1C7HA

Crystal structure of a mutant r75a in ketosteroid isomerase from psedomonas putida biotype b
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
126
structure length
123
Chain Sequence
NLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFYRQGLKVRACLTGPVAASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords DELTA-5-3-KETOSTEROID ISOMERASE
publication title Roles of active site aromatic residues in catalysis by ketosteroid isomerase from Pseudomonas putida biotype B.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 29
structure length 123
sequence length 126
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2000-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1c7hA00
2XR8B 5KP3A 4HM8B 2JQ5A 1JN5A 4HM2B 3F7XA 3VSYA 3FKAA 1OF5A 4HM4B 2HMNB 3GZRA 3LZAA 4XBTA 5IG3A 1TUHA 2HMKB 3Q90A 4CDLA 2STDA 3NV0B 5TGNA 6STDA 3B4OA 1W02A 4FCJA 3JUNA 1E97A 1ISKA 3LYGA 1GY5A 1OH0A 4GB5A 1GS3A 2F99A 1E3VA 3FLJA 2Z77A 3NV0A 3SEDA 5IEPA 4ORLA 3DM8A 1OUNA 1GY6A 3MSOA 2RCDA 1EA2A 3F9SA 1SJWA 2GBXB 5HGRA 2Z76A 2GBWB 2HMMB 3M8CA 3DXOA 1BUQA 5AIHA 3CNMA 3EC9A 4X2HA 3EBYA 1JKGB 3GRDA 4WWUC 3EJVA 1OCVA 3ECFA 1Q40B 4Q53A 5IG4A 2XSHB 3ROBA 3K0ZA 5AIIA 3F40A 2GEXA 3KKGA 5IEOA 7STDA 3MHEA 3SOAA 3EN1B 5STDA 5AIGA 3MYTA 1ULJB 4HM1B 1Z1SA 4HM5B 5AI1A 3VGNA 3DUKA 3FF0A 1JKGA 1Q40A 2RFRA 3SOYA 3NM2A 4RZMA 2A15A 5BVBA 4U13A 5D82A 5EVHA 1OPYA 2YFLB 1QMAA 4KVHA 4R1KA 1JB2A 5IF6A 3F7SA 3BB9A 3CU3A 3OX9A 3FH1A 5JPUA 5CK6A 3EBTA 1Q42A 5JPPA 3EX9A 3EF8A 4HVNA 1HKXA 2Z7AA 3G0KA 4HZ9B 1W00A 5G2GA 4H3UA 1OGZA 3BLZA 1O7MB 5CF2A 3OWYA 2CHCA 2QIYA 1O7PB 3OV4A 3FF2A 4LMIA 3FSDA 3K7CA 3T8NA 1JB4A 3WMDA 2BMRB 3HX8A 3HK4A 8CHOA 2XRXB 4MJDA 3F14A 4XDVA 3JUMA 3EN8A 5IG0A 3DZLA 3EQQB 2RGQA 1U5OA 4X2OA 3GZYB 4L8OA 1O7HB 3OWSA 1AR0A 5CF1A 2YFIB 3DMCA 4STDA 4HM7B 3KE7A 3KSPA 2CKFB 3FZWA 2INXA 5IG5A 4K1VA 4R9KA 2BMOB 1ZO2A 4IIAA 1W6YA 5AIFA 1OHOA 3I0YA 4N3VA 5D81A 3RGRA 2GEYA 1DMMA 1STDA 3MKIA 3S5CA 1UUVB 1VZZA 5FW5A 3B7CA 5IERA 3T8UA 1O7WB 3A76A 3JUQA 4LGQA 1ULIB 3HZPA 5CXOA 3D9RA 1TP6A 1GYBA 5KP1A 1JB5A 3EHCA 2YFJB 3MG1A 1UUWB 3OWUA 1NWWA 3UJMA 4WP5A 4I4KA 1W01A 1IDPA 2F98A 1E3RA 2K54A 4J9AA 4R9LA 3F8XA 3G16A 1EG9B 1C7HA 2HMLB 3MG3A 4WYKB 3RGAA 4OUQA 3NBRA 1OHPA 1S5AA 5IENA 3GZXB 3FGYA 1O7GB 4HKVB 4FCMA 5CLKA 1OGXA 3G8ZA 1O7NB 4WYKA 1GY7A 2IMJA 4XBYA 3H51A 5D83A 3CNXA 4XM4A 2HMOB 5BXQA 5DRVA 3KZTA 4HJLB 3B8LA 1NU3A 4L8PA 2I9WA 2R4IA 2B24B 3STDA 4HZBB 4HM6B 3H3HA 2UX0A 3NXJA 3ER7A 3B4PA 1ZX2A 1DMNA 4J8TA 2GXFA 1ASKA 3OXAA 3IPTA 3GWRA 3JUOA 3NUVA 1A2KA 4K1UA 3GZBA 5KP4A 3E99A 2BMQB 3F8HA 5AEUB 1QJGA 2XSOB 2OWPA 1OHSA 3MG2A 4HM0B 1K41A 4OVMA 4XB5A 1WQLB 2HMJB 2BNGA 4L7KA 3CPOA 2B1XB 5AEWB 2PZVA 1JN5B 1NDOB 5DREA 4HM3B 1OF5B 2QGUA 2F86B 4LEHA 4XDWA 4XBXA 1DMQA 2W2CA 1CQSA 3UNLA 4PEJA 3JUPA 3NHXA
chains in the Genus database with same CATH superfamily
4AEQA 1VQL3 2XR8B 4BL3A 1JBRA 5KP3A 4HM8B 1CYUA 2JQ5A 1JN5A 1RSNA 4HM2B 3CCQ3 1I2EA 1RGAA 3F7XA 3J7Yd 2RNTA 3VSYA 1IQXA 1DYUA 1UW1A 2ZDJA 3FKAA 1IQYA 3N9HA 5EQLA 1OF5A 3T0UA 4HM4B 1VQK3 4K61A 2HMNB 1A67A 1JBSA 4HBRA 3GZRA 3LZAA 5AYSC 2K0MA 1RJOA 2UGIA 1FUTA 4FMBA 4XBTA 3WODG 5IG3A 1TUHA 2HMKB 1G02A 1GMQA 2XEPA 3Q90A 3RDEA 1MGRA 2KCDA 1BU4A 3DGOA 3IJEB 5LC7A 4EXRA 1TU5A 4CDLA 2P0XA 1MNLA 2STDA 5ELUA 2OQEA 3NV0B 5TGNA 6STDA 3B4OA 3DGYA 5G1KA 1C54A 1W02A 4FCJA 4LSOA 1A2VA 3LT9A 3JUNA 2CW9A 1E97A 2AAEA 2UUGC 1ISKA 1IVXA 2JDIH 3LXUX 1JV2B 5M18A 3LYGA 1GY5A 1FYSA 2RBIA 1OH0A 2YX9A 4ZM8A 1KD14 4GB5A 2XFSA 3N54B 7STDA 1W2ZA 1GS3A 1QAKA 2F99A 2IA7A 1E3VA 6GSPA 1NB5I 3FLJA 1SPUA 3S28A 4AKYA 3D5IA 5A0OB 1AVKA 2WO0A 1L5GB 2Z77A 2ZL8A 1Q824 5GSPA 3IMAB 2J8XB 3NV0A 3SEDA 5IEPA 3X42A 1JBTA 1VQ93 4ORLA 5RNTA 4RNYA 3DM8A 4IPBA 1EUIC 1FGQA 1OUNA 1GY6A 1YGEA 2E2UA 3MSOA 4EC6A 1MWRA 3KIIA 1VQ43 1CH0A 2RCDA 1EA2A 1TFOA 3F9SA 1UGHI 4FMCA 4EYCA 1KSIA 1RGCA 5M19A 1SJWA 8RNTA 1RLSA 2GBXB 2E2TA 1K28A 4KFEA 5HGRA 2P09A 2Z76A 2GBWB 1QVG2 2HMMB 3M8CA 3NX0A 3SVAA 1DE3A 1EQKA 3NQZA 2WGOA 3DXOA 3EB8A 1BSBA 1BUQA 1I2FA 3SYUA 1MWUA 3D5GA 5AIHA 3CNMA 1N8QA 3K63A 3EC9A 4X2HA 3LTDA 3EBYA 1JKGB 1GMRA 3GRDA 4WWUC 3KCHA 3EJVA 2IUJA 1OCVA 3ECFA 1Q40B 1QVF2 1IYYA 3S27A 4Q53A 5IG4A 5JBSA 5I97A 2SARA 2XSHB 1FUSA 1RCKA 1RN1A 1IVUA 3ROBA 2XFTA 4I5QA 3K0ZA 2L1SA 5AIIA 3F40A 2GEXA 1VQO3 1VQQA 1D6YA 1LOXA 3KKGA 1K9M4 1GSPA 2ZA4A 2LQVA 2KRTA 3ZG5A 5IEOA 1GOYA 1G96A 4FMAA 4LYLB 1PU4A 1RGHA 3MHEA 2BHMA 3AHWA 1BSEA 2CG0A 1FGTA 3EN1B 3S29A 5STDA 1FGMA 5AIGA 3SOAA 3MYTA 3BNDA 1ULJB 1UI8A 2AADA 4HM1B 5BIRA 1Q7Y4 4EW5A 1BVIA 1Z1SA 4HM5B 1RDSA 5AI1A 2MF7A 3VGNA 2GU1A 3DUKA 3FF0A 1JKGA 1LNIA 3UL5A 2OQEC 6RNTA 1Q40A 3Q2PA 3CC43 2IUKA 4GHOA 2RFRA 1CEWI 3SOYA 1N5PA 3BIRA 3NM2A 3TDGA 4CCVA 3AGNA 4RZMA 2A15A 4FR9A 4BIRA 2R41A 3FCSB 5BVBA 1GMPA 4U13A 4AKZA 5D82A 5EVHA 1MWSA 1OPYA 2YFLB 3AHSA 3PS8A 4K90B 3I563 3QK9A 2O9UX 3ALAA 3EE1A 1IT8A 1T3BA 4HOHA 1QMAA 1VQ83 2KF6A 4N6MA 3SLUA 3CMA3 2W6JH 4RBNA 1UUGB 1IT7A 1UDII 4KZ1A 1YJ93 1NJI4 4EV5A 4KVHA 1ZGXA 4WFOA 9RNTA 4H61A 4R1KA 1AY7A 1BNRA 1JB2A 1I70A 1RKYA 5G1LA 5IF6A 3F7SA 2BO9B 3BB9A 3CU3A 3OX9A 3A5EA 1B2XA 1M9GA 3FH1A 4EV2A 1B3SA 5JPUA 5BU4A 4IT7A 5CK6A 1BSDA 3NQYA 3EBTA 1Q42A 1BNJA 3FG4A 3HOHA 2L4VA 5JPPA 5IW9A 1YNVX 4N6V0 1WNHA 2KXGA 3EX9A 1RN7A 2CK3H 1TRPA 3EF8A 3KFQC 2HOHA 2GSPA 4MMZB 4HVNA 2CFDA 1HKXA 2Z7AA 3G0KA 1EEJA 1ZS7A 3DGMA 1W00A 3LTBA 4HZ9B 1GD3A 5G2GA 4H3UA 1JNQA 1OGZA 1UCLA 1KQS2 4LZIA 1LVNA 2K3DA 1O7MB 3BLZA 1J2BA 3AMOB 5CF2A 1HYFA 3OWYA 4J5GA 1JRQA 3CC73 2CHCA 2W9PA 1FW7A 1KWIA 2FNQA 2XGLA 2QIYA 1O7PB 2CIUA 3OV4A 3FF2A 3X3ZA 3CCJ3 4QWTA 1R4YA 1RGGA 2SBLA 4LMIA 3ZFZA 4MEIA 3FSDA 3K7CA 1SIHA 2M7OA 2F56A 3T8NA 1JB4A 1B2ZA 1RCLA 1WTHA 1R4CA 2BMRB 3HK4A 3HX8A 3WMDA 3G6E3 1JJ22 3NBJA 2XRXB 8CHOA 1US1A 1BRIA 1D6UA 1A2PA 1YJN3 1BNEA 1Q864 3PZWA 1VQP3 4MJDA 3F14A 3L0RA 3CXC2 1BRGA 4XDVA 1M904 3JUMA 2W04A 1Q814 3DH2A 1KC84 3UL6A 1JZDA 1GD4A 1UCIA 4G1MB 3AMOA 3EN8A 5FGOA 4O3VA 5IG0A 1GOUA 3DZLA 3QRDA 1IV9A 2RGQA 3EQQB 3MPHA 1LOVA 1LNHA 1U5OA 4X2OA 1RTUA 1YGWA 2Y73A 3SXXA 3GZYB 4L8OA 1O7HB 1PFPA 1AR0A 2W03A 3OWSA 2KF5A 5CF1A 1DETA 2YFIB 3DMCA 2ZHXB 3NBBA 4HM7B 4STDA 3URPA 1QALA 3CPW2 4MMXB 1BNIA 3KE7A 1FA3A 3KSPA 4NREA 3V99A 2CX1A 3X3YA 2XH9A 2CKFB 3AGOA 3FG3A 3PYJA 4RNTA 3FZWA 2INXA 1YJW3 1BRSA 5IG5A 3KN4A 1SQWA 1BNFA 2WGQA 4K1VA 4KFDA 4N6OB 4MMYB 4R9KA 5AYRB 3WOEB 4EBGA 3LTAA 2BMOB 1TRQA 3X41A 1T5YA 2F4YA 1T2IA 2CX0A 1TIJA 1UCJA 1ZO2A 4R80A 1B21A 4IIAA 1S723 1W6YA 5AIFA 1UGIA 1BGSA 3PGBA 1OHOA 1RGKA 3I0YA 1AV4A 1BAOA 4N3VA 1TTOA 3K9MC 5D81A 3RGRA 1DVDA 2GEYA 1DMMA 1G0TA 1STDA 1PYLA 3D79A 3X3XA 1RGEA 3PCRA 1CYVA 3MKIA 1NO3A 3S5CA 1UUVB 1I8VA 3I553 1VZZA 1FGRA 1YIJ3 5FW5A 2IYJA 3B7CA 5IERA 3HIIA 3VF1A 1IV7A 1EKMA 1MOLA 2KF3A 1LQMB 3T8UA 1BNSA 3CCM3 1F8NA 4JF8A 1O7WB 3Q1CA 3A76A 4ILFA 4BU4A 2P05A 1IQ8A 3NM7A 1RHLA 3JUQA 1K8A4 1GOVA 1FZUA 4LGQA 2D1WA 1ULIB 1X1YA 1SARA 3HZPA 1M1K4 5CXOA 2LYXA 2CFKA 1TP6A 3D9RA 3UB1A 1GYBA 4O02B 5KP1A 2OOVA 4J5KA 1JB5A 2P0MA 3EHCA 4KT3B 2YFJB 3BNCA 1YIT3 1IVVA 2KF4A 1RNBA 3MG1A 1BUJA 1UUWB 3G4S3 1AVLA 2OCTA 2W56B 3OWUA 3CCL3 1BNGA 1LOYA 1DVCA 1NWWA 2Z6BA 3UJMA 1NNVA 2BT3A 2CWTA 4WP5A 2D42A 2CC3A 1U8CB 1LOWA 3DGNA 4I4KA 1TFKA 1BOXA 3MWZA 4WHAA 4BTWA 2IY2A 1IU7A 1W01A 2WOHA 3DGLA 3CCE3 1OACA 1IDPA 2RSXA 2F98A 3LH4A 3CD63 3WHOA 1E3RA 2K54A 3PXMA 1RGFA 4J9AA 4R9LA 2QA43 3F8XA 2QEX3 1M1XB 4NPBA 3G16A 2CH9A 1EG9B 1C7HA 2HMLB 1AQZA 3MG3A 5M1AA 3WOFB 3U1WA 3WA3A 4WYKB 3CCV3 1X1XA 3RGAA 3CC23 1BANA 1PY3A 4OUQA 3NBRA 1Y4KA 3DY5A 2W56A 1N9JA 1Q7HA 3JVCA 1X1WA 1W2B2 1HU9A 1OHPA 3WDGB 3GSPA 1S5AA 5IENA 2OTL3 4FCZA 1D6ZA 3GZXB 3FGYA 1I0VA 1O7GB 2PNCA 4HKVB 2Q07A 4FCMA 3HIGA 7RNTA 5CLKA 1OGXA 4BTXA 1B2MA 1FGOA 1HZ1A 1LQGC 3N8BA 3BNBA 4R4KA 5LC6A 3G8ZA 1O7NB 4WYKA 4CJNA 7GSPA 1GY7A 2CFGA 1MWTA 2F5MA 2IMJA 2FGTA 4XBYA 3OW22 1VQ73 3H51A 2V1LA 1WMNA 3D3LA 5D83A 1V58A 3CNXA 1UI7A 2Y74A 3X40A 4XM4A 4BL2A 2HMOB 4KFFA 1BRJA 2P38A 5BXQA 3S67A 1RGLA 1BSCA 5DRVA 2BIRA 3ZG0A 3KZTA 4HJLB 3BU4A 1N8R4 4N6NB 1BRNL 3B8LA 4BTYA 2OTJ3 1BSAA 1NU3A 2C10A 1YVSA 1W6CA 4L8PA 2I9WA 1VQ53 2R4IA 4DKIA 4FMDA 1LXEA 1I0XA 1FUWA 1ROAA 2W9QA 2B24B 3STDA 2WOFA 2OOVC 1RRLA 2F5WA 2H0HA 4HZBB 4CPKA 4OK0A 3RNTA 4HM6B 2CG1A 3H3HA 1BRKA 2CFLA 1T2HA 3CCS3 2UX0A 1UCKA 1W5ZA 1X1UA 1I3IA 1RNTA 1N5HA 2BU4A 3NXJA 3ER7A 2XGNA 5HOHA 1BRHA 3B4PA 1W7CA 4NHFA 1Q9EA 1SIIA 1ZX2A 1DMNA 2CWVA 1BIRA 3G713 1NB3I 4J8TA 4N6LA 1WMPA 2GXFA 1ASKA 3OXAA 3Q3FA 3IPTA 1V57A 2KAAA 3GWRA 1STFI 3JUOA 2XF3A 3NUVA 1A2KA 4K1UA 3GZBA 4GL6A 4N6TA 5KP4A 2H0GA 4HAAA 1YHQ3 5ELJA 1I3FA 1JZOA 3E99A 2BMQB 2GU3A 3F8HA 2E2VA 3O8YA 4RNZA 5AEUB 1W6GA 1QJGA 1QAFA 1RN4A 2OWPA 1OHSA 2XSOB 4O2HA 3U97A 3MG2A 4HM0B 1W4NA 3FG1A 1IVWA 3D4AA 1YI23 1K41A 3WA2X 3K5TA 1VQ63 1B2SA 4OVMA 1B27A 4XB5A 1B2UA 2CWUA 3CCR3 1WQLB 4GSPA 1K734 1VQN3 1A90A 2HMJB 3PCSA 2BNGA 4L7KA 1RRHA 3CPOA 3NHXA 3BNEA 3V98A 2B1XB 1N9EA 1V74A 3WR2A 4TX4A 5AEWB 2PZVA 3CME3 3HI7A 1VQM3 4N6UA 1JN5B 3V92A 1IK3A 2ML5A 1NDOB 1ROVA 4O8SA 4HM3B 5DREA 1OF5B 2QGUA 3LT8A 2F86B 3LOYA 4LEHA 4XDWA 2W0QA 1WMOA 2CFWA 3LMLA 1I2GA 2C11A 1MGWA 3LTCA 1B20A 4XBXA 2ML6A 3KSED 4JRFA 1DMQA 3SX1A 2W2CA 2FXTA 1CQSA 5EEOA 2C4BA 4HYZA 3UNLA 4PEJA 3CCU3 2H0IA 1RMSA 1TJDA 2O3OA 3JUPA 1YVBI 1LRAA 3GAXA 2MC8A
chains in the Genus database with same CATH topology
4AEQA 1VQL3 2XR8B 5KP3A 4HM8B 1CYUA 2JQ5A 1JN5A 4HM2B 3CCQ3 3J7Yd 3F7XA 3VSYA 1IQXA 1DYUA 1UW1A 2ZDJA 3FKAA 1IQYA 3N9HA 5EQLA 1OF5A 3T0UA 4HM4B 1VQK3 4K61A 2HMNB 1A67A 4HBRA 3GZRA 3LZAA 5AYSC 2K0MA 1RJOA 4FMBA 4XBTA 3WODG 5IG3A 1TUHA 2HMKB 2XEPA 3Q90A 3RDEA 2KCDA 3DGOA 3IJEB 5LC7A 4EXRA 1TU5A 4CDLA 2P0XA 1MNLA 2STDA 5ELUA 2OQEA 3NV0B 5TGNA 6STDA 3B4OA 1W02A 4FCJA 4LSOA 1A2VA 3LT9A 3JUNA 2CW9A 1E97A 1ISKA 1IVXA 2JDIH 3LXUX 1JV2B 3LYGA 1GY5A 1OH0A 2YX9A 4ZM8A 1KD14 4GB5A 2XFSA 3N54B 1W2ZA 1GS3A 1QAKA 2F99A 2IA7A 1E3VA 3FLJA 1SPUA 3S28A 4AKYA 5A0OB 1AVKA 2WO0A 1L5GB 2Z77A 2ZL8A 1Q824 3IMAB 3NV0A 3SEDA 5IEPA 3X42A 1VQ93 4ORLA 4RNYA 3DM8A 4IPBA 1FGQA 1OUNA 1GY6A 1YGEA 2E2UA 3MSOA 4EC6A 1VQ43 3KIIA 2RCDA 1EA2A 1TFOA 3F9SA 4FMCA 4EYCA 1KSIA 1SJWA 2GBXB 2E2TA 1K28A 4KFEA 5HGRA 2P09A 2Z76A 2GBWB 1QVG2 2HMMB 3M8CA 3NX0A 3SVAA 1EQKA 3NQZA 2WGOA 3DXOA 3EB8A 1BUQA 5AIHA 3CNMA 1N8QA 3K63A 3EC9A 4X2HA 3LTDA 3EBYA 1JKGB 3GRDA 4WWUC 3EJVA 2IUJA 1OCVA 3ECFA 1Q40B 1QVF2 3S27A 4Q53A 5IG4A 5JBSA 5I97A 2XSHB 1IVUA 3ROBA 2XFTA 3K0ZA 5AIIA 3F40A 2GEXA 1VQO3 1D6YA 1LOXA 3KKGA 1K9M4 2LQVA 2KRTA 5IEOA 1G96A 4FMAA 1PU4A 7STDA 3MHEA 2BHMA 3WA2X 2CG0A 1FGTA 3EN1B 3S29A 5STDA 1FGMA 5AIGA 3SOAA 3MYTA 3BNDA 1ULJB 1UI8A 4HM1B 1Q7Y4 1Z1SA 4HM5B 5AI1A 3VGNA 2MF7A 2GU1A 3DUKA 3FF0A 1JKGA 3UL5A 2OQEC 1Q40A 3Q2PA 3CC43 2IUKA 2RFRA 1CEWI 3SOYA 1N5PA 3NM2A 3TDGA 4CCVA 4RZMA 2A15A 4FR9A 3FCSB 5BVBA 4U13A 4AKZA 5D82A 5EVHA 1OPYA 2YFLB 3PS8A 4K90B 3I563 3QK9A 2O9UX 3ALAA 3EE1A 1IT8A 1VQ83 1QMAA 3CMA3 4N6MA 3SLUA 2W6JH 4RBNA 1IT7A 4KZ1A 1YJ93 1NJI4 4EV5A 4KVHA 4WFOA 4H61A 4R1KA 1JB2A 1RKYA 5IF6A 3F7SA 2BO9B 3BB9A 3CU3A 3OX9A 1M9GA 3FH1A 4EV2A 5JPUA 4IT7A 5CK6A 3NQYA 3EBTA 1Q42A 3FG4A 2L4VA 5JPPA 5IW9A 4N6V0 1WNHA 2KXGA 3EX9A 1RN7A 2CK3H 3EF8A 3KFQC 4MMZB 4HVNA 2CFDA 1HKXA 2Z7AA 3G0KA 3LTBA 3DGMA 4HZ9B 1W00A 1GD3A 5G2GA 4H3UA 1JNQA 1OGZA 1KQS2 4LZIA 1LVNA 3BLZA 1O7MB 1J2BA 3AMOB 5CF2A 3OWYA 1JRQA 3CC73 2CHCA 2W9PA 1KWIA 2FNQA 2XGLA 2QIYA 1O7PB 2CIUA 3OV4A 3FF2A 3X3ZA 3CCJ3 4QWTA 2SBLA 4LMIA 4MEIA 3FSDA 3K7CA 1SIHA 2M7OA 3T8NA 1JB4A 1WTHA 2BMRB 3HX8A 1R4CA 3WMDA 3HK4A 2QA43 3G6E3 1JJ22 3NBJA 2XRXB 8CHOA 1US1A 1D6UA 1YJN3 1Q864 1NB5I 3PZWA 1VQP3 4MJDA 3F14A 3L0RA 3CXC2 4XDVA 1M904 3JUMA 2W04A 1Q814 1KC84 3UL6A 1GD4A 4G1MB 3AMOA 3EN8A 5FGOA 4O3VA 5IG0A 3DZLA 3QRDA 1IV9A 2RGQA 3EQQB 3MPHA 1LNHA 1U5OA 4X2OA 2Y73A 3SXXA 3GZYB 4L8OA 1O7HB 1PFPA 1AR0A 2W03A 3OWSA 5CF1A 3CPW2 2YFIB 3DMCA 4STDA 3NBBA 4HM7B 1QALA 4MMXB 3KE7A 1FA3A 3KSPA 4NREA 3V99A 3X3YA 2XH9A 2CKFB 3FG3A 3PYJA 3FZWA 2INXA 1YJW3 5IG5A 3KN4A 1SQWA 2WGQA 4K1VA 4KFDA 4N6OB 4R9KA 4MMYB 5AYRB 3WOEB 4EBGA 3LTAA 2BMOB 3X41A 1T5YA 1TIJA 1ZO2A 4R80A 4IIAA 1S723 1W6YA 5AIFA 3PGBA 1OHOA 3I0YA 1AV4A 4N3VA 3K9MC 5D81A 3RGRA 1DVDA 2GEYA 1DMMA 1STDA 3X3XA 3PCRA 1CYVA 3MKIA 1NO3A 3S5CA 1UUVB 3I553 1VZZA 1FGRA 1YIJ3 5FW5A 3B7CA 5IERA 3HIIA 3VF1A 1IV7A 1EKMA 1MOLA 3T8UA 3CCM3 1F8NA 4JF8A 1O7WB 3Q1CA 3A76A 2P05A 1IQ8A 3NM7A 3JUQA 1K8A4 4LGQA 2D1WA 1ULIB 3HZPA 1M1K4 5CXOA 2LYXA 2CFKA 1TP6A 3D9RA 3UB1A 1GYBA 4O02B 5KP1A 2OOVA 1JB5A 2P0MA 3EHCA 2YFJB 3BNCA 1YIT3 1IVVA 3MG1A 1UUWB 3G4S3 1AVLA 2OCTA 2W56B 3OWUA 3CCL3 1NWWA 1DVCA 2Z6BA 3UJMA 2BT3A 2CWTA 4WP5A 2D42A 2CC3A 1U8CB 3DGNA 4I4KA 1TFKA 3MWZA 4WHAA 4BTWA 1IU7A 1W01A 2WOHA 3DGLA 3CCE3 1OACA 1IDPA 2RSXA 2F98A 3LH4A 3CD63 1E3RA 2K54A 3PXMA 4J9AA 4R9LA 3F8XA 2QEX3 1M1XB 3G16A 2CH9A 1EG9B 1C7HA 2HMLB 3MG3A 3WOFB 3U1WA 3WA3A 4WYKB 3CCV3 3RGAA 3CC23 4OUQA 3NBRA 1Y4KA 3DY5A 2W56A 1N9JA 3JVCA 1W2B2 1HU9A 1OHPA 3WDGB 1S5AA 5IENA 2OTL3 4FCZA 1D6ZA 3GZXB 3FGYA 1O7GB 2PNCA 4HKVB 2Q07A 4FCMA 3HIGA 5CLKA 1OGXA 4BTXA 1FGOA 3N8BA 5LC6A 4R4KA 3BNBA 3G8ZA 1O7NB 4WYKA 1GY7A 2CFGA 2IMJA 2FGTA 4XBYA 3OW22 1VQ73 3H51A 2V1LA 1WMNA 3D3LA 5D83A 3CNXA 1UI7A 2Y74A 3X40A 4XM4A 2HMOB 4KFFA 2P38A 5BXQA 3S67A 5DRVA 3KZTA 4HJLB 1N8R4 4N6NB 3B8LA 4BTYA 2OTJ3 1NU3A 2C10A 1W6CA 4L8PA 2I9WA 1VQ53 2R4IA 4FMDA 1LXEA 1FUWA 1ROAA 2W9QA 2B24B 3STDA 2WOFA 2OOVC 1RRLA 4HZBB 4OK0A 4HM6B 2CG1A 3H3HA 2CFLA 3CCS3 2UX0A 1W5ZA 1N5HA 3NXJA 3ER7A 2XGNA 3B4PA 1W7CA 4NHFA 1SIIA 1ZX2A 1DMNA 2CWVA 3G713 1NB3I 4J8TA 4N6LA 1WMPA 2GXFA 1ASKA 3OXAA 3IPTA 3GWRA 3JUOA 1STFI 2XF3A 3NUVA 1A2KA 4K1UA 3GZBA 4GL6A 4N6TA 5KP4A 1YHQ3 5ELJA 3E99A 2BMQB 2GU3A 3F8HA 2E2VA 3O8YA 4RNZA 5AEUB 1W6GA 1QJGA 1QAFA 2OWPA 2XSOB 1OHSA 4O2HA 3U97A 3MG2A 4HM0B 1W4NA 3FG1A 1IVWA 1YI23 1K41A 3K5TA 1VQ63 4OVMA 4XB5A 3CCR3 2CWUA 1K734 1WQLB 1VQN3 1A90A 2HMJB 3PCSA 2BNGA 4L7KA 1RRHA 3CPOA 3NHXA 3BNEA 3V98A 2B1XB 1N9EA 1V74A 4TX4A 5AEWB 2PZVA 3CME3 3HI7A 1VQM3 4N6UA 1JN5B 3V92A 1IK3A 2ML5A 1NDOB 1ROVA 4O8SA 4HM3B 5DREA 1OF5B 2QGUA 3LT8A 2F86B 3LOYA 4LEHA 4XDWA 2W0QA 1WMOA 2CFWA 3LMLA 2C11A 3LTCA 4XBXA 2ML6A 3KSED 4JRFA 1DMQA 3SX1A 2W2CA 2FXTA 1CQSA 5EEOA 4HYZA 3UNLA 4PEJA 3CCU3 2O3OA 3JUPA 1YVBI 3GAXA 2MC8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XR8 B;  5KP3 A;  4HM8 B;  2JQ5 A;  1JN5 A;  4HM2 B;  3F7X A;  3VSY A;  3FKA A;  1OF5 A;  4HM4 B;  2HMN B;  3GZR A;  3LZA A;  4XBT A;  5IG3 A;  1TUH A;  2HMK B;  3Q90 A;  4CDL A;  2STD A;  3NV0 B;  5TGN A;  6STD A;  3B4O A;  1W02 A;  4FCJ A;  3JUN A;  1E97 A;  1ISK A;  3LYG A;  1GY5 A;  1OH0 A;  4GB5 A;  1GS3 A;  2F99 A;  1E3V A;  3FLJ A;  2Z77 A;  3NV0 A;  3SED A;  5IEP A;  4ORL A;  3DM8 A;  1OUN A;  1GY6 A;  3MSO A;  2RCD A;  1EA2 A;  3F9S A;  1SJW A;  2GBX B;  5HGR A;  2Z76 A;  2GBW B;  2HMM B;  3M8C A;  3DXO A;  1BUQ A;  5AIH A;  3CNM A;  3EC9 A;  4X2H A;  3EBY A;  1JKG B;  3GRD A;  4WWU C;  3EJV A;  1OCV A;  3ECF A;  1Q40 B;  4Q53 A;  5IG4 A;  2XSH B;  3ROB A;  3K0Z A;  5AII A;  3F40 A;  2GEX A;  3KKG A;  5IEO A;  7STD A;  3MHE A;  3SOA A;  3EN1 B;  5STD A;  5AIG A;  3MYT A;  1ULJ B;  4HM1 B;  1Z1S A;  4HM5 B;  5AI1 A;  3VGN A;  3DUK A;  3FF0 A;  1JKG A;  1Q40 A;  2RFR A;  3SOY A;  3NM2 A;  4RZM A;  2A15 A;  5BVB A;  4U13 A;  5D82 A;  5EVH A;  1OPY A;  2YFL B;  1QMA A;  4KVH A;  4R1K A;  1JB2 A;  5IF6 A;  3F7S A;  3BB9 A;  3CU3 A;  3OX9 A;  3FH1 A;  5JPU A;  5CK6 A;  3EBT A;  1Q42 A;  5JPP A;  3EX9 A;  3EF8 A;  4HVN A;  1HKX A;  2Z7A A;  3G0K A;  4HZ9 B;  1W00 A;  5G2G A;  4H3U A;  1OGZ A;  3BLZ A;  1O7M B;  5CF2 A;  3OWY A;  2CHC A;  2QIY A;  1O7P B;  3OV4 A;  3FF2 A;  4LMI A;  3FSD A;  3K7C A;  3T8N A;  1JB4 A;  3WMD A;  2BMR B;  3HX8 A;  3HK4 A;  8CHO A;  2XRX B;  4MJD A;  3F14 A;  4XDV A;  3JUM A;  3EN8 A;  5IG0 A;  3DZL A;  3EQQ B;  2RGQ A;  1U5O A;  4X2O A;  3GZY B;  4L8O A;  1O7H B;  3OWS A;  1AR0 A;  5CF1 A;  2YFI B;  3DMC A;  4STD A;  4HM7 B;  3KE7 A;  3KSP A;  2CKF B;  3FZW A;  2INX A;  5IG5 A;  4K1V A;  4R9K A;  2BMO B;  1ZO2 A;  4IIA A;  1W6Y A;  5AIF A;  1OHO A;  3I0Y A;  4N3V A;  5D81 A;  3RGR A;  2GEY A;  1DMM A;  1STD A;  3MKI A;  3S5C A;  1UUV B;  1VZZ A;  5FW5 A;  3B7C A;  5IER A;  3T8U A;  1O7W B;  3A76 A;  3JUQ A;  4LGQ A;  1ULI B;  3HZP A;  5CXO A;  3D9R A;  1TP6 A;  1GYB A;  5KP1 A;  1JB5 A;  3EHC A;  2YFJ B;  3MG1 A;  1UUW B;  3OWU A;  1NWW A;  3UJM A;  4WP5 A;  4I4K A;  1W01 A;  1IDP A;  2F98 A;  1E3R A;  2K54 A;  4J9A A;  4R9L A;  3F8X A;  3G16 A;  1EG9 B;  1C7H A;  2HML B;  3MG3 A;  4WYK B;  3RGA A;  4OUQ A;  3NBR A;  1OHP A;  1S5A A;  5IEN A;  3GZX B;  3FGY A;  1O7G B;  4HKV B;  4FCM A;  5CLK A;  1OGX A;  3G8Z A;  1O7N B;  4WYK A;  1GY7 A;  2IMJ A;  4XBY A;  3H51 A;  5D83 A;  3CNX A;  4XM4 A;  2HMO B;  5BXQ A;  5DRV A;  3KZT A;  4HJL B;  3B8L A;  1NU3 A;  4L8P A;  2I9W A;  2R4I A;  2B24 B;  3STD A;  4HZB B;  4HM6 B;  3H3H A;  2UX0 A;  3NXJ A;  3ER7 A;  3B4P A;  1ZX2 A;  1DMN A;  4J8T A;  2GXF A;  1ASK A;  3OXA A;  3IPT A;  3GWR A;  3JUO A;  3NUV A;  1A2K A;  4K1U A;  3GZB A;  5KP4 A;  3E99 A;  2BMQ B;  3F8H A;  5AEU B;  1QJG A;  2XSO B;  2OWP A;  1OHS A;  3MG2 A;  4HM0 B;  1K41 A;  4OVM A;  4XB5 A;  1WQL B;  2HMJ B;  2BNG A;  4L7K A;  3CPO A;  2B1X B;  5AEW B;  2PZV A;  1JN5 B;  1NDO B;  5DRE A;  4HM3 B;  1OF5 B;  2QGU A;  2F86 B;  4LEH A;  4XDW A;  4XBX A;  1DMQ A;  2W2C A;  1CQS A;  3UNL A;  4PEJ A;  3JUP A;  3NHX A; 
#chains in the Genus database with same CATH topology
 4AEQ A;  1VQL 3;  2XR8 B;  4BL3 A;  1JBR A;  5KP3 A;  4HM8 B;  1CYU A;  2JQ5 A;  1JN5 A;  1RSN A;  4HM2 B;  3CCQ 3;  1I2E A;  1RGA A;  3F7X A;  3J7Y d;  2RNT A;  3VSY A;  1IQX A;  1DYU A;  1UW1 A;  2ZDJ A;  3FKA A;  1IQY A;  3N9H A;  5EQL A;  1OF5 A;  3T0U A;  4HM4 B;  1VQK 3;  4K61 A;  2HMN B;  1A67 A;  1JBS A;  4HBR A;  3GZR A;  3LZA A;  5AYS C;  2K0M A;  1RJO A;  2UGI A;  1FUT A;  4FMB A;  4XBT A;  3WOD G;  5IG3 A;  1TUH A;  2HMK B;  1G02 A;  1GMQ A;  2XEP A;  3Q90 A;  3RDE A;  1MGR A;  2KCD A;  1BU4 A;  3DGO A;  3IJE B;  5LC7 A;  4EXR A;  1TU5 A;  4CDL A;  2P0X A;  1MNL A;  2STD A;  5ELU A;  2OQE A;  3NV0 B;  5TGN A;  6STD A;  3B4O A;  3DGY A;  5G1K A;  1C54 A;  1W02 A;  4FCJ A;  4LSO A;  1A2V A;  3LT9 A;  3JUN A;  2CW9 A;  1E97 A;  2AAE A;  2UUG C;  1ISK A;  1IVX A;  2JDI H;  3LXU X;  1JV2 B;  5M18 A;  3LYG A;  1GY5 A;  1FYS A;  2RBI A;  1OH0 A;  2YX9 A;  4ZM8 A;  1KD1 4;  4GB5 A;  2XFS A;  3N54 B;  7STD A;  1W2Z A;  1GS3 A;  1QAK A;  2F99 A;  2IA7 A;  1E3V A;  6GSP A;  1NB5 I;  3FLJ A;  1SPU A;  3S28 A;  4AKY A;  3D5I A;  5A0O B;  1AVK A;  2WO0 A;  1L5G B;  2Z77 A;  2ZL8 A;  1Q82 4;  5GSP A;  3IMA B;  2J8X B;  3NV0 A;  3SED A;  5IEP A;  3X42 A;  1JBT A;  1VQ9 3;  4ORL A;  5RNT A;  4RNY A;  3DM8 A;  4IPB A;  1EUI C;  1FGQ A;  1OUN A;  1GY6 A;  1YGE A;  2E2U A;  3MSO A;  4EC6 A;  1MWR A;  3KII A;  1VQ4 3;  1CH0 A;  2RCD A;  1EA2 A;  1TFO A;  3F9S A;  1UGH I;  4FMC A;  4EYC A;  1KSI A;  1RGC A;  5M19 A;  1SJW A;  8RNT A;  1RLS A;  2GBX B;  2E2T A;  1K28 A;  4KFE A;  5HGR A;  2P09 A;  2Z76 A;  2GBW B;  1QVG 2;  2HMM B;  3M8C A;  3NX0 A;  3SVA A;  1DE3 A;  1EQK A;  3NQZ A;  2WGO A;  3DXO A;  3EB8 A;  1BSB A;  1BUQ A;  1I2F A;  3SYU A;  1MWU A;  3D5G A;  5AIH A;  3CNM A;  1N8Q A;  3K63 A;  3EC9 A;  4X2H A;  3LTD A;  3EBY A;  1JKG B;  1GMR A;  3GRD A;  4WWU C;  3KCH A;  3EJV A;  2IUJ A;  1OCV A;  3ECF A;  1Q40 B;  1QVF 2;  1IYY A;  3S27 A;  4Q53 A;  5IG4 A;  5JBS A;  5I97 A;  2SAR A;  2XSH B;  1FUS A;  1RCK A;  1RN1 A;  1IVU A;  3ROB A;  2XFT A;  4I5Q A;  3K0Z A;  2L1S A;  5AII A;  3F40 A;  2GEX A;  1VQO 3;  1VQQ A;  1D6Y A;  1LOX A;  3KKG A;  1K9M 4;  1GSP A;  2ZA4 A;  2LQV A;  2KRT A;  3ZG5 A;  5IEO A;  1GOY A;  1G96 A;  4FMA A;  4LYL B;  1PU4 A;  1RGH A;  3MHE A;  2BHM A;  3AHW A;  1BSE A;  2CG0 A;  1FGT A;  3EN1 B;  3S29 A;  5STD A;  1FGM A;  5AIG A;  3SOA A;  3MYT A;  3BND A;  1ULJ B;  1UI8 A;  2AAD A;  4HM1 B;  5BIR A;  1Q7Y 4;  4EW5 A;  1BVI A;  1Z1S A;  4HM5 B;  1RDS A;  5AI1 A;  2MF7 A;  3VGN A;  2GU1 A;  3DUK A;  3FF0 A;  1JKG A;  1LNI A;  3UL5 A;  2OQE C;  6RNT A;  1Q40 A;  3Q2P A;  3CC4 3;  2IUK A;  4GHO A;  2RFR A;  1CEW I;  3SOY A;  1N5P A;  3BIR A;  3NM2 A;  3TDG A;  4CCV A;  3AGN A;  4RZM A;  2A15 A;  4FR9 A;  4BIR A;  2R41 A;  3FCS B;  5BVB A;  1GMP A;  4U13 A;  4AKZ A;  5D82 A;  5EVH A;  1MWS A;  1OPY A;  2YFL B;  3AHS A;  3PS8 A;  4K90 B;  3I56 3;  3QK9 A;  2O9U X;  3ALA A;  3EE1 A;  1IT8 A;  1T3B A;  4HOH A;  1QMA A;  1VQ8 3;  2KF6 A;  4N6M A;  3SLU A;  3CMA 3;  2W6J H;  4RBN A;  1UUG B;  1IT7 A;  1UDI I;  4KZ1 A;  1YJ9 3;  1NJI 4;  4EV5 A;  4KVH A;  1ZGX A;  4WFO A;  9RNT A;  4H61 A;  4R1K A;  1AY7 A;  1BNR A;  1JB2 A;  1I70 A;  1RKY A;  5G1L A;  5IF6 A;  3F7S A;  2BO9 B;  3BB9 A;  3CU3 A;  3OX9 A;  3A5E A;  1B2X A;  1M9G A;  3FH1 A;  4EV2 A;  1B3S A;  5JPU A;  5BU4 A;  4IT7 A;  5CK6 A;  1BSD A;  3NQY A;  3EBT A;  1Q42 A;  1BNJ A;  3FG4 A;  3HOH A;  2L4V A;  5JPP A;  5IW9 A;  1YNV X;  4N6V 0;  1WNH A;  2KXG A;  3EX9 A;  1RN7 A;  2CK3 H;  1TRP A;  3EF8 A;  3KFQ C;  2HOH A;  2GSP A;  4MMZ B;  4HVN A;  2CFD A;  1HKX A;  2Z7A A;  3G0K A;  1EEJ A;  1ZS7 A;  3DGM A;  1W00 A;  3LTB A;  4HZ9 B;  1GD3 A;  5G2G A;  4H3U A;  1JNQ A;  1OGZ A;  1UCL A;  1KQS 2;  4LZI A;  1LVN A;  2K3D A;  1O7M B;  3BLZ A;  1J2B A;  3AMO B;  5CF2 A;  1HYF A;  3OWY A;  4J5G A;  1JRQ A;  3CC7 3;  2CHC A;  2W9P A;  1FW7 A;  1KWI A;  2FNQ A;  2XGL A;  2QIY A;  1O7P B;  2CIU A;  3OV4 A;  3FF2 A;  3X3Z A;  3CCJ 3;  4QWT A;  1R4Y A;  1RGG A;  2SBL A;  4LMI A;  3ZFZ A;  4MEI A;  3FSD A;  3K7C A;  1SIH A;  2M7O A;  2F56 A;  3T8N A;  1JB4 A;  1B2Z A;  1RCL A;  1WTH A;  1R4C A;  2BMR B;  3HK4 A;  3HX8 A;  3WMD A;  3G6E 3;  1JJ2 2;  3NBJ A;  2XRX B;  8CHO A;  1US1 A;  1BRI A;  1D6U A;  1A2P A;  1YJN 3;  1BNE A;  1Q86 4;  3PZW A;  1VQP 3;  4MJD A;  3F14 A;  3L0R A;  3CXC 2;  1BRG A;  4XDV A;  1M90 4;  3JUM A;  2W04 A;  1Q81 4;  3DH2 A;  1KC8 4;  3UL6 A;  1JZD A;  1GD4 A;  1UCI A;  4G1M B;  3AMO A;  3EN8 A;  5FGO A;  4O3V A;  5IG0 A;  1GOU A;  3DZL A;  3QRD A;  1IV9 A;  2RGQ A;  3EQQ B;  3MPH A;  1LOV A;  1LNH A;  1U5O A;  4X2O A;  1RTU A;  1YGW A;  2Y73 A;  3SXX A;  3GZY B;  4L8O A;  1O7H B;  1PFP A;  1AR0 A;  2W03 A;  3OWS A;  2KF5 A;  5CF1 A;  1DET A;  2YFI B;  3DMC A;  2ZHX B;  3NBB A;  4HM7 B;  4STD A;  3URP A;  1QAL A;  3CPW 2;  4MMX B;  1BNI A;  3KE7 A;  1FA3 A;  3KSP A;  4NRE A;  3V99 A;  2CX1 A;  3X3Y A;  2XH9 A;  2CKF B;  3AGO A;  3FG3 A;  3PYJ A;  4RNT A;  3FZW A;  2INX A;  1YJW 3;  1BRS A;  5IG5 A;  3KN4 A;  1SQW A;  1BNF A;  2WGQ A;  4K1V A;  4KFD A;  4N6O B;  4MMY B;  4R9K A;  5AYR B;  3WOE B;  4EBG A;  3LTA A;  2BMO B;  1TRQ A;  3X41 A;  1T5Y A;  2F4Y A;  1T2I A;  2CX0 A;  1TIJ A;  1UCJ A;  1ZO2 A;  4R80 A;  1B21 A;  4IIA A;  1S72 3;  1W6Y A;  5AIF A;  1UGI A;  1BGS A;  3PGB A;  1OHO A;  1RGK A;  3I0Y A;  1AV4 A;  1BAO A;  4N3V A;  1TTO A;  3K9M C;  5D81 A;  3RGR A;  1DVD A;  2GEY A;  1DMM A;  1G0T A;  1STD A;  1PYL A;  3D79 A;  3X3X A;  1RGE A;  3PCR A;  1CYV A;  3MKI A;  1NO3 A;  3S5C A;  1UUV B;  1I8V A;  3I55 3;  1VZZ A;  1FGR A;  1YIJ 3;  5FW5 A;  2IYJ A;  3B7C A;  5IER A;  3HII A;  3VF1 A;  1IV7 A;  1EKM A;  1MOL A;  2KF3 A;  1LQM B;  3T8U A;  1BNS A;  3CCM 3;  1F8N A;  4JF8 A;  1O7W B;  3Q1C A;  3A76 A;  4ILF A;  4BU4 A;  2P05 A;  1IQ8 A;  3NM7 A;  1RHL A;  3JUQ A;  1K8A 4;  1GOV A;  1FZU A;  4LGQ A;  2D1W A;  1ULI B;  1X1Y A;  1SAR A;  3HZP A;  1M1K 4;  5CXO A;  2LYX A;  2CFK A;  1TP6 A;  3D9R A;  3UB1 A;  1GYB A;  4O02 B;  5KP1 A;  2OOV A;  4J5K A;  1JB5 A;  2P0M A;  3EHC A;  4KT3 B;  2YFJ B;  3BNC A;  1YIT 3;  1IVV A;  2KF4 A;  1RNB A;  3MG1 A;  1BUJ A;  1UUW B;  3G4S 3;  1AVL A;  2OCT A;  2W56 B;  3OWU A;  3CCL 3;  1BNG A;  1LOY A;  1DVC A;  1NWW A;  2Z6B A;  3UJM A;  1NNV A;  2BT3 A;  2CWT A;  4WP5 A;  2D42 A;  2CC3 A;  1U8C B;  1LOW A;  3DGN A;  4I4K A;  1TFK A;  1BOX A;  3MWZ A;  4WHA A;  4BTW A;  2IY2 A;  1IU7 A;  1W01 A;  2WOH A;  3DGL A;  3CCE 3;  1OAC A;  1IDP A;  2RSX A;  2F98 A;  3LH4 A;  3CD6 3;  3WHO A;  1E3R A;  2K54 A;  3PXM A;  1RGF A;  4J9A A;  4R9L A;  2QA4 3;  3F8X A;  2QEX 3;  1M1X B;  4NPB A;  3G16 A;  2CH9 A;  1EG9 B;  1C7H A;  2HML B;  1AQZ A;  3MG3 A;  5M1A A;  3WOF B;  3U1W A;  3WA3 A;  4WYK B;  3CCV 3;  1X1X A;  3RGA A;  3CC2 3;  1BAN A;  1PY3 A;  4OUQ A;  3NBR A;  1Y4K A;  3DY5 A;  2W56 A;  1N9J A;  1Q7H A;  3JVC A;  1X1W A;  1W2B 2;  1HU9 A;  1OHP A;  3WDG B;  3GSP A;  1S5A A;  5IEN A;  2OTL 3;  4FCZ A;  1D6Z A;  3GZX B;  3FGY A;  1I0V A;  1O7G B;  2PNC A;  4HKV B;  2Q07 A;  4FCM A;  3HIG A;  7RNT A;  5CLK A;  1OGX A;  4BTX A;  1B2M A;  1FGO A;  1HZ1 A;  1LQG C;  3N8B A;  3BNB A;  4R4K A;  5LC6 A;  3G8Z A;  1O7N B;  4WYK A;  4CJN A;  7GSP A;  1GY7 A;  2CFG A;  1MWT A;  2F5M A;  2IMJ A;  2FGT A;  4XBY A;  3OW2 2;  1VQ7 3;  3H51 A;  2V1L A;  1WMN A;  3D3L A;  5D83 A;  1V58 A;  3CNX A;  1UI7 A;  2Y74 A;  3X40 A;  4XM4 A;  4BL2 A;  2HMO B;  4KFF A;  1BRJ A;  2P38 A;  5BXQ A;  3S67 A;  1RGL A;  1BSC A;  5DRV A;  2BIR A;  3ZG0 A;  3KZT A;  4HJL B;  3BU4 A;  1N8R 4;  4N6N B;  1BRN L;  3B8L A;  4BTY A;  2OTJ 3;  1BSA A;  1NU3 A;  2C10 A;  1YVS A;  1W6C A;  4L8P A;  2I9W A;  1VQ5 3;  2R4I A;  4DKI A;  4FMD A;  1LXE A;  1I0X A;  1FUW A;  1ROA A;  2W9Q A;  2B24 B;  3STD A;  2WOF A;  2OOV C;  1RRL A;  2F5W A;  2H0H A;  4HZB B;  4CPK A;  4OK0 A;  3RNT A;  4HM6 B;  2CG1 A;  3H3H A;  1BRK A;  2CFL A;  1T2H A;  3CCS 3;  2UX0 A;  1UCK A;  1W5Z A;  1X1U A;  1I3I A;  1RNT A;  1N5H A;  2BU4 A;  3NXJ A;  3ER7 A;  2XGN A;  5HOH A;  1BRH A;  3B4P A;  1W7C A;  4NHF A;  1Q9E A;  1SII A;  1ZX2 A;  1DMN A;  2CWV A;  1BIR A;  3G71 3;  1NB3 I;  4J8T A;  4N6L A;  1WMP A;  2GXF A;  1ASK A;  3OXA A;  3Q3F A;  3IPT A;  1V57 A;  2KAA A;  3GWR A;  1STF I;  3JUO A;  2XF3 A;  3NUV A;  1A2K A;  4K1U A;  3GZB A;  4GL6 A;  4N6T A;  5KP4 A;  2H0G A;  4HAA A;  1YHQ 3;  5ELJ A;  1I3F A;  1JZO A;  3E99 A;  2BMQ B;  2GU3 A;  3F8H A;  2E2V A;  3O8Y A;  4RNZ A;  5AEU B;  1W6G A;  1QJG A;  1QAF A;  1RN4 A;  2OWP A;  1OHS A;  2XSO B;  4O2H A;  3U97 A;  3MG2 A;  4HM0 B;  1W4N A;  3FG1 A;  1IVW A;  3D4A A;  1YI2 3;  1K41 A;  3WA2 X;  3K5T A;  1VQ6 3;  1B2S A;  4OVM A;  1B27 A;  4XB5 A;  1B2U A;  2CWU A;  3CCR 3;  1WQL B;  4GSP A;  1K73 4;  1VQN 3;  1A90 A;  2HMJ B;  3PCS A;  2BNG A;  4L7K A;  1RRH A;  3CPO A;  3NHX A;  3BNE A;  3V98 A;  2B1X B;  1N9E A;  1V74 A;  3WR2 A;  4TX4 A;  5AEW B;  2PZV A;  3CME 3;  3HI7 A;  1VQM 3;  4N6U A;  1JN5 B;  3V92 A;  1IK3 A;  2ML5 A;  1NDO B;  1ROV A;  4O8S A;  4HM3 B;  5DRE A;  1OF5 B;  2QGU A;  3LT8 A;  2F86 B;  3LOY A;  4LEH A;  4XDW A;  2W0Q A;  1WMO A;  2CFW A;  3LML A;  1I2G A;  2C11 A;  1MGW A;  3LTC A;  1B20 A;  4XBX A;  2ML6 A;  3KSE D;  4JRF A;  1DMQ A;  3SX1 A;  2W2C A;  2FXT A;  1CQS A;  5EEO A;  2C4B A;  4HYZ A;  3UNL A;  4PEJ A;  3CCU 3;  2H0I A;  1RMS A;  1TJD A;  2O3O A;  3JUP A;  1YVB I;  1LRA A;  3GAX A;  2MC8 A; 
#chains in the Genus database with same CATH homology
 4AEQ A;  1VQL 3;  2XR8 B;  5KP3 A;  4HM8 B;  1CYU A;  2JQ5 A;  1JN5 A;  4HM2 B;  3CCQ 3;  3J7Y d;  3F7X A;  3VSY A;  1IQX A;  1DYU A;  1UW1 A;  2ZDJ A;  3FKA A;  1IQY A;  3N9H A;  5EQL A;  1OF5 A;  3T0U A;  4HM4 B;  1VQK 3;  4K61 A;  2HMN B;  1A67 A;  4HBR A;  3GZR A;  3LZA A;  5AYS C;  2K0M A;  1RJO A;  4FMB A;  4XBT A;  3WOD G;  5IG3 A;  1TUH A;  2HMK B;  2XEP A;  3Q90 A;  3RDE A;  2KCD A;  3DGO A;  3IJE B;  5LC7 A;  4EXR A;  1TU5 A;  4CDL A;  2P0X A;  1MNL A;  2STD A;  5ELU A;  2OQE A;  3NV0 B;  5TGN A;  6STD A;  3B4O A;  1W02 A;  4FCJ A;  4LSO A;  1A2V A;  3LT9 A;  3JUN A;  2CW9 A;  1E97 A;  1ISK A;  1IVX A;  2JDI H;  3LXU X;  1JV2 B;  3LYG A;  1GY5 A;  1OH0 A;  2YX9 A;  4ZM8 A;  1KD1 4;  4GB5 A;  2XFS A;  3N54 B;  1W2Z A;  1GS3 A;  1QAK A;  2F99 A;  2IA7 A;  1E3V A;  3FLJ A;  1SPU A;  3S28 A;  4AKY A;  5A0O B;  1AVK A;  2WO0 A;  1L5G B;  2Z77 A;  2ZL8 A;  1Q82 4;  3IMA B;  3NV0 A;  3SED A;  5IEP A;  3X42 A;  1VQ9 3;  4ORL A;  4RNY A;  3DM8 A;  4IPB A;  1FGQ A;  1OUN A;  1GY6 A;  1YGE A;  2E2U A;  3MSO A;  4EC6 A;  1VQ4 3;  3KII A;  2RCD A;  1EA2 A;  1TFO A;  3F9S A;  4FMC A;  4EYC A;  1KSI A;  1SJW A;  2GBX B;  2E2T A;  1K28 A;  4KFE A;  5HGR A;  2P09 A;  2Z76 A;  2GBW B;  1QVG 2;  2HMM B;  3M8C A;  3NX0 A;  3SVA A;  1EQK A;  3NQZ A;  2WGO A;  3DXO A;  3EB8 A;  1BUQ A;  5AIH A;  3CNM A;  1N8Q A;  3K63 A;  3EC9 A;  4X2H A;  3LTD A;  3EBY A;  1JKG B;  3GRD A;  4WWU C;  3EJV A;  2IUJ A;  1OCV A;  3ECF A;  1Q40 B;  1QVF 2;  3S27 A;  4Q53 A;  5IG4 A;  5JBS A;  5I97 A;  2XSH B;  1IVU A;  3ROB A;  2XFT A;  3K0Z A;  5AII A;  3F40 A;  2GEX A;  1VQO 3;  1D6Y A;  1LOX A;  3KKG A;  1K9M 4;  2LQV A;  2KRT A;  5IEO A;  1G96 A;  4FMA A;  1PU4 A;  7STD A;  3MHE A;  2BHM A;  3WA2 X;  2CG0 A;  1FGT A;  3EN1 B;  3S29 A;  5STD A;  1FGM A;  5AIG A;  3SOA A;  3MYT A;  3BND A;  1ULJ B;  1UI8 A;  4HM1 B;  1Q7Y 4;  1Z1S A;  4HM5 B;  5AI1 A;  3VGN A;  2MF7 A;  2GU1 A;  3DUK A;  3FF0 A;  1JKG A;  3UL5 A;  2OQE C;  1Q40 A;  3Q2P A;  3CC4 3;  2IUK A;  2RFR A;  1CEW I;  3SOY A;  1N5P A;  3NM2 A;  3TDG A;  4CCV A;  4RZM A;  2A15 A;  4FR9 A;  3FCS B;  5BVB A;  4U13 A;  4AKZ A;  5D82 A;  5EVH A;  1OPY A;  2YFL B;  3PS8 A;  4K90 B;  3I56 3;  3QK9 A;  2O9U X;  3ALA A;  3EE1 A;  1IT8 A;  1VQ8 3;  1QMA A;  3CMA 3;  4N6M A;  3SLU A;  2W6J H;  4RBN A;  1IT7 A;  4KZ1 A;  1YJ9 3;  1NJI 4;  4EV5 A;  4KVH A;  4WFO A;  4H61 A;  4R1K A;  1JB2 A;  1RKY A;  5IF6 A;  3F7S A;  2BO9 B;  3BB9 A;  3CU3 A;  3OX9 A;  1M9G A;  3FH1 A;  4EV2 A;  5JPU A;  4IT7 A;  5CK6 A;  3NQY A;  3EBT A;  1Q42 A;  3FG4 A;  2L4V A;  5JPP A;  5IW9 A;  4N6V 0;  1WNH A;  2KXG A;  3EX9 A;  1RN7 A;  2CK3 H;  3EF8 A;  3KFQ C;  4MMZ B;  4HVN A;  2CFD A;  1HKX A;  2Z7A A;  3G0K A;  3LTB A;  3DGM A;  4HZ9 B;  1W00 A;  1GD3 A;  5G2G A;  4H3U A;  1JNQ A;  1OGZ A;  1KQS 2;  4LZI A;  1LVN A;  3BLZ A;  1O7M B;  1J2B A;  3AMO B;  5CF2 A;  3OWY A;  1JRQ A;  3CC7 3;  2CHC A;  2W9P A;  1KWI A;  2FNQ A;  2XGL A;  2QIY A;  1O7P B;  2CIU A;  3OV4 A;  3FF2 A;  3X3Z A;  3CCJ 3;  4QWT A;  2SBL A;  4LMI A;  4MEI A;  3FSD A;  3K7C A;  1SIH A;  2M7O A;  3T8N A;  1JB4 A;  1WTH A;  2BMR B;  3HX8 A;  1R4C A;  3WMD A;  3HK4 A;  2QA4 3;  3G6E 3;  1JJ2 2;  3NBJ A;  2XRX B;  8CHO A;  1US1 A;  1D6U A;  1YJN 3;  1Q86 4;  1NB5 I;  3PZW A;  1VQP 3;  4MJD A;  3F14 A;  3L0R A;  3CXC 2;  4XDV A;  1M90 4;  3JUM A;  2W04 A;  1Q81 4;  1KC8 4;  3UL6 A;  1GD4 A;  4G1M B;  3AMO A;  3EN8 A;  5FGO A;  4O3V A;  5IG0 A;  3DZL A;  3QRD A;  1IV9 A;  2RGQ A;  3EQQ B;  3MPH A;  1LNH A;  1U5O A;  4X2O A;  2Y73 A;  3SXX A;  3GZY B;  4L8O A;  1O7H B;  1PFP A;  1AR0 A;  2W03 A;  3OWS A;  5CF1 A;  3CPW 2;  2YFI B;  3DMC A;  4STD A;  3NBB A;  4HM7 B;  1QAL A;  4MMX B;  3KE7 A;  1FA3 A;  3KSP A;  4NRE A;  3V99 A;  3X3Y A;  2XH9 A;  2CKF B;  3FG3 A;  3PYJ A;  3FZW A;  2INX A;  1YJW 3;  5IG5 A;  3KN4 A;  1SQW A;  2WGQ A;  4K1V A;  4KFD A;  4N6O B;  4R9K A;  4MMY B;  5AYR B;  3WOE B;  4EBG A;  3LTA A;  2BMO B;  3X41 A;  1T5Y A;  1TIJ A;  1ZO2 A;  4R80 A;  4IIA A;  1S72 3;  1W6Y A;  5AIF A;  3PGB A;  1OHO A;  3I0Y A;  1AV4 A;  4N3V A;  3K9M C;  5D81 A;  3RGR A;  1DVD A;  2GEY A;  1DMM A;  1STD A;  3X3X A;  3PCR A;  1CYV A;  3MKI A;  1NO3 A;  3S5C A;  1UUV B;  3I55 3;  1VZZ A;  1FGR A;  1YIJ 3;  5FW5 A;  3B7C A;  5IER A;  3HII A;  3VF1 A;  1IV7 A;  1EKM A;  1MOL A;  3T8U A;  3CCM 3;  1F8N A;  4JF8 A;  1O7W B;  3Q1C A;  3A76 A;  2P05 A;  1IQ8 A;  3NM7 A;  3JUQ A;  1K8A 4;  4LGQ A;  2D1W A;  1ULI B;  3HZP A;  1M1K 4;  5CXO A;  2LYX A;  2CFK A;  1TP6 A;  3D9R A;  3UB1 A;  1GYB A;  4O02 B;  5KP1 A;  2OOV A;  1JB5 A;  2P0M A;  3EHC A;  2YFJ B;  3BNC A;  1YIT 3;  1IVV A;  3MG1 A;  1UUW B;  3G4S 3;  1AVL A;  2OCT A;  2W56 B;  3OWU A;  3CCL 3;  1NWW A;  1DVC A;  2Z6B A;  3UJM A;  2BT3 A;  2CWT A;  4WP5 A;  2D42 A;  2CC3 A;  1U8C B;  3DGN A;  4I4K A;  1TFK A;  3MWZ A;  4WHA A;  4BTW A;  1IU7 A;  1W01 A;  2WOH A;  3DGL A;  3CCE 3;  1OAC A;  1IDP A;  2RSX A;  2F98 A;  3LH4 A;  3CD6 3;  1E3R A;  2K54 A;  3PXM A;  4J9A A;  4R9L A;  3F8X A;  2QEX 3;  1M1X B;  3G16 A;  2CH9 A;  1EG9 B;  1C7H A;  2HML B;  3MG3 A;  3WOF B;  3U1W A;  3WA3 A;  4WYK B;  3CCV 3;  3RGA A;  3CC2 3;  4OUQ A;  3NBR A;  1Y4K A;  3DY5 A;  2W56 A;  1N9J A;  3JVC A;  1W2B 2;  1HU9 A;  1OHP A;  3WDG B;  1S5A A;  5IEN A;  2OTL 3;  4FCZ A;  1D6Z A;  3GZX B;  3FGY A;  1O7G B;  2PNC A;  4HKV B;  2Q07 A;  4FCM A;  3HIG A;  5CLK A;  1OGX A;  4BTX A;  1FGO A;  3N8B A;  5LC6 A;  4R4K A;  3BNB A;  3G8Z A;  1O7N B;  4WYK A;  1GY7 A;  2CFG A;  2IMJ A;  2FGT A;  4XBY A;  3OW2 2;  1VQ7 3;  3H51 A;  2V1L A;  1WMN A;  3D3L A;  5D83 A;  3CNX A;  1UI7 A;  2Y74 A;  3X40 A;  4XM4 A;  2HMO B;  4KFF A;  2P38 A;  5BXQ A;  3S67 A;  5DRV A;  3KZT A;  4HJL B;  1N8R 4;  4N6N B;  3B8L A;  4BTY A;  2OTJ 3;  1NU3 A;  2C10 A;  1W6C A;  4L8P A;  2I9W A;  1VQ5 3;  2R4I A;  4FMD A;  1LXE A;  1FUW A;  1ROA A;  2W9Q A;  2B24 B;  3STD A;  2WOF A;  2OOV C;  1RRL A;  4HZB B;  4OK0 A;  4HM6 B;  2CG1 A;  3H3H A;  2CFL A;  3CCS 3;  2UX0 A;  1W5Z A;  1N5H A;  3NXJ A;  3ER7 A;  2XGN A;  3B4P A;  1W7C A;  4NHF A;  1SII A;  1ZX2 A;  1DMN A;  2CWV A;  3G71 3;  1NB3 I;  4J8T A;  4N6L A;  1WMP A;  2GXF A;  1ASK A;  3OXA A;  3IPT A;  3GWR A;  3JUO A;  1STF I;  2XF3 A;  3NUV A;  1A2K A;  4K1U A;  3GZB A;  4GL6 A;  4N6T A;  5KP4 A;  1YHQ 3;  5ELJ A;  3E99 A;  2BMQ B;  2GU3 A;  3F8H A;  2E2V A;  3O8Y A;  4RNZ A;  5AEU B;  1W6G A;  1QJG A;  1QAF A;  2OWP A;  2XSO B;  1OHS A;  4O2H A;  3U97 A;  3MG2 A;  4HM0 B;  1W4N A;  3FG1 A;  1IVW A;  1YI2 3;  1K41 A;  3K5T A;  1VQ6 3;  4OVM A;  4XB5 A;  3CCR 3;  2CWU A;  1K73 4;  1WQL B;  1VQN 3;  1A90 A;  2HMJ B;  3PCS A;  2BNG A;  4L7K A;  1RRH A;  3CPO A;  3NHX A;  3BNE A;  3V98 A;  2B1X B;  1N9E A;  1V74 A;  4TX4 A;  5AEW B;  2PZV A;  3CME 3;  3HI7 A;  1VQM 3;  4N6U A;  1JN5 B;  3V92 A;  1IK3 A;  2ML5 A;  1NDO B;  1ROV A;  4O8S A;  4HM3 B;  5DRE A;  1OF5 B;  2QGU A;  3LT8 A;  2F86 B;  3LOY A;  4LEH A;  4XDW A;  2W0Q A;  1WMO A;  2CFW A;  3LML A;  2C11 A;  3LTC A;  4XBX A;  2ML6 A;  3KSE D;  4JRF A;  1DMQ A;  3SX1 A;  2W2C A;  2FXT A;  1CQS A;  5EEO A;  4HYZ A;  3UNL A;  4PEJ A;  3CCU 3;  2O3O A;  3JUP A;  1YVB I;  3GAX A;  2MC8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...