1A67A

Chicken egg white cystatin wildtype, nmr, 16 structures
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
108
structure length
108
Chain Sequence
b'GAPVPVDENDEGLQRALQFAMAEYNRASNDKYSSRVVRVISAKRQLVSGIKYILQVEIGRTTCPKSSGDLQSCEFHDEPEMAKYTTCTFVVYSIPWLNQIKLLESKCQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYSTATIN
publication title The structures of native phosphorylated chicken cystatin and of a recombinant unphosphorylated variant in solution.
pubmed doi rcsb
molecule tags Proteinase inhibitor
total genus 13
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 1998-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1a67A00
1PFPA 3GAXA 4ZM8A 2W9PA 4N6OB 3LH4A 1TIJA 3Q2PA 3NX0A 1LXEA 5EQLA 3PXMA 1IV7A 1WNHA 5LC6A 4EYCA 3PS8A 1N9JA 1R4CA 4LZIA 5ELUA 4N6NB 1N5HA 3KSED 1A67A 1DVDA 4TX4A 1YVBI 5ELJA 2O9UX 4N6MA 1MNLA 1M9GA 2BO9B 3UL5A 3MWZA 1A90A 1DVCA 1IV9A 1RN7A 3S67A 3PYJA 5LC7A 3SVAA 4IT7A 3K9MC 1CYUA 1FA3A 3QRDA 1NB5I 1FUWA 4CCVA 4N6LA 4N6UA 1GD4A 1N5PA 3IMAB 1CEWI 5A0OB 1MOLA 1STFI 1CYVA 1GD3A 2W9QA 2CH9A 1EQKA 2KXGA 3L0RA 4N6V0 2OCTA 3UL6A 1G96A 1NB3I 1KWIA 1ROAA 3KFQC 4N6TA
chains in the Genus database with same CATH superfamily
2CHCA 2GBWB 7GSPA 1SPUA 3LMLA 3FLJA 4HJLB 1JB4A 1BSEA 3VGNA 2GBXB 3GZBA 3CCV3 1I70A 1RCKA 3MHEA 3MG1A 3JUQA 2UX0A 3CCU3 3MPHA 3PGBA 3NUVA 3LH4A 1BSBA 1EUIC 4H61A 1NWWA 1W6CA 3Q2PA 5I97A 1LXEA 3B7CA 4HM8B 1BNFA 4BU4A 4JRFA 3BNBA 3V98A 3STDA 1RGHA 5LC6A 2Z6BA 2A15A 3AGNA 3B4PA 5BIRA 1PU4A 1DMNA 3WOFB 3F8HA 2IYJA 1R4CA 3NV0A 3CC23 1BSDA 1OGXA 1ASKA 3OWYA 1RNBA 1BVIA 3DMCA 4WFOA 1VQ43 1RGCA 1T2HA 4BIRA 3CXC2 4EBGA 3Q1CA 5FGOA 3EF8A 1BANA 1LQMB 4ILFA 1EA2A 2MF7A 2H0HA 1BGSA 4FR9A 3CCQ3 1YNVX 4U13A 2BMOB 3LTAA 1J2BA 2YFIB 1JBTA 4PEJA 2F5WA 1W00A 2F4YA 1IYYA 3FF0A 2BO9B 3K63A 5FW5A 3UL5A 2HOHA 4EW5A 3CC73 3GSPA 3FG3A 1BNJA 4HM6B 3U1WA 1GMQA 3BB9A 3PCRA 5KP3A 1UGIA 1V58A 4XBXA 3ROBA 3VSYA 2WOFA 3ZG0A 2XRXB 3Q90A 2CWTA 4R1KA 2QEX3 1A90A 3PYJA 4BTXA 1N8QA 1UW1A 5LC7A 3MYTA 3OWUA 3J7Yd 1YIJ3 1QALA 1TRQA 2RNTA 3K9MC 2XFSA 1Q7HA 3RDEA 3N54B 3WHOA 1RGAA 1MWTA 1UCKA 1QVG2 1I0VA 5JPPA 7STDA 3OXAA 2BT3A 3N8BA 4OVMA 3RNTA 1IQ8A 1AV4A 1QMAA 2WGOA 2XSOB 1UUGB 4Q53A 3SLUA 1O7PB 4N6LA 4LSOA 3DY5A 3NHXA 4WWUC 1B2ZA 3G0KA 4O2HA 1JB2A 3LOYA 4WYKA 3NBJA 4QWTA 3IMAB 1RGFA 1AQZA 2H0IA 3MSOA 1TU5A 3CU3A 1WQLB 1E3RA 1X1UA 3S28A 1JKGB 4RNTA 2CKFB 3D4AA 5BVBA 1B27A 3DUKA 4HZBB 4LMIA 2F86B 1OUNA 1WMNA 1GD3A 2CFLA 2W9QA 3TDGA 3CPW2 2KF6A 4HOHA 1W7CA 2P09A 3GRDA 3K0ZA 2F99A 1IQXA 1RHLA 2KXGA 2CG1A 4RNZA 3L0RA 2OQEC 5IG3A 5IG5A 4N6V0 1TFOA 2KRTA 3AMOB 3LT9A 4AKYA 4HVNA 2OCTA 3LYGA 1JZOA 3GWRA 2GU3A 2GEYA 2HMLB 3QK9A 4FMCA 2YX9A 3MKIA 1MWUA 4KT3B 1L5GB 3OWSA 5AYRB 1EEJA 1Y4KA 2WOHA 1OF5A 1KWIA 3EBTA 5BU4A 2P05A 1OCVA 1Q814 3KFQC 4R80A 1V74A 3F8XA 1B20A 5AIFA 5G1KA 3GAXA 1LOWA 1VQ53 1LNHA 1U8CB 1WMPA 4K1VA 3N9HA 1K41A 4O02B 1UCLA 5IEOA 1ZGXA 3HIGA 1M1K4 3NQYA 1LQGC 2CFWA 1ISKA 3EX9A 2LYXA 3DGOA 1HZ1A 5AEWB 1Q40B 1IVWA 1I3IA 2R4IA 1SIIA 2FXTA 2ZDJA 1O7WB 1Q9EA 1E3VA 1GOVA 4GHOA 3UNLA 1Q42A 4WP5A 1NNVA 2E2VA 3HK4A 2YFJB 4G1MB 4GSPA 3EBYA 4LYLB 4XM4A 3NX0A 1MGRA 3UB1A 5EQLA 2K3DA 2BIRA 4HM0B 1JBRA 1IV7A 2KAAA 3DH2A 3LZAA 2CIUA 8RNTA 2KF5A 1E97A 3O8YA 1W6GA 3X40A 1W5ZA 4KFFA 1A2KA 1LRAA 3FH1A 4AEQA 2W03A 5M1AA 3V99A 1RN4A 1GY6A 5G2GA 1F8NA 4HM2B 4HKVB 1GY5A 5CK6A 3H51A 1IVXA 1NO3A 1N9EA 3LTDA 1D6ZA 4O8SA 1A67A 1SJWA 2D1WA 4RBNA 1Q7Y4 1WMOA 4TX4A 2XF3A 2AADA 4EV5A 1YVBI 3NM7A 1IDPA 5ELJA 2B1XB 2W2CA 3BLZA 3JVCA 2K0MA 1VQP3 4KVHA 3E99A 3FG1A 2AAEA 3H3HA 3KSPA 3WODG 1BRSA 2GXFA 3I563 1TFKA 3OX9A 1LOXA 1FGOA 1I8VA 2Z76A 4WHAA 1M9GA 3F9SA 3DXOA 3LTCA 5RNTA 1YJ93 2W6JH 3HOHA 1K9M4 4J8TA 2QA43 3GZXB 1BIRA 2I9WA 1BRIA 5CXOA 3LT8A 2L4VA 3S67A 2CFGA 4HM4B 4L8OA 1RDSA 3FF2A 2IY2A 1OHSA 4ORLA 2W04A 3X3ZA 2CG0A 4I4KA 1ZX2A 2F98A 1A2PA 1YVSA 2HMOB 1JN5A 3CMA3 1HYFA 3DZLA 1NB5I 1B21A 1KQS2 3CNMA 4CCVA 1UCJA 1K734 1HU9A 3HI7A 2IUJA 1Q824 1AVKA 4NHFA 3MG2A 1RRLA 1GD4A 4WYKB 2K54A 1MWRA 2PNCA 1DMMA 8CHOA 2O3OA 2OTL3 3ALAA 3FCSB 4KFEA 3NQZA 1Q864 1MOLA 5CF1A 1BUJA 1BNEA 1CYVA 2P0XA 1RMSA 2RSXA 3X42A 3PZWA 3F14A 4FCZA 2OOVC 3EQQB 3NBRA 4LGQA 3WOEB 1IVUA 6RNTA 1VQ73 1ULJB 3CC43 1EKMA 5KP1A 3X41A 1FYSA 2C10A 5IG0A 4AKZA 4CDLA 1I3FA 2HMKB 3ZG5A 1R4YA 1C7HA 3UL6A 1VQQA 3T8NA 1Z1SA 2IMJA 3CME3 1G96A 1GYBA 2Z7AA 3G4S3 1QVF2 1D6YA 1G02A 2XGLA 3ER7A 3KN4A 3F7SA 1WTHA 1OF5B 2WO0A 4IIAA 1RGKA 3AHSA 1BRHA 4KFDA 4CPKA 4K90B 4N6TA 5D82A 1TUHA 4L8PA 3DGYA 3D9RA 1KC84 1BNRA 1X1WA 2F56A 2BU4A 3D79A 2ML6A 1B3SA 1GS3A 1M1XB 3BU4A 1YJW3 2P0MA 3CCS3 2RGQA 3HZPA 3CPOA 3SXXA 1JBSA 1IQYA 3IPTA 5M18A 4MEIA 1BRKA 1OHOA 4HM1B 4N6OB 1B2MA 1BRGA 3I553 1K8A4 3KIIA 3PXMA 1RSNA 2FNQA 1IU7A 1AY7A 2GU1A 2V1LA 5AIIA 1GMPA 2C4BA 1W01A 2LQVA 5GSPA 2GEXA 1YJN3 4K1UA 4EYCA 4XB5A 4XDWA 5STDA 3FZWA 4R9LA 1O7GB 2CX0A 3V92A 5IERA 1N9JA 1V57A 3D3LA 4HYZA 4MMXB 5AYSC 1CH0A 3B4OA 1BRJA 1W2B2 1ZS7A 1SARA 1BSAA 2W56A 1GMRA 1B2UA 3KSED 3G16A 2HMMB 3URPA 1VQO3 1DVDA 1TTOA 4BTYA 2INXA 2Z77A 5IG4A 2KF4A 1STDA 1I0XA 3BNDA 3FG4A 1QJGA 2CFKA 5D81A 1FGMA 1QAFA 2CFDA 5CF2A 2XSHB 2O9UX 1RTUA 4I5QA 1GOYA 4N6MA 1A2VA 3WA2X 1VQ63 2KF3A 1RJOA 4XBYA 1GY7A 1QAKA 4KZ1A 3BNEA 4FMAA 1YHQ3 2STDA 2BMQB 2XEPA 1FGRA 1DVCA 5JPUA 4MMZB 3S27A 2L1SA 3NV0B 1DYUA 3SVAA 3KCHA 2ZA4A 1T3BA 1KD14 1O7MB 3SX1A 4XDVA 4BL2A 2GSPA 3G8ZA 4RZMA 2BMRB 3OV4A 3G6E3 2CC3A 4R9KA 1CYUA 2F5MA 1FA3A 1K28A 1YGWA 3EJVA 3QRDA 1JN5B 4J5KA 3X3YA 4OK0A 1RKYA 3WA3A 5IW9A 4N3VA 1PYLA 1OPYA 2HMJB 1FUWA 1UGHI 1FZUA 1RNTA 3CCJ3 1M904 3Q3FA 1BSCA 2OWPA 1OACA 5IEPA 3U97A 4N6UA 1S723 4EV2A 2PZVA 1VQL3 1LOVA 1N5PA 2RBIA 1RCLA 1CEWI 1U5OA 1ULIB 1BU4A 1DETA 3JUPA 4RNYA 4STDA 1RGGA 3LTBA 1BNSA 4HZ9B 3G713 1IT8A 1PY3A 3I0YA 4JF8A 1TRPA 2SARA 1YGEA 2E2UA 1VQ83 3HX8A 1T2IA 2Y74A 3JUMA 4XBTA 6GSPA 1Q40A 2QIYA 3KZTA 1RLSA 6STDA 3S29A 2CH9A 1EQKA 1X1YA 1FUSA 1LOYA 4O3VA 1W6YA 5KP4A 3EE1A 2FGTA 1DMQA 1I2FA 3CCM3 1BRNL 1CQSA 1UI7A 1LNIA 1UUWB 2RCDA 1JNQA 1JV2B 4R4KA 4HM3B 3A76A 1JB5A 3NBBA 3JUOA 4HM5B 5HGRA 2J8XB 3CCR3 2MC8A 3D5IA 1N8R4 1IT7A 3GZRA 1UI8A 2QGUA 4MMYB 5IF6A 1FGTA 2M7OA 1VZZA 1PFPA 2Y73A 5HOHA 2ZHXB 5AIGA 3WDGB 1IVVA 1TJDA 1O7NB 3T0UA 1W4NA 2XR8B 1GSPA 3CCE3 2B24B 4X2HA 4K61A 3A5EA 4BL3A 1RGEA 4ZM8A 2W9PA 1BNIA 1NJI4 4EC6A 3MG3A 4HM7B 2ML5A 4FCMA 5DREA 1UCIA 1MWSA 1TIJA 1G0TA 1NU3A 1X1XA 5CLKA 4CJNA 2H0GA 3T8UA 1W02A 1JRQA 1HKXA 3M8CA 1I2EA 5TGNA 1WNHA 3DGNA 3LXUX 1FUTA 2UUGC 2SBLA 1ROVA 1ZO2A 4MJDA 5G1LA 7RNTA 1VQM3 3CCL3 1FW7A 3PS8A 1BAOA 3RGAA 4LZIA 2IUKA 1D6UA 5ELUA 1YI23 1LVNA 2C11A 4N6NB 1N5HA 1B2XA 2W56B 3EN1B 3F7XA 3KKGA 5JBSA 3WR2A 3X3XA 2BNGA 2KCDA 1BUQA 1IK3A 1TP6A 3ECFA 2HMNB 5AIHA 3RGRA 4FCJA 3K5TA 1UUVB 3DGMA 1C54A 3CD63 5BXQA 2XFTA 5M19A 1KSIA 2W0QA 3BIRA 1MNLA 3FGYA 4FMBA 4GL6A 4NREA 5AI1A 3SEDA 3NXJA 3PCSA 3UJMA 1EG9B 1B2SA 1MGWA 3EHCA 3MWZA 1S5AA 3F40A 1US1A 1IV9A 1RN7A 3SYUA 4FMDA 1VQ93 3FKAA 3KE7A 3GZYB 3EC9A 1OH0A 3NM2A 1DE3A 4IT7A 2CK3H 3JUNA 4BTWA 4DKIA 3WMDA 1AR0A 2BHMA 2CWVA 2P38A 2WGQA 2JDIH 2CW9A 1BOXA 1AVLA 1O7HB 2JQ5A 2OOVA 2IA7A 1RRHA 3S5CA 2CX1A 3VF1A 3BNCA 1BNGA 4H3UA 1RN1A 1SQWA 5AEUB 2Q07A 3FSDA 3AGOA 3K7CA 5EVHA 2RFRA 1FGQA 4J5GA 2OTJ3 4J9AA 4HBRA 1JKGA 5IENA 1OGZA 2CWUA 3HIIA 5A0OB 4X2OA 2UGIA 2YFLB 4OUQA 3SOYA 1STFI 2D42A 5DRVA 4IPBA 4L7KA 1JZDA 2E2TA 1SIHA 1VQN3 3AHWA 1RGLA 3D5GA 1YIT3 2XH9A 3CNXA 3B8LA 5EEOA 1NDOB 3EB8A 1UDII 3DGLA 3AMOA 4GB5A 3DM8A 4NPBA 1W2ZA 2R41A 3OW22 3SOAA 2OQEA 4EXRA 1NB3I 2ZL8A 1OHPA 1I2GA 5D83A 3EN8A 3ZFZA 4HAAA 9RNTA 1ROAA 2XGNA 1JJ22 1GOUA 1T5YA 4LEHA 3IJEB 1VQK3
chains in the Genus database with same CATH topology
2CHCA 2GBWB 1SPUA 3LMLA 3FLJA 4HJLB 1JB4A 3VGNA 2GBXB 3GZBA 3CCV3 3MHEA 3MG1A 3JUQA 2UX0A 3CCU3 3MPHA 3PGBA 3NUVA 3LH4A 4H61A 1NWWA 1W6CA 3Q2PA 5I97A 1LXEA 3B7CA 4HM8B 4JRFA 3BNBA 3V98A 3STDA 5LC6A 2Z6BA 2A15A 3B4PA 1PU4A 1YJN3 1DMNA 3WOFB 3F8HA 3NV0A 1R4CA 3CC23 1OGXA 1ASKA 3OWYA 3DMCA 4WFOA 1VQ43 3CXC2 4EBGA 3Q1CA 5FGOA 3EF8A 1EA2A 2MF7A 4FR9A 3CCQ3 4U13A 2BMOB 3LTAA 1J2BA 2YFIB 4PEJA 1W00A 3FF0A 2BO9B 3K63A 5FW5A 3UL5A 3CC73 3FG3A 4HM6B 3U1WA 3BB9A 3PCRA 5KP3A 3ROBA 3VSYA 4XBXA 1A90A 2WOFA 2QEX3 2XRXB 3Q90A 2CWTA 4R1KA 3PYJA 4BTXA 1N8QA 1UW1A 5LC7A 3MYTA 3OWUA 3J7Yd 1YIJ3 1QALA 3K9MC 2XFSA 3RDEA 3N54B 1QVG2 5JPPA 7STDA 3OXAA 2BT3A 3N8BA 4OVMA 1IQ8A 1AV4A 1QMAA 2WGOA 2XSOB 4Q53A 3SLUA 1O7PB 4N6LA 4LSOA 3DY5A 3NHXA 4WWUC 4O2HA 3G0KA 1JB2A 3LOYA 4WYKA 3NBJA 4QWTA 3IMAB 3MSOA 1TU5A 3CU3A 1WQLB 1E3RA 3S28A 1JKGB 2CKFB 5BVBA 3DUKA 4HZBB 4LMIA 2F86B 1OUNA 1WMNA 1GD3A 2CFLA 2W9QA 3TDGA 3CPW2 1W7CA 2P09A 3GRDA 3K0ZA 2F99A 1IQXA 2KXGA 2CG1A 4RNZA 3L0RA 2OQEC 5IG3A 5IG5A 4N6V0 1TFOA 2KRTA 3AMOB 3LT9A 4AKYA 4HVNA 2OCTA 3LYGA 3GWRA 2GU3A 2GEYA 2HMLB 3QK9A 4FMCA 2YX9A 3MKIA 1L5GB 3OWSA 5AYRB 1Y4KA 2WOHA 1OF5A 1KWIA 3EBTA 2P05A 1OCVA 1Q814 3KFQC 4R80A 1V74A 3F8XA 5AIFA 3GAXA 1VQ53 1LNHA 1U8CB 1WMPA 4K1VA 3N9HA 1K41A 4O02B 5IEOA 3HIGA 1M1K4 3NQYA 2CFWA 1ISKA 3EX9A 2LYXA 3DGOA 5AEWB 1Q40B 1IVWA 2R4IA 2ZDJA 1SIIA 2FXTA 1O7WB 1E3VA 3UNLA 1Q42A 4WP5A 2E2VA 3HK4A 2YFJB 4G1MB 4XM4A 3EBYA 3UB1A 3NX0A 5EQLA 4HM0B 1IV7A 3LZAA 2CIUA 3X40A 1E97A 3O8YA 1W6GA 4AEQA 1W5ZA 4KFFA 1A2KA 3FH1A 2W03A 3V99A 1GY6A 5G2GA 1F8NA 4HM2B 4HKVB 1GY5A 5CK6A 3H51A 1IVXA 1NO3A 1N9EA 3LTDA 1D6ZA 4O8SA 1A67A 1SJWA 2D1WA 4RBNA 1Q7Y4 1WMOA 4TX4A 2XF3A 4EV5A 1YVBI 3NM7A 1IDPA 5ELJA 2B1XB 2W2CA 3BLZA 3JVCA 2K0MA 1VQP3 4KVHA 3E99A 3FG1A 3KSPA 3H3HA 3WODG 2GXFA 3I563 1TFKA 3OX9A 1LOXA 1FGOA 4WHAA 2Z76A 1YJ93 1M9GA 3F9SA 3DXOA 3LTCA 2W6JH 1K9M4 4J8TA 2QA43 3GZXB 2I9WA 5CXOA 3LT8A 2L4VA 3S67A 2CFGA 4HM4B 4L8OA 3FF2A 1OHSA 4ORLA 2W04A 3X3ZA 2CG0A 4I4KA 1ZX2A 2F98A 2HMOB 1JN5A 3CMA3 3DZLA 1NB5I 1KQS2 3CNMA 4CCVA 1K734 1HU9A 3HI7A 2IUJA 1Q824 1AVKA 4NHFA 3MG2A 1RRLA 1GD4A 4WYKB 2K54A 2PNCA 1DMMA 8CHOA 2O3OA 2OTL3 3ALAA 3FCSB 4KFEA 3NQZA 1Q864 1MOLA 5CF1A 1CYVA 2P0XA 2RSXA 3X42A 3PZWA 3F14A 4FCZA 2OOVC 3EQQB 3NBRA 4LGQA 3WOEB 1IVUA 1VQ73 1ULJB 3CC43 1EKMA 5KP1A 3X41A 2C10A 5IG0A 4AKZA 4CDLA 2HMKB 1C7HA 3UL6A 3T8NA 3CME3 1Z1SA 2IMJA 1G96A 1GYBA 2Z7AA 3G4S3 1QVF2 1D6YA 2XGLA 3ER7A 3KN4A 4IIAA 3F7SA 1WTHA 1OF5B 2WO0A 4KFDA 4K90B 4N6TA 5D82A 1TUHA 4L8PA 1KC84 3D9RA 2ML6A 1GS3A 1M1XB 1YJW3 2P0MA 3CCS3 2RGQA 3HZPA 3CPOA 3SXXA 1IQYA 3IPTA 4MEIA 1OHOA 4HM1B 4N6OB 3I553 1K8A4 3KIIA 3PXMA 2FNQA 1IU7A 2GU1A 2V1LA 5AIIA 1W01A 2LQVA 2GEXA 4K1UA 4EYCA 4XB5A 4XDWA 5STDA 3FZWA 4R9LA 1O7GB 5IERA 3V92A 1N9JA 3D3LA 4HYZA 4MMXB 5AYSC 3B4OA 1W2B2 2W56A 3KSED 3G16A 2HMMB 1VQO3 1DVDA 4BTYA 2INXA 2Z77A 5IG4A 1STDA 3BNDA 3FG4A 1QJGA 2CFKA 5D81A 1FGMA 1QAFA 2CFDA 5CF2A 2XSHB 2O9UX 4N6MA 1A2VA 3WA2X 1VQ63 1RJOA 4XBYA 1GY7A 1QAKA 4KZ1A 3BNEA 4FMAA 1YHQ3 2STDA 2BMQB 2XEPA 1FGRA 1DVCA 5JPUA 4MMZB 3S27A 3NV0B 1DYUA 3SVAA 1KD14 1O7MB 3SX1A 4XDVA 4RZMA 3G8ZA 2BMRB 3OV4A 3G6E3 2CC3A 4R9KA 1CYUA 1FA3A 1K28A 3EJVA 3QRDA 1JN5B 3X3YA 1RKYA 4OK0A 3WA3A 5IW9A 4N3VA 1FUWA 1OPYA 2HMJB 3CCJ3 1M904 2OWPA 1OACA 5IEPA 3U97A 4N6UA 1S723 4EV2A 2PZVA 1VQL3 1N5PA 1CEWI 1U5OA 1ULIB 3JUPA 4RNYA 4STDA 3LTBA 4HZ9B 3G713 1IT8A 3I0YA 4JF8A 1YGEA 2E2UA 1VQ83 3HX8A 2Y74A 3JUMA 4XBTA 1Q40A 2QIYA 3KZTA 6STDA 3S29A 2CH9A 1EQKA 4O3VA 1W6YA 5KP4A 3EE1A 2FGTA 1DMQA 1CQSA 1UI7A 1UUWB 2RCDA 1JNQA 1JV2B 4R4KA 4HM3B 3A76A 1JB5A 3NBBA 3JUOA 4HM5B 5HGRA 3CCR3 2MC8A 1N8R4 1IT7A 3GZRA 1UI8A 2QGUA 4MMYB 5IF6A 1FGTA 2M7OA 1VZZA 1PFPA 2Y73A 5AIGA 3WDGB 1IVVA 1O7NB 3T0UA 1W4NA 2XR8B 3CCE3 2B24B 4X2HA 4K61A 4ZM8A 2W9PA 1NJI4 4EC6A 3MG3A 4HM7B 2ML5A 4FCMA 5DREA 1TIJA 1NU3A 5CLKA 3T8UA 1W02A 1JRQA 1HKXA 3M8CA 5TGNA 1WNHA 3DGNA 3LXUX 4MJDA 2SBLA 3CCM3 1ROVA 1ZO2A 1VQM3 3CCL3 3PS8A 3RGAA 4LZIA 2IUKA 1D6UA 5ELUA 1YI23 1LVNA 2C11A 4N6NB 1N5HA 2W56B 3EN1B 3F7XA 3KKGA 5JBSA 3X3XA 2BNGA 2KCDA 1BUQA 1IK3A 1TP6A 3ECFA 2HMNB 5AIHA 3RGRA 4FCJA 3K5TA 1UUVB 3DGMA 3CD63 5BXQA 2XFTA 1KSIA 2W0QA 1MNLA 3FGYA 4FMBA 4GL6A 4NREA 5AI1A 3SEDA 3NXJA 3PCSA 3UJMA 1EG9B 3EHCA 3MWZA 1S5AA 3F40A 1US1A 1IV9A 1RN7A 1VQ93 4FMDA 3FKAA 3KE7A 3GZYB 3EC9A 1OH0A 3NM2A 4IT7A 2CK3H 3JUNA 4BTWA 3WMDA 1AR0A 2BHMA 2CWVA 2P38A 2WGQA 2JDIH 2CW9A 1AVLA 1O7HB 2JQ5A 2OOVA 2IA7A 1RRHA 3S5CA 3VF1A 3BNCA 4H3UA 1SQWA 5AEUB 2Q07A 3FSDA 3K7CA 5EVHA 2RFRA 1FGQA 2OTJ3 4J9AA 4HBRA 1JKGA 5IENA 1OGZA 2CWUA 3HIIA 5A0OB 4X2OA 2YFLB 4OUQA 3SOYA 1STFI 2D42A 5DRVA 4IPBA 4L7KA 2E2TA 1SIHA 1VQN3 1YIT3 2XH9A 3CNXA 3B8LA 5EEOA 1NDOB 3EB8A 3DGLA 3AMOA 4GB5A 3DM8A 1W2ZA 3OW22 3SOAA 2OQEA 4EXRA 1NB3I 2ZL8A 1OHPA 5D83A 3EN8A 1ROAA 2XGNA 1JJ22 1T5YA 4LEHA 3IJEB 1VQK3
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PFP A;  3GAX A;  4ZM8 A;  2W9P A;  4N6O B;  3LH4 A;  1TIJ A;  3Q2P A;  3NX0 A;  1LXE A;  5EQL A;  3PXM A;  1IV7 A;  1WNH A;  5LC6 A;  4EYC A;  3PS8 A;  1N9J A;  1R4C A;  4LZI A;  5ELU A;  4N6N B;  1N5H A;  3KSE D;  1A67 A;  1DVD A;  4TX4 A;  1YVB I;  5ELJ A;  2O9U X;  4N6M A;  1MNL A;  1M9G A;  2BO9 B;  3UL5 A;  3MWZ A;  1A90 A;  1DVC A;  1IV9 A;  1RN7 A;  3S67 A;  3PYJ A;  5LC7 A;  3SVA A;  4IT7 A;  3K9M C;  1CYU A;  1FA3 A;  3QRD A;  1NB5 I;  1FUW A;  4CCV A;  4N6L A;  4N6U A;  1GD4 A;  1N5P A;  3IMA B;  1CEW I;  5A0O B;  1MOL A;  1STF I;  1CYV A;  1GD3 A;  2W9Q A;  2CH9 A;  1EQK A;  2KXG A;  3L0R A;  4N6V 0;  2OCT A;  3UL6 A;  1G96 A;  1NB3 I;  1KWI A;  1ROA A;  3KFQ C;  4N6T A; 
#chains in the Genus database with same CATH topology
 2CHC A;  2GBW B;  7GSP A;  1SPU A;  3LML A;  3FLJ A;  4HJL B;  1JB4 A;  1BSE A;  3VGN A;  2GBX B;  3GZB A;  3CCV 3;  1I70 A;  1RCK A;  3MHE A;  3MG1 A;  3JUQ A;  2UX0 A;  3CCU 3;  3MPH A;  3PGB A;  3NUV A;  3LH4 A;  1BSB A;  1EUI C;  4H61 A;  1NWW A;  1W6C A;  3Q2P A;  5I97 A;  1LXE A;  3B7C A;  4HM8 B;  1BNF A;  4BU4 A;  4JRF A;  3BNB A;  3V98 A;  3STD A;  1RGH A;  5LC6 A;  2Z6B A;  2A15 A;  3AGN A;  3B4P A;  5BIR A;  1PU4 A;  1DMN A;  3WOF B;  3F8H A;  2IYJ A;  1R4C A;  3NV0 A;  3CC2 3;  1BSD A;  1OGX A;  1ASK A;  3OWY A;  1RNB A;  1BVI A;  3DMC A;  4WFO A;  1VQ4 3;  1RGC A;  1T2H A;  4BIR A;  3CXC 2;  4EBG A;  3Q1C A;  5FGO A;  3EF8 A;  1BAN A;  1LQM B;  4ILF A;  1EA2 A;  2MF7 A;  2H0H A;  1BGS A;  4FR9 A;  3CCQ 3;  1YNV X;  4U13 A;  2BMO B;  3LTA A;  1J2B A;  2YFI B;  1JBT A;  4PEJ A;  2F5W A;  1W00 A;  2F4Y A;  1IYY A;  3FF0 A;  2BO9 B;  3K63 A;  5FW5 A;  3UL5 A;  2HOH A;  4EW5 A;  3CC7 3;  3GSP A;  3FG3 A;  1BNJ A;  4HM6 B;  3U1W A;  1GMQ A;  3BB9 A;  3PCR A;  5KP3 A;  1UGI A;  1V58 A;  4XBX A;  3ROB A;  3VSY A;  2WOF A;  3ZG0 A;  2XRX B;  3Q90 A;  2CWT A;  4R1K A;  2QEX 3;  1A90 A;  3PYJ A;  4BTX A;  1N8Q A;  1UW1 A;  5LC7 A;  3MYT A;  3OWU A;  3J7Y d;  1YIJ 3;  1QAL A;  1TRQ A;  2RNT A;  3K9M C;  2XFS A;  1Q7H A;  3RDE A;  3N54 B;  3WHO A;  1RGA A;  1MWT A;  1UCK A;  1QVG 2;  1I0V A;  5JPP A;  7STD A;  3OXA A;  2BT3 A;  3N8B A;  4OVM A;  3RNT A;  1IQ8 A;  1AV4 A;  1QMA A;  2WGO A;  2XSO B;  1UUG B;  4Q53 A;  3SLU A;  1O7P B;  4N6L A;  4LSO A;  3DY5 A;  3NHX A;  4WWU C;  1B2Z A;  3G0K A;  4O2H A;  1JB2 A;  3LOY A;  4WYK A;  3NBJ A;  4QWT A;  3IMA B;  1RGF A;  1AQZ A;  2H0I A;  3MSO A;  1TU5 A;  3CU3 A;  1WQL B;  1E3R A;  1X1U A;  3S28 A;  1JKG B;  4RNT A;  2CKF B;  3D4A A;  5BVB A;  1B27 A;  3DUK A;  4HZB B;  4LMI A;  2F86 B;  1OUN A;  1WMN A;  1GD3 A;  2CFL A;  2W9Q A;  3TDG A;  3CPW 2;  2KF6 A;  4HOH A;  1W7C A;  2P09 A;  3GRD A;  3K0Z A;  2F99 A;  1IQX A;  1RHL A;  2KXG A;  2CG1 A;  4RNZ A;  3L0R A;  2OQE C;  5IG3 A;  5IG5 A;  4N6V 0;  1TFO A;  2KRT A;  3AMO B;  3LT9 A;  4AKY A;  4HVN A;  2OCT A;  3LYG A;  1JZO A;  3GWR A;  2GU3 A;  2GEY A;  2HML B;  3QK9 A;  4FMC A;  2YX9 A;  3MKI A;  1MWU A;  4KT3 B;  1L5G B;  3OWS A;  5AYR B;  1EEJ A;  1Y4K A;  2WOH A;  1OF5 A;  1KWI A;  3EBT A;  5BU4 A;  2P05 A;  1OCV A;  1Q81 4;  3KFQ C;  4R80 A;  1V74 A;  3F8X A;  1B20 A;  5AIF A;  5G1K A;  3GAX A;  1LOW A;  1VQ5 3;  1LNH A;  1U8C B;  1WMP A;  4K1V A;  3N9H A;  1K41 A;  4O02 B;  1UCL A;  5IEO A;  1ZGX A;  3HIG A;  1M1K 4;  3NQY A;  1LQG C;  2CFW A;  1ISK A;  3EX9 A;  2LYX A;  3DGO A;  1HZ1 A;  5AEW B;  1Q40 B;  1IVW A;  1I3I A;  2R4I A;  1SII A;  2FXT A;  2ZDJ A;  1O7W B;  1Q9E A;  1E3V A;  1GOV A;  4GHO A;  3UNL A;  1Q42 A;  4WP5 A;  1NNV A;  2E2V A;  3HK4 A;  2YFJ B;  4G1M B;  4GSP A;  3EBY A;  4LYL B;  4XM4 A;  3NX0 A;  1MGR A;  3UB1 A;  5EQL A;  2K3D A;  2BIR A;  4HM0 B;  1JBR A;  1IV7 A;  2KAA A;  3DH2 A;  3LZA A;  2CIU A;  8RNT A;  2KF5 A;  1E97 A;  3O8Y A;  1W6G A;  3X40 A;  1W5Z A;  4KFF A;  1A2K A;  1LRA A;  3FH1 A;  4AEQ A;  2W03 A;  5M1A A;  3V99 A;  1RN4 A;  1GY6 A;  5G2G A;  1F8N A;  4HM2 B;  4HKV B;  1GY5 A;  5CK6 A;  3H51 A;  1IVX A;  1NO3 A;  1N9E A;  3LTD A;  1D6Z A;  4O8S A;  1A67 A;  1SJW A;  2D1W A;  4RBN A;  1Q7Y 4;  1WMO A;  4TX4 A;  2XF3 A;  2AAD A;  4EV5 A;  1YVB I;  3NM7 A;  1IDP A;  5ELJ A;  2B1X B;  2W2C A;  3BLZ A;  3JVC A;  2K0M A;  1VQP 3;  4KVH A;  3E99 A;  3FG1 A;  2AAE A;  3H3H A;  3KSP A;  3WOD G;  1BRS A;  2GXF A;  3I56 3;  1TFK A;  3OX9 A;  1LOX A;  1FGO A;  1I8V A;  2Z76 A;  4WHA A;  1M9G A;  3F9S A;  3DXO A;  3LTC A;  5RNT A;  1YJ9 3;  2W6J H;  3HOH A;  1K9M 4;  4J8T A;  2QA4 3;  3GZX B;  1BIR A;  2I9W A;  1BRI A;  5CXO A;  3LT8 A;  2L4V A;  3S67 A;  2CFG A;  4HM4 B;  4L8O A;  1RDS A;  3FF2 A;  2IY2 A;  1OHS A;  4ORL A;  2W04 A;  3X3Z A;  2CG0 A;  4I4K A;  1ZX2 A;  2F98 A;  1A2P A;  1YVS A;  2HMO B;  1JN5 A;  3CMA 3;  1HYF A;  3DZL A;  1NB5 I;  1B21 A;  1KQS 2;  3CNM A;  4CCV A;  1UCJ A;  1K73 4;  1HU9 A;  3HI7 A;  2IUJ A;  1Q82 4;  1AVK A;  4NHF A;  3MG2 A;  1RRL A;  1GD4 A;  4WYK B;  2K54 A;  1MWR A;  2PNC A;  1DMM A;  8CHO A;  2O3O A;  2OTL 3;  3ALA A;  3FCS B;  4KFE A;  3NQZ A;  1Q86 4;  1MOL A;  5CF1 A;  1BUJ A;  1BNE A;  1CYV A;  2P0X A;  1RMS A;  2RSX A;  3X42 A;  3PZW A;  3F14 A;  4FCZ A;  2OOV C;  3EQQ B;  3NBR A;  4LGQ A;  3WOE B;  1IVU A;  6RNT A;  1VQ7 3;  1ULJ B;  3CC4 3;  1EKM A;  5KP1 A;  3X41 A;  1FYS A;  2C10 A;  5IG0 A;  4AKZ A;  4CDL A;  1I3F A;  2HMK B;  3ZG5 A;  1R4Y A;  1C7H A;  3UL6 A;  1VQQ A;  3T8N A;  1Z1S A;  2IMJ A;  3CME 3;  1G96 A;  1GYB A;  2Z7A A;  3G4S 3;  1QVF 2;  1D6Y A;  1G02 A;  2XGL A;  3ER7 A;  3KN4 A;  3F7S A;  1WTH A;  1OF5 B;  2WO0 A;  4IIA A;  1RGK A;  3AHS A;  1BRH A;  4KFD A;  4CPK A;  4K90 B;  4N6T A;  5D82 A;  1TUH A;  4L8P A;  3DGY A;  3D9R A;  1KC8 4;  1BNR A;  1X1W A;  2F56 A;  2BU4 A;  3D79 A;  2ML6 A;  1B3S A;  1GS3 A;  1M1X B;  3BU4 A;  1YJW 3;  2P0M A;  3CCS 3;  2RGQ A;  3HZP A;  3CPO A;  3SXX A;  1JBS A;  1IQY A;  3IPT A;  5M18 A;  4MEI A;  1BRK A;  1OHO A;  4HM1 B;  4N6O B;  1B2M A;  1BRG A;  3I55 3;  1K8A 4;  3KII A;  3PXM A;  1RSN A;  2FNQ A;  1IU7 A;  1AY7 A;  2GU1 A;  2V1L A;  5AII A;  1GMP A;  2C4B A;  1W01 A;  2LQV A;  5GSP A;  2GEX A;  1YJN 3;  4K1U A;  4EYC A;  4XB5 A;  4XDW A;  5STD A;  3FZW A;  4R9L A;  1O7G B;  2CX0 A;  3V92 A;  5IER A;  1N9J A;  1V57 A;  3D3L A;  4HYZ A;  4MMX B;  5AYS C;  1CH0 A;  3B4O A;  1BRJ A;  1W2B 2;  1ZS7 A;  1SAR A;  1BSA A;  2W56 A;  1GMR A;  1B2U A;  3KSE D;  3G16 A;  2HMM B;  3URP A;  1VQO 3;  1DVD A;  1TTO A;  4BTY A;  2INX A;  2Z77 A;  5IG4 A;  2KF4 A;  1STD A;  1I0X A;  3BND A;  3FG4 A;  1QJG A;  2CFK A;  5D81 A;  1FGM A;  1QAF A;  2CFD A;  5CF2 A;  2XSH B;  2O9U X;  1RTU A;  4I5Q A;  1GOY A;  4N6M A;  1A2V A;  3WA2 X;  1VQ6 3;  2KF3 A;  1RJO A;  4XBY A;  1GY7 A;  1QAK A;  4KZ1 A;  3BNE A;  4FMA A;  1YHQ 3;  2STD A;  2BMQ B;  2XEP A;  1FGR A;  1DVC A;  5JPU A;  4MMZ B;  3S27 A;  2L1S A;  3NV0 B;  1DYU A;  3SVA A;  3KCH A;  2ZA4 A;  1T3B A;  1KD1 4;  1O7M B;  3SX1 A;  4XDV A;  4BL2 A;  2GSP A;  3G8Z A;  4RZM A;  2BMR B;  3OV4 A;  3G6E 3;  2CC3 A;  4R9K A;  1CYU A;  2F5M A;  1FA3 A;  1K28 A;  1YGW A;  3EJV A;  3QRD A;  1JN5 B;  4J5K A;  3X3Y A;  4OK0 A;  1RKY A;  3WA3 A;  5IW9 A;  4N3V A;  1PYL A;  1OPY A;  2HMJ B;  1FUW A;  1UGH I;  1FZU A;  1RNT A;  3CCJ 3;  1M90 4;  3Q3F A;  1BSC A;  2OWP A;  1OAC A;  5IEP A;  3U97 A;  4N6U A;  1S72 3;  4EV2 A;  2PZV A;  1VQL 3;  1LOV A;  1N5P A;  2RBI A;  1RCL A;  1CEW I;  1U5O A;  1ULI B;  1BU4 A;  1DET A;  3JUP A;  4RNY A;  4STD A;  1RGG A;  3LTB A;  1BNS A;  4HZ9 B;  3G71 3;  1IT8 A;  1PY3 A;  3I0Y A;  4JF8 A;  1TRP A;  2SAR A;  1YGE A;  2E2U A;  1VQ8 3;  3HX8 A;  1T2I A;  2Y74 A;  3JUM A;  4XBT A;  6GSP A;  1Q40 A;  2QIY A;  3KZT A;  1RLS A;  6STD A;  3S29 A;  2CH9 A;  1EQK A;  1X1Y A;  1FUS A;  1LOY A;  4O3V A;  1W6Y A;  5KP4 A;  3EE1 A;  2FGT A;  1DMQ A;  1I2F A;  3CCM 3;  1BRN L;  1CQS A;  1UI7 A;  1LNI A;  1UUW B;  2RCD A;  1JNQ A;  1JV2 B;  4R4K A;  4HM3 B;  3A76 A;  1JB5 A;  3NBB A;  3JUO A;  4HM5 B;  5HGR A;  2J8X B;  3CCR 3;  2MC8 A;  3D5I A;  1N8R 4;  1IT7 A;  3GZR A;  1UI8 A;  2QGU A;  4MMY B;  5IF6 A;  1FGT A;  2M7O A;  1VZZ A;  1PFP A;  2Y73 A;  5HOH A;  2ZHX B;  5AIG A;  3WDG B;  1IVV A;  1TJD A;  1O7N B;  3T0U A;  1W4N A;  2XR8 B;  1GSP A;  3CCE 3;  2B24 B;  4X2H A;  4K61 A;  3A5E A;  4BL3 A;  1RGE A;  4ZM8 A;  2W9P A;  1BNI A;  1NJI 4;  4EC6 A;  3MG3 A;  4HM7 B;  2ML5 A;  4FCM A;  5DRE A;  1UCI A;  1MWS A;  1TIJ A;  1G0T A;  1NU3 A;  1X1X A;  5CLK A;  4CJN A;  2H0G A;  3T8U A;  1W02 A;  1JRQ A;  1HKX A;  3M8C A;  1I2E A;  5TGN A;  1WNH A;  3DGN A;  3LXU X;  1FUT A;  2UUG C;  2SBL A;  1ROV A;  1ZO2 A;  4MJD A;  5G1L A;  7RNT A;  1VQM 3;  3CCL 3;  1FW7 A;  3PS8 A;  1BAO A;  3RGA A;  4LZI A;  2IUK A;  1D6U A;  5ELU A;  1YI2 3;  1LVN A;  2C11 A;  4N6N B;  1N5H A;  1B2X A;  2W56 B;  3EN1 B;  3F7X A;  3KKG A;  5JBS A;  3WR2 A;  3X3X A;  2BNG A;  2KCD A;  1BUQ A;  1IK3 A;  1TP6 A;  3ECF A;  2HMN B;  5AIH A;  3RGR A;  4FCJ A;  3K5T A;  1UUV B;  3DGM A;  1C54 A;  3CD6 3;  5BXQ A;  2XFT A;  5M19 A;  1KSI A;  2W0Q A;  3BIR A;  1MNL A;  3FGY A;  4FMB A;  4GL6 A;  4NRE A;  5AI1 A;  3SED A;  3NXJ A;  3PCS A;  3UJM A;  1EG9 B;  1B2S A;  1MGW A;  3EHC A;  3MWZ A;  1S5A A;  3F40 A;  1US1 A;  1IV9 A;  1RN7 A;  3SYU A;  4FMD A;  1VQ9 3;  3FKA A;  3KE7 A;  3GZY B;  3EC9 A;  1OH0 A;  3NM2 A;  1DE3 A;  4IT7 A;  2CK3 H;  3JUN A;  4BTW A;  4DKI A;  3WMD A;  1AR0 A;  2BHM A;  2CWV A;  2P38 A;  2WGQ A;  2JDI H;  2CW9 A;  1BOX A;  1AVL A;  1O7H B;  2JQ5 A;  2OOV A;  2IA7 A;  1RRH A;  3S5C A;  2CX1 A;  3VF1 A;  3BNC A;  1BNG A;  4H3U A;  1RN1 A;  1SQW A;  5AEU B;  2Q07 A;  3FSD A;  3AGO A;  3K7C A;  5EVH A;  2RFR A;  1FGQ A;  4J5G A;  2OTJ 3;  4J9A A;  4HBR A;  1JKG A;  5IEN A;  1OGZ A;  2CWU A;  3HII A;  5A0O B;  4X2O A;  2UGI A;  2YFL B;  4OUQ A;  3SOY A;  1STF I;  2D42 A;  5DRV A;  4IPB A;  4L7K A;  1JZD A;  2E2T A;  1SIH A;  1VQN 3;  3AHW A;  1RGL A;  3D5G A;  1YIT 3;  2XH9 A;  3CNX A;  3B8L A;  5EEO A;  1NDO B;  3EB8 A;  1UDI I;  3DGL A;  3AMO A;  4GB5 A;  3DM8 A;  4NPB A;  1W2Z A;  2R41 A;  3OW2 2;  3SOA A;  2OQE A;  4EXR A;  1NB3 I;  2ZL8 A;  1OHP A;  1I2G A;  5D83 A;  3EN8 A;  3ZFZ A;  4HAA A;  9RNT A;  1ROA A;  2XGN A;  1JJ2 2;  1GOU A;  1T5Y A;  4LEH A;  3IJE B;  1VQK 3; 
#chains in the Genus database with same CATH homology
 2CHC A;  2GBW B;  1SPU A;  3LML A;  3FLJ A;  4HJL B;  1JB4 A;  3VGN A;  2GBX B;  3GZB A;  3CCV 3;  3MHE A;  3MG1 A;  3JUQ A;  2UX0 A;  3CCU 3;  3MPH A;  3PGB A;  3NUV A;  3LH4 A;  4H61 A;  1NWW A;  1W6C A;  3Q2P A;  5I97 A;  1LXE A;  3B7C A;  4HM8 B;  4JRF A;  3BNB A;  3V98 A;  3STD A;  5LC6 A;  2Z6B A;  2A15 A;  3B4P A;  1PU4 A;  1YJN 3;  1DMN A;  3WOF B;  3F8H A;  3NV0 A;  1R4C A;  3CC2 3;  1OGX A;  1ASK A;  3OWY A;  3DMC A;  4WFO A;  1VQ4 3;  3CXC 2;  4EBG A;  3Q1C A;  5FGO A;  3EF8 A;  1EA2 A;  2MF7 A;  4FR9 A;  3CCQ 3;  4U13 A;  2BMO B;  3LTA A;  1J2B A;  2YFI B;  4PEJ A;  1W00 A;  3FF0 A;  2BO9 B;  3K63 A;  5FW5 A;  3UL5 A;  3CC7 3;  3FG3 A;  4HM6 B;  3U1W A;  3BB9 A;  3PCR A;  5KP3 A;  3ROB A;  3VSY A;  4XBX A;  1A90 A;  2WOF A;  2QEX 3;  2XRX B;  3Q90 A;  2CWT A;  4R1K A;  3PYJ A;  4BTX A;  1N8Q A;  1UW1 A;  5LC7 A;  3MYT A;  3OWU A;  3J7Y d;  1YIJ 3;  1QAL A;  3K9M C;  2XFS A;  3RDE A;  3N54 B;  1QVG 2;  5JPP A;  7STD A;  3OXA A;  2BT3 A;  3N8B A;  4OVM A;  1IQ8 A;  1AV4 A;  1QMA A;  2WGO A;  2XSO B;  4Q53 A;  3SLU A;  1O7P B;  4N6L A;  4LSO A;  3DY5 A;  3NHX A;  4WWU C;  4O2H A;  3G0K A;  1JB2 A;  3LOY A;  4WYK A;  3NBJ A;  4QWT A;  3IMA B;  3MSO A;  1TU5 A;  3CU3 A;  1WQL B;  1E3R A;  3S28 A;  1JKG B;  2CKF B;  5BVB A;  3DUK A;  4HZB B;  4LMI A;  2F86 B;  1OUN A;  1WMN A;  1GD3 A;  2CFL A;  2W9Q A;  3TDG A;  3CPW 2;  1W7C A;  2P09 A;  3GRD A;  3K0Z A;  2F99 A;  1IQX A;  2KXG A;  2CG1 A;  4RNZ A;  3L0R A;  2OQE C;  5IG3 A;  5IG5 A;  4N6V 0;  1TFO A;  2KRT A;  3AMO B;  3LT9 A;  4AKY A;  4HVN A;  2OCT A;  3LYG A;  3GWR A;  2GU3 A;  2GEY A;  2HML B;  3QK9 A;  4FMC A;  2YX9 A;  3MKI A;  1L5G B;  3OWS A;  5AYR B;  1Y4K A;  2WOH A;  1OF5 A;  1KWI A;  3EBT A;  2P05 A;  1OCV A;  1Q81 4;  3KFQ C;  4R80 A;  1V74 A;  3F8X A;  5AIF A;  3GAX A;  1VQ5 3;  1LNH A;  1U8C B;  1WMP A;  4K1V A;  3N9H A;  1K41 A;  4O02 B;  5IEO A;  3HIG A;  1M1K 4;  3NQY A;  2CFW A;  1ISK A;  3EX9 A;  2LYX A;  3DGO A;  5AEW B;  1Q40 B;  1IVW A;  2R4I A;  2ZDJ A;  1SII A;  2FXT A;  1O7W B;  1E3V A;  3UNL A;  1Q42 A;  4WP5 A;  2E2V A;  3HK4 A;  2YFJ B;  4G1M B;  4XM4 A;  3EBY A;  3UB1 A;  3NX0 A;  5EQL A;  4HM0 B;  1IV7 A;  3LZA A;  2CIU A;  3X40 A;  1E97 A;  3O8Y A;  1W6G A;  4AEQ A;  1W5Z A;  4KFF A;  1A2K A;  3FH1 A;  2W03 A;  3V99 A;  1GY6 A;  5G2G A;  1F8N A;  4HM2 B;  4HKV B;  1GY5 A;  5CK6 A;  3H51 A;  1IVX A;  1NO3 A;  1N9E A;  3LTD A;  1D6Z A;  4O8S A;  1A67 A;  1SJW A;  2D1W A;  4RBN A;  1Q7Y 4;  1WMO A;  4TX4 A;  2XF3 A;  4EV5 A;  1YVB I;  3NM7 A;  1IDP A;  5ELJ A;  2B1X B;  2W2C A;  3BLZ A;  3JVC A;  2K0M A;  1VQP 3;  4KVH A;  3E99 A;  3FG1 A;  3KSP A;  3H3H A;  3WOD G;  2GXF A;  3I56 3;  1TFK A;  3OX9 A;  1LOX A;  1FGO A;  4WHA A;  2Z76 A;  1YJ9 3;  1M9G A;  3F9S A;  3DXO A;  3LTC A;  2W6J H;  1K9M 4;  4J8T A;  2QA4 3;  3GZX B;  2I9W A;  5CXO A;  3LT8 A;  2L4V A;  3S67 A;  2CFG A;  4HM4 B;  4L8O A;  3FF2 A;  1OHS A;  4ORL A;  2W04 A;  3X3Z A;  2CG0 A;  4I4K A;  1ZX2 A;  2F98 A;  2HMO B;  1JN5 A;  3CMA 3;  3DZL A;  1NB5 I;  1KQS 2;  3CNM A;  4CCV A;  1K73 4;  1HU9 A;  3HI7 A;  2IUJ A;  1Q82 4;  1AVK A;  4NHF A;  3MG2 A;  1RRL A;  1GD4 A;  4WYK B;  2K54 A;  2PNC A;  1DMM A;  8CHO A;  2O3O A;  2OTL 3;  3ALA A;  3FCS B;  4KFE A;  3NQZ A;  1Q86 4;  1MOL A;  5CF1 A;  1CYV A;  2P0X A;  2RSX A;  3X42 A;  3PZW A;  3F14 A;  4FCZ A;  2OOV C;  3EQQ B;  3NBR A;  4LGQ A;  3WOE B;  1IVU A;  1VQ7 3;  1ULJ B;  3CC4 3;  1EKM A;  5KP1 A;  3X41 A;  2C10 A;  5IG0 A;  4AKZ A;  4CDL A;  2HMK B;  1C7H A;  3UL6 A;  3T8N A;  3CME 3;  1Z1S A;  2IMJ A;  1G96 A;  1GYB A;  2Z7A A;  3G4S 3;  1QVF 2;  1D6Y A;  2XGL A;  3ER7 A;  3KN4 A;  4IIA A;  3F7S A;  1WTH A;  1OF5 B;  2WO0 A;  4KFD A;  4K90 B;  4N6T A;  5D82 A;  1TUH A;  4L8P A;  1KC8 4;  3D9R A;  2ML6 A;  1GS3 A;  1M1X B;  1YJW 3;  2P0M A;  3CCS 3;  2RGQ A;  3HZP A;  3CPO A;  3SXX A;  1IQY A;  3IPT A;  4MEI A;  1OHO A;  4HM1 B;  4N6O B;  3I55 3;  1K8A 4;  3KII A;  3PXM A;  2FNQ A;  1IU7 A;  2GU1 A;  2V1L A;  5AII A;  1W01 A;  2LQV A;  2GEX A;  4K1U A;  4EYC A;  4XB5 A;  4XDW A;  5STD A;  3FZW A;  4R9L A;  1O7G B;  5IER A;  3V92 A;  1N9J A;  3D3L A;  4HYZ A;  4MMX B;  5AYS C;  3B4O A;  1W2B 2;  2W56 A;  3KSE D;  3G16 A;  2HMM B;  1VQO 3;  1DVD A;  4BTY A;  2INX A;  2Z77 A;  5IG4 A;  1STD A;  3BND A;  3FG4 A;  1QJG A;  2CFK A;  5D81 A;  1FGM A;  1QAF A;  2CFD A;  5CF2 A;  2XSH B;  2O9U X;  4N6M A;  1A2V A;  3WA2 X;  1VQ6 3;  1RJO A;  4XBY A;  1GY7 A;  1QAK A;  4KZ1 A;  3BNE A;  4FMA A;  1YHQ 3;  2STD A;  2BMQ B;  2XEP A;  1FGR A;  1DVC A;  5JPU A;  4MMZ B;  3S27 A;  3NV0 B;  1DYU A;  3SVA A;  1KD1 4;  1O7M B;  3SX1 A;  4XDV A;  4RZM A;  3G8Z A;  2BMR B;  3OV4 A;  3G6E 3;  2CC3 A;  4R9K A;  1CYU A;  1FA3 A;  1K28 A;  3EJV A;  3QRD A;  1JN5 B;  3X3Y A;  1RKY A;  4OK0 A;  3WA3 A;  5IW9 A;  4N3V A;  1FUW A;  1OPY A;  2HMJ B;  3CCJ 3;  1M90 4;  2OWP A;  1OAC A;  5IEP A;  3U97 A;  4N6U A;  1S72 3;  4EV2 A;  2PZV A;  1VQL 3;  1N5P A;  1CEW I;  1U5O A;  1ULI B;  3JUP A;  4RNY A;  4STD A;  3LTB A;  4HZ9 B;  3G71 3;  1IT8 A;  3I0Y A;  4JF8 A;  1YGE A;  2E2U A;  1VQ8 3;  3HX8 A;  2Y74 A;  3JUM A;  4XBT A;  1Q40 A;  2QIY A;  3KZT A;  6STD A;  3S29 A;  2CH9 A;  1EQK A;  4O3V A;  1W6Y A;  5KP4 A;  3EE1 A;  2FGT A;  1DMQ A;  1CQS A;  1UI7 A;  1UUW B;  2RCD A;  1JNQ A;  1JV2 B;  4R4K A;  4HM3 B;  3A76 A;  1JB5 A;  3NBB A;  3JUO A;  4HM5 B;  5HGR A;  3CCR 3;  2MC8 A;  1N8R 4;  1IT7 A;  3GZR A;  1UI8 A;  2QGU A;  4MMY B;  5IF6 A;  1FGT A;  2M7O A;  1VZZ A;  1PFP A;  2Y73 A;  5AIG A;  3WDG B;  1IVV A;  1O7N B;  3T0U A;  1W4N A;  2XR8 B;  3CCE 3;  2B24 B;  4X2H A;  4K61 A;  4ZM8 A;  2W9P A;  1NJI 4;  4EC6 A;  3MG3 A;  4HM7 B;  2ML5 A;  4FCM A;  5DRE A;  1TIJ A;  1NU3 A;  5CLK A;  3T8U A;  1W02 A;  1JRQ A;  1HKX A;  3M8C A;  5TGN A;  1WNH A;  3DGN A;  3LXU X;  4MJD A;  2SBL A;  3CCM 3;  1ROV A;  1ZO2 A;  1VQM 3;  3CCL 3;  3PS8 A;  3RGA A;  4LZI A;  2IUK A;  1D6U A;  5ELU A;  1YI2 3;  1LVN A;  2C11 A;  4N6N B;  1N5H A;  2W56 B;  3EN1 B;  3F7X A;  3KKG A;  5JBS A;  3X3X A;  2BNG A;  2KCD A;  1BUQ A;  1IK3 A;  1TP6 A;  3ECF A;  2HMN B;  5AIH A;  3RGR A;  4FCJ A;  3K5T A;  1UUV B;  3DGM A;  3CD6 3;  5BXQ A;  2XFT A;  1KSI A;  2W0Q A;  1MNL A;  3FGY A;  4FMB A;  4GL6 A;  4NRE A;  5AI1 A;  3SED A;  3NXJ A;  3PCS A;  3UJM A;  1EG9 B;  3EHC A;  3MWZ A;  1S5A A;  3F40 A;  1US1 A;  1IV9 A;  1RN7 A;  1VQ9 3;  4FMD A;  3FKA A;  3KE7 A;  3GZY B;  3EC9 A;  1OH0 A;  3NM2 A;  4IT7 A;  2CK3 H;  3JUN A;  4BTW A;  3WMD A;  1AR0 A;  2BHM A;  2CWV A;  2P38 A;  2WGQ A;  2JDI H;  2CW9 A;  1AVL A;  1O7H B;  2JQ5 A;  2OOV A;  2IA7 A;  1RRH A;  3S5C A;  3VF1 A;  3BNC A;  4H3U A;  1SQW A;  5AEU B;  2Q07 A;  3FSD A;  3K7C A;  5EVH A;  2RFR A;  1FGQ A;  2OTJ 3;  4J9A A;  4HBR A;  1JKG A;  5IEN A;  1OGZ A;  2CWU A;  3HII A;  5A0O B;  4X2O A;  2YFL B;  4OUQ A;  3SOY A;  1STF I;  2D42 A;  5DRV A;  4IPB A;  4L7K A;  2E2T A;  1SIH A;  1VQN 3;  1YIT 3;  2XH9 A;  3CNX A;  3B8L A;  5EEO A;  1NDO B;  3EB8 A;  3DGL A;  3AMO A;  4GB5 A;  3DM8 A;  1W2Z A;  3OW2 2;  3SOA A;  2OQE A;  4EXR A;  1NB3 I;  2ZL8 A;  1OHP A;  5D83 A;  3EN8 A;  1ROA A;  2XGN A;  1JJ2 2;  1T5Y A;  4LEH A;  3IJE B;  1VQK 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...