1A67A

Chicken egg white cystatin wildtype, nmr, 16 structures
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
108
structure length
108
Chain Sequence
GAPVPVDENDEGLQRALQFAMAEYNRASNDKYSSRVVRVISAKRQLVSGIKYILQVEIGRTTCPKSSGDLQSCEFHDEPEMAKYTTCTFVVYSIPWLNQIKLLESKCQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Proteinase inhibitor
molecule keywords CYSTATIN
publication title The structures of native phosphorylated chicken cystatin and of a recombinant unphosphorylated variant in solution.
pubmed doi rcsb
total genus 13
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 1998-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1a67A00
4TX4A 1DVDA 3UL5A 3PXMA 1R4CA 5LC6A 1STFI 1A90A 1M9GA 3PYJA 1N5PA 1IV9A 1IV7A 3QRDA 4N6TA 2W9PA 1ROAA 4N6MA 3UL6A 3IMAB 1GD3A 5ELUA 2CH9A 3SVAA 1G96A 5A0OB 3S67A 4N6UA 1MOLA 3Q2PA 5LC7A 1A67A 3L0RA 1N9JA 2OCTA 4N6NB 4ZM8A 2O9UX 1CEWI 1N5HA 4EYCA 4LZIA 1LXEA 3PS8A 1KWIA 1CYUA 3KFQC 5EQLA 1YVBI 4IT7A 4N6OB 3LH4A 2BO9B 2KXGA 3GAXA 1NB3I 5ELJA 1PFPA 1WNHA 4CCVA 3NX0A 4N6V0 1CYVA 1TIJA 1NB5I 1EQKA 1DVCA 3MWZA 1GD4A 4N6LA 1MNLA 1RN7A 1FA3A 3K9MC 2W9QA 1FUWA 3KSED
chains in the Genus database with same CATH superfamily
1ZS7A 3F40A 3AMOA 4HM0B 1I3IA 1LOXA 3MG1A 1UUVB 1RSNA 1UUGB 1UUWB 1RLSA 3AGNA 1AY7A 4RNTA 4WHAA 3U1WA 2D1WA 5CK6A 4KFEA 3HX8A 3HZPA 3JUNA 3FLJA 2F98A 1D6YA 5G2GA 1OHSA 2L1SA 3KIIA 1OF5A 4MJDA 5HOHA 5FW5A 5IG0A 1BRNL 3F7SA 4R1KA 3H51A 1I2FA 1JV2B 2XGLA 5JPPA 1B2UA 1JKGA 1J2BA 3X3YA 4BU4A 1IV9A 2XRXB 1OHOA 2QA43 2Z77A 1DE3A 1GS3A 3CME3 1GMQA 3CPW2 3QRDA 5D81A 2O3OA 4MMZB 5BVBA 1ROAA 1JNQA 3LT9A 1BSAA 3X40A 3N8BA 1O7PB 3GZYB 3HOHA 5IG4A 1W02A 1M1XB 4IIAA 1FZUA 2OQEC 1VQ63 5RNTA 3DUKA 3HK4A 3MPHA 3AHSA 1RGGA 1YGEA 3EJVA 2OOVA 1Q7HA 3NM2A 5CF1A 5M18A 2LYXA 1I2GA 1PYLA 2YFLB 3EQQB 1JBRA 3WODG 3G0KA 1MWRA 1K9M4 1Q864 1MOLA 4H3UA 1OHPA 3MKIA 3Q2PA 1PU4A 1I3FA 1RGLA 3OW22 2PNCA 2K54A 5LC7A 1G0TA 2I9WA 1C54A 5CLKA 1E3VA 4L8PA 5TGNA 1A67A 4X2HA 4ILFA 3K7CA 4HJLB 5M1AA 1BGSA 1JB5A 2D42A 1K28A 3GZBA 5IF6A 2FNQA 3LTDA 1YI23 1N5HA 5IENA 1BRSA 3F14A 1OH0A 3IJEB 1UCIA 3DGNA 4K61A 3SX1A 3O8YA 1JZOA 3DZLA 1BSEA 2GBXB 1LXEA 2CFLA 1T5YA 3PCSA 1KSIA 1BRJA 2HMOB 1CYUA 2WO0A 2W6JH 2ZL8A 4O02B 4RNYA 1EKMA 1JRQA 5EQLA 1YVBI 3X3XA 3OXAA 1AVKA 3CC23 3LH4A 2BO9B 2IA7A 1MGWA 1LNHA 2A15A 3DMCA 4EV5A 2WGOA 1Y4KA 6RNTA 8CHOA 3JUQA 4LYLB 4BTYA 1YVSA 1YHQ3 1SIHA 2UX0A 3NX0A 1V57A 1M904 1KC84 3VF1A 1AR0A 3T0UA 2CKFB 3OX9A 3DGOA 2CW9A 6GSPA 4EXRA 8RNTA 3GZXB 1RN4A 5IERA 1AQZA 2HMNB 1OGXA 4DKIA 3HIGA 1RNBA 2Z7AA 4BL2A 1BVIA 2XGNA 3OWUA 1UGIA 3D3LA 1SARA 1OUNA 3FG4A 3Q1CA 4LSOA 5G1KA 3Q3FA 7STDA 3FF0A 3D9RA 3FG1A 1TFOA 2C4BA 2SBLA 2RBIA 4LEHA 3EBYA 2IY2A 3RNTA 3K9MC 5AIFA 1IQ8A 3V99A 5CF2A 2W9QA 1IVUA 1VQ73 1NU3A 2XFTA 4HM1B 4RZMA 1VQP3 4BL3A 1VQQA 3PZWA 1DMQA 2H0GA 1RN1A 2M7OA 2OWPA 5D82A 3E99A 2WOFA 1VQK3 2YFJB 2CX0A 4XBTA 3A76A 3OWSA 1DVDA 5IG5A 2MF7A 1OPYA 4WFOA 5BXQA 2Z76A 1STFI 2BHMA 4XBYA 3CNXA 1M1K4 3NBBA 5AYRB 4KFDA 1A90A 3B4OA 1EG9B 3FZWA 3PYJA 4Q53A 3ROBA 1N5PA 2P0MA 2RNTA 3FCSB 1TRPA 1WMNA 1JB2A 3N54B 3RGAA 1QAFA 3WDGB 4L8OA 1RGFA 1W01A 1NO3A 1TFKA 4R9LA 3ZFZA 3GRDA 4WWUC 1Q40A 1STDA 3K63A 1JN5B 3KE7A 2J8XB 4LGQA 5CXOA 1Q7Y4 4KFFA 3QK9A 1BRIA 3CCE3 1KD14 1GD3A 3MG2A 1NWWA 2AAEA 1JZDA 3PGBA 5ELUA 3OV4A 3CD63 2BMRB 3U97A 2K3DA 1IQYA 1MWUA 2CIUA 3CCM3 3WMDA 1QVG2 1GY7A 1NNVA 4FR9A 3SVAA 1AVLA 2V1LA 1C7HA 4N6UA 3S67A 1RKYA 3KKGA 3K0ZA 1RRLA 5DRVA 5KP1A 1IU7A 1CH0A 1LQMB 1EEJA 1RMSA 2XF3A 1W4NA 2P38A 1RGKA 1UI8A 3BU4A 1IT8A 3CCS3 2KAAA 2OCTA 3FKAA 2STDA 2INXA 2CX1A 3JUPA 3F7XA 3BNCA 4ZM8A 1CEWI 1DMNA 2GSPA 3B7CA 3LMLA 1VQ83 1GY6A 1MWSA 2R4IA 1FGRA 3D5GA 2W56B 4LZIA 3OWYA 4JF8A 3SOAA 2F5WA 1RNTA 3Q90A 2LQVA 1K41A 3PCRA 1QJGA 2BIRA 2BNGA 2QGUA 3NXJA 4K1VA 1VQ93 1MWTA 1BAOA 1BNSA 1UGHI 4N6OB 1R4YA 1YJ93 1ZX2A 4KZ1A 1S5AA 1L5GB 3GAXA 3EE1A 1W2B2 1CQSA 5BU4A 3EB8A 1ROVA 4HOHA 1GOYA 3CPOA 4J5GA 4AEQA 3LZAA 5ELJA 1Q824 1PFPA 2KF5A 4O8SA 2E2TA 1KQS2 1W5ZA 2AADA 2FXTA 1FGOA 1ZO2A 2QIYA 2UUGC 1NB5I 1PY3A 1UCLA 1UW1A 3KSPA 3JUOA 1O7HB 3LOYA 1FUTA 1G02A 4HM7B 1MNLA 2KCDA 5EEOA 4I5QA 2RCDA 3I553 1QMAA 1B2ZA 3SEDA 1VQO3 1RTUA 2ZA4A 1FUSA 1W6GA 4HM5B 3WOFB 3CC73 3KZTA 1VQL3 1FA3A 2W2CA 1I8VA 4WYKB 1IVXA 1IQXA 1V74A 2B24B 3NV0B 4FMDA 4HKVB 3MHEA 1FUWA 1X1WA 1LQGC 4EC6A 1BSCA 4FCMA 3MSOA 4K1UA 5STDA 3WOEB 3AMOB 1HKXA 2XSHB 4JRFA 1A2PA 2ZDJA 2ML6A 4AKZA 4LMIA 2CHCA 1A2VA 2BU4A 3UL5A 4GL6A 1R4CA 4IPBA 3FG3A 1K734 2F5MA 1FGQA 2C11A 3MG3A 4EW5A 3DM8A 6STDA 4O2HA 2W03A 3BNEA 1BRHA 1OF5B 3EN1B 3M8CA 5IEPA 4NREA 2GBWB 1JKGB 1YIT3 1IT7A 2XH9A 2F4YA 4HM4B 1GMRA 3KCHA 1D6ZA 4CDLA 1I0XA 1UCKA 3V98A 3CCJ3 1W6YA 3ALAA 3EBTA 3AGOA 4L7KA 1YIJ3 4HAAA 1B2XA 4HZBB 1E97A 3URPA 1BUQA 3GWRA 1SJWA 2W9PA 1X1YA 1X1XA 4CPKA 3NQZA 3EX9A 2HOHA 1RCKA 1WQLB 3IMAB 4J9AA 2GU3A 3N9HA 3ZG0A 1GOUA 3CCV3 2CFKA 3TDGA 3S29A 1BIRA 2C10A 2IMJA 9RNTA 2IUJA 1LVNA 3AHWA 1E3RA 4WP5A 1IK3A 5AIHA 5AEUB 2CC3A 2CFWA 1Q814 1G96A 4K90B 4BIRA 1VQM3 3F9SA 1O7MB 4HVNA 5HGRA 3SOYA 3H3HA 1LOYA 2JDIH 1BNJA 1GSPA 1WTHA 5AIIA 3UJMA 3VGNA 2BT3A 3DY5A 1N8QA 2RGQA 2OQEA 4MMXB 4U13A 1SQWA 1BOXA 1GY5A 2P0XA 3L0RA 1BNFA 1N9JA 4GB5A 1OGZA 1T2HA 1B20A 2XR8B 2H0IA 2K0MA 2KRTA 4EYCA 3B8LA 3G8ZA 2CWUA 2R41A 1TTOA 2WGQA 1TRQA 1TJDA 4NHFA 3X3ZA 4HM3B 3T8NA 1RCLA 1YJW3 1O7WB 3ER7A 4RNZA 3G713 1B2SA 3DXOA 3IPTA 2CWVA 3D5IA 3NQYA 5FGOA 3UB1A 1NDOB 1B3SA 3CXC2 1U5OA 1SIIA 5JPUA 2GEXA 3K5TA 1RGEA 1I2EA 4BTXA 2BMQB 4IT7A 1N8R4 2GU1A 3S27A 2E2VA 3CC43 2CK3H 5M19A 1U8CB 2IYJA 4FMAA 1QVF2 2KF4A 3CCL3 1WMPA 3RGRA 2QEX3 2W04A 4N6V0 1O7GB 4CJNA 1MGRA 2CG1A 1TIJA 5I97A 1VZZA 1FGTA 1HZ1A 2ZHXB 3NBRA 1EQKA 1O7NB 3V92A 4XDVA 3MWZA 3SYUA 3LTBA 3F8XA 1BRGA 3WR2A 1RJOA 4N6LA 2ML5A 4EBGA 2Q07A 3FGYA 4FMBA 5JBSA 1VQN3 1Z1SA 5AI1A 3CU3A 1LNIA 3I0YA 2CFGA 2W0QA 4I4KA 2RFRA 3EC9A 4STDA 2XSOB 1LRAA 1YGWA 1W00A 4MEIA 1JBSA 4AKYA 3LT8A 3ECFA 2OTJ3 1V58A 3DGLA 3G4S3 1IVVA 3G6E3 1B2MA 2KF6A 1YJN3 1BNEA 3GSPA 1IYYA 4TX4A 3VSYA 5IEOA 1IVWA 3WHOA 1SPUA 3CCQ3 2L4VA 2XFSA 3PXMA 3ZG5A 5AYSC 5LC6A 1I70A 5IG3A 2IUKA 1BNIA 3GZRA 4R80A 1N9EA 2P09A 4O3VA 1M9GA 4J5KA 4BTWA 1DETA 4XB5A 4EV2A 1S723 3JVCA 3JUMA 4H61A 4XM4A 3KN4A 3DGMA 4G1MB 3D4AA 4OUQA 1IV7A 1VQ43 2F99A 1K8A4 1BU4A 1HYFA 4HZ9B 1A2KA 1Q40B 1W7CA 3CNMA 1EUIC 2WOHA 2Y74A 2CWTA 2Y73A 4N6TA 1JN5A 1BNRA 2KF3A 4N6MA 3UL6A 4QWTA 1BUJA 1DYUA 2JQ5A 3BNDA 1AV4A 2XEPA 1US1A 4HBRA 5D83A 2CH9A 2HMMB 2MC8A 1HU9A 3NBJA 3B4PA 4FMCA 1UCJA 1T3BA 2CG0A 2UGIA 3UNLA 5A0OB 4OVMA 3J7Yd 1LOVA 2RSXA 2B1XB 1FW7A 3F8HA 3LYGA 5BIRA 4XBXA 1TU5A 1RGAA 4N3VA 1T2IA 1BSDA 3STDA 2FGTA 4J8TA 3X42A 4PEJA 1GMPA 1B21A 5KP4A 4KT3B 1BANA 1F8NA 1WMOA 2GEYA 1RRHA 1TP6A 1RHLA 3NUVA 1BRKA 4OK0A 1GYBA 4N6NB 1UDII 2OOVC 1ULIB 1ASKA 1FYSA 2O9UX 3FF2A 2F86B 1EA2A 4HM8B 3CCU3 5G1LA 2CFDA 4HM2B 1RGHA 3T8UA 5KP3A 3FH1A 4MMYB 1BSBA 1OCVA 1JJ22 2W56A 1I0VA 4X2OA 2YX9A 3A5EA 3NM7A 5AIGA 1BNGA 3PS8A 3BLZA 2SARA 4NPBA 1JBTA 1OACA 4R4KA 1KWIA 1Q42A 3MYTA 3KFQC 5DREA 5EVHA 1JB4A 3I563 1IDPA 1RDSA 3G16A 3LXUX 7RNTA 3DGYA 4R9KA 2F56A 2KXGA 1X1UA 3X41A 3BB9A 1NB3I 1B27A 4XDWA 3BNBA 1FGMA 1ZGXA 1WNHA 3HI7A 1QALA 1ULJB 5GSPA 3WA2X 4CCVA 2H0HA 1RGCA 3EF8A 3S28A 3SLUA 1CYVA 1DMMA 3LTAA 7GSPA 3WA3A 1QAKA 4HYZA 1GOVA 1Q9EA 2PZVA 4HM6B 1DVCA 3LTCA 3DH2A 3NHXA 2YFIB 1GD4A 4ORLA 3HIIA 5AEWB 3RDEA 2BMOB 3BIRA 3FSDA 3CMA3 4GHOA 2OTL3 2E2UA 1VQ53 4KVHA 1RN7A 2HMLB 1W2ZA 1W6CA 2HMJB 2Z6BA 3S5CA 4WYKA 2P05A 4RBNA 5IW9A 3D79A 2HMKB 3SXXA 3KSED 1NJI4 1ISKA 3CCR3 1D6UA 3NV0A 2GXFA 1YNVX 3EHCA 1UI7A 3EN8A 4FCJA 4GSPA 4FCZA 1LOWA 1TUHA
chains in the Genus database with same CATH topology
3F40A 3AMOA 4HM0B 1LOXA 3MG1A 1UUVB 1UUWB 4WHAA 3U1WA 2D1WA 5CK6A 4KFEA 3HX8A 3HZPA 3JUNA 3FLJA 2F98A 1D6YA 5G2GA 1OHSA 3KIIA 4MJDA 1OF5A 5FW5A 5IG0A 3F7SA 4R1KA 3H51A 1JV2B 2XGLA 5JPPA 1J2BA 1JKGA 3X3YA 1IV9A 2XRXB 1OHOA 2QA43 2Z77A 1GS3A 3CME3 3CPW2 3QRDA 5D81A 2O3OA 4MMZB 5BVBA 1ROAA 1JNQA 3LT9A 3X40A 3N8BA 1O7PB 3GZYB 5IG4A 1W02A 1M1XB 4IIAA 2OQEC 1VQ63 3DUKA 3HK4A 3MPHA 1YGEA 3EJVA 2OOVA 5CF1A 3NM2A 2LYXA 3EQQB 2YFLB 3WODG 3G0KA 1K9M4 1Q864 1MOLA 4H3UA 1OHPA 3MKIA 3Q2PA 1PU4A 3OW22 2PNCA 2K54A 5LC7A 2I9WA 5CLKA 1E3VA 4L8PA 5TGNA 1A67A 4X2HA 3K7CA 4HJLB 1JB5A 2D42A 1K28A 3GZBA 5IF6A 2FNQA 3LTDA 1YI23 1N5HA 5IENA 3F14A 1OH0A 3IJEB 4K61A 3DGNA 3SX1A 3O8YA 3DZLA 2GBXB 1LXEA 2CFLA 1T5YA 3PCSA 1KSIA 2HMOB 1CYUA 2WO0A 2ZL8A 2W6JH 4O02B 4RNYA 1EKMA 1JRQA 5EQLA 1YVBI 3X3XA 3OXAA 1AVKA 3CC23 3LH4A 2BO9B 2IA7A 1LNHA 2A15A 3DMCA 4EV5A 2WGOA 1Y4KA 8CHOA 3JUQA 4BTYA 1YHQ3 1SIHA 2UX0A 3NX0A 1M904 1KC84 3VF1A 1AR0A 3T0UA 2CKFB 3OX9A 3DGOA 2CW9A 4EXRA 3GZXB 5IERA 2HMNB 1OGXA 3HIGA 2Z7AA 2XGNA 3Q1CA 3OWUA 3D3LA 3FG4A 1OUNA 4LSOA 3FF0A 3D9RA 3FG1A 1TFOA 2SBLA 4LEHA 3EBYA 3K9MC 5AIFA 1IQ8A 3V99A 5CF2A 2W9QA 1IVUA 1VQ73 1NU3A 2XFTA 4HM1B 4RZMA 1VQP3 3PZWA 1DMQA 2OWPA 2M7OA 5D82A 3E99A 2WOFA 1VQK3 2YFJB 4XBTA 3A76A 3OWSA 1DVDA 5IG5A 2MF7A 1OPYA 4WFOA 5BXQA 2Z76A 1STFI 2BHMA 4XBYA 3CNXA 1M1K4 3NBBA 5AYRB 4KFDA 1A90A 3B4OA 1EG9B 3FZWA 3PYJA 4Q53A 3ROBA 1N5PA 2P0MA 3FCSB 1WMNA 1JB2A 3N54B 3RGAA 1QAFA 3WDGB 4L8OA 1W01A 1NO3A 1TFKA 4R9LA 3GRDA 4WWUC 1Q40A 1STDA 3K63A 1JN5B 3KE7A 4LGQA 5CXOA 1Q7Y4 4KFFA 3QK9A 3CCE3 1KD14 1GD3A 3MG2A 1NWWA 3PGBA 5ELUA 3OV4A 3CD63 2BMRB 3U97A 1IQYA 2CIUA 3CCM3 3WMDA 1QVG2 1GY7A 3SVAA 4FR9A 1AVLA 2V1LA 1C7HA 4N6UA 3S67A 1RKYA 3KKGA 3K0ZA 1RRLA 5DRVA 5KP1A 1IU7A 2XF3A 1W4NA 2P38A 1UI8A 1IT8A 3CCS3 2OCTA 3FKAA 2STDA 2INXA 3JUPA 3F7XA 3BNCA 4ZM8A 1CEWI 1DMNA 3B7CA 3LMLA 1VQ83 1GY6A 2R4IA 1FGRA 2W56B 4LZIA 3OWYA 4JF8A 3SOAA 3Q90A 2LQVA 1K41A 3PCRA 1QJGA 2QGUA 2BNGA 3NXJA 4K1VA 1VQ93 4N6OB 1YJ93 1ZX2A 4KZ1A 1S5AA 1L5GB 3GAXA 3EE1A 1W2B2 1CQSA 3EB8A 1ROVA 3CPOA 4AEQA 3LZAA 5ELJA 1Q824 1PFPA 4O8SA 2E2TA 1KQS2 1W5ZA 2FXTA 1FGOA 1ZO2A 2QIYA 1NB5I 3KSPA 1UW1A 3JUOA 1O7HB 3LOYA 4HM7B 1MNLA 2KCDA 5EEOA 2RCDA 3I553 1QMAA 3SEDA 1VQO3 1W6GA 3CC73 4HM5B 3WOFB 1VQL3 3KZTA 1FA3A 2W2CA 4WYKB 1IVXA 1IQXA 1V74A 2B24B 3NV0B 4FMDA 4HKVB 3MHEA 1FUWA 4EC6A 4FCMA 3MSOA 4K1UA 5STDA 3WOEB 3AMOB 1HKXA 2XSHB 4JRFA 2ZDJA 2ML6A 4AKZA 4LMIA 2CHCA 1A2VA 3UL5A 4GL6A 1R4CA 4IPBA 3FG3A 1K734 1FGQA 2C11A 3MG3A 6STDA 3DM8A 4O2HA 2W03A 3BNEA 3EN1B 1OF5B 3M8CA 5IEPA 4NREA 2GBWB 1JKGB 1YIT3 1IT7A 2XH9A 4HM4B 1D6ZA 4CDLA 3V98A 3CCJ3 1YIJ3 1W6YA 3ALAA 3EBTA 4L7KA 4HZBB 1E97A 1BUQA 3GWRA 1SJWA 2W9PA 3NQZA 3EX9A 4J9AA 1WQLB 3IMAB 2GU3A 3N9HA 3CCV3 2CFKA 3TDGA 3S29A 2C10A 2IMJA 1IK3A 2IUJA 1LVNA 4WP5A 1E3RA 5AIHA 5AEUB 2CC3A 2CFWA 1Q814 1G96A 4K90B 1VQM3 3F9SA 1O7MB 4HVNA 5HGRA 3SOYA 3H3HA 2JDIH 5AIIA 1WTHA 3UJMA 3VGNA 2BT3A 3DY5A 1N8QA 2RGQA 2OQEA 4MMXB 4U13A 1SQWA 1GY5A 2P0XA 3L0RA 1N9JA 4GB5A 1OGZA 2XR8B 4EYCA 2K0MA 2KRTA 3B8LA 3G8ZA 2CWUA 3X3ZA 2WGQA 4NHFA 1YJW3 4HM3B 3T8NA 1O7WB 3ER7A 4RNZA 3G713 3DXOA 3IPTA 5FGOA 2CWVA 3NQYA 3UB1A 1NDOB 3CXC2 1U5OA 1SIIA 5JPUA 2GEXA 3K5TA 4BTXA 2BMQB 4IT7A 1N8R4 2GU1A 3S27A 2E2VA 3CC43 2CK3H 1U8CB 4FMAA 1QVF2 3CCL3 1WMPA 3RGRA 2QEX3 2W04A 4N6V0 1O7GB 2CG1A 1TIJA 5I97A 1VZZA 1FGTA 3NBRA 1EQKA 1O7NB 3V92A 4XDVA 3MWZA 3LTBA 3F8XA 1RJOA 4N6LA 2ML5A 4EBGA 2Q07A 3FGYA 4FMBA 5JBSA 1VQN3 1Z1SA 5AI1A 3CU3A 3I0YA 2CFGA 2W0QA 4I4KA 2RFRA 3EC9A 4STDA 2XSOB 1W00A 4MEIA 4AKYA 3LT8A 3ECFA 2OTJ3 3DGLA 3G4S3 1IVVA 3G6E3 1YJN3 4TX4A 3VSYA 5IEOA 1IVWA 1SPUA 3CCQ3 2L4VA 2XFSA 3PXMA 5AYSC 5LC6A 5IG3A 2IUKA 3GZRA 4R80A 1N9EA 2P09A 4O3VA 1M9GA 4BTWA 4XB5A 4EV2A 1S723 3JVCA 3JUMA 4H61A 4XM4A 3KN4A 3DGMA 4G1MB 4OUQA 1IV7A 1VQ43 2F99A 1K8A4 4HZ9B 1A2KA 1Q40B 1W7CA 3CNMA 2Y74A 2WOHA 2Y73A 2CWTA 4N6TA 1JN5A 4N6MA 3UL6A 4QWTA 1DYUA 2JQ5A 3BNDA 1AV4A 2XEPA 1US1A 4HBRA 5D83A 2CH9A 2HMMB 2MC8A 1HU9A 3NBJA 3B4PA 4FMCA 2CG0A 3UNLA 5A0OB 4OVMA 3J7Yd 2RSXA 2B1XB 3F8HA 3LYGA 4XBXA 1TU5A 4N3VA 3STDA 2FGTA 4J8TA 3X42A 4PEJA 5KP4A 1F8NA 1WMOA 2GEYA 1RRHA 1TP6A 3NUVA 4OK0A 1GYBA 4N6NB 2OOVC 1ULIB 1ASKA 2O9UX 3FF2A 2F86B 1EA2A 4HM8B 3CCU3 2CFDA 4HM2B 3T8UA 5KP3A 3FH1A 4MMYB 1OCVA 1JJ22 2W56A 4X2OA 2YX9A 3NM7A 5AIGA 3PS8A 3BLZA 1OACA 4R4KA 1KWIA 1Q42A 3MYTA 3KFQC 5DREA 5EVHA 1JB4A 3I563 1IDPA 3G16A 3LXUX 4R9KA 2KXGA 3X41A 3BB9A 1NB3I 4XDWA 3BNBA 1FGMA 3WA2X 1WNHA 3HI7A 1QALA 1ULJB 4CCVA 7STDA 3S28A 3EF8A 3SLUA 1CYVA 1DMMA 3LTAA 3WA3A 1QAKA 4HYZA 2PZVA 4HM6B 1DVCA 3LTCA 3NHXA 2YFIB 1GD4A 4ORLA 3HIIA 5AEWB 3RDEA 2BMOB 3FSDA 3CMA3 2OTL3 2E2UA 1VQ53 4KVHA 1RN7A 2HMLB 1W2ZA 1W6CA 2HMJB 2Z6BA 3S5CA 4WYKA 2P05A 4RBNA 5IW9A 2HMKB 3SXXA 3KSED 1NJI4 1ISKA 3CCR3 1D6UA 3NV0A 2GXFA 3EN8A 1UI7A 4FCJA 4FCZA 3EHCA 1TUHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TX4 A;  1DVD A;  3UL5 A;  3PXM A;  1R4C A;  5LC6 A;  1STF I;  1A90 A;  1M9G A;  3PYJ A;  1N5P A;  1IV9 A;  1IV7 A;  3QRD A;  4N6T A;  2W9P A;  1ROA A;  4N6M A;  3UL6 A;  3IMA B;  1GD3 A;  5ELU A;  2CH9 A;  3SVA A;  1G96 A;  5A0O B;  3S67 A;  4N6U A;  1MOL A;  3Q2P A;  5LC7 A;  1A67 A;  3L0R A;  1N9J A;  2OCT A;  4N6N B;  4ZM8 A;  2O9U X;  1CEW I;  1N5H A;  4EYC A;  4LZI A;  1LXE A;  3PS8 A;  1KWI A;  1CYU A;  3KFQ C;  5EQL A;  1YVB I;  4IT7 A;  4N6O B;  3LH4 A;  2BO9 B;  2KXG A;  3GAX A;  1NB3 I;  5ELJ A;  1PFP A;  1WNH A;  4CCV A;  3NX0 A;  4N6V 0;  1CYV A;  1TIJ A;  1NB5 I;  1EQK A;  1DVC A;  3MWZ A;  1GD4 A;  4N6L A;  1MNL A;  1RN7 A;  1FA3 A;  3K9M C;  2W9Q A;  1FUW A;  3KSE D; 
#chains in the Genus database with same CATH topology
 1ZS7 A;  3F40 A;  3AMO A;  4HM0 B;  1I3I A;  1LOX A;  3MG1 A;  1UUV B;  1RSN A;  1UUG B;  1UUW B;  1RLS A;  3AGN A;  1AY7 A;  4RNT A;  4WHA A;  3U1W A;  2D1W A;  5CK6 A;  4KFE A;  3HX8 A;  3HZP A;  3JUN A;  3FLJ A;  2F98 A;  1D6Y A;  5G2G A;  1OHS A;  2L1S A;  3KII A;  1OF5 A;  4MJD A;  5HOH A;  5FW5 A;  5IG0 A;  1BRN L;  3F7S A;  4R1K A;  3H51 A;  1I2F A;  1JV2 B;  2XGL A;  5JPP A;  1B2U A;  1JKG A;  1J2B A;  3X3Y A;  4BU4 A;  1IV9 A;  2XRX B;  1OHO A;  2QA4 3;  2Z77 A;  1DE3 A;  1GS3 A;  3CME 3;  1GMQ A;  3CPW 2;  3QRD A;  5D81 A;  2O3O A;  4MMZ B;  5BVB A;  1ROA A;  1JNQ A;  3LT9 A;  1BSA A;  3X40 A;  3N8B A;  1O7P B;  3GZY B;  3HOH A;  5IG4 A;  1W02 A;  1M1X B;  4IIA A;  1FZU A;  2OQE C;  1VQ6 3;  5RNT A;  3DUK A;  3HK4 A;  3MPH A;  3AHS A;  1RGG A;  1YGE A;  3EJV A;  2OOV A;  1Q7H A;  3NM2 A;  5CF1 A;  5M18 A;  2LYX A;  1I2G A;  1PYL A;  2YFL B;  3EQQ B;  1JBR A;  3WOD G;  3G0K A;  1MWR A;  1K9M 4;  1Q86 4;  1MOL A;  4H3U A;  1OHP A;  3MKI A;  3Q2P A;  1PU4 A;  1I3F A;  1RGL A;  3OW2 2;  2PNC A;  2K54 A;  5LC7 A;  1G0T A;  2I9W A;  1C54 A;  5CLK A;  1E3V A;  4L8P A;  5TGN A;  1A67 A;  4X2H A;  4ILF A;  3K7C A;  4HJL B;  5M1A A;  1BGS A;  1JB5 A;  2D42 A;  1K28 A;  3GZB A;  5IF6 A;  2FNQ A;  3LTD A;  1YI2 3;  1N5H A;  5IEN A;  1BRS A;  3F14 A;  1OH0 A;  3IJE B;  1UCI A;  3DGN A;  4K61 A;  3SX1 A;  3O8Y A;  1JZO A;  3DZL A;  1BSE A;  2GBX B;  1LXE A;  2CFL A;  1T5Y A;  3PCS A;  1KSI A;  1BRJ A;  2HMO B;  1CYU A;  2WO0 A;  2W6J H;  2ZL8 A;  4O02 B;  4RNY A;  1EKM A;  1JRQ A;  5EQL A;  1YVB I;  3X3X A;  3OXA A;  1AVK A;  3CC2 3;  3LH4 A;  2BO9 B;  2IA7 A;  1MGW A;  1LNH A;  2A15 A;  3DMC A;  4EV5 A;  2WGO A;  1Y4K A;  6RNT A;  8CHO A;  3JUQ A;  4LYL B;  4BTY A;  1YVS A;  1YHQ 3;  1SIH A;  2UX0 A;  3NX0 A;  1V57 A;  1M90 4;  1KC8 4;  3VF1 A;  1AR0 A;  3T0U A;  2CKF B;  3OX9 A;  3DGO A;  2CW9 A;  6GSP A;  4EXR A;  8RNT A;  3GZX B;  1RN4 A;  5IER A;  1AQZ A;  2HMN B;  1OGX A;  4DKI A;  3HIG A;  1RNB A;  2Z7A A;  4BL2 A;  1BVI A;  2XGN A;  3OWU A;  1UGI A;  3D3L A;  1SAR A;  1OUN A;  3FG4 A;  3Q1C A;  4LSO A;  5G1K A;  3Q3F A;  7STD A;  3FF0 A;  3D9R A;  3FG1 A;  1TFO A;  2C4B A;  2SBL A;  2RBI A;  4LEH A;  3EBY A;  2IY2 A;  3RNT A;  3K9M C;  5AIF A;  1IQ8 A;  3V99 A;  5CF2 A;  2W9Q A;  1IVU A;  1VQ7 3;  1NU3 A;  2XFT A;  4HM1 B;  4RZM A;  1VQP 3;  4BL3 A;  1VQQ A;  3PZW A;  1DMQ A;  2H0G A;  1RN1 A;  2M7O A;  2OWP A;  5D82 A;  3E99 A;  2WOF A;  1VQK 3;  2YFJ B;  2CX0 A;  4XBT A;  3A76 A;  3OWS A;  1DVD A;  5IG5 A;  2MF7 A;  1OPY A;  4WFO A;  5BXQ A;  2Z76 A;  1STF I;  2BHM A;  4XBY A;  3CNX A;  1M1K 4;  3NBB A;  5AYR B;  4KFD A;  1A90 A;  3B4O A;  1EG9 B;  3FZW A;  3PYJ A;  4Q53 A;  3ROB A;  1N5P A;  2P0M A;  2RNT A;  3FCS B;  1TRP A;  1WMN A;  1JB2 A;  3N54 B;  3RGA A;  1QAF A;  3WDG B;  4L8O A;  1RGF A;  1W01 A;  1NO3 A;  1TFK A;  4R9L A;  3ZFZ A;  3GRD A;  4WWU C;  1Q40 A;  1STD A;  3K63 A;  1JN5 B;  3KE7 A;  2J8X B;  4LGQ A;  5CXO A;  1Q7Y 4;  4KFF A;  3QK9 A;  1BRI A;  3CCE 3;  1KD1 4;  1GD3 A;  3MG2 A;  1NWW A;  2AAE A;  1JZD A;  3PGB A;  5ELU A;  3OV4 A;  3CD6 3;  2BMR B;  3U97 A;  2K3D A;  1IQY A;  1MWU A;  2CIU A;  3CCM 3;  3WMD A;  1QVG 2;  1GY7 A;  1NNV A;  4FR9 A;  3SVA A;  1AVL A;  2V1L A;  1C7H A;  4N6U A;  3S67 A;  1RKY A;  3KKG A;  3K0Z A;  1RRL A;  5DRV A;  5KP1 A;  1IU7 A;  1CH0 A;  1LQM B;  1EEJ A;  1RMS A;  2XF3 A;  1W4N A;  2P38 A;  1RGK A;  1UI8 A;  3BU4 A;  1IT8 A;  3CCS 3;  2KAA A;  2OCT A;  3FKA A;  2STD A;  2INX A;  2CX1 A;  3JUP A;  3F7X A;  3BNC A;  4ZM8 A;  1CEW I;  1DMN A;  2GSP A;  3B7C A;  3LML A;  1VQ8 3;  1GY6 A;  1MWS A;  2R4I A;  1FGR A;  3D5G A;  2W56 B;  4LZI A;  3OWY A;  4JF8 A;  3SOA A;  2F5W A;  1RNT A;  3Q90 A;  2LQV A;  1K41 A;  3PCR A;  1QJG A;  2BIR A;  2BNG A;  2QGU A;  3NXJ A;  4K1V A;  1VQ9 3;  1MWT A;  1BAO A;  1BNS A;  1UGH I;  4N6O B;  1R4Y A;  1YJ9 3;  1ZX2 A;  4KZ1 A;  1S5A A;  1L5G B;  3GAX A;  3EE1 A;  1W2B 2;  1CQS A;  5BU4 A;  3EB8 A;  1ROV A;  4HOH A;  1GOY A;  3CPO A;  4J5G A;  4AEQ A;  3LZA A;  5ELJ A;  1Q82 4;  1PFP A;  2KF5 A;  4O8S A;  2E2T A;  1KQS 2;  1W5Z A;  2AAD A;  2FXT A;  1FGO A;  1ZO2 A;  2QIY A;  2UUG C;  1NB5 I;  1PY3 A;  1UCL A;  1UW1 A;  3KSP A;  3JUO A;  1O7H B;  3LOY A;  1FUT A;  1G02 A;  4HM7 B;  1MNL A;  2KCD A;  5EEO A;  4I5Q A;  2RCD A;  3I55 3;  1QMA A;  1B2Z A;  3SED A;  1VQO 3;  1RTU A;  2ZA4 A;  1FUS A;  1W6G A;  4HM5 B;  3WOF B;  3CC7 3;  3KZT A;  1VQL 3;  1FA3 A;  2W2C A;  1I8V A;  4WYK B;  1IVX A;  1IQX A;  1V74 A;  2B24 B;  3NV0 B;  4FMD A;  4HKV B;  3MHE A;  1FUW A;  1X1W A;  1LQG C;  4EC6 A;  1BSC A;  4FCM A;  3MSO A;  4K1U A;  5STD A;  3WOE B;  3AMO B;  1HKX A;  2XSH B;  4JRF A;  1A2P A;  2ZDJ A;  2ML6 A;  4AKZ A;  4LMI A;  2CHC A;  1A2V A;  2BU4 A;  3UL5 A;  4GL6 A;  1R4C A;  4IPB A;  3FG3 A;  1K73 4;  2F5M A;  1FGQ A;  2C11 A;  3MG3 A;  4EW5 A;  3DM8 A;  6STD A;  4O2H A;  2W03 A;  3BNE A;  1BRH A;  1OF5 B;  3EN1 B;  3M8C A;  5IEP A;  4NRE A;  2GBW B;  1JKG B;  1YIT 3;  1IT7 A;  2XH9 A;  2F4Y A;  4HM4 B;  1GMR A;  3KCH A;  1D6Z A;  4CDL A;  1I0X A;  1UCK A;  3V98 A;  3CCJ 3;  1W6Y A;  3ALA A;  3EBT A;  3AGO A;  4L7K A;  1YIJ 3;  4HAA A;  1B2X A;  4HZB B;  1E97 A;  3URP A;  1BUQ A;  3GWR A;  1SJW A;  2W9P A;  1X1Y A;  1X1X A;  4CPK A;  3NQZ A;  3EX9 A;  2HOH A;  1RCK A;  1WQL B;  3IMA B;  4J9A A;  2GU3 A;  3N9H A;  3ZG0 A;  1GOU A;  3CCV 3;  2CFK A;  3TDG A;  3S29 A;  1BIR A;  2C10 A;  2IMJ A;  9RNT A;  2IUJ A;  1LVN A;  3AHW A;  1E3R A;  4WP5 A;  1IK3 A;  5AIH A;  5AEU B;  2CC3 A;  2CFW A;  1Q81 4;  1G96 A;  4K90 B;  4BIR A;  1VQM 3;  3F9S A;  1O7M B;  4HVN A;  5HGR A;  3SOY A;  3H3H A;  1LOY A;  2JDI H;  1BNJ A;  1GSP A;  1WTH A;  5AII A;  3UJM A;  3VGN A;  2BT3 A;  3DY5 A;  1N8Q A;  2RGQ A;  2OQE A;  4MMX B;  4U13 A;  1SQW A;  1BOX A;  1GY5 A;  2P0X A;  3L0R A;  1BNF A;  1N9J A;  4GB5 A;  1OGZ A;  1T2H A;  1B20 A;  2XR8 B;  2H0I A;  2K0M A;  2KRT A;  4EYC A;  3B8L A;  3G8Z A;  2CWU A;  2R41 A;  1TTO A;  2WGQ A;  1TRQ A;  1TJD A;  4NHF A;  3X3Z A;  4HM3 B;  3T8N A;  1RCL A;  1YJW 3;  1O7W B;  3ER7 A;  4RNZ A;  3G71 3;  1B2S A;  3DXO A;  3IPT A;  2CWV A;  3D5I A;  3NQY A;  5FGO A;  3UB1 A;  1NDO B;  1B3S A;  3CXC 2;  1U5O A;  1SII A;  5JPU A;  2GEX A;  3K5T A;  1RGE A;  1I2E A;  4BTX A;  2BMQ B;  4IT7 A;  1N8R 4;  2GU1 A;  3S27 A;  2E2V A;  3CC4 3;  2CK3 H;  5M19 A;  1U8C B;  2IYJ A;  4FMA A;  1QVF 2;  2KF4 A;  3CCL 3;  1WMP A;  3RGR A;  2QEX 3;  2W04 A;  4N6V 0;  1O7G B;  4CJN A;  1MGR A;  2CG1 A;  1TIJ A;  5I97 A;  1VZZ A;  1FGT A;  1HZ1 A;  2ZHX B;  3NBR A;  1EQK A;  1O7N B;  3V92 A;  4XDV A;  3MWZ A;  3SYU A;  3LTB A;  3F8X A;  1BRG A;  3WR2 A;  1RJO A;  4N6L A;  2ML5 A;  4EBG A;  2Q07 A;  3FGY A;  4FMB A;  5JBS A;  1VQN 3;  1Z1S A;  5AI1 A;  3CU3 A;  1LNI A;  3I0Y A;  2CFG A;  2W0Q A;  4I4K A;  2RFR A;  3EC9 A;  4STD A;  2XSO B;  1LRA A;  1YGW A;  1W00 A;  4MEI A;  1JBS A;  4AKY A;  3LT8 A;  3ECF A;  2OTJ 3;  1V58 A;  3DGL A;  3G4S 3;  1IVV A;  3G6E 3;  1B2M A;  2KF6 A;  1YJN 3;  1BNE A;  3GSP A;  1IYY A;  4TX4 A;  3VSY A;  5IEO A;  1IVW A;  3WHO A;  1SPU A;  3CCQ 3;  2L4V A;  2XFS A;  3PXM A;  3ZG5 A;  5AYS C;  5LC6 A;  1I70 A;  5IG3 A;  2IUK A;  1BNI A;  3GZR A;  4R80 A;  1N9E A;  2P09 A;  4O3V A;  1M9G A;  4J5K A;  4BTW A;  1DET A;  4XB5 A;  4EV2 A;  1S72 3;  3JVC A;  3JUM A;  4H61 A;  4XM4 A;  3KN4 A;  3DGM A;  4G1M B;  3D4A A;  4OUQ A;  1IV7 A;  1VQ4 3;  2F99 A;  1K8A 4;  1BU4 A;  1HYF A;  4HZ9 B;  1A2K A;  1Q40 B;  1W7C A;  3CNM A;  1EUI C;  2WOH A;  2Y74 A;  2CWT A;  2Y73 A;  4N6T A;  1JN5 A;  1BNR A;  2KF3 A;  4N6M A;  3UL6 A;  4QWT A;  1BUJ A;  1DYU A;  2JQ5 A;  3BND A;  1AV4 A;  2XEP A;  1US1 A;  4HBR A;  5D83 A;  2CH9 A;  2HMM B;  2MC8 A;  1HU9 A;  3NBJ A;  3B4P A;  4FMC A;  1UCJ A;  1T3B A;  2CG0 A;  2UGI A;  3UNL A;  5A0O B;  4OVM A;  3J7Y d;  1LOV A;  2RSX A;  2B1X B;  1FW7 A;  3F8H A;  3LYG A;  5BIR A;  4XBX A;  1TU5 A;  1RGA A;  4N3V A;  1T2I A;  1BSD A;  3STD A;  2FGT A;  4J8T A;  3X42 A;  4PEJ A;  1GMP A;  1B21 A;  5KP4 A;  4KT3 B;  1BAN A;  1F8N A;  1WMO A;  2GEY A;  1RRH A;  1TP6 A;  1RHL A;  3NUV A;  1BRK A;  4OK0 A;  1GYB A;  4N6N B;  1UDI I;  2OOV C;  1ULI B;  1ASK A;  1FYS A;  2O9U X;  3FF2 A;  2F86 B;  1EA2 A;  4HM8 B;  3CCU 3;  5G1L A;  2CFD A;  4HM2 B;  1RGH A;  3T8U A;  5KP3 A;  3FH1 A;  4MMY B;  1BSB A;  1OCV A;  1JJ2 2;  2W56 A;  1I0V A;  4X2O A;  2YX9 A;  3A5E A;  3NM7 A;  5AIG A;  1BNG A;  3PS8 A;  3BLZ A;  2SAR A;  4NPB A;  1JBT A;  1OAC A;  4R4K A;  1KWI A;  1Q42 A;  3MYT A;  3KFQ C;  5DRE A;  5EVH A;  1JB4 A;  3I56 3;  1IDP A;  1RDS A;  3G16 A;  3LXU X;  7RNT A;  3DGY A;  4R9K A;  2F56 A;  2KXG A;  1X1U A;  3X41 A;  3BB9 A;  1NB3 I;  1B27 A;  4XDW A;  3BNB A;  1FGM A;  1ZGX A;  1WNH A;  3HI7 A;  1QAL A;  1ULJ B;  5GSP A;  3WA2 X;  4CCV A;  2H0H A;  1RGC A;  3EF8 A;  3S28 A;  3SLU A;  1CYV A;  1DMM A;  3LTA A;  7GSP A;  3WA3 A;  1QAK A;  4HYZ A;  1GOV A;  1Q9E A;  2PZV A;  4HM6 B;  1DVC A;  3LTC A;  3DH2 A;  3NHX A;  2YFI B;  1GD4 A;  4ORL A;  3HII A;  5AEW B;  3RDE A;  2BMO B;  3BIR A;  3FSD A;  3CMA 3;  4GHO A;  2OTL 3;  2E2U A;  1VQ5 3;  4KVH A;  1RN7 A;  2HML B;  1W2Z A;  1W6C A;  2HMJ B;  2Z6B A;  3S5C A;  4WYK A;  2P05 A;  4RBN A;  5IW9 A;  3D79 A;  2HMK B;  3SXX A;  3KSE D;  1NJI 4;  1ISK A;  3CCR 3;  1D6U A;  3NV0 A;  2GXF A;  1YNV X;  3EHC A;  1UI7 A;  3EN8 A;  4FCJ A;  4GSP A;  4FCZ A;  1LOW A;  1TUH A; 
#chains in the Genus database with same CATH homology
 3F40 A;  3AMO A;  4HM0 B;  1LOX A;  3MG1 A;  1UUV B;  1UUW B;  4WHA A;  3U1W A;  2D1W A;  5CK6 A;  4KFE A;  3HX8 A;  3HZP A;  3JUN A;  3FLJ A;  2F98 A;  1D6Y A;  5G2G A;  1OHS A;  3KII A;  4MJD A;  1OF5 A;  5FW5 A;  5IG0 A;  3F7S A;  4R1K A;  3H51 A;  1JV2 B;  2XGL A;  5JPP A;  1J2B A;  1JKG A;  3X3Y A;  1IV9 A;  2XRX B;  1OHO A;  2QA4 3;  2Z77 A;  1GS3 A;  3CME 3;  3CPW 2;  3QRD A;  5D81 A;  2O3O A;  4MMZ B;  5BVB A;  1ROA A;  1JNQ A;  3LT9 A;  3X40 A;  3N8B A;  1O7P B;  3GZY B;  5IG4 A;  1W02 A;  1M1X B;  4IIA A;  2OQE C;  1VQ6 3;  3DUK A;  3HK4 A;  3MPH A;  1YGE A;  3EJV A;  2OOV A;  5CF1 A;  3NM2 A;  2LYX A;  3EQQ B;  2YFL B;  3WOD G;  3G0K A;  1K9M 4;  1Q86 4;  1MOL A;  4H3U A;  1OHP A;  3MKI A;  3Q2P A;  1PU4 A;  3OW2 2;  2PNC A;  2K54 A;  5LC7 A;  2I9W A;  5CLK A;  1E3V A;  4L8P A;  5TGN A;  1A67 A;  4X2H A;  3K7C A;  4HJL B;  1JB5 A;  2D42 A;  1K28 A;  3GZB A;  5IF6 A;  2FNQ A;  3LTD A;  1YI2 3;  1N5H A;  5IEN A;  3F14 A;  1OH0 A;  3IJE B;  4K61 A;  3DGN A;  3SX1 A;  3O8Y A;  3DZL A;  2GBX B;  1LXE A;  2CFL A;  1T5Y A;  3PCS A;  1KSI A;  2HMO B;  1CYU A;  2WO0 A;  2ZL8 A;  2W6J H;  4O02 B;  4RNY A;  1EKM A;  1JRQ A;  5EQL A;  1YVB I;  3X3X A;  3OXA A;  1AVK A;  3CC2 3;  3LH4 A;  2BO9 B;  2IA7 A;  1LNH A;  2A15 A;  3DMC A;  4EV5 A;  2WGO A;  1Y4K A;  8CHO A;  3JUQ A;  4BTY A;  1YHQ 3;  1SIH A;  2UX0 A;  3NX0 A;  1M90 4;  1KC8 4;  3VF1 A;  1AR0 A;  3T0U A;  2CKF B;  3OX9 A;  3DGO A;  2CW9 A;  4EXR A;  3GZX B;  5IER A;  2HMN B;  1OGX A;  3HIG A;  2Z7A A;  2XGN A;  3Q1C A;  3OWU A;  3D3L A;  3FG4 A;  1OUN A;  4LSO A;  3FF0 A;  3D9R A;  3FG1 A;  1TFO A;  2SBL A;  4LEH A;  3EBY A;  3K9M C;  5AIF A;  1IQ8 A;  3V99 A;  5CF2 A;  2W9Q A;  1IVU A;  1VQ7 3;  1NU3 A;  2XFT A;  4HM1 B;  4RZM A;  1VQP 3;  3PZW A;  1DMQ A;  2OWP A;  2M7O A;  5D82 A;  3E99 A;  2WOF A;  1VQK 3;  2YFJ B;  4XBT A;  3A76 A;  3OWS A;  1DVD A;  5IG5 A;  2MF7 A;  1OPY A;  4WFO A;  5BXQ A;  2Z76 A;  1STF I;  2BHM A;  4XBY A;  3CNX A;  1M1K 4;  3NBB A;  5AYR B;  4KFD A;  1A90 A;  3B4O A;  1EG9 B;  3FZW A;  3PYJ A;  4Q53 A;  3ROB A;  1N5P A;  2P0M A;  3FCS B;  1WMN A;  1JB2 A;  3N54 B;  3RGA A;  1QAF A;  3WDG B;  4L8O A;  1W01 A;  1NO3 A;  1TFK A;  4R9L A;  3GRD A;  4WWU C;  1Q40 A;  1STD A;  3K63 A;  1JN5 B;  3KE7 A;  4LGQ A;  5CXO A;  1Q7Y 4;  4KFF A;  3QK9 A;  3CCE 3;  1KD1 4;  1GD3 A;  3MG2 A;  1NWW A;  3PGB A;  5ELU A;  3OV4 A;  3CD6 3;  2BMR B;  3U97 A;  1IQY A;  2CIU A;  3CCM 3;  3WMD A;  1QVG 2;  1GY7 A;  3SVA A;  4FR9 A;  1AVL A;  2V1L A;  1C7H A;  4N6U A;  3S67 A;  1RKY A;  3KKG A;  3K0Z A;  1RRL A;  5DRV A;  5KP1 A;  1IU7 A;  2XF3 A;  1W4N A;  2P38 A;  1UI8 A;  1IT8 A;  3CCS 3;  2OCT A;  3FKA A;  2STD A;  2INX A;  3JUP A;  3F7X A;  3BNC A;  4ZM8 A;  1CEW I;  1DMN A;  3B7C A;  3LML A;  1VQ8 3;  1GY6 A;  2R4I A;  1FGR A;  2W56 B;  4LZI A;  3OWY A;  4JF8 A;  3SOA A;  3Q90 A;  2LQV A;  1K41 A;  3PCR A;  1QJG A;  2QGU A;  2BNG A;  3NXJ A;  4K1V A;  1VQ9 3;  4N6O B;  1YJ9 3;  1ZX2 A;  4KZ1 A;  1S5A A;  1L5G B;  3GAX A;  3EE1 A;  1W2B 2;  1CQS A;  3EB8 A;  1ROV A;  3CPO A;  4AEQ A;  3LZA A;  5ELJ A;  1Q82 4;  1PFP A;  4O8S A;  2E2T A;  1KQS 2;  1W5Z A;  2FXT A;  1FGO A;  1ZO2 A;  2QIY A;  1NB5 I;  3KSP A;  1UW1 A;  3JUO A;  1O7H B;  3LOY A;  4HM7 B;  1MNL A;  2KCD A;  5EEO A;  2RCD A;  3I55 3;  1QMA A;  3SED A;  1VQO 3;  1W6G A;  3CC7 3;  4HM5 B;  3WOF B;  1VQL 3;  3KZT A;  1FA3 A;  2W2C A;  4WYK B;  1IVX A;  1IQX A;  1V74 A;  2B24 B;  3NV0 B;  4FMD A;  4HKV B;  3MHE A;  1FUW A;  4EC6 A;  4FCM A;  3MSO A;  4K1U A;  5STD A;  3WOE B;  3AMO B;  1HKX A;  2XSH B;  4JRF A;  2ZDJ A;  2ML6 A;  4AKZ A;  4LMI A;  2CHC A;  1A2V A;  3UL5 A;  4GL6 A;  1R4C A;  4IPB A;  3FG3 A;  1K73 4;  1FGQ A;  2C11 A;  3MG3 A;  6STD A;  3DM8 A;  4O2H A;  2W03 A;  3BNE A;  3EN1 B;  1OF5 B;  3M8C A;  5IEP A;  4NRE A;  2GBW B;  1JKG B;  1YIT 3;  1IT7 A;  2XH9 A;  4HM4 B;  1D6Z A;  4CDL A;  3V98 A;  3CCJ 3;  1YIJ 3;  1W6Y A;  3ALA A;  3EBT A;  4L7K A;  4HZB B;  1E97 A;  1BUQ A;  3GWR A;  1SJW A;  2W9P A;  3NQZ A;  3EX9 A;  4J9A A;  1WQL B;  3IMA B;  2GU3 A;  3N9H A;  3CCV 3;  2CFK A;  3TDG A;  3S29 A;  2C10 A;  2IMJ A;  1IK3 A;  2IUJ A;  1LVN A;  4WP5 A;  1E3R A;  5AIH A;  5AEU B;  2CC3 A;  2CFW A;  1Q81 4;  1G96 A;  4K90 B;  1VQM 3;  3F9S A;  1O7M B;  4HVN A;  5HGR A;  3SOY A;  3H3H A;  2JDI H;  5AII A;  1WTH A;  3UJM A;  3VGN A;  2BT3 A;  3DY5 A;  1N8Q A;  2RGQ A;  2OQE A;  4MMX B;  4U13 A;  1SQW A;  1GY5 A;  2P0X A;  3L0R A;  1N9J A;  4GB5 A;  1OGZ A;  2XR8 B;  4EYC A;  2K0M A;  2KRT A;  3B8L A;  3G8Z A;  2CWU A;  3X3Z A;  2WGQ A;  4NHF A;  1YJW 3;  4HM3 B;  3T8N A;  1O7W B;  3ER7 A;  4RNZ A;  3G71 3;  3DXO A;  3IPT A;  5FGO A;  2CWV A;  3NQY A;  3UB1 A;  1NDO B;  3CXC 2;  1U5O A;  1SII A;  5JPU A;  2GEX A;  3K5T A;  4BTX A;  2BMQ B;  4IT7 A;  1N8R 4;  2GU1 A;  3S27 A;  2E2V A;  3CC4 3;  2CK3 H;  1U8C B;  4FMA A;  1QVF 2;  3CCL 3;  1WMP A;  3RGR A;  2QEX 3;  2W04 A;  4N6V 0;  1O7G B;  2CG1 A;  1TIJ A;  5I97 A;  1VZZ A;  1FGT A;  3NBR A;  1EQK A;  1O7N B;  3V92 A;  4XDV A;  3MWZ A;  3LTB A;  3F8X A;  1RJO A;  4N6L A;  2ML5 A;  4EBG A;  2Q07 A;  3FGY A;  4FMB A;  5JBS A;  1VQN 3;  1Z1S A;  5AI1 A;  3CU3 A;  3I0Y A;  2CFG A;  2W0Q A;  4I4K A;  2RFR A;  3EC9 A;  4STD A;  2XSO B;  1W00 A;  4MEI A;  4AKY A;  3LT8 A;  3ECF A;  2OTJ 3;  3DGL A;  3G4S 3;  1IVV A;  3G6E 3;  1YJN 3;  4TX4 A;  3VSY A;  5IEO A;  1IVW A;  1SPU A;  3CCQ 3;  2L4V A;  2XFS A;  3PXM A;  5AYS C;  5LC6 A;  5IG3 A;  2IUK A;  3GZR A;  4R80 A;  1N9E A;  2P09 A;  4O3V A;  1M9G A;  4BTW A;  4XB5 A;  4EV2 A;  1S72 3;  3JVC A;  3JUM A;  4H61 A;  4XM4 A;  3KN4 A;  3DGM A;  4G1M B;  4OUQ A;  1IV7 A;  1VQ4 3;  2F99 A;  1K8A 4;  4HZ9 B;  1A2K A;  1Q40 B;  1W7C A;  3CNM A;  2Y74 A;  2WOH A;  2Y73 A;  2CWT A;  4N6T A;  1JN5 A;  4N6M A;  3UL6 A;  4QWT A;  1DYU A;  2JQ5 A;  3BND A;  1AV4 A;  2XEP A;  1US1 A;  4HBR A;  5D83 A;  2CH9 A;  2HMM B;  2MC8 A;  1HU9 A;  3NBJ A;  3B4P A;  4FMC A;  2CG0 A;  3UNL A;  5A0O B;  4OVM A;  3J7Y d;  2RSX A;  2B1X B;  3F8H A;  3LYG A;  4XBX A;  1TU5 A;  4N3V A;  3STD A;  2FGT A;  4J8T A;  3X42 A;  4PEJ A;  5KP4 A;  1F8N A;  1WMO A;  2GEY A;  1RRH A;  1TP6 A;  3NUV A;  4OK0 A;  1GYB A;  4N6N B;  2OOV C;  1ULI B;  1ASK A;  2O9U X;  3FF2 A;  2F86 B;  1EA2 A;  4HM8 B;  3CCU 3;  2CFD A;  4HM2 B;  3T8U A;  5KP3 A;  3FH1 A;  4MMY B;  1OCV A;  1JJ2 2;  2W56 A;  4X2O A;  2YX9 A;  3NM7 A;  5AIG A;  3PS8 A;  3BLZ A;  1OAC A;  4R4K A;  1KWI A;  1Q42 A;  3MYT A;  3KFQ C;  5DRE A;  5EVH A;  1JB4 A;  3I56 3;  1IDP A;  3G16 A;  3LXU X;  4R9K A;  2KXG A;  3X41 A;  3BB9 A;  1NB3 I;  4XDW A;  3BNB A;  1FGM A;  3WA2 X;  1WNH A;  3HI7 A;  1QAL A;  1ULJ B;  4CCV A;  7STD A;  3S28 A;  3EF8 A;  3SLU A;  1CYV A;  1DMM A;  3LTA A;  3WA3 A;  1QAK A;  4HYZ A;  2PZV A;  4HM6 B;  1DVC A;  3LTC A;  3NHX A;  2YFI B;  1GD4 A;  4ORL A;  3HII A;  5AEW B;  3RDE A;  2BMO B;  3FSD A;  3CMA 3;  2OTL 3;  2E2U A;  1VQ5 3;  4KVH A;  1RN7 A;  2HML B;  1W2Z A;  1W6C A;  2HMJ B;  2Z6B A;  3S5C A;  4WYK A;  2P05 A;  4RBN A;  5IW9 A;  2HMK B;  3SXX A;  3KSE D;  1NJI 4;  1ISK A;  3CCR 3;  1D6U A;  3NV0 A;  2GXF A;  3EN8 A;  1UI7 A;  4FCJ A;  4FCZ A;  3EHC A;  1TUH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...