5A0OB

Adhiron raised against p300
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
93
structure length
93
Chain Sequence
b'ASNSLEIEELARFAVDEHNKKENALLEFVRVVKAKEQANLYLSTPIDTMYYLTLEAKDGGKKKLYEAKVWVKHIMYYPKTANFKELQEFKPVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADHIRON
publication title Exploration of the Hif-1Alpha.P300 Interface Using Peptide and Adhiron Phage Display Technologies
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 16
structure length 93
sequence length 93
chains with identical sequence S
ec nomenclature
pdb deposition date 2015-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5a0oB00
1G96A 3L0RA 5EQLA 1PFPA 3KFQC 4N6V0 1GD3A 1ROAA 3PXMA 4N6NB 1NB5I 1RN7A 5LC6A 1CYVA 3UL6A 1STFI 1TIJA 3KSED 2KXGA 4N6LA 4N6MA 1DVDA 4N6TA 1CYUA 4TX4A 3SVAA 5ELUA 1A67A 2OCTA 3NX0A 4LZIA 4CCVA 2W9QA 1WNHA 3MWZA 1LXEA 3UL5A 1N5HA 3Q2PA 1R4CA 1MNLA 2BO9B 5LC7A 2W9PA 2CH9A 1N9JA 1MOLA 3K9MC 4EYCA 5ELJA 3LH4A 5A0OB 3QRDA 4IT7A 1CEWI 1N5PA 1IV7A 1DVCA 3S67A 2O9UX 1IV9A 3IMAB 4ZM8A 1NB3I 1FUWA 1GD4A 1KWIA 3PYJA 3GAXA 1YVBI 1EQKA 4N6UA 1FA3A 3PS8A 1A90A 4N6OB 1M9GA
chains in the Genus database with same CATH superfamily
1TTOA 3BNCA 4KZ1A 1G96A 2BMOB 3BLZA 3N9HA 3L0RA 3CCE3 5EQLA 1X1WA 2P0MA 1AVKA 1FUSA 1FGMA 1BANA 4RNYA 1T2IA 2D42A 1AY7A 1HZ1A 3FF2A 4BTWA 3RGAA 4XDVA 1O7WB 1GY7A 4HM3B 1W6YA 1TJDA 1BSAA 1NDOB 4I4KA 4FCMA 3DGOA 4N6NB 2L4VA 4XBXA 2CG1A 1RGEA 2YFIB 4MJDA 4EXRA 3CMA3 2W56A 4I5QA 1BSCA 2W56B 3FF0A 3NUVA 3NXJA 1O7PB 1BRNL 1JRQA 4O8SA 3U1WA 3WA2X 3UL6A 4FMBA 4STDA 2H0GA 1BSDA 1TRQA 1ASKA 1O7MB 3SOAA 1BNGA 4OVMA 3NQYA 4FMAA 3WODG 1RCLA 4EBGA 1KC84 4N6TA 5IF6A 3S27A 1CYUA 4TX4A 4FCZA 1IK3A 3OX9A 2BMQB 3HIGA 1RNBA 3B7CA 3ROBA 3SVAA 5G1KA 1TFKA 2CX1A 4FMDA 3PCRA 1UUGB 2BNGA 3DY5A 4R9LA 3NX0A 4O3VA 4IIAA 5AEWB 3PZWA 3CPW2 1W5ZA 4CJNA 2XSOB 1QAKA 2YX9A 4HKVB 3NM7A 3SX1A 2WO0A 1C54A 4KFDA 4OK0A 2CFGA 3BNDA 1BNJA 1AQZA 2D1WA 4HZ9B 2KAAA 3HIIA 1QJGA 2K0MA 3Q90A 4HM1B 1X1UA 2E2VA 1W2ZA 3K7CA 1MGWA 3UL5A 3D9RA 3NHXA 1R4CA 2XFSA 3RGRA 1K734 5D81A 1VQ83 2BIRA 2QGUA 3I0YA 1K8A4 1LOVA 3CCQ3 4HAAA 1OHOA 1RRHA 1UW1A 1N9EA 3OXAA 1W00A 2MC8A 3CC23 4EC6A 2W9PA 2O3OA 3KSPA 7STDA 2CH9A 2P05A 2OQEC 4XDWA 5STDA 3CXC2 3CCV3 3G16A 3BNEA 4L7KA 3AMOB 3KIIA 5ELJA 1SARA 3LZAA 4GB5A 2HMKB 2A15A 3K5TA 1FGOA 2IUKA 2Z76A 1DVCA 1EEJA 1B21A 3G4S3 3G6E3 5DRVA 1IYYA 3RDEA 3O8YA 4KFFA 8CHOA 1GOYA 1LQMB 1KSIA 1BRHA 5AYSC 3HX8A 2OTL3 2XH9A 3DM8A 1D6ZA 5IEPA 2KF3A 2IUJA 1B2UA 1IQ8A 1NB3I 2Q07A 4EV5A 1FUWA 6STDA 5M18A 2J8XB 2KF5A 1C7HA 3FG1A 3DXOA 2KCDA 1N8QA 1TRPA 2XRXB 4BIRA 1QAFA 1EQKA 1JZOA 3BU4A 4J9AA 4HBRA 3X40A 3EF8A 2HMNB 3UJMA 3ZFZA 1B3SA 1AR0A 3MG1A 3CC73 1VQN3 1X1XA 1GY5A 2H0HA 5JPUA 2R4IA 1BNEA 4G1MB 3EHCA 1GOVA 1UGIA 4IPBA 5IG5A 4HJLB 1WMOA 1BRJA 4HM6B 1MWSA 5BXQA 4HM4B 4LSOA 3X41A 4NREA 1UGHI 2QEX3 1S5AA 1JKGA 4XBYA 3A76A 1JKGB 3ZG5A 1VQ53 1BUJA 1GMRA 1RGFA 3B4OA 4BTYA 1BUQA 3I553 2ZA4A 2MF7A 3NBJA 3J7Yd 2FGTA 4FMCA 1GD3A 1B2XA 3WDGB 2QA43 1EKMA 1D6YA 3PXMA 1BRGA 2OOVC 1RN7A 1OPYA 1NB5I 3EX9A 1JB2A 1TU5A 1SQWA 3CCU3 1YJW3 4R9KA 2RCDA 1LRAA 1QMAA 2XFTA 3WOEB 6RNTA 3UB1A 3PGBA 3WMDA 1UCJA 2UX0A 7RNTA 1I0VA 4HM2B 3D79A 3CD63 3WOFB 1VQ93 2WGOA 1LOYA 3DH2A 5IEOA 5KP4A 3KSED 1I2EA 1RCKA 3DZLA 3LTDA 3WHOA 3F40A 3E99A 1IVXA 5CK6A 2KF4A 1W6GA 1W7CA 2CG0A 3VGNA 1DVDA 4ORLA 2IMJA 4J8TA 1MWTA 2INXA 5TGNA 3U97A 1W6CA 1BGSA 5KP1A 1YI23 1MWUA 8RNTA 4GSPA 1K41A 3ZG0A 4X2OA 1OHPA 3STDA 5BVBA 2IY2A 1DETA 4OUQA 1VQL3 1I2GA 4XB5A 2LYXA 4H3UA 2P38A 3OWUA 1I2FA 1I3IA 2Y74A 3S29A 1RGLA 5I97A 2CIUA 1OUNA 2RSXA 5G2GA 1I0XA 1RGHA 1BIRA 4K61A 3EJVA 3LTAA 2W9QA 4WYKA 2OOVA 4WYKB 3SLUA 3PCSA 3MWZA 1LXEA 2YFJB 1N5HA 1VQO3 3WR2A 1MGRA 2XR8B 3FG3A 1RTUA 5M1AA 1O7GB 2CHCA 3FH1A 2ZDJA 3SOYA 1VQ63 3UNLA 4K90B 4MMYB 1LNIA 1ROVA 4J5GA 4JRFA 3MG2A 1N8R4 3GSPA 1Q7Y4 1YIJ3 3FLJA 1NJI4 1Z1SA 4BU4A 4HM8B 5G1LA 2BT3A 2W04A 1WTHA 2L1SA 3K9MC 3RNTA 1JZDA 1V74A 3N54B 2ZL8A 1OH0A 1B2SA 2UGIA 5A0OB 3QRDA 3EQQB 1VQK3 1A2PA 1JBTA 1ULJB 3CNXA 4IT7A 1CEWI 3Q3FA 2WOFA 2XEPA 2K3DA 2W0QA 3EE1A 1KQS2 1W2B2 4KVHA 4CDLA 5AIFA 2O9UX 5AIGA 3VF1A 2Y73A 1G02A 2F5WA 4HVNA 1FW7A 1HU9A 4PEJA 1IV9A 1JB5A 3CCL3 1M904 1CH0A 3HZPA 3PYJA 1KWIA 1JBRA 1RGAA 5JBSA 1K9M4 1IQXA 1YJ93 1UCKA 2F86B 2HOHA 4MMXB 1FA3A 1E3VA 2M7OA 3CME3 2OTJ3 2SBLA 1STDA 1RNTA 2KRTA 2FNQA 3GZXB 3EBTA 2GSPA 1LOXA 4MEIA 1NU3A 1E97A 1UDII 2IYJA 2F98A 1FYSA 1T5YA 2XF3A 3X3ZA 1GY6A 1GOUA 4XBTA 1Q864 3IJEB 1WMPA 3GZBA 2CC3A 1RLSA 2F56A 1RKYA 1MWRA 1BU4A 4EW5A 5CLKA 2WOHA 3KE7A 3NM2A 4O2HA 1BOXA 4DKIA 5CF1A 1QVG2 3KFQC 1BSBA 4RBNA 1GSPA 2AAEA 3D5GA 2V1LA 2Z7AA 3MPHA 3G8ZA 3NBBA 3AGNA 5CF2A 1F8NA 1UCLA 2SARA 1L5GB 1OCVA 1VZZA 3D3LA 3FCSB 5GSPA 5BU4A 3JUOA 3X3XA 1EA2A 3NQZA 2W6JH 5IENA 3CCR3 1JNQA 1OGXA 1A2KA 1TIJA 1VQP3 3JUMA 3AHSA 2YFLB 3ECFA 1BRSA 2OQEA 5RNTA 3CCS3 1JBSA 1ISKA 3EC9A 2KXGA 4N6LA 2AADA 1I3FA 1SJWA 2HMMB 3DGYA 4LYLB 4WHAA 3MG3A 1NNVA 1KD14 2C4BA 1DE3A 2ZHXB 4WWUC 1ZGXA 3F7XA 1IVUA 5IG0A 5IG4A 2C11A 1BNFA 2OCTA 3F8HA 1A67A 5AI1A 1YJN3 1V58A 3K63A 3LT9A 1TP6A 1W4NA 1Y4KA 2CX0A 4RNTA 1BRKA 5FGOA 2HMLB 3A5EA 1RGKA 4HM0B 4LZIA 4CCVA 1HKXA 3CU3A 3MKIA 2R41A 3WA3A 1FGRA 3FG4A 1O7HB 3B8LA 1WNHA 2QIYA 3LOYA 5AIIA 1TFOA 2CW9A 4HM5B 1VQ73 1ZS7A 3LXUX 1BNRA 3K0ZA 3KCHA 3OV4A 3CCM3 1FGQA 1A2VA 1LNHA 1X1YA 1Q42A 3FSDA 1RJOA 3V98A 3MHEA 1ZO2A 3TDGA 2H0IA 4R1KA 1S723 1BNIA 1I70A 1RDSA 1U5OA 3F9SA 2RGQA 2P09A 3ER7A 3SEDA 1JV2B 1RSNA 3FGYA 1UI8A 4KFEA 1GMPA 3LT8A 3KN4A 3FZWA 2PZVA 2I9WA 2XGLA 1E3RA 4MMZB 5M19A 2JDIH 5AIHA 2BHMA 2GBXB 3LH4A 4L8OA 4R4KA 3AHWA 3V92A 3B4PA 2Z6BA 1N5PA 3ALAA 2B1XB 1NO3A 3EB8A 4EV2A 3GWRA 3OWYA 3HK4A 1IVWA 5AYRB 1PYLA 1VQQA 4WFOA 1BVIA 3S5CA 3HI7A 3D4AA 4HZBB 4L8PA 3IPTA 1LQGC 3BIRA 2CFLA 1GD4A 1RMSA 1YIT3 3D5IA 3GAXA 3BNBA 3GRDA 4LGQA 1BRIA 1RGCA 2CFKA 4FCJA 5DREA 1YVBI 2ML6A 3JUNA 3DGNA 3VSYA 4BTXA 1PU4A 1DYUA 2FXTA 3PS8A 1JN5A 1YVSA 1JN5B 1OHSA 1ZX2A 1JB4A 3G0KA 4K1UA 4N6OB 1R4YA 2F4YA 1M9GA 4QWTA 3F14A 1B27A 1WMNA 1QALA 4AKZA 1JJ22 4LMIA 3AGOA 3N8BA 1V57A 3CPOA 1K28A 3LMLA 1PFPA 1FGTA 2B24B 2CK3H 3NBRA 4N6V0 6GSPA 3F8XA 1YHQ3 2F99A 2CWUA 3JUQA 1ROAA 3SYUA 3OW22 1BAOA 1I8VA 1GYBA 1US1A 5AEUB 2GEYA 2Z77A 5LC6A 3T8UA 9RNTA 1FZUA 1CYVA 3GZYB 4HYZA 5HGRA 1UUWB 3I563 3DMCA 1STFI 1FUTA 3BB9A 3OWSA 3HOHA 4RNZA 3V99A 3S28A 1IT7A 2BU4A 5EVHA 1CQSA 1IDPA 4N6MA 1NWWA 4AEQA 3X3YA 4R80A 5CXOA 5D83A 1B2MA 2PNCA 1EUIC 1T2HA 1WQLB 5IG3A 1OGZA 1UUVB 1IU7A 7GSPA 1TUHA 4XM4A 3DUKA 2E2TA 3T8NA 2W2CA 3CCJ3 1IQYA 4J5KA 1D6UA 5ELUA 5EEOA 2RBIA 3FKAA 4Q53A 5D82A 1BSEA 2K54A 3KKGA 3H3HA 4FR9A 4BL2A 1Q814 3JUPA 2GXFA 3AMOA 3JVCA 4CPKA 1ULIB 1O7NB 3MYTA 3QK9A 2F5MA 4X2HA 2CFWA 2E2UA 2C10A 5IW9A 2UUGC 1RHLA 2GEXA 2KF6A 1PY3A 1EG9B 1SIIA 1BNSA 1YGWA 1U8CB 1OACA 2CWVA 1RN4A 2ML5A 1GS3A 3SXXA 3Q2PA 3F7SA 2GU3A 1MNLA 1J2BA 1AV4A 2IA7A 4JF8A 3M8CA 3EBYA 4WP5A 1VQ43 1QVF2 4H61A 3DGMA 4NHFA 5IERA 4GHOA 1SPUA 5BIRA 2BO9B 2STDA 2XGNA 3H51A 5LC7A 1LOWA 3GZRA 2WGQA 4K1VA 1OF5A 1UCIA 1N9JA 1OF5B 4N3VA 1VQM3 1M1XB 1Q7HA 1YNVX 3T0UA 4LEHA 3X42A 1MOLA 3LTBA 4EYCA 1W02A 4U13A 3CC43 4BL3A 2JQ5A 3Q1CA 4RZMA 1YGEA 2LQVA 4O02B 3URPA 4HM7B 4AKYA 1IV7A 3LTCA 3NV0A 1RRLA 3NV0B 3S67A 3G713 1G0TA 5FW5A 1SIHA 1HYFA 1DMNA 2GU1A 3IMAB 3MSOA 1AVLA 4GL6A 2RNTA 4ZM8A 1T3BA 2W03A 2CWTA 2OWPA 2CKFB 3EN1B 4NPBA 4HOHA 3CNMA 4ILFA 5JPPA 4N6UA 2GBWB 5HOHA 1Q9EA 3DGLA 1IVVA 2P0XA 1B20A 2RFRA 3KZTA 5KP3A 1DMMA 1RN1A 1W01A 2BMRB 1LVNA 1RGGA 3EN8A 1M1K4 3LYGA 1Q824 2HMJB 1IT8A 2XSHB 4KT3B 1UI7A 1A90A 1Q40A 1B2ZA 1DMQA 1Q40B 1GMQA 2HMOB 2CFDA
chains in the Genus database with same CATH topology
3BNCA 4KZ1A 1G96A 2BMOB 3BLZA 3N9HA 3L0RA 3CCE3 5EQLA 2P0MA 1AVKA 1FGMA 4RNYA 2D42A 3FF2A 4BTWA 3RGAA 4XDVA 1O7WB 1GY7A 4HM3B 1W6YA 1NDOB 4I4KA 4FCMA 3DGOA 4N6NB 2L4VA 4XBXA 2CG1A 2YFIB 4EXRA 4MJDA 3CMA3 2W56A 2W56B 3NUVA 3FF0A 3NXJA 1O7PB 1JRQA 4O8SA 3U1WA 3WA2X 3UL6A 4FMBA 4STDA 1ASKA 1O7MB 3SOAA 4OVMA 3NQYA 4FMAA 3WODG 4EBGA 1KC84 4N6TA 5IF6A 3S27A 1CYUA 4TX4A 4FCZA 1IK3A 3OX9A 2BMQB 3HIGA 3B7CA 3ROBA 3SVAA 1TFKA 4FMDA 3PCRA 2BNGA 3DY5A 4R9LA 3NX0A 4O3VA 4IIAA 5AEWB 3PZWA 3CPW2 1W5ZA 2YX9A 2XSOB 1QAKA 4HKVB 3NM7A 3SX1A 2WO0A 4OK0A 2CFGA 3BNDA 2D1WA 4HZ9B 3HIIA 3Q90A 1QJGA 2K0MA 4HM1B 2E2VA 1W2ZA 3K7CA 3UL5A 3D9RA 3NHXA 1R4CA 2XFSA 3RGRA 1K734 5D81A 1VQ83 1K8A4 2QGUA 3I0YA 1Q40B 3CCQ3 1OHOA 1RRHA 1UW1A 1N9EA 3OXAA 1W00A 2MC8A 3CC23 4EC6A 2W9PA 2O3OA 3KSPA 7STDA 2CH9A 2P05A 2OQEC 4XDWA 5STDA 3CXC2 3CCV3 3G16A 3BNEA 4L7KA 3AMOB 3KIIA 5ELJA 3LZAA 4GB5A 2HMKB 2A15A 3K5TA 1FGOA 2IUKA 2Z76A 1DVCA 3G4S3 3G6E3 5DRVA 3RDEA 3O8YA 4KFFA 8CHOA 1KSIA 5AYSC 3HX8A 2OTL3 2XH9A 3DM8A 1D6ZA 5IEPA 2IUJA 1IQ8A 1NB3I 2Q07A 4EV5A 1FUWA 6STDA 3FG1A 1C7HA 3DXOA 2KCDA 1N8QA 2XRXB 1QAFA 1EQKA 4J9AA 4HBRA 3X40A 3EF8A 2HMNB 3UJMA 1AR0A 3MG1A 3CC73 1VQN3 1GY5A 5JPUA 2R4IA 4G1MB 3EHCA 4IPBA 5IG5A 4HJLB 1WMOA 4HM6B 5BXQA 4HM4B 4LSOA 3X41A 4NREA 1VQ53 2QEX3 1S5AA 1JKGA 4XBYA 3A76A 1JKGB 3B4OA 4BTYA 1BUQA 3I553 2MF7A 3NBJA 3J7Yd 2FGTA 4FMCA 1GD3A 3WDGB 2QA43 1EKMA 1D6YA 3PXMA 2OOVC 1RN7A 1OPYA 1NB5I 3EX9A 1JB2A 1TU5A 1SQWA 3CCU3 1YJW3 4R9KA 2RCDA 1QMAA 2XFTA 3WOEB 3UB1A 3PGBA 3WMDA 2UX0A 4HM2B 3CD63 3WOFB 1VQ93 2WGOA 5IEOA 5KP4A 3KSED 3DZLA 3LTDA 3F40A 3E99A 1IVXA 5CK6A 1DVDA 1W6GA 1W7CA 2CG0A 3VGNA 4ORLA 2IMJA 4J8TA 2INXA 5TGNA 3U97A 1W6CA 5KP1A 1YI23 1K41A 4X2OA 1OHPA 3STDA 5BVBA 4OUQA 1VQL3 4XB5A 2LYXA 4H3UA 2P38A 3OWUA 2Y74A 3S29A 5I97A 1OUNA 2RSXA 5G2GA 4K61A 3EJVA 3LTAA 2W9QA 4WYKA 2OOVA 4WYKB 3SLUA 3PCSA 3MWZA 1LXEA 2YFJB 1N5HA 1VQO3 2XR8B 3FG3A 1O7GB 2CHCA 3FH1A 2ZDJA 3SOYA 1VQ63 3UNLA 4K90B 4MMYB 1ROVA 4JRFA 3MG2A 1N8R4 1Q7Y4 1YIJ3 3FLJA 1NJI4 1Z1SA 4HM8B 2BT3A 2W04A 1WTHA 3K9MC 3N54B 1V74A 2ZL8A 1OH0A 5A0OB 1VQK3 3QRDA 3EQQB 1ULJB 3CNXA 4IT7A 1CEWI 2WOFA 2XEPA 2W0QA 3EE1A 1KQS2 1W2B2 4KVHA 4CDLA 5AIFA 2O9UX 5AIGA 3VF1A 2Y73A 4HVNA 1HU9A 4PEJA 1IV9A 1JB5A 3CCL3 1M904 3HZPA 3PYJA 1KWIA 1K9M4 5JBSA 1IQXA 1YJ93 2F86B 4MMXB 1FA3A 1E3VA 2M7OA 3CME3 2OTJ3 2SBLA 1STDA 2KRTA 2FNQA 3GZXB 3EBTA 1LOXA 4MEIA 1NU3A 1E97A 2F98A 2XF3A 1T5YA 3X3ZA 1GY6A 1Q864 4XBTA 3IJEB 1WMPA 3GZBA 2CC3A 1RKYA 5CLKA 2WOHA 3KE7A 3NM2A 4O2HA 1QVG2 5CF1A 3KFQC 4RBNA 2V1LA 2Z7AA 3MPHA 3G8ZA 3NBBA 5CF2A 1F8NA 1L5GB 1OCVA 1VZZA 3D3LA 3FCSB 3JUOA 3X3XA 1EA2A 3NQZA 2W6JH 5IENA 3CCR3 1JNQA 1OGXA 1A2KA 1TIJA 1VQP3 3JUMA 3ECFA 2YFLB 2OQEA 3CCS3 1J2BA 1ISKA 3EC9A 2KXGA 4N6LA 1SJWA 2HMMB 4WHAA 3MG3A 1KD14 4WWUC 3F7XA 1IVUA 5IG0A 5IG4A 2C11A 1A67A 2OCTA 3F8HA 5AI1A 1YJN3 3K63A 3LT9A 1TP6A 1W4NA 1Y4KA 5FGOA 2HMLB 4HM0B 4LZIA 4CCVA 1HKXA 3CU3A 3MKIA 3WA3A 1FGRA 3FG4A 1O7HB 3B8LA 1WNHA 2QIYA 3LOYA 5AIIA 1TFOA 2CW9A 4HM5B 1VQ73 3LXUX 3K0ZA 3OV4A 3CCM3 1FGQA 1A2VA 1LNHA 1Q42A 3FSDA 1RJOA 3V98A 3MHEA 1ZO2A 3TDGA 4R1KA 1S723 1U5OA 3F9SA 3SEDA 2RGQA 2P09A 3ER7A 1JV2B 3FGYA 1UI8A 4KFEA 3LT8A 3KN4A 3FZWA 2PZVA 2I9WA 2XGLA 1E3RA 4MMZB 2JDIH 5AIHA 2BHMA 2GBXB 3LH4A 4L8OA 4R4KA 3V92A 3B4PA 2Z6BA 1N5PA 3ALAA 2B1XB 1NO3A 3EB8A 4EV2A 3GWRA 3OWYA 3HK4A 1IVWA 5AYRB 4WFOA 3S5CA 3HI7A 4HZBB 4L8PA 3IPTA 2CFLA 1GD4A 1YIT3 3GRDA 3GAXA 3BNBA 4LGQA 2CFKA 4FCJA 5DREA 1YVBI 2ML6A 3JUNA 3DGNA 3VSYA 4BTXA 1PU4A 1DYUA 2FXTA 3PS8A 1JN5A 1JN5B 1OHSA 1ZX2A 1JB4A 3G0KA 4K1UA 4N6OB 1M9GA 4QWTA 3F14A 1WMNA 1QALA 4AKZA 1JJ22 4LMIA 3N8BA 3CPOA 1K28A 3LMLA 1PFPA 1FGTA 2B24B 2CK3H 3NBRA 4N6V0 3F8XA 1YHQ3 2F99A 2CWUA 3JUQA 1ROAA 3OW22 1GYBA 1US1A 5AEUB 2GEYA 2Z77A 5LC6A 3T8UA 1CYVA 3GZYB 4HYZA 5HGRA 1UUWB 3I563 3DMCA 1STFI 3BB9A 3OWSA 4RNZA 3V99A 3S28A 1IT7A 5EVHA 1CQSA 1IDPA 4N6MA 1NWWA 4AEQA 3X3YA 4R80A 5CXOA 5D83A 2PNCA 1WQLB 5IG3A 1OGZA 1UUVB 1IU7A 1TUHA 4XM4A 3DUKA 2E2TA 3T8NA 2W2CA 3CCJ3 1IQYA 5ELUA 1D6UA 5EEOA 3FKAA 4Q53A 5D82A 2K54A 3KKGA 4FR9A 3H3HA 1Q814 3JUPA 2GXFA 3AMOA 3JVCA 1ULIB 1O7NB 3MYTA 3QK9A 4X2HA 2CFWA 2E2UA 2C10A 5IW9A 2GEXA 1EG9B 1SIIA 1U8CB 1OACA 2CWVA 2ML5A 1GS3A 3SXXA 3Q2PA 3F7SA 2GU3A 1MNLA 1AV4A 2IA7A 4JF8A 3M8CA 3EBYA 4WP5A 1VQ43 1QVF2 4H61A 3DGMA 4NHFA 5IERA 1SPUA 2BO9B 2STDA 2XGNA 3H51A 5LC7A 3GZRA 2WGQA 4K1VA 1OF5A 4N3VA 1N9JA 1OF5B 1VQM3 1M1XB 3T0UA 4LEHA 3X42A 1MOLA 3LTBA 4EYCA 1W02A 4U13A 3CC43 2JQ5A 3Q1CA 4RZMA 1YGEA 2LQVA 4O02B 4HM7B 4AKYA 1IV7A 3LTCA 3NV0A 1RRLA 3NV0B 3S67A 3G713 5FW5A 1SIHA 1DMNA 2GU1A 3IMAB 3MSOA 1AVLA 4GL6A 4ZM8A 2W03A 2CWTA 2OWPA 2CKFB 3EN1B 3CNMA 5JPPA 4N6UA 2GBWB 3DGLA 1IVVA 2P0XA 3KZTA 2RFRA 5KP3A 1DMMA 1W01A 2BMRB 1LVNA 3EN8A 1M1K4 3LYGA 1Q824 2HMJB 2XSHB 1IT8A 1UI7A 1A90A 1Q40A 1DMQA 2CIUA 4KFDA 2HMOB 2CFDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G96 A;  3L0R A;  5EQL A;  1PFP A;  3KFQ C;  4N6V 0;  1GD3 A;  1ROA A;  3PXM A;  4N6N B;  1NB5 I;  1RN7 A;  5LC6 A;  1CYV A;  3UL6 A;  1STF I;  1TIJ A;  3KSE D;  2KXG A;  4N6L A;  4N6M A;  1DVD A;  4N6T A;  1CYU A;  4TX4 A;  3SVA A;  5ELU A;  1A67 A;  2OCT A;  3NX0 A;  4LZI A;  4CCV A;  2W9Q A;  1WNH A;  3MWZ A;  1LXE A;  3UL5 A;  1N5H A;  3Q2P A;  1R4C A;  1MNL A;  2BO9 B;  5LC7 A;  2W9P A;  2CH9 A;  1N9J A;  1MOL A;  3K9M C;  4EYC A;  5ELJ A;  3LH4 A;  5A0O B;  3QRD A;  4IT7 A;  1CEW I;  1N5P A;  1IV7 A;  1DVC A;  3S67 A;  2O9U X;  1IV9 A;  3IMA B;  4ZM8 A;  1NB3 I;  1FUW A;  1GD4 A;  1KWI A;  3PYJ A;  3GAX A;  1YVB I;  1EQK A;  4N6U A;  1FA3 A;  3PS8 A;  1A90 A;  4N6O B;  1M9G A; 
#chains in the Genus database with same CATH topology
 1TTO A;  3BNC A;  4KZ1 A;  1G96 A;  2BMO B;  3BLZ A;  3N9H A;  3L0R A;  3CCE 3;  5EQL A;  1X1W A;  2P0M A;  1AVK A;  1FUS A;  1FGM A;  1BAN A;  4RNY A;  1T2I A;  2D42 A;  1AY7 A;  1HZ1 A;  3FF2 A;  4BTW A;  3RGA A;  4XDV A;  1O7W B;  1GY7 A;  4HM3 B;  1W6Y A;  1TJD A;  1BSA A;  1NDO B;  4I4K A;  4FCM A;  3DGO A;  4N6N B;  2L4V A;  4XBX A;  2CG1 A;  1RGE A;  2YFI B;  4MJD A;  4EXR A;  3CMA 3;  2W56 A;  4I5Q A;  1BSC A;  2W56 B;  3FF0 A;  3NUV A;  3NXJ A;  1O7P B;  1BRN L;  1JRQ A;  4O8S A;  3U1W A;  3WA2 X;  3UL6 A;  4FMB A;  4STD A;  2H0G A;  1BSD A;  1TRQ A;  1ASK A;  1O7M B;  3SOA A;  1BNG A;  4OVM A;  3NQY A;  4FMA A;  3WOD G;  1RCL A;  4EBG A;  1KC8 4;  4N6T A;  5IF6 A;  3S27 A;  1CYU A;  4TX4 A;  4FCZ A;  1IK3 A;  3OX9 A;  2BMQ B;  3HIG A;  1RNB A;  3B7C A;  3ROB A;  3SVA A;  5G1K A;  1TFK A;  2CX1 A;  4FMD A;  3PCR A;  1UUG B;  2BNG A;  3DY5 A;  4R9L A;  3NX0 A;  4O3V A;  4IIA A;  5AEW B;  3PZW A;  3CPW 2;  1W5Z A;  4CJN A;  2XSO B;  1QAK A;  2YX9 A;  4HKV B;  3NM7 A;  3SX1 A;  2WO0 A;  1C54 A;  4KFD A;  4OK0 A;  2CFG A;  3BND A;  1BNJ A;  1AQZ A;  2D1W A;  4HZ9 B;  2KAA A;  3HII A;  1QJG A;  2K0M A;  3Q90 A;  4HM1 B;  1X1U A;  2E2V A;  1W2Z A;  3K7C A;  1MGW A;  3UL5 A;  3D9R A;  3NHX A;  1R4C A;  2XFS A;  3RGR A;  1K73 4;  5D81 A;  1VQ8 3;  2BIR A;  2QGU A;  3I0Y A;  1K8A 4;  1LOV A;  3CCQ 3;  4HAA A;  1OHO A;  1RRH A;  1UW1 A;  1N9E A;  3OXA A;  1W00 A;  2MC8 A;  3CC2 3;  4EC6 A;  2W9P A;  2O3O A;  3KSP A;  7STD A;  2CH9 A;  2P05 A;  2OQE C;  4XDW A;  5STD A;  3CXC 2;  3CCV 3;  3G16 A;  3BNE A;  4L7K A;  3AMO B;  3KII A;  5ELJ A;  1SAR A;  3LZA A;  4GB5 A;  2HMK B;  2A15 A;  3K5T A;  1FGO A;  2IUK A;  2Z76 A;  1DVC A;  1EEJ A;  1B21 A;  3G4S 3;  3G6E 3;  5DRV A;  1IYY A;  3RDE A;  3O8Y A;  4KFF A;  8CHO A;  1GOY A;  1LQM B;  1KSI A;  1BRH A;  5AYS C;  3HX8 A;  2OTL 3;  2XH9 A;  3DM8 A;  1D6Z A;  5IEP A;  2KF3 A;  2IUJ A;  1B2U A;  1IQ8 A;  1NB3 I;  2Q07 A;  4EV5 A;  1FUW A;  6STD A;  5M18 A;  2J8X B;  2KF5 A;  1C7H A;  3FG1 A;  3DXO A;  2KCD A;  1N8Q A;  1TRP A;  2XRX B;  4BIR A;  1QAF A;  1EQK A;  1JZO A;  3BU4 A;  4J9A A;  4HBR A;  3X40 A;  3EF8 A;  2HMN B;  3UJM A;  3ZFZ A;  1B3S A;  1AR0 A;  3MG1 A;  3CC7 3;  1VQN 3;  1X1X A;  1GY5 A;  2H0H A;  5JPU A;  2R4I A;  1BNE A;  4G1M B;  3EHC A;  1GOV A;  1UGI A;  4IPB A;  5IG5 A;  4HJL B;  1WMO A;  1BRJ A;  4HM6 B;  1MWS A;  5BXQ A;  4HM4 B;  4LSO A;  3X41 A;  4NRE A;  1UGH I;  2QEX 3;  1S5A A;  1JKG A;  4XBY A;  3A76 A;  1JKG B;  3ZG5 A;  1VQ5 3;  1BUJ A;  1GMR A;  1RGF A;  3B4O A;  4BTY A;  1BUQ A;  3I55 3;  2ZA4 A;  2MF7 A;  3NBJ A;  3J7Y d;  2FGT A;  4FMC A;  1GD3 A;  1B2X A;  3WDG B;  2QA4 3;  1EKM A;  1D6Y A;  3PXM A;  1BRG A;  2OOV C;  1RN7 A;  1OPY A;  1NB5 I;  3EX9 A;  1JB2 A;  1TU5 A;  1SQW A;  3CCU 3;  1YJW 3;  4R9K A;  2RCD A;  1LRA A;  1QMA A;  2XFT A;  3WOE B;  6RNT A;  3UB1 A;  3PGB A;  3WMD A;  1UCJ A;  2UX0 A;  7RNT A;  1I0V A;  4HM2 B;  3D79 A;  3CD6 3;  3WOF B;  1VQ9 3;  2WGO A;  1LOY A;  3DH2 A;  5IEO A;  5KP4 A;  3KSE D;  1I2E A;  1RCK A;  3DZL A;  3LTD A;  3WHO A;  3F40 A;  3E99 A;  1IVX A;  5CK6 A;  2KF4 A;  1W6G A;  1W7C A;  2CG0 A;  3VGN A;  1DVD A;  4ORL A;  2IMJ A;  4J8T A;  1MWT A;  2INX A;  5TGN A;  3U97 A;  1W6C A;  1BGS A;  5KP1 A;  1YI2 3;  1MWU A;  8RNT A;  4GSP A;  1K41 A;  3ZG0 A;  4X2O A;  1OHP A;  3STD A;  5BVB A;  2IY2 A;  1DET A;  4OUQ A;  1VQL 3;  1I2G A;  4XB5 A;  2LYX A;  4H3U A;  2P38 A;  3OWU A;  1I2F A;  1I3I A;  2Y74 A;  3S29 A;  1RGL A;  5I97 A;  2CIU A;  1OUN A;  2RSX A;  5G2G A;  1I0X A;  1RGH A;  1BIR A;  4K61 A;  3EJV A;  3LTA A;  2W9Q A;  4WYK A;  2OOV A;  4WYK B;  3SLU A;  3PCS A;  3MWZ A;  1LXE A;  2YFJ B;  1N5H A;  1VQO 3;  3WR2 A;  1MGR A;  2XR8 B;  3FG3 A;  1RTU A;  5M1A A;  1O7G B;  2CHC A;  3FH1 A;  2ZDJ A;  3SOY A;  1VQ6 3;  3UNL A;  4K90 B;  4MMY B;  1LNI A;  1ROV A;  4J5G A;  4JRF A;  3MG2 A;  1N8R 4;  3GSP A;  1Q7Y 4;  1YIJ 3;  3FLJ A;  1NJI 4;  1Z1S A;  4BU4 A;  4HM8 B;  5G1L A;  2BT3 A;  2W04 A;  1WTH A;  2L1S A;  3K9M C;  3RNT A;  1JZD A;  1V74 A;  3N54 B;  2ZL8 A;  1OH0 A;  1B2S A;  2UGI A;  5A0O B;  3QRD A;  3EQQ B;  1VQK 3;  1A2P A;  1JBT A;  1ULJ B;  3CNX A;  4IT7 A;  1CEW I;  3Q3F A;  2WOF A;  2XEP A;  2K3D A;  2W0Q A;  3EE1 A;  1KQS 2;  1W2B 2;  4KVH A;  4CDL A;  5AIF A;  2O9U X;  5AIG A;  3VF1 A;  2Y73 A;  1G02 A;  2F5W A;  4HVN A;  1FW7 A;  1HU9 A;  4PEJ A;  1IV9 A;  1JB5 A;  3CCL 3;  1M90 4;  1CH0 A;  3HZP A;  3PYJ A;  1KWI A;  1JBR A;  1RGA A;  5JBS A;  1K9M 4;  1IQX A;  1YJ9 3;  1UCK A;  2F86 B;  2HOH A;  4MMX B;  1FA3 A;  1E3V A;  2M7O A;  3CME 3;  2OTJ 3;  2SBL A;  1STD A;  1RNT A;  2KRT A;  2FNQ A;  3GZX B;  3EBT A;  2GSP A;  1LOX A;  4MEI A;  1NU3 A;  1E97 A;  1UDI I;  2IYJ A;  2F98 A;  1FYS A;  1T5Y A;  2XF3 A;  3X3Z A;  1GY6 A;  1GOU A;  4XBT A;  1Q86 4;  3IJE B;  1WMP A;  3GZB A;  2CC3 A;  1RLS A;  2F56 A;  1RKY A;  1MWR A;  1BU4 A;  4EW5 A;  5CLK A;  2WOH A;  3KE7 A;  3NM2 A;  4O2H A;  1BOX A;  4DKI A;  5CF1 A;  1QVG 2;  3KFQ C;  1BSB A;  4RBN A;  1GSP A;  2AAE A;  3D5G A;  2V1L A;  2Z7A A;  3MPH A;  3G8Z A;  3NBB A;  3AGN A;  5CF2 A;  1F8N A;  1UCL A;  2SAR A;  1L5G B;  1OCV A;  1VZZ A;  3D3L A;  3FCS B;  5GSP A;  5BU4 A;  3JUO A;  3X3X A;  1EA2 A;  3NQZ A;  2W6J H;  5IEN A;  3CCR 3;  1JNQ A;  1OGX A;  1A2K A;  1TIJ A;  1VQP 3;  3JUM A;  3AHS A;  2YFL B;  3ECF A;  1BRS A;  2OQE A;  5RNT A;  3CCS 3;  1JBS A;  1ISK A;  3EC9 A;  2KXG A;  4N6L A;  2AAD A;  1I3F A;  1SJW A;  2HMM B;  3DGY A;  4LYL B;  4WHA A;  3MG3 A;  1NNV A;  1KD1 4;  2C4B A;  1DE3 A;  2ZHX B;  4WWU C;  1ZGX A;  3F7X A;  1IVU A;  5IG0 A;  5IG4 A;  2C11 A;  1BNF A;  2OCT A;  3F8H A;  1A67 A;  5AI1 A;  1YJN 3;  1V58 A;  3K63 A;  3LT9 A;  1TP6 A;  1W4N A;  1Y4K A;  2CX0 A;  4RNT A;  1BRK A;  5FGO A;  2HML B;  3A5E A;  1RGK A;  4HM0 B;  4LZI A;  4CCV A;  1HKX A;  3CU3 A;  3MKI A;  2R41 A;  3WA3 A;  1FGR A;  3FG4 A;  1O7H B;  3B8L A;  1WNH A;  2QIY A;  3LOY A;  5AII A;  1TFO A;  2CW9 A;  4HM5 B;  1VQ7 3;  1ZS7 A;  3LXU X;  1BNR A;  3K0Z A;  3KCH A;  3OV4 A;  3CCM 3;  1FGQ A;  1A2V A;  1LNH A;  1X1Y A;  1Q42 A;  3FSD A;  1RJO A;  3V98 A;  3MHE A;  1ZO2 A;  3TDG A;  2H0I A;  4R1K A;  1S72 3;  1BNI A;  1I70 A;  1RDS A;  1U5O A;  3F9S A;  2RGQ A;  2P09 A;  3ER7 A;  3SED A;  1JV2 B;  1RSN A;  3FGY A;  1UI8 A;  4KFE A;  1GMP A;  3LT8 A;  3KN4 A;  3FZW A;  2PZV A;  2I9W A;  2XGL A;  1E3R A;  4MMZ B;  5M19 A;  2JDI H;  5AIH A;  2BHM A;  2GBX B;  3LH4 A;  4L8O A;  4R4K A;  3AHW A;  3V92 A;  3B4P A;  2Z6B A;  1N5P A;  3ALA A;  2B1X B;  1NO3 A;  3EB8 A;  4EV2 A;  3GWR A;  3OWY A;  3HK4 A;  1IVW A;  5AYR B;  1PYL A;  1VQQ A;  4WFO A;  1BVI A;  3S5C A;  3HI7 A;  3D4A A;  4HZB B;  4L8P A;  3IPT A;  1LQG C;  3BIR A;  2CFL A;  1GD4 A;  1RMS A;  1YIT 3;  3D5I A;  3GAX A;  3BNB A;  3GRD A;  4LGQ A;  1BRI A;  1RGC A;  2CFK A;  4FCJ A;  5DRE A;  1YVB I;  2ML6 A;  3JUN A;  3DGN A;  3VSY A;  4BTX A;  1PU4 A;  1DYU A;  2FXT A;  3PS8 A;  1JN5 A;  1YVS A;  1JN5 B;  1OHS A;  1ZX2 A;  1JB4 A;  3G0K A;  4K1U A;  4N6O B;  1R4Y A;  2F4Y A;  1M9G A;  4QWT A;  3F14 A;  1B27 A;  1WMN A;  1QAL A;  4AKZ A;  1JJ2 2;  4LMI A;  3AGO A;  3N8B A;  1V57 A;  3CPO A;  1K28 A;  3LML A;  1PFP A;  1FGT A;  2B24 B;  2CK3 H;  3NBR A;  4N6V 0;  6GSP A;  3F8X A;  1YHQ 3;  2F99 A;  2CWU A;  3JUQ A;  1ROA A;  3SYU A;  3OW2 2;  1BAO A;  1I8V A;  1GYB A;  1US1 A;  5AEU B;  2GEY A;  2Z77 A;  5LC6 A;  3T8U A;  9RNT A;  1FZU A;  1CYV A;  3GZY B;  4HYZ A;  5HGR A;  1UUW B;  3I56 3;  3DMC A;  1STF I;  1FUT A;  3BB9 A;  3OWS A;  3HOH A;  4RNZ A;  3V99 A;  3S28 A;  1IT7 A;  2BU4 A;  5EVH A;  1CQS A;  1IDP A;  4N6M A;  1NWW A;  4AEQ A;  3X3Y A;  4R80 A;  5CXO A;  5D83 A;  1B2M A;  2PNC A;  1EUI C;  1T2H A;  1WQL B;  5IG3 A;  1OGZ A;  1UUV B;  1IU7 A;  7GSP A;  1TUH A;  4XM4 A;  3DUK A;  2E2T A;  3T8N A;  2W2C A;  3CCJ 3;  1IQY A;  4J5K A;  1D6U A;  5ELU A;  5EEO A;  2RBI A;  3FKA A;  4Q53 A;  5D82 A;  1BSE A;  2K54 A;  3KKG A;  3H3H A;  4FR9 A;  4BL2 A;  1Q81 4;  3JUP A;  2GXF A;  3AMO A;  3JVC A;  4CPK A;  1ULI B;  1O7N B;  3MYT A;  3QK9 A;  2F5M A;  4X2H A;  2CFW A;  2E2U A;  2C10 A;  5IW9 A;  2UUG C;  1RHL A;  2GEX A;  2KF6 A;  1PY3 A;  1EG9 B;  1SII A;  1BNS A;  1YGW A;  1U8C B;  1OAC A;  2CWV A;  1RN4 A;  2ML5 A;  1GS3 A;  3SXX A;  3Q2P A;  3F7S A;  2GU3 A;  1MNL A;  1J2B A;  1AV4 A;  2IA7 A;  4JF8 A;  3M8C A;  3EBY A;  4WP5 A;  1VQ4 3;  1QVF 2;  4H61 A;  3DGM A;  4NHF A;  5IER A;  4GHO A;  1SPU A;  5BIR A;  2BO9 B;  2STD A;  2XGN A;  3H51 A;  5LC7 A;  1LOW A;  3GZR A;  2WGQ A;  4K1V A;  1OF5 A;  1UCI A;  1N9J A;  1OF5 B;  4N3V A;  1VQM 3;  1M1X B;  1Q7H A;  1YNV X;  3T0U A;  4LEH A;  3X42 A;  1MOL A;  3LTB A;  4EYC A;  1W02 A;  4U13 A;  3CC4 3;  4BL3 A;  2JQ5 A;  3Q1C A;  4RZM A;  1YGE A;  2LQV A;  4O02 B;  3URP A;  4HM7 B;  4AKY A;  1IV7 A;  3LTC A;  3NV0 A;  1RRL A;  3NV0 B;  3S67 A;  3G71 3;  1G0T A;  5FW5 A;  1SIH A;  1HYF A;  1DMN A;  2GU1 A;  3IMA B;  3MSO A;  1AVL A;  4GL6 A;  2RNT A;  4ZM8 A;  1T3B A;  2W03 A;  2CWT A;  2OWP A;  2CKF B;  3EN1 B;  4NPB A;  4HOH A;  3CNM A;  4ILF A;  5JPP A;  4N6U A;  2GBW B;  5HOH A;  1Q9E A;  3DGL A;  1IVV A;  2P0X A;  1B20 A;  2RFR A;  3KZT A;  5KP3 A;  1DMM A;  1RN1 A;  1W01 A;  2BMR B;  1LVN A;  1RGG A;  3EN8 A;  1M1K 4;  3LYG A;  1Q82 4;  2HMJ B;  1IT8 A;  2XSH B;  4KT3 B;  1UI7 A;  1A90 A;  1Q40 A;  1B2Z A;  1DMQ A;  1Q40 B;  1GMQ A;  2HMO B;  2CFD A; 
#chains in the Genus database with same CATH homology
 3BNC A;  4KZ1 A;  1G96 A;  2BMO B;  3BLZ A;  3N9H A;  3L0R A;  3CCE 3;  5EQL A;  2P0M A;  1AVK A;  1FGM A;  4RNY A;  2D42 A;  3FF2 A;  4BTW A;  3RGA A;  4XDV A;  1O7W B;  1GY7 A;  4HM3 B;  1W6Y A;  1NDO B;  4I4K A;  4FCM A;  3DGO A;  4N6N B;  2L4V A;  4XBX A;  2CG1 A;  2YFI B;  4EXR A;  4MJD A;  3CMA 3;  2W56 A;  2W56 B;  3NUV A;  3FF0 A;  3NXJ A;  1O7P B;  1JRQ A;  4O8S A;  3U1W A;  3WA2 X;  3UL6 A;  4FMB A;  4STD A;  1ASK A;  1O7M B;  3SOA A;  4OVM A;  3NQY A;  4FMA A;  3WOD G;  4EBG A;  1KC8 4;  4N6T A;  5IF6 A;  3S27 A;  1CYU A;  4TX4 A;  4FCZ A;  1IK3 A;  3OX9 A;  2BMQ B;  3HIG A;  3B7C A;  3ROB A;  3SVA A;  1TFK A;  4FMD A;  3PCR A;  2BNG A;  3DY5 A;  4R9L A;  3NX0 A;  4O3V A;  4IIA A;  5AEW B;  3PZW A;  3CPW 2;  1W5Z A;  2YX9 A;  2XSO B;  1QAK A;  4HKV B;  3NM7 A;  3SX1 A;  2WO0 A;  4OK0 A;  2CFG A;  3BND A;  2D1W A;  4HZ9 B;  3HII A;  3Q90 A;  1QJG A;  2K0M A;  4HM1 B;  2E2V A;  1W2Z A;  3K7C A;  3UL5 A;  3D9R A;  3NHX A;  1R4C A;  2XFS A;  3RGR A;  1K73 4;  5D81 A;  1VQ8 3;  1K8A 4;  2QGU A;  3I0Y A;  1Q40 B;  3CCQ 3;  1OHO A;  1RRH A;  1UW1 A;  1N9E A;  3OXA A;  1W00 A;  2MC8 A;  3CC2 3;  4EC6 A;  2W9P A;  2O3O A;  3KSP A;  7STD A;  2CH9 A;  2P05 A;  2OQE C;  4XDW A;  5STD A;  3CXC 2;  3CCV 3;  3G16 A;  3BNE A;  4L7K A;  3AMO B;  3KII A;  5ELJ A;  3LZA A;  4GB5 A;  2HMK B;  2A15 A;  3K5T A;  1FGO A;  2IUK A;  2Z76 A;  1DVC A;  3G4S 3;  3G6E 3;  5DRV A;  3RDE A;  3O8Y A;  4KFF A;  8CHO A;  1KSI A;  5AYS C;  3HX8 A;  2OTL 3;  2XH9 A;  3DM8 A;  1D6Z A;  5IEP A;  2IUJ A;  1IQ8 A;  1NB3 I;  2Q07 A;  4EV5 A;  1FUW A;  6STD A;  3FG1 A;  1C7H A;  3DXO A;  2KCD A;  1N8Q A;  2XRX B;  1QAF A;  1EQK A;  4J9A A;  4HBR A;  3X40 A;  3EF8 A;  2HMN B;  3UJM A;  1AR0 A;  3MG1 A;  3CC7 3;  1VQN 3;  1GY5 A;  5JPU A;  2R4I A;  4G1M B;  3EHC A;  4IPB A;  5IG5 A;  4HJL B;  1WMO A;  4HM6 B;  5BXQ A;  4HM4 B;  4LSO A;  3X41 A;  4NRE A;  1VQ5 3;  2QEX 3;  1S5A A;  1JKG A;  4XBY A;  3A76 A;  1JKG B;  3B4O A;  4BTY A;  1BUQ A;  3I55 3;  2MF7 A;  3NBJ A;  3J7Y d;  2FGT A;  4FMC A;  1GD3 A;  3WDG B;  2QA4 3;  1EKM A;  1D6Y A;  3PXM A;  2OOV C;  1RN7 A;  1OPY A;  1NB5 I;  3EX9 A;  1JB2 A;  1TU5 A;  1SQW A;  3CCU 3;  1YJW 3;  4R9K A;  2RCD A;  1QMA A;  2XFT A;  3WOE B;  3UB1 A;  3PGB A;  3WMD A;  2UX0 A;  4HM2 B;  3CD6 3;  3WOF B;  1VQ9 3;  2WGO A;  5IEO A;  5KP4 A;  3KSE D;  3DZL A;  3LTD A;  3F40 A;  3E99 A;  1IVX A;  5CK6 A;  1DVD A;  1W6G A;  1W7C A;  2CG0 A;  3VGN A;  4ORL A;  2IMJ A;  4J8T A;  2INX A;  5TGN A;  3U97 A;  1W6C A;  5KP1 A;  1YI2 3;  1K41 A;  4X2O A;  1OHP A;  3STD A;  5BVB A;  4OUQ A;  1VQL 3;  4XB5 A;  2LYX A;  4H3U A;  2P38 A;  3OWU A;  2Y74 A;  3S29 A;  5I97 A;  1OUN A;  2RSX A;  5G2G A;  4K61 A;  3EJV A;  3LTA A;  2W9Q A;  4WYK A;  2OOV A;  4WYK B;  3SLU A;  3PCS A;  3MWZ A;  1LXE A;  2YFJ B;  1N5H A;  1VQO 3;  2XR8 B;  3FG3 A;  1O7G B;  2CHC A;  3FH1 A;  2ZDJ A;  3SOY A;  1VQ6 3;  3UNL A;  4K90 B;  4MMY B;  1ROV A;  4JRF A;  3MG2 A;  1N8R 4;  1Q7Y 4;  1YIJ 3;  3FLJ A;  1NJI 4;  1Z1S A;  4HM8 B;  2BT3 A;  2W04 A;  1WTH A;  3K9M C;  3N54 B;  1V74 A;  2ZL8 A;  1OH0 A;  5A0O B;  1VQK 3;  3QRD A;  3EQQ B;  1ULJ B;  3CNX A;  4IT7 A;  1CEW I;  2WOF A;  2XEP A;  2W0Q A;  3EE1 A;  1KQS 2;  1W2B 2;  4KVH A;  4CDL A;  5AIF A;  2O9U X;  5AIG A;  3VF1 A;  2Y73 A;  4HVN A;  1HU9 A;  4PEJ A;  1IV9 A;  1JB5 A;  3CCL 3;  1M90 4;  3HZP A;  3PYJ A;  1KWI A;  1K9M 4;  5JBS A;  1IQX A;  1YJ9 3;  2F86 B;  4MMX B;  1FA3 A;  1E3V A;  2M7O A;  3CME 3;  2OTJ 3;  2SBL A;  1STD A;  2KRT A;  2FNQ A;  3GZX B;  3EBT A;  1LOX A;  4MEI A;  1NU3 A;  1E97 A;  2F98 A;  2XF3 A;  1T5Y A;  3X3Z A;  1GY6 A;  1Q86 4;  4XBT A;  3IJE B;  1WMP A;  3GZB A;  2CC3 A;  1RKY A;  5CLK A;  2WOH A;  3KE7 A;  3NM2 A;  4O2H A;  1QVG 2;  5CF1 A;  3KFQ C;  4RBN A;  2V1L A;  2Z7A A;  3MPH A;  3G8Z A;  3NBB A;  5CF2 A;  1F8N A;  1L5G B;  1OCV A;  1VZZ A;  3D3L A;  3FCS B;  3JUO A;  3X3X A;  1EA2 A;  3NQZ A;  2W6J H;  5IEN A;  3CCR 3;  1JNQ A;  1OGX A;  1A2K A;  1TIJ A;  1VQP 3;  3JUM A;  3ECF A;  2YFL B;  2OQE A;  3CCS 3;  1J2B A;  1ISK A;  3EC9 A;  2KXG A;  4N6L A;  1SJW A;  2HMM B;  4WHA A;  3MG3 A;  1KD1 4;  4WWU C;  3F7X A;  1IVU A;  5IG0 A;  5IG4 A;  2C11 A;  1A67 A;  2OCT A;  3F8H A;  5AI1 A;  1YJN 3;  3K63 A;  3LT9 A;  1TP6 A;  1W4N A;  1Y4K A;  5FGO A;  2HML B;  4HM0 B;  4LZI A;  4CCV A;  1HKX A;  3CU3 A;  3MKI A;  3WA3 A;  1FGR A;  3FG4 A;  1O7H B;  3B8L A;  1WNH A;  2QIY A;  3LOY A;  5AII A;  1TFO A;  2CW9 A;  4HM5 B;  1VQ7 3;  3LXU X;  3K0Z A;  3OV4 A;  3CCM 3;  1FGQ A;  1A2V A;  1LNH A;  1Q42 A;  3FSD A;  1RJO A;  3V98 A;  3MHE A;  1ZO2 A;  3TDG A;  4R1K A;  1S72 3;  1U5O A;  3F9S A;  3SED A;  2RGQ A;  2P09 A;  3ER7 A;  1JV2 B;  3FGY A;  1UI8 A;  4KFE A;  3LT8 A;  3KN4 A;  3FZW A;  2PZV A;  2I9W A;  2XGL A;  1E3R A;  4MMZ B;  2JDI H;  5AIH A;  2BHM A;  2GBX B;  3LH4 A;  4L8O A;  4R4K A;  3V92 A;  3B4P A;  2Z6B A;  1N5P A;  3ALA A;  2B1X B;  1NO3 A;  3EB8 A;  4EV2 A;  3GWR A;  3OWY A;  3HK4 A;  1IVW A;  5AYR B;  4WFO A;  3S5C A;  3HI7 A;  4HZB B;  4L8P A;  3IPT A;  2CFL A;  1GD4 A;  1YIT 3;  3GRD A;  3GAX A;  3BNB A;  4LGQ A;  2CFK A;  4FCJ A;  5DRE A;  1YVB I;  2ML6 A;  3JUN A;  3DGN A;  3VSY A;  4BTX A;  1PU4 A;  1DYU A;  2FXT A;  3PS8 A;  1JN5 A;  1JN5 B;  1OHS A;  1ZX2 A;  1JB4 A;  3G0K A;  4K1U A;  4N6O B;  1M9G A;  4QWT A;  3F14 A;  1WMN A;  1QAL A;  4AKZ A;  1JJ2 2;  4LMI A;  3N8B A;  3CPO A;  1K28 A;  3LML A;  1PFP A;  1FGT A;  2B24 B;  2CK3 H;  3NBR A;  4N6V 0;  3F8X A;  1YHQ 3;  2F99 A;  2CWU A;  3JUQ A;  1ROA A;  3OW2 2;  1GYB A;  1US1 A;  5AEU B;  2GEY A;  2Z77 A;  5LC6 A;  3T8U A;  1CYV A;  3GZY B;  4HYZ A;  5HGR A;  1UUW B;  3I56 3;  3DMC A;  1STF I;  3BB9 A;  3OWS A;  4RNZ A;  3V99 A;  3S28 A;  1IT7 A;  5EVH A;  1CQS A;  1IDP A;  4N6M A;  1NWW A;  4AEQ A;  3X3Y A;  4R80 A;  5CXO A;  5D83 A;  2PNC A;  1WQL B;  5IG3 A;  1OGZ A;  1UUV B;  1IU7 A;  1TUH A;  4XM4 A;  3DUK A;  2E2T A;  3T8N A;  2W2C A;  3CCJ 3;  1IQY A;  5ELU A;  1D6U A;  5EEO A;  3FKA A;  4Q53 A;  5D82 A;  2K54 A;  3KKG A;  4FR9 A;  3H3H A;  1Q81 4;  3JUP A;  2GXF A;  3AMO A;  3JVC A;  1ULI B;  1O7N B;  3MYT A;  3QK9 A;  4X2H A;  2CFW A;  2E2U A;  2C10 A;  5IW9 A;  2GEX A;  1EG9 B;  1SII A;  1U8C B;  1OAC A;  2CWV A;  2ML5 A;  1GS3 A;  3SXX A;  3Q2P A;  3F7S A;  2GU3 A;  1MNL A;  1AV4 A;  2IA7 A;  4JF8 A;  3M8C A;  3EBY A;  4WP5 A;  1VQ4 3;  1QVF 2;  4H61 A;  3DGM A;  4NHF A;  5IER A;  1SPU A;  2BO9 B;  2STD A;  2XGN A;  3H51 A;  5LC7 A;  3GZR A;  2WGQ A;  4K1V A;  1OF5 A;  4N3V A;  1N9J A;  1OF5 B;  1VQM 3;  1M1X B;  3T0U A;  4LEH A;  3X42 A;  1MOL A;  3LTB A;  4EYC A;  1W02 A;  4U13 A;  3CC4 3;  2JQ5 A;  3Q1C A;  4RZM A;  1YGE A;  2LQV A;  4O02 B;  4HM7 B;  4AKY A;  1IV7 A;  3LTC A;  3NV0 A;  1RRL A;  3NV0 B;  3S67 A;  3G71 3;  5FW5 A;  1SIH A;  1DMN A;  2GU1 A;  3IMA B;  3MSO A;  1AVL A;  4GL6 A;  4ZM8 A;  2W03 A;  2CWT A;  2OWP A;  2CKF B;  3EN1 B;  3CNM A;  5JPP A;  4N6U A;  2GBW B;  3DGL A;  1IVV A;  2P0X A;  3KZT A;  2RFR A;  5KP3 A;  1DMM A;  1W01 A;  2BMR B;  1LVN A;  3EN8 A;  1M1K 4;  3LYG A;  1Q82 4;  2HMJ B;  2XSH B;  1IT8 A;  1UI7 A;  1A90 A;  1Q40 A;  1DMQ A;  2CIU A;  4KFD A;  2HMO B;  2CFD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...