1K41 A;  1YIT 3;  1E97 A;  1FGT A;  1Z1S A;  1SII A;  3EN8 A;  5IG4 A;  1W5Z A;  2K54 A;  3G16 A;  3V98 A;  4KZ1 A;  1N5P A;  3KN4 A;  1IDP A;  4KVH A;  2YFL B;  4MEI A;  5CLK A;  2RGQ A;  4N6O B;  1KC8 4;  5D83 A;  2IMJ A;  2HMN B;  5FGO A;  2CG0 A;  1GYB A;  1WMO A;  3F9S A;  3OWS A;  4K1U A;  4XBT A;  1W6C A;  3KSP A;  1TU5 A;  3HI7 A;  1L5G B;  2B24 B;  3N8B A;  4MJD A;  1T5Y A;  4H3U A;  4MMX B;  3NBR A;  3VSY A;  3JUO A;  2Z6B A;  1E3V A;  1JJ2 2;  1UUV B;  2CG1 A;  2HMO B;  4MMY B;  3B8L A;  4WP5 A;  1FGR A;  1OHS A;  3CME 3;  1JKG B;  2L4V A;  1A2K A;  1VZZ A;  1SPU A;  3G0K A;  4R1K A;  3EC9 A;  4JF8 A;  2R4I A;  3JUN A;  1OAC A;  4AKZ A;  3CNX A;  3EF8 A;  3NV0 B;  1N8Q A;  1A90 A;  4N6U A;  4N6N B;  3EE1 A;  3NQY A;  2CWT A;  3RDE A;  1HKX A;  2GBX B;  1RJO A;  4HKV B;  4WWU C;  5I97 A;  4XDW A;  1ZO2 A;  3SX1 A;  4EXR A;  1RRH A;  5KP1 A;  3CCS 3;  2GU1 A;  4O2H A;  3FH1 A;  1MOL A;  4N6T A;  3FCS B;  4R4K A;  3SLU A;  3LZA A;  2YX9 A;  1DMM A;  1K9M 4;  2CHC A;  1N9J A;  3AMO A;  1OHO A;  4XBY A;  1O7H B;  2OTL 3;  1RN7 A;  4IT7 A;  4LGQ A;  2RCD A;  1KWI A;  2CC3 A;  2O9U X;  4L8O A;  4PEJ A;  1DVD A;  1OUN A;  2UX0 A;  3FLJ A;  1K8A 4;  4R80 A;  2O3O A;  4Q53 A;  5LC6 A;  3SXX A;  2V1L A;  4WYK A;  3WOD G;  1D6Z A;  3PCS A;  3MKI A;  1W4N A;  1LXE A;  3BNC A;  3CNM A;  3DXO A;  4RZM A;  3SOY A;  3BNE A;  1GD3 A;  1K28 A;  1W7C A;  3WMD A;  2W56 B;  1UW1 A;  1JRQ A;  3LTB A;  4ORL A;  3S27 A;  4G1M B;  1M9G A;  5LC7 A;  3GZY B;  2W9P A;  1Q81 4;  4J8T A;  5EQL A;  1YJN 3;  1ROV A;  1WMP A;  1NU3 A;  5IEP A;  1IQY A;  2CH9 A;  2F86 B;  1RKY A;  1ISK A;  4WFO A;  4NRE A;  3LTA A;  4NHF A;  5HGR A;  3X3X A;  1FUW A;  3LML A;  1JB2 A;  3NBB A;  1N9E A;  2E2U A;  4OUQ A;  5IER A;  1SIH A;  1PFP A;  1Y4K A;  3OXA A;  2HMM B;  2OTJ 3;  3F40 A;  4K90 B;  3K5T A;  2CFG A;  3D9R A;  1QJG A;  3MPH A;  1N5H A;  3X40 A;  1YIJ 3;  3EHC A;  3UJM A;  1NJI 4;  4HM8 B;  1KQS 2;  1JNQ A;  5CK6 A;  3CXC 2;  2HMJ B;  1GY5 A;  4N6L A;  5DRE A;  5G2G A;  2Z76 A;  2PNC A;  5EEO A;  4EBG A;  3GZR A;  1VQ8 3;  3GZB A;  2SBL A;  5AYS C;  1ASK A;  4XDV A;  3HK4 A;  3CCQ 3;  4FMC A;  2XH9 A;  3DUK A;  5AIF A;  4HM5 B;  4O02 B;  1VQ9 3;  1QAL A;  1EQK A;  3S28 A;  3BNB A;  3OWU A;  5D81 A;  4RBN A;  1A2V A;  2OOV C;  3DGM A;  1ROA A;  2P38 A;  3K9M C;  2HMK B;  3CCL 3;  3B7C A;  4FCZ A;  5TGN A;  5CF1 A;  1VQM 3;  5JPU A;  3CC7 3;  3PGB A;  4K61 A;  2LQV A;  3EB8 A;  4LZI A;  1UI8 A;  3NBJ A;  2W04 A;  2XFS A;  4L7K A;  5IG3 A;  1QAF A;  2BT3 A;  7STD A;  2Q07 A;  3VF1 A;  2XSO B;  4QWT A;  3WA2 X;  1FGM A;  3MHE A;  4EV5 A;  2XRX B;  1DVC A;  3O8Y A;  1Q40 B;  3X41 A;  2XGN A;  3RGA A;  1J2B A;  4IPB A;  2W2C A;  1G96 A;  3MG1 A;  3KSE D;  1M1X B;  1D6U A;  3I55 3;  2WOF A;  4HM0 B;  4N3V A;  1O7P B;  3BB9 A;  5KP4 A;  1YHQ 3;  3CD6 3;  2QGU A;  1YJW 3;  1O7N B;  2XEP A;  3WA3 A;  4O3V A;  1O7G B;  3NM2 A;  3HZP A;  1VQ7 3;  2ML6 A;  3K63 A;  2HML B;  5JBS A;  4FMA A;  4HVN A;  4EYC A;  4HJL B;  3F8H A;  3LTD A;  1QVG 2;  2CWU A;  4KFD A;  3X3Z A;  5A0O B;  1VQ4 3;  4H61 A;  5JPP A;  3OWY A;  6STD A;  2GU3 A;  3ALA A;  3PXM A;  1VQP 3;  3L0R A;  4LEH A;  1TUH A;  3UNL A;  1IV7 A;  3EBT A;  1R4C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...