5A0OB

Adhiron raised against p300
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
93
structure length
93
Chain Sequence
ASNSLEIEELARFAVDEHNKKENALLEFVRVVKAKEQANLYLSTPIDTMYYLTLEAKDGGKKKLYEAKVWVKHIMYYPKTANFKELQEFKPVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords ADHIRON
publication title Exploration of the Hif-1Alpha.P300 Interface Using Peptide and Adhiron Phage Display Technologies
pubmed doi rcsb
source organism Synthetic construct
total genus 16
structure length 93
sequence length 93
chains with identical sequence S
ec nomenclature
pdb deposition date 2015-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5a0oB00
1CYVA 2KXGA 1R4CA 3L0RA 1PFPA 3LH4A 3KSED 3KFQC 5A0OB 2BO9B 2W9QA 1WNHA 1IV7A 1G96A 3PS8A 1YVBI 3UL5A 1M9GA 4N6LA 1EQKA 4N6MA 4IT7A 3NX0A 1N5HA 1N5PA 3MWZA 4CCVA 1N9JA 4N6NB 5EQLA 1DVCA 4N6OB 4LZIA 1KWIA 4N6UA 1FA3A 4N6V0 3UL6A 1LXEA 1TIJA 3Q2PA 3GAXA 1GD3A 1MNLA 4EYCA 5LC7A 1A90A 1CYUA 1FUWA 2CH9A 1NB3I 4N6TA 1A67A 3S67A 1DVDA 5ELUA 3QRDA 4ZM8A 1IV9A 3PXMA 2OCTA 2O9UX 2W9PA 1NB5I 1RN7A 1GD4A 1CEWI 3K9MC 3PYJA 1STFI 3SVAA 4TX4A 5ELJA 3IMAB 5LC6A 1ROAA 1MOLA
chains in the Genus database with same CATH superfamily
3DGLA 1JNQA 2BIRA 3HK4A 3B4PA 3PCSA 3FCSB 3DGNA 3S5CA 4H3UA 3I553 1RHLA 2HMOB 1Q40A 3KSED 2H0GA 3ROBA 3D3LA 3F8XA 2GEYA 3MPHA 3KKGA 4CJNA 5JPPA 1GYBA 1A2VA 4BTWA 2CWVA 1VQ63 1SIIA 2BO9B 3LZAA 1Z1SA 1GMPA 1N8R4 1IYYA 2XFSA 1RGCA 3EF8A 2E2UA 3LTAA 1Q7HA 2XEPA 1BSAA 1YGWA 2P05A 2ZHXB 3EN8A 3FG4A 3Q1CA 4WYKB 3NBRA 2F4YA 4IPBA 2CFKA 3X41A 1O7MB 2C10A 2OWPA 2GU3A 1M1XB 1T2HA 3SYUA 1UI8A 2RCDA 1B2ZA 1I2GA 1MGRA 4HJLB 1M9GA 3U1WA 1IVVA 4L7KA 1RGGA 1UUVB 1RGFA 3OWYA 3WHOA 2SARA 5M1AA 1S723 1W6GA 1BUJA 1JN5B 4H61A 5CF1A 3I563 1BRJA 2Z77A 1JJ22 4HM0B 1AR0A 1BNJA 1BSDA 4NHFA 1N5HA 4K1UA 3URPA 3WA2X 2HOHA 2KF3A 3LT8A 3MWZA 1AVKA 4LMIA 4XBXA 1YJ93 1RTUA 1YHQ3 1IT8A 2W03A 4N6NB 4HZBB 1JKGA 3H51A 4HVNA 5KP4A 3CCM3 1I8VA 4FMBA 1BNEA 4STDA 5D81A 3CPOA 7STDA 1JV2B 2KF6A 1KWIA 1UDII 3HI7A 3N54B 1ROVA 2B24B 4FCMA 1FGMA 3LOYA 1LOVA 4N6UA 4R1KA 5AI1A 2XFTA 1BRSA 1W02A 1U5OA 2HMJB 4XBTA 4XM4A 1BSEA 1D6UA 1W01A 3EQQB 3NM7A 4GHOA 4X2HA 3VGNA 3AHSA 1WMPA 4MMXB 2KRTA 3HX8A 1LVNA 1TIJA 1TRPA 2OTJ3 2BMRB 1B3SA 1IVUA 1RJOA 3Q2PA 2WO0A 5IF6A 3LYGA 4BTXA 4R9KA 1WMOA 1RMSA 3GRDA 4WYKA 2Z7AA 1BNFA 1KD14 1W5ZA 1AY7A 1IVWA 2STDA 3MG2A 3CXC2 3F9SA 2CX0A 1UCLA 1C7HA 1NJI4 4U13A 3V98A 1VQ73 3DUKA 3CU3A 2YFJB 3VF1A 3G16A 1CH0A 1OHSA 1VQ93 1EG9B 2CKFB 1WMNA 1LQGC 1JZDA 4LYLB 1QVG2 1JN5A 1FGOA 1LOYA 5IG3A 2L4VA 3DGOA 1O7NB 1JB4A 1N9EA 3GWRA 1GOYA 5D82A 5BIRA 3CC23 1TRQA 3CPW2 2BHMA 3CCE3 5CK6A 3EBTA 1KC84 2W9PA 3ER7A 1Q824 4J5KA 1UUWB 1UGIA 3DMCA 5FW5A 1B2XA 2BU4A 1CEWI 3JVCA 1L5GB 5BXQA 3KIIA 1V57A 4XB5A 1AQZA 1BNIA 3CCR3 1PU4A 3D5GA 5JBSA 1VQP3 1GY5A 4MMZB 1D6ZA 1K28A 3X3YA 2K54A 1GMRA 2F5MA 3GSPA 3OX9A 1A2PA 1AV4A 1O7WB 4RNYA 1J2BA 1VZZA 3GZRA 1T3BA 1W2B2 1IQXA 1MOLA 2LQVA 4FCZA 2QA43 1STDA 2CFGA 3EX9A 1KSIA 4HZ9B 1X1UA 4O02B 2KXGA 4L8OA 3T8NA 4KT3B 1OF5B 1PFPA 4G1MB 4EBGA 1JBRA 5JPUA 5AIHA 2W6JH 3CCS3 4RZMA 1GY6A 4KVHA 4KFFA 1BRNL 1GS3A 7GSPA 3NV0B 1QMAA 3X3XA 4EV2A 1WNHA 1D6YA 1IV7A 2BT3A 4BL2A 3HIGA 3EE1A 4HAAA 4J5GA 5CF2A 1N8QA 1YIT3 1RCKA 3M8CA 1UCKA 3LTBA 1NU3A 1JZOA 1GOUA 3EJVA 4FMDA 1K734 4R9LA 3QK9A 3AGOA 4K61A 3F8HA 3ALAA 1VQ53 1ZS7A 4N6LA 3LTDA 3CNXA 3DGMA 1AVLA 3WOFB 3BNEA 1BOXA 4FMAA 1LRAA 1BRIA 3UB1A 2Z6BA 2CFDA 2IMJA 3FZWA 4IT7A 4OK0A 3NX0A 2GBWB 1E3VA 3EN1B 4EXRA 4HM1B 1OGXA 1IK3A 3MG1A 3O8YA 5CXOA 1JBTA 1RDSA 1TTOA 2M7OA 1BUQA 2CC3A 1N5PA 3S29A 5FGOA 1N9JA 1BAOA 3G713 4ILFA 3SLUA 3WA3A 1BGSA 2GXFA 1S5AA 4GB5A 3RGRA 2RBIA 2W56B 1O7HB 5HOHA 4N6OB 3BIRA 3X40A 7RNTA 4HM3B 3X3ZA 5AIIA 4Q53A 1LNIA 3WODG 1W2ZA 3DZLA 9RNTA 4WHAA 3WMDA 4O2HA 3EHCA 2I9WA 1W6CA 4EC6A 1IT7A 3STDA 1OF5A 1SPUA 1X1XA 3G4S3 3K5TA 3SX1A 3UL6A 1EKMA 3B4OA 1LXEA 1A2KA 2ZDJA 3OWSA 5DRVA 1UW1A 2V1LA 2K0MA 2W2CA 3JUNA 1B27A 3NV0A 1FGTA 1I0XA 1DE3A 2RNTA 3UJMA 1GD3A 4N3VA 3CC43 2CIUA 5M18A 1FYSA 3G0KA 2PZVA 2IA7A 1YIJ3 1VQ83 1QVF2 1CYUA 2LYXA 1BNSA 1CQSA 1LOWA 1TP6A 2XR8B 2CH9A 3GZBA 3K0ZA 5DREA 1FUWA 2OQEA 3MSOA 4N6TA 3FKAA 4HM6B 2XSHB 3DGYA 3T0UA 1TUHA 3S67A 1RN1A 1Q864 2INXA 3KSPA 5ELUA 1YVSA 4WP5A 3SEDA 1NWWA 3TDGA 4ZM8A 1WTHA 4HBRA 1RNBA 2CW9A 1IV9A 3FF0A 2XGLA 3D4AA 3CNMA 4ORLA 1NB5I 1T5YA 2ZL8A 3K7CA 1VQN3 2C4BA 5AEWB 4XDWA 3FG1A 4X2OA 3WOEB 1W7CA 3K9MC 5AYRB 1BU4A 1STFI 1FZUA 3AGNA 3NHXA 3PYJA 4RBNA 4J9AA 1TJDA 4TX4A 1UCIA 5IG4A 2W56A 3IMAB 2JQ5A 3N8BA 3JUQA 1BRGA 5LC6A 1ISKA 1ROAA 3BU4A 5BVBA 1RRHA 1EUIC 1HZ1A 4HM5B 4LEHA 1ULJB 2F86B 1W4NA 3T8UA 2WOHA 3CCU3 1RGEA 1R4CA 4MMYB 3L0RA 1TU5A 3LH4A 1RNTA 1OCVA 1GMQA 1IU7A 3KFQC 3ZG5A 5IEOA 5A0OB 3ZFZA 2QEX3 3LXUX 1BNGA 3SOAA 3E99A 3BNCA 5KP1A 2CK3H 3ECFA 3FG3A 2W9QA 2ML6A 2CWTA 2P0MA 1DMNA 1VQO3 2CG0A 3RGAA 1QAFA 1LOXA 4DKIA 4BIRA 3PS8A 2MC8A 3Q3FA 1YVBI 3JUOA 1SIHA 4I4KA 3UL5A 2BMQB 1UUGB 5AIFA 3VSYA 1GOVA 5CLKA 1MWSA 3FGYA 5G1KA 1LQMB 1TFKA 3NM2A 2KF5A 1NNVA 4RNTA 3CME3 6RNTA 2WGOA 3JUMA 4PEJA 3D79A 2JDIH 3EBYA 2F98A 2MF7A 1YGEA 2UGIA 2F56A 2FXTA 1U8CB 2AAEA 1RGKA 2HMKB 3HZPA 5STDA 4AEQA 5IENA 1BSCA 2RFRA 1B2UA 4CCVA 3SXXA 2Q07A 2CFWA 1SARA 1R4YA 2UX0A 3GZXB 3OWUA 1RGHA 1T2IA 2IUKA 3FF2A 1RKYA 4LSOA 4LZIA 1Q7Y4 2ML5A 3WDGB 2XRXB 1IVXA 5EEOA 3CCQ3 2XSOB 1I3IA 3DY5A 1W00A 2H0HA 1I3FA 2RSXA 3HIIA 4EW5A 1UCJA 3FH1A 1B2SA 3G8ZA 5IEPA 3CCV3 4GSPA 4BTYA 4J8TA 4N6V0 2CFLA 1PYLA 1MWUA 3DXOA 1TFOA 2K3DA 4AKZA 2SBLA 1ULIB 3GAXA 4JRFA 2R4IA 1QALA 2A15A 2FGTA 2WGQA 3B8LA 1FGQA 2GSPA 1MNLA 2E2TA 2OOVC 4I5QA 5AYSC 2YFIB 1V74A 2KAAA 2P09A 4HKVB 4HYZA 1MWTA 3UNLA 5RNTA 1Y4KA 1ZX2A 3KN4A 1NB3I 3GZYB 4L8PA 3I0YA 1X1WA 3A5EA 4GL6A 3AMOB 1VQK3 4OUQA 1A67A 2GBXB 3AHWA 3PCRA 5G2GA 5HGRA 1E97A 1DVDA 2O3OA 2YX9A 4BL3A 1PY3A 3RNTA 3OW22 1I2EA 3BLZA 3KZTA 1I0VA 2OCTA 4OVMA 2GEXA 3CMA3 2CWUA 2HMMB 1LNHA 4HM2B 3IJEB 2L1SA 1VQM3 1JB2A 3SVAA 1UI7A 1YNVX 1VQL3 1ZO2A 4XBYA 1BSBA 6GSPA 1QJGA 3D9RA 3HOHA 2IY2A 1JBSA 3OV4A 3J7Yd 2IUJA 1Q9EA 5IG5A 3LTCA 3BB9A 3FSDA 1SJWA 4AKYA 1VQ43 1MGWA 2CG1A 1IQYA 2W0QA 1F8NA 2PNCA 1CYVA 2W04A 5M19A 5I97A 2CHCA 1UGHI 1G02A 4CPKA 1OUNA 3FLJA 4WWUC 5AEUB 1X1YA 1OACA 6STDA 4CDLA 1W6YA 1OHPA 2YFLB 1M904 8CHOA 2B1XB 1K8A4 2QGUA 2E2VA 2Z76A 1Q814 1K41A 4IIAA 2XGNA 1RSNA 2P38A 4LGQA 2QIYA 1EA2A 1G96A 4KFEA 3BNBA 3K63A 1KQS2 3S27A 1B20A 4R4KA 3SOYA 2F5WA 1FW7A 3DM8A 1BNRA 3F14A 3AMOA 4KFDA 2IYJA 4HM8B 3NQZA 4O8SA 3Q90A 5D83A 2CX1A 1OGZA 1EQKA 4O3VA 3LMLA 4XDVA 3U97A 3KCHA 4N6MA 4R80A 2Y73A 4QWTA 3BNDA 1WQLB 1HKXA 1VQQA 1QAKA 3A76A 3F7XA 1GSPA 2J8XB 1JRQA 3MKIA 4FR9A 1US1A 4RNZA 1OPYA 1C54A 2RGQA 5TGNA 2D1WA 1YJW3 3B7CA 2HMLB 3NQYA 5KP3A 1DYUA 4HM4B 1DETA 5EQLA 2KF4A 3LT9A 1DVCA 1G0TA 5BU4A 1I70A 1BANA 3PGBA 4MJDA 3ZG0A 5AIGA 1YI23 2HMNB 1HU9A 4MEIA 4WFOA 1RLSA 4FCJA 1GY7A 3G6E3 1BIRA 3F7SA 4K1VA 1B2MA 1FA3A 2OQEC 3F40A 2C11A 4EV5A 4JF8A 1Q40B 1RGLA 3MHEA 1RCLA 3V99A 1B21A 3NXJA 2F99A 1FGRA 1ASKA 2OOVA 1BVIA 2BMOB 1RRLA 2XF3A 1M1K4 4NPBA 1ZGXA 3EB8A 3NUVA 5G1LA 2GU1A 1BRHA 1EEJA 5LC7A 4EYCA 1I2FA 3MG3A 3JUPA 4FMCA 5GSPA 5IG0A 1YJN3 1A90A 3D5IA 3N9HA 4HM7B 3WR2A 1FUSA 1RN4A 1MWRA 1E3RA 1BRKA 3DH2A 2R41A 3H3HA 4K90B 1O7GB 2ZA4A 5EVHA 1IDPA 1DMQA 2UUGC 4NREA 3PZWA 3CC73 3QRDA 2P0XA 2XH9A 5IERA 3OXAA 1JB5A 3PXMA 3S28A 1SQWA 2KCDA 2WOFA 2O9UX 3CD63 1RN7A 3KE7A 1GD4A 2OTL3 1DMMA 3IPTA 3CCJ3 1O7PB 1NO3A 2D42A 3CCL3 4KZ1A 2Y74A 3NBJA 1K9M4 1OHOA 3X42A 8RNTA 1OH0A 3EC9A 1JKGB 3NBBA 4HOHA 1V58A 5ELJA 1NDOB 1RGAA 1Q42A 2AADA 2BNGA 2FNQA 1FUTA 4BU4A 1IQ8A 3V92A 3MYTA 2H0IA 5IW9A 1HYFA 3RDEA
chains in the Genus database with same CATH topology
3DGLA 1JNQA 3HK4A 3B4PA 3PCSA 3FCSB 3DGNA 3S5CA 4H3UA 3I553 2HMOB 3ROBA 1Q40A 3KSED 5JPPA 3D3LA 3F8XA 2GEYA 3MPHA 3KKGA 1GYBA 1A2VA 4BTWA 2CWVA 1VQ63 1SIIA 2BO9B 3LZAA 1Z1SA 1N8R4 2XFSA 3EF8A 2E2UA 3LTAA 2XEPA 2P05A 3FG4A 3Q1CA 4WYKB 3EN8A 3NBRA 4IPBA 3X41A 2CFKA 1O7MB 2C10A 2OWPA 2GU3A 1M1XB 1UI8A 2RCDA 1M9GA 3U1WA 1IVVA 4L7KA 1UUVB 3OWYA 1S723 1W6GA 1JN5B 4H61A 5CF1A 3I563 2Z77A 1JJ22 4HM0B 1AR0A 4NHFA 1N5HA 4K1UA 3WA2X 3LT8A 3MWZA 1AVKA 4LMIA 4XBXA 1YJ93 1YHQ3 1IT8A 2W03A 4N6NB 4HZBB 1JKGA 3H51A 4HVNA 5KP4A 3CCM3 4FMBA 4STDA 5D81A 3CPOA 7STDA 1JV2B 1KWIA 3HI7A 3N54B 1ROVA 2B24B 4FCMA 1FGMA 3LOYA 5AI1A 4N6UA 4R1KA 2XFTA 1W02A 1U5OA 2HMJB 4XBTA 4XM4A 1D6UA 1W01A 3EQQB 3NM7A 3VGNA 4X2HA 1WMPA 4MMXB 2KRTA 3HX8A 1LVNA 1TIJA 2OTJ3 2BMRB 3Q2PA 1IVUA 1RJOA 2WO0A 5IF6A 3LYGA 4BTXA 4R9KA 1WMOA 4WYKA 3GRDA 2Z7AA 1KD14 1W5ZA 1IVWA 2STDA 3MG2A 3CXC2 3F9SA 1C7HA 1NJI4 4U13A 3V98A 1VQ73 3DUKA 3CU3A 2YFJB 3VF1A 3G16A 1OHSA 1VQ93 1EG9B 2CKFB 1WMNA 1QVG2 1JN5A 1FGOA 5IG3A 2L4VA 3DGOA 1O7NB 1JB4A 1N9EA 3GWRA 5D82A 3CC23 3CCE3 3CPW2 2BHMA 5CK6A 3EBTA 1KC84 2W9PA 3ER7A 1Q824 1UUWB 3DMCA 5FW5A 1L5GB 1CEWI 3JVCA 5BXQA 3KIIA 4XB5A 3CCR3 1PU4A 5JBSA 1VQP3 1GY5A 4MMZB 1D6ZA 1K28A 3X3YA 2K54A 3OX9A 4RNYA 1J2BA 1AV4A 1O7WB 1VZZA 3GZRA 1W2B2 1IQXA 1MOLA 2LQVA 4FCZA 2QA43 1STDA 2CFGA 3EX9A 1KSIA 4HZ9B 4O02B 2KXGA 4L8OA 3T8NA 1OF5B 1PFPA 4G1MB 4EBGA 5JPUA 5AIHA 2W6JH 3CCS3 4RZMA 1GY6A 4KVHA 4KFFA 1GS3A 3NV0B 1QMAA 3X3XA 4EV2A 1WNHA 1D6YA 1IV7A 2BT3A 3HIGA 3EE1A 5CF2A 1YIT3 1N8QA 3M8CA 3LTBA 1NU3A 3EJVA 4FMDA 1K734 4R9LA 3QK9A 4K61A 3F8HA 3ALAA 1VQ53 4N6LA 3LTDA 3CNXA 3DGMA 1AVLA 3WOFB 3BNEA 4FMAA 3UB1A 2Z6BA 2CFDA 2IMJA 3FZWA 4IT7A 4OK0A 3NX0A 2GBWB 1E3VA 3EN1B 4EXRA 4HM1B 1OGXA 1IK3A 3MG1A 3O8YA 5CXOA 2M7OA 1BUQA 2CC3A 1N5PA 3S29A 5FGOA 1N9JA 3G713 3SLUA 3WA3A 2GXFA 4GB5A 1S5AA 3RGRA 2W56B 1O7HB 4N6OB 3X40A 4HM3B 3X3ZA 5AIIA 4Q53A 3WODG 1W2ZA 3DZLA 4WHAA 3WMDA 4O2HA 3EHCA 2I9WA 1W6CA 4EC6A 1IT7A 3STDA 1OF5A 1SPUA 3G4S3 3K5TA 3SX1A 3UL6A 1EKMA 3B4OA 1LXEA 1A2KA 2ZDJA 3OWSA 5DRVA 1UW1A 2V1LA 2K0MA 2W2CA 3JUNA 3NV0A 1FGTA 3UJMA 1GD3A 4N3VA 3CC43 2CIUA 3G0KA 2PZVA 2IA7A 1YIJ3 1VQ83 1QVF2 1CYUA 2LYXA 1CQSA 3GZBA 1TP6A 5DREA 2XR8B 2CH9A 3K0ZA 1FUWA 2OQEA 3MSOA 4N6TA 3FKAA 4HM6B 2XSHB 3T0UA 1TUHA 3S67A 1Q864 2INXA 3KSPA 5ELUA 4WP5A 3SEDA 1NWWA 3TDGA 4ZM8A 1WTHA 4HBRA 2CW9A 1IV9A 3FF0A 2XGLA 4ORLA 3CNMA 1NB5I 1T5YA 2ZL8A 3K7CA 1VQN3 5AEWB 4XDWA 3FG1A 4X2OA 3WOEB 1W7CA 3K9MC 5AYRB 3PYJA 1STFI 3NHXA 4RBNA 4J9AA 5IG4A 4TX4A 2W56A 3IMAB 2JQ5A 3N8BA 3JUQA 5LC6A 1ISKA 1ROAA 5BVBA 1RRHA 4HM5B 4LEHA 1ULJB 2F86B 1W4NA 3T8UA 2WOHA 3CCU3 1R4CA 4MMYB 3L0RA 1TU5A 3LH4A 1OCVA 1IU7A 3KFQC 5IEOA 5A0OB 2QEX3 3LXUX 3SOAA 3E99A 3BNCA 5KP1A 2CK3H 3ECFA 3FG3A 2W9QA 2ML6A 2CWTA 2P0MA 1DMNA 1VQO3 2CG0A 3RGAA 1QAFA 1LOXA 3PS8A 2MC8A 1YVBI 3JUOA 1SIHA 4I4KA 3UL5A 2BMQB 5AIFA 3VSYA 5CLKA 3FGYA 1TFKA 3NM2A 3CME3 2WGOA 3JUMA 4PEJA 2JDIH 3EBYA 2F98A 2MF7A 1YGEA 2FXTA 1U8CB 2HMKB 3HZPA 5STDA 4AEQA 5IENA 2RFRA 4CCVA 3SXXA 2Q07A 2CFWA 2UX0A 3GZXB 3OWUA 1RKYA 2IUKA 3FF2A 4LSOA 4LZIA 1Q7Y4 2ML5A 3WDGB 2XRXB 1IVXA 5EEOA 3CCQ3 2XSOB 3DY5A 1W00A 2RSXA 3HIIA 3FH1A 3G8ZA 5IEPA 3CCV3 4BTYA 4J8TA 4N6V0 2CFLA 3DXOA 1TFOA 4AKZA 2SBLA 1ULIB 3GAXA 4JRFA 2R4IA 1QALA 2A15A 2FGTA 2WGQA 3B8LA 1FGQA 1MNLA 2E2TA 2OOVC 5AYSC 2YFIB 1V74A 2P09A 4HKVB 4HYZA 3UNLA 1Y4KA 1ZX2A 3KN4A 1NB3I 3GZYB 4L8PA 3I0YA 4GL6A 1VQK3 1A67A 3AMOB 4OUQA 2GBXB 3PCRA 5G2GA 5HGRA 1DVDA 1E97A 2O3OA 2YX9A 3OW22 3BLZA 3KZTA 2OCTA 4OVMA 2GEXA 3CMA3 2CWUA 2HMMB 1LNHA 4HM2B 3IJEB 1VQM3 1JB2A 3SVAA 1UI7A 1VQL3 1ZO2A 4XBYA 1QJGA 3D9RA 3OV4A 3J7Yd 2IUJA 5IG5A 3LTCA 3BB9A 3FSDA 1SJWA 4AKYA 1VQ43 2CG1A 1IQYA 2W0QA 1F8NA 2PNCA 1CYVA 2W04A 5I97A 2CHCA 1OUNA 3FLJA 4WWUC 5AEUB 1OACA 6STDA 4CDLA 1W6YA 1OHPA 2YFLB 1M904 8CHOA 2B1XB 1K8A4 2QGUA 2E2VA 2Z76A 1Q814 1K41A 4IIAA 2XGNA 2P38A 4LGQA 2QIYA 1EA2A 1G96A 4KFEA 3BNBA 3K63A 1KQS2 3S27A 4R4KA 3SOYA 3DM8A 3F14A 3AMOA 4KFDA 4HM8B 3NQZA 4O8SA 3Q90A 5D83A 1OGZA 1EQKA 4O3VA 3LMLA 4XDVA 3U97A 4N6MA 4R80A 2Y73A 4QWTA 3BNDA 1WQLB 1HKXA 1QAKA 3A76A 3F7XA 3MKIA 4FR9A 1JRQA 4RNZA 1US1A 1OPYA 2RGQA 5TGNA 2D1WA 1YJW3 3B7CA 2HMLB 3NQYA 5KP3A 1DYUA 4HM4B 5EQLA 3LT9A 1DVCA 3PGBA 4MJDA 5AIGA 1YI23 2HMNB 1HU9A 4MEIA 4WFOA 4FCJA 1GY7A 3G6E3 3F7SA 4K1VA 1FA3A 2OQEC 3F40A 2C11A 4EV5A 4JF8A 1Q40B 3MHEA 3V99A 3NXJA 2F99A 1FGRA 1ASKA 2OOVA 2BMOB 1RRLA 2XF3A 1M1K4 3EB8A 3NUVA 2GU1A 4EYCA 5LC7A 1YJN3 1A90A 3MG3A 3JUPA 4FMCA 5IG0A 3N9HA 4HM7B 1E3RA 3H3HA 4K90B 1O7GB 5EVHA 1IDPA 1DMQA 4NREA 3PZWA 3CC73 3QRDA 2P0XA 2XH9A 5IERA 3OXAA 1JB5A 3PXMA 3S28A 1SQWA 2KCDA 2WOFA 2O9UX 3CD63 1RN7A 3KE7A 1GD4A 2OTL3 1DMMA 3IPTA 3CCJ3 1O7PB 1NO3A 2D42A 3CCL3 4KZ1A 2Y74A 3NBJA 1K9M4 1OHOA 3X42A 1OH0A 3EC9A 1JKGB 3NBBA 5ELJA 1NDOB 2FNQA 1Q42A 2BNGA 1IQ8A 3V92A 3MYTA 5IW9A 4HJLB 3RDEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CYV A;  2KXG A;  1R4C A;  3L0R A;  1PFP A;  3LH4 A;  3KSE D;  3KFQ C;  5A0O B;  2BO9 B;  2W9Q A;  1WNH A;  1IV7 A;  1G96 A;  3PS8 A;  1YVB I;  3UL5 A;  1M9G A;  4N6L A;  1EQK A;  4N6M A;  4IT7 A;  3NX0 A;  1N5H A;  1N5P A;  3MWZ A;  4CCV A;  1N9J A;  4N6N B;  5EQL A;  1DVC A;  4N6O B;  4LZI A;  1KWI A;  4N6U A;  1FA3 A;  4N6V 0;  3UL6 A;  1LXE A;  1TIJ A;  3Q2P A;  3GAX A;  1GD3 A;  1MNL A;  4EYC A;  5LC7 A;  1A90 A;  1CYU A;  1FUW A;  2CH9 A;  1NB3 I;  4N6T A;  1A67 A;  3S67 A;  1DVD A;  5ELU A;  3QRD A;  4ZM8 A;  1IV9 A;  3PXM A;  2OCT A;  2O9U X;  2W9P A;  1NB5 I;  1RN7 A;  1GD4 A;  1CEW I;  3K9M C;  3PYJ A;  1STF I;  3SVA A;  4TX4 A;  5ELJ A;  3IMA B;  5LC6 A;  1ROA A;  1MOL A; 
#chains in the Genus database with same CATH topology
 3DGL A;  1JNQ A;  2BIR A;  3HK4 A;  3B4P A;  3PCS A;  3FCS B;  3DGN A;  3S5C A;  4H3U A;  3I55 3;  1RHL A;  2HMO B;  1Q40 A;  3KSE D;  2H0G A;  3ROB A;  3D3L A;  3F8X A;  2GEY A;  3MPH A;  3KKG A;  4CJN A;  5JPP A;  1GYB A;  1A2V A;  4BTW A;  2CWV A;  1VQ6 3;  1SII A;  2BO9 B;  3LZA A;  1Z1S A;  1GMP A;  1N8R 4;  1IYY A;  2XFS A;  1RGC A;  3EF8 A;  2E2U A;  3LTA A;  1Q7H A;  2XEP A;  1BSA A;  1YGW A;  2P05 A;  2ZHX B;  3EN8 A;  3FG4 A;  3Q1C A;  4WYK B;  3NBR A;  2F4Y A;  4IPB A;  2CFK A;  3X41 A;  1O7M B;  2C10 A;  2OWP A;  2GU3 A;  1M1X B;  1T2H A;  3SYU A;  1UI8 A;  2RCD A;  1B2Z A;  1I2G A;  1MGR A;  4HJL B;  1M9G A;  3U1W A;  1IVV A;  4L7K A;  1RGG A;  1UUV B;  1RGF A;  3OWY A;  3WHO A;  2SAR A;  5M1A A;  1S72 3;  1W6G A;  1BUJ A;  1JN5 B;  4H61 A;  5CF1 A;  3I56 3;  1BRJ A;  2Z77 A;  1JJ2 2;  4HM0 B;  1AR0 A;  1BNJ A;  1BSD A;  4NHF A;  1N5H A;  4K1U A;  3URP A;  3WA2 X;  2HOH A;  2KF3 A;  3LT8 A;  3MWZ A;  1AVK A;  4LMI A;  4XBX A;  1YJ9 3;  1RTU A;  1YHQ 3;  1IT8 A;  2W03 A;  4N6N B;  4HZB B;  1JKG A;  3H51 A;  4HVN A;  5KP4 A;  3CCM 3;  1I8V A;  4FMB A;  1BNE A;  4STD A;  5D81 A;  3CPO A;  7STD A;  1JV2 B;  2KF6 A;  1KWI A;  1UDI I;  3HI7 A;  3N54 B;  1ROV A;  2B24 B;  4FCM A;  1FGM A;  3LOY A;  1LOV A;  4N6U A;  4R1K A;  5AI1 A;  2XFT A;  1BRS A;  1W02 A;  1U5O A;  2HMJ B;  4XBT A;  4XM4 A;  1BSE A;  1D6U A;  1W01 A;  3EQQ B;  3NM7 A;  4GHO A;  4X2H A;  3VGN A;  3AHS A;  1WMP A;  4MMX B;  2KRT A;  3HX8 A;  1LVN A;  1TIJ A;  1TRP A;  2OTJ 3;  2BMR B;  1B3S A;  1IVU A;  1RJO A;  3Q2P A;  2WO0 A;  5IF6 A;  3LYG A;  4BTX A;  4R9K A;  1WMO A;  1RMS A;  3GRD A;  4WYK A;  2Z7A A;  1BNF A;  1KD1 4;  1W5Z A;  1AY7 A;  1IVW A;  2STD A;  3MG2 A;  3CXC 2;  3F9S A;  2CX0 A;  1UCL A;  1C7H A;  1NJI 4;  4U13 A;  3V98 A;  1VQ7 3;  3DUK A;  3CU3 A;  2YFJ B;  3VF1 A;  3G16 A;  1CH0 A;  1OHS A;  1VQ9 3;  1EG9 B;  2CKF B;  1WMN A;  1LQG C;  1JZD A;  4LYL B;  1QVG 2;  1JN5 A;  1FGO A;  1LOY A;  5IG3 A;  2L4V A;  3DGO A;  1O7N B;  1JB4 A;  1N9E A;  3GWR A;  1GOY A;  5D82 A;  5BIR A;  3CC2 3;  1TRQ A;  3CPW 2;  2BHM A;  3CCE 3;  5CK6 A;  3EBT A;  1KC8 4;  2W9P A;  3ER7 A;  1Q82 4;  4J5K A;  1UUW B;  1UGI A;  3DMC A;  5FW5 A;  1B2X A;  2BU4 A;  1CEW I;  3JVC A;  1L5G B;  5BXQ A;  3KII A;  1V57 A;  4XB5 A;  1AQZ A;  1BNI A;  3CCR 3;  1PU4 A;  3D5G A;  5JBS A;  1VQP 3;  1GY5 A;  4MMZ B;  1D6Z A;  1K28 A;  3X3Y A;  2K54 A;  1GMR A;  2F5M A;  3GSP A;  3OX9 A;  1A2P A;  1AV4 A;  1O7W B;  4RNY A;  1J2B A;  1VZZ A;  3GZR A;  1T3B A;  1W2B 2;  1IQX A;  1MOL A;  2LQV A;  4FCZ A;  2QA4 3;  1STD A;  2CFG A;  3EX9 A;  1KSI A;  4HZ9 B;  1X1U A;  4O02 B;  2KXG A;  4L8O A;  3T8N A;  4KT3 B;  1OF5 B;  1PFP A;  4G1M B;  4EBG A;  1JBR A;  5JPU A;  5AIH A;  2W6J H;  3CCS 3;  4RZM A;  1GY6 A;  4KVH A;  4KFF A;  1BRN L;  1GS3 A;  7GSP A;  3NV0 B;  1QMA A;  3X3X A;  4EV2 A;  1WNH A;  1D6Y A;  1IV7 A;  2BT3 A;  4BL2 A;  3HIG A;  3EE1 A;  4HAA A;  4J5G A;  5CF2 A;  1N8Q A;  1YIT 3;  1RCK A;  3M8C A;  1UCK A;  3LTB A;  1NU3 A;  1JZO A;  1GOU A;  3EJV A;  4FMD A;  1K73 4;  4R9L A;  3QK9 A;  3AGO A;  4K61 A;  3F8H A;  3ALA A;  1VQ5 3;  1ZS7 A;  4N6L A;  3LTD A;  3CNX A;  3DGM A;  1AVL A;  3WOF B;  3BNE A;  1BOX A;  4FMA A;  1LRA A;  1BRI A;  3UB1 A;  2Z6B A;  2CFD A;  2IMJ A;  3FZW A;  4IT7 A;  4OK0 A;  3NX0 A;  2GBW B;  1E3V A;  3EN1 B;  4EXR A;  4HM1 B;  1OGX A;  1IK3 A;  3MG1 A;  3O8Y A;  5CXO A;  1JBT A;  1RDS A;  1TTO A;  2M7O A;  1BUQ A;  2CC3 A;  1N5P A;  3S29 A;  5FGO A;  1N9J A;  1BAO A;  3G71 3;  4ILF A;  3SLU A;  3WA3 A;  1BGS A;  2GXF A;  1S5A A;  4GB5 A;  3RGR A;  2RBI A;  2W56 B;  1O7H B;  5HOH A;  4N6O B;  3BIR A;  3X40 A;  7RNT A;  4HM3 B;  3X3Z A;  5AII A;  4Q53 A;  1LNI A;  3WOD G;  1W2Z A;  3DZL A;  9RNT A;  4WHA A;  3WMD A;  4O2H A;  3EHC A;  2I9W A;  1W6C A;  4EC6 A;  1IT7 A;  3STD A;  1OF5 A;  1SPU A;  1X1X A;  3G4S 3;  3K5T A;  3SX1 A;  3UL6 A;  1EKM A;  3B4O A;  1LXE A;  1A2K A;  2ZDJ A;  3OWS A;  5DRV A;  1UW1 A;  2V1L A;  2K0M A;  2W2C A;  3JUN A;  1B27 A;  3NV0 A;  1FGT A;  1I0X A;  1DE3 A;  2RNT A;  3UJM A;  1GD3 A;  4N3V A;  3CC4 3;  2CIU A;  5M18 A;  1FYS A;  3G0K A;  2PZV A;  2IA7 A;  1YIJ 3;  1VQ8 3;  1QVF 2;  1CYU A;  2LYX A;  1BNS A;  1CQS A;  1LOW A;  1TP6 A;  2XR8 B;  2CH9 A;  3GZB A;  3K0Z A;  5DRE A;  1FUW A;  2OQE A;  3MSO A;  4N6T A;  3FKA A;  4HM6 B;  2XSH B;  3DGY A;  3T0U A;  1TUH A;  3S67 A;  1RN1 A;  1Q86 4;  2INX A;  3KSP A;  5ELU A;  1YVS A;  4WP5 A;  3SED A;  1NWW A;  3TDG A;  4ZM8 A;  1WTH A;  4HBR A;  1RNB A;  2CW9 A;  1IV9 A;  3FF0 A;  2XGL A;  3D4A A;  3CNM A;  4ORL A;  1NB5 I;  1T5Y A;  2ZL8 A;  3K7C A;  1VQN 3;  2C4B A;  5AEW B;  4XDW A;  3FG1 A;  4X2O A;  3WOE B;  1W7C A;  3K9M C;  5AYR B;  1BU4 A;  1STF I;  1FZU A;  3AGN A;  3NHX A;  3PYJ A;  4RBN A;  4J9A A;  1TJD A;  4TX4 A;  1UCI A;  5IG4 A;  2W56 A;  3IMA B;  2JQ5 A;  3N8B A;  3JUQ A;  1BRG A;  5LC6 A;  1ISK A;  1ROA A;  3BU4 A;  5BVB A;  1RRH A;  1EUI C;  1HZ1 A;  4HM5 B;  4LEH A;  1ULJ B;  2F86 B;  1W4N A;  3T8U A;  2WOH A;  3CCU 3;  1RGE A;  1R4C A;  4MMY B;  3L0R A;  1TU5 A;  3LH4 A;  1RNT A;  1OCV A;  1GMQ A;  1IU7 A;  3KFQ C;  3ZG5 A;  5IEO A;  5A0O B;  3ZFZ A;  2QEX 3;  3LXU X;  1BNG A;  3SOA A;  3E99 A;  3BNC A;  5KP1 A;  2CK3 H;  3ECF A;  3FG3 A;  2W9Q A;  2ML6 A;  2CWT A;  2P0M A;  1DMN A;  1VQO 3;  2CG0 A;  3RGA A;  1QAF A;  1LOX A;  4DKI A;  4BIR A;  3PS8 A;  2MC8 A;  3Q3F A;  1YVB I;  3JUO A;  1SIH A;  4I4K A;  3UL5 A;  2BMQ B;  1UUG B;  5AIF A;  3VSY A;  1GOV A;  5CLK A;  1MWS A;  3FGY A;  5G1K A;  1LQM B;  1TFK A;  3NM2 A;  2KF5 A;  1NNV A;  4RNT A;  3CME 3;  6RNT A;  2WGO A;  3JUM A;  4PEJ A;  3D79 A;  2JDI H;  3EBY A;  2F98 A;  2MF7 A;  1YGE A;  2UGI A;  2F56 A;  2FXT A;  1U8C B;  2AAE A;  1RGK A;  2HMK B;  3HZP A;  5STD A;  4AEQ A;  5IEN A;  1BSC A;  2RFR A;  1B2U A;  4CCV A;  3SXX A;  2Q07 A;  2CFW A;  1SAR A;  1R4Y A;  2UX0 A;  3GZX B;  3OWU A;  1RGH A;  1T2I A;  2IUK A;  3FF2 A;  1RKY A;  4LSO A;  4LZI A;  1Q7Y 4;  2ML5 A;  3WDG B;  2XRX B;  1IVX A;  5EEO A;  3CCQ 3;  2XSO B;  1I3I A;  3DY5 A;  1W00 A;  2H0H A;  1I3F A;  2RSX A;  3HII A;  4EW5 A;  1UCJ A;  3FH1 A;  1B2S A;  3G8Z A;  5IEP A;  3CCV 3;  4GSP A;  4BTY A;  4J8T A;  4N6V 0;  2CFL A;  1PYL A;  1MWU A;  3DXO A;  1TFO A;  2K3D A;  4AKZ A;  2SBL A;  1ULI B;  3GAX A;  4JRF A;  2R4I A;  1QAL A;  2A15 A;  2FGT A;  2WGQ A;  3B8L A;  1FGQ A;  2GSP A;  1MNL A;  2E2T A;  2OOV C;  4I5Q A;  5AYS C;  2YFI B;  1V74 A;  2KAA A;  2P09 A;  4HKV B;  4HYZ A;  1MWT A;  3UNL A;  5RNT A;  1Y4K A;  1ZX2 A;  3KN4 A;  1NB3 I;  3GZY B;  4L8P A;  3I0Y A;  1X1W A;  3A5E A;  4GL6 A;  3AMO B;  1VQK 3;  4OUQ A;  1A67 A;  2GBX B;  3AHW A;  3PCR A;  5G2G A;  5HGR A;  1E97 A;  1DVD A;  2O3O A;  2YX9 A;  4BL3 A;  1PY3 A;  3RNT A;  3OW2 2;  1I2E A;  3BLZ A;  3KZT A;  1I0V A;  2OCT A;  4OVM A;  2GEX A;  3CMA 3;  2CWU A;  2HMM B;  1LNH A;  4HM2 B;  3IJE B;  2L1S A;  1VQM 3;  1JB2 A;  3SVA A;  1UI7 A;  1YNV X;  1VQL 3;  1ZO2 A;  4XBY A;  1BSB A;  6GSP A;  1QJG A;  3D9R A;  3HOH A;  2IY2 A;  1JBS A;  3OV4 A;  3J7Y d;  2IUJ A;  1Q9E A;  5IG5 A;  3LTC A;  3BB9 A;  3FSD A;  1SJW A;  4AKY A;  1VQ4 3;  1MGW A;  2CG1 A;  1IQY A;  2W0Q A;  1F8N A;  2PNC A;  1CYV A;  2W04 A;  5M19 A;  5I97 A;  2CHC A;  1UGH I;  1G02 A;  4CPK A;  1OUN A;  3FLJ A;  4WWU C;  5AEU B;  1X1Y A;  1OAC A;  6STD A;  4CDL A;  1W6Y A;  1OHP A;  2YFL B;  1M90 4;  8CHO A;  2B1X B;  1K8A 4;  2QGU A;  2E2V A;  2Z76 A;  1Q81 4;  1K41 A;  4IIA A;  2XGN A;  1RSN A;  2P38 A;  4LGQ A;  2QIY A;  1EA2 A;  1G96 A;  4KFE A;  3BNB A;  3K63 A;  1KQS 2;  3S27 A;  1B20 A;  4R4K A;  3SOY A;  2F5W A;  1FW7 A;  3DM8 A;  1BNR A;  3F14 A;  3AMO A;  4KFD A;  2IYJ A;  4HM8 B;  3NQZ A;  4O8S A;  3Q90 A;  5D83 A;  2CX1 A;  1OGZ A;  1EQK A;  4O3V A;  3LML A;  4XDV A;  3U97 A;  3KCH A;  4N6M A;  4R80 A;  2Y73 A;  4QWT A;  3BND A;  1WQL B;  1HKX A;  1VQQ A;  1QAK A;  3A76 A;  3F7X A;  1GSP A;  2J8X B;  1JRQ A;  3MKI A;  4FR9 A;  1US1 A;  4RNZ A;  1OPY A;  1C54 A;  2RGQ A;  5TGN A;  2D1W A;  1YJW 3;  3B7C A;  2HML B;  3NQY A;  5KP3 A;  1DYU A;  4HM4 B;  1DET A;  5EQL A;  2KF4 A;  3LT9 A;  1DVC A;  1G0T A;  5BU4 A;  1I70 A;  1BAN A;  3PGB A;  4MJD A;  3ZG0 A;  5AIG A;  1YI2 3;  2HMN B;  1HU9 A;  4MEI A;  4WFO A;  1RLS A;  4FCJ A;  1GY7 A;  3G6E 3;  1BIR A;  3F7S A;  4K1V A;  1B2M A;  1FA3 A;  2OQE C;  3F40 A;  2C11 A;  4EV5 A;  4JF8 A;  1Q40 B;  1RGL A;  3MHE A;  1RCL A;  3V99 A;  1B21 A;  3NXJ A;  2F99 A;  1FGR A;  1ASK A;  2OOV A;  1BVI A;  2BMO B;  1RRL A;  2XF3 A;  1M1K 4;  4NPB A;  1ZGX A;  3EB8 A;  3NUV A;  5G1L A;  2GU1 A;  1BRH A;  1EEJ A;  5LC7 A;  4EYC A;  1I2F A;  3MG3 A;  3JUP A;  4FMC A;  5GSP A;  5IG0 A;  1YJN 3;  1A90 A;  3D5I A;  3N9H A;  4HM7 B;  3WR2 A;  1FUS A;  1RN4 A;  1MWR A;  1E3R A;  1BRK A;  3DH2 A;  2R41 A;  3H3H A;  4K90 B;  1O7G B;  2ZA4 A;  5EVH A;  1IDP A;  1DMQ A;  2UUG C;  4NRE A;  3PZW A;  3CC7 3;  3QRD A;  2P0X A;  2XH9 A;  5IER A;  3OXA A;  1JB5 A;  3PXM A;  3S28 A;  1SQW A;  2KCD A;  2WOF A;  2O9U X;  3CD6 3;  1RN7 A;  3KE7 A;  1GD4 A;  2OTL 3;  1DMM A;  3IPT A;  3CCJ 3;  1O7P B;  1NO3 A;  2D42 A;  3CCL 3;  4KZ1 A;  2Y74 A;  3NBJ A;  1K9M 4;  1OHO A;  3X42 A;  8RNT A;  1OH0 A;  3EC9 A;  1JKG B;  3NBB A;  4HOH A;  1V58 A;  5ELJ A;  1NDO B;  1RGA A;  1Q42 A;  2AAD A;  2BNG A;  2FNQ A;  1FUT A;  4BU4 A;  1IQ8 A;  3V92 A;  3MYT A;  2H0I A;  5IW9 A;  1HYF A;  3RDE A; 
#chains in the Genus database with same CATH homology
 3DGL A;  1JNQ A;  3HK4 A;  3B4P A;  3PCS A;  3FCS B;  3DGN A;  3S5C A;  4H3U A;  3I55 3;  2HMO B;  3ROB A;  1Q40 A;  3KSE D;  5JPP A;  3D3L A;  3F8X A;  2GEY A;  3MPH A;  3KKG A;  1GYB A;  1A2V A;  4BTW A;  2CWV A;  1VQ6 3;  1SII A;  2BO9 B;  3LZA A;  1Z1S A;  1N8R 4;  2XFS A;  3EF8 A;  2E2U A;  3LTA A;  2XEP A;  2P05 A;  3FG4 A;  3Q1C A;  4WYK B;  3EN8 A;  3NBR A;  4IPB A;  3X41 A;  2CFK A;  1O7M B;  2C10 A;  2OWP A;  2GU3 A;  1M1X B;  1UI8 A;  2RCD A;  1M9G A;  3U1W A;  1IVV A;  4L7K A;  1UUV B;  3OWY A;  1S72 3;  1W6G A;  1JN5 B;  4H61 A;  5CF1 A;  3I56 3;  2Z77 A;  1JJ2 2;  4HM0 B;  1AR0 A;  4NHF A;  1N5H A;  4K1U A;  3WA2 X;  3LT8 A;  3MWZ A;  1AVK A;  4LMI A;  4XBX A;  1YJ9 3;  1YHQ 3;  1IT8 A;  2W03 A;  4N6N B;  4HZB B;  1JKG A;  3H51 A;  4HVN A;  5KP4 A;  3CCM 3;  4FMB A;  4STD A;  5D81 A;  3CPO A;  7STD A;  1JV2 B;  1KWI A;  3HI7 A;  3N54 B;  1ROV A;  2B24 B;  4FCM A;  1FGM A;  3LOY A;  5AI1 A;  4N6U A;  4R1K A;  2XFT A;  1W02 A;  1U5O A;  2HMJ B;  4XBT A;  4XM4 A;  1D6U A;  1W01 A;  3EQQ B;  3NM7 A;  3VGN A;  4X2H A;  1WMP A;  4MMX B;  2KRT A;  3HX8 A;  1LVN A;  1TIJ A;  2OTJ 3;  2BMR B;  3Q2P A;  1IVU A;  1RJO A;  2WO0 A;  5IF6 A;  3LYG A;  4BTX A;  4R9K A;  1WMO A;  4WYK A;  3GRD A;  2Z7A A;  1KD1 4;  1W5Z A;  1IVW A;  2STD A;  3MG2 A;  3CXC 2;  3F9S A;  1C7H A;  1NJI 4;  4U13 A;  3V98 A;  1VQ7 3;  3DUK A;  3CU3 A;  2YFJ B;  3VF1 A;  3G16 A;  1OHS A;  1VQ9 3;  1EG9 B;  2CKF B;  1WMN A;  1QVG 2;  1JN5 A;  1FGO A;  5IG3 A;  2L4V A;  3DGO A;  1O7N B;  1JB4 A;  1N9E A;  3GWR A;  5D82 A;  3CC2 3;  3CCE 3;  3CPW 2;  2BHM A;  5CK6 A;  3EBT A;  1KC8 4;  2W9P A;  3ER7 A;  1Q82 4;  1UUW B;  3DMC A;  5FW5 A;  1L5G B;  1CEW I;  3JVC A;  5BXQ A;  3KII A;  4XB5 A;  3CCR 3;  1PU4 A;  5JBS A;  1VQP 3;  1GY5 A;  4MMZ B;  1D6Z A;  1K28 A;  3X3Y A;  2K54 A;  3OX9 A;  4RNY A;  1J2B A;  1AV4 A;  1O7W B;  1VZZ A;  3GZR A;  1W2B 2;  1IQX A;  1MOL A;  2LQV A;  4FCZ A;  2QA4 3;  1STD A;  2CFG A;  3EX9 A;  1KSI A;  4HZ9 B;  4O02 B;  2KXG A;  4L8O A;  3T8N A;  1OF5 B;  1PFP A;  4G1M B;  4EBG A;  5JPU A;  5AIH A;  2W6J H;  3CCS 3;  4RZM A;  1GY6 A;  4KVH A;  4KFF A;  1GS3 A;  3NV0 B;  1QMA A;  3X3X A;  4EV2 A;  1WNH A;  1D6Y A;  1IV7 A;  2BT3 A;  3HIG A;  3EE1 A;  5CF2 A;  1YIT 3;  1N8Q A;  3M8C A;  3LTB A;  1NU3 A;  3EJV A;  4FMD A;  1K73 4;  4R9L A;  3QK9 A;  4K61 A;  3F8H A;  3ALA A;  1VQ5 3;  4N6L A;  3LTD A;  3CNX A;  3DGM A;  1AVL A;  3WOF B;  3BNE A;  4FMA A;  3UB1 A;  2Z6B A;  2CFD A;  2IMJ A;  3FZW A;  4IT7 A;  4OK0 A;  3NX0 A;  2GBW B;  1E3V A;  3EN1 B;  4EXR A;  4HM1 B;  1OGX A;  1IK3 A;  3MG1 A;  3O8Y A;  5CXO A;  2M7O A;  1BUQ A;  2CC3 A;  1N5P A;  3S29 A;  5FGO A;  1N9J A;  3G71 3;  3SLU A;  3WA3 A;  2GXF A;  4GB5 A;  1S5A A;  3RGR A;  2W56 B;  1O7H B;  4N6O B;  3X40 A;  4HM3 B;  3X3Z A;  5AII A;  4Q53 A;  3WOD G;  1W2Z A;  3DZL A;  4WHA A;  3WMD A;  4O2H A;  3EHC A;  2I9W A;  1W6C A;  4EC6 A;  1IT7 A;  3STD A;  1OF5 A;  1SPU A;  3G4S 3;  3K5T A;  3SX1 A;  3UL6 A;  1EKM A;  3B4O A;  1LXE A;  1A2K A;  2ZDJ A;  3OWS A;  5DRV A;  1UW1 A;  2V1L A;  2K0M A;  2W2C A;  3JUN A;  3NV0 A;  1FGT A;  3UJM A;  1GD3 A;  4N3V A;  3CC4 3;  2CIU A;  3G0K A;  2PZV A;  2IA7 A;  1YIJ 3;  1VQ8 3;  1QVF 2;  1CYU A;  2LYX A;  1CQS A;  3GZB A;  1TP6 A;  5DRE A;  2XR8 B;  2CH9 A;  3K0Z A;  1FUW A;  2OQE A;  3MSO A;  4N6T A;  3FKA A;  4HM6 B;  2XSH B;  3T0U A;  1TUH A;  3S67 A;  1Q86 4;  2INX A;  3KSP A;  5ELU A;  4WP5 A;  3SED A;  1NWW A;  3TDG A;  4ZM8 A;  1WTH A;  4HBR A;  2CW9 A;  1IV9 A;  3FF0 A;  2XGL A;  4ORL A;  3CNM A;  1NB5 I;  1T5Y A;  2ZL8 A;  3K7C A;  1VQN 3;  5AEW B;  4XDW A;  3FG1 A;  4X2O A;  3WOE B;  1W7C A;  3K9M C;  5AYR B;  3PYJ A;  1STF I;  3NHX A;  4RBN A;  4J9A A;  5IG4 A;  4TX4 A;  2W56 A;  3IMA B;  2JQ5 A;  3N8B A;  3JUQ A;  5LC6 A;  1ISK A;  1ROA A;  5BVB A;  1RRH A;  4HM5 B;  4LEH A;  1ULJ B;  2F86 B;  1W4N A;  3T8U A;  2WOH A;  3CCU 3;  1R4C A;  4MMY B;  3L0R A;  1TU5 A;  3LH4 A;  1OCV A;  1IU7 A;  3KFQ C;  5IEO A;  5A0O B;  2QEX 3;  3LXU X;  3SOA A;  3E99 A;  3BNC A;  5KP1 A;  2CK3 H;  3ECF A;  3FG3 A;  2W9Q A;  2ML6 A;  2CWT A;  2P0M A;  1DMN A;  1VQO 3;  2CG0 A;  3RGA A;  1QAF A;  1LOX A;  3PS8 A;  2MC8 A;  1YVB I;  3JUO A;  1SIH A;  4I4K A;  3UL5 A;  2BMQ B;  5AIF A;  3VSY A;  5CLK A;  3FGY A;  1TFK A;  3NM2 A;  3CME 3;  2WGO A;  3JUM A;  4PEJ A;  2JDI H;  3EBY A;  2F98 A;  2MF7 A;  1YGE A;  2FXT A;  1U8C B;  2HMK B;  3HZP A;  5STD A;  4AEQ A;  5IEN A;  2RFR A;  4CCV A;  3SXX A;  2Q07 A;  2CFW A;  2UX0 A;  3GZX B;  3OWU A;  1RKY A;  2IUK A;  3FF2 A;  4LSO A;  4LZI A;  1Q7Y 4;  2ML5 A;  3WDG B;  2XRX B;  1IVX A;  5EEO A;  3CCQ 3;  2XSO B;  3DY5 A;  1W00 A;  2RSX A;  3HII A;  3FH1 A;  3G8Z A;  5IEP A;  3CCV 3;  4BTY A;  4J8T A;  4N6V 0;  2CFL A;  3DXO A;  1TFO A;  4AKZ A;  2SBL A;  1ULI B;  3GAX A;  4JRF A;  2R4I A;  1QAL A;  2A15 A;  2FGT A;  2WGQ A;  3B8L A;  1FGQ A;  1MNL A;  2E2T A;  2OOV C;  5AYS C;  2YFI B;  1V74 A;  2P09 A;  4HKV B;  4HYZ A;  3UNL A;  1Y4K A;  1ZX2 A;  3KN4 A;  1NB3 I;  3GZY B;  4L8P A;  3I0Y A;  4GL6 A;  1VQK 3;  1A67 A;  3AMO B;  4OUQ A;  2GBX B;  3PCR A;  5G2G A;  5HGR A;  1DVD A;  1E97 A;  2O3O A;  2YX9 A;  3OW2 2;  3BLZ A;  3KZT A;  2OCT A;  4OVM A;  2GEX A;  3CMA 3;  2CWU A;  2HMM B;  1LNH A;  4HM2 B;  3IJE B;  1VQM 3;  1JB2 A;  3SVA A;  1UI7 A;  1VQL 3;  1ZO2 A;  4XBY A;  1QJG A;  3D9R A;  3OV4 A;  3J7Y d;  2IUJ A;  5IG5 A;  3LTC A;  3BB9 A;  3FSD A;  1SJW A;  4AKY A;  1VQ4 3;  2CG1 A;  1IQY A;  2W0Q A;  1F8N A;  2PNC A;  1CYV A;  2W04 A;  5I97 A;  2CHC A;  1OUN A;  3FLJ A;  4WWU C;  5AEU B;  1OAC A;  6STD A;  4CDL A;  1W6Y A;  1OHP A;  2YFL B;  1M90 4;  8CHO A;  2B1X B;  1K8A 4;  2QGU A;  2E2V A;  2Z76 A;  1Q81 4;  1K41 A;  4IIA A;  2XGN A;  2P38 A;  4LGQ A;  2QIY A;  1EA2 A;  1G96 A;  4KFE A;  3BNB A;  3K63 A;  1KQS 2;  3S27 A;  4R4K A;  3SOY A;  3DM8 A;  3F14 A;  3AMO A;  4KFD A;  4HM8 B;  3NQZ A;  4O8S A;  3Q90 A;  5D83 A;  1OGZ A;  1EQK A;  4O3V A;  3LML A;  4XDV A;  3U97 A;  4N6M A;  4R80 A;  2Y73 A;  4QWT A;  3BND A;  1WQL B;  1HKX A;  1QAK A;  3A76 A;  3F7X A;  3MKI A;  4FR9 A;  1JRQ A;  4RNZ A;  1US1 A;  1OPY A;  2RGQ A;  5TGN A;  2D1W A;  1YJW 3;  3B7C A;  2HML B;  3NQY A;  5KP3 A;  1DYU A;  4HM4 B;  5EQL A;  3LT9 A;  1DVC A;  3PGB A;  4MJD A;  5AIG A;  1YI2 3;  2HMN B;  1HU9 A;  4MEI A;  4WFO A;  4FCJ A;  1GY7 A;  3G6E 3;  3F7S A;  4K1V A;  1FA3 A;  2OQE C;  3F40 A;  2C11 A;  4EV5 A;  4JF8 A;  1Q40 B;  3MHE A;  3V99 A;  3NXJ A;  2F99 A;  1FGR A;  1ASK A;  2OOV A;  2BMO B;  1RRL A;  2XF3 A;  1M1K 4;  3EB8 A;  3NUV A;  2GU1 A;  4EYC A;  5LC7 A;  1YJN 3;  1A90 A;  3MG3 A;  3JUP A;  4FMC A;  5IG0 A;  3N9H A;  4HM7 B;  1E3R A;  3H3H A;  4K90 B;  1O7G B;  5EVH A;  1IDP A;  1DMQ A;  4NRE A;  3PZW A;  3CC7 3;  3QRD A;  2P0X A;  2XH9 A;  5IER A;  3OXA A;  1JB5 A;  3PXM A;  3S28 A;  1SQW A;  2KCD A;  2WOF A;  2O9U X;  3CD6 3;  1RN7 A;  3KE7 A;  1GD4 A;  2OTL 3;  1DMM A;  3IPT A;  3CCJ 3;  1O7P B;  1NO3 A;  2D42 A;  3CCL 3;  4KZ1 A;  2Y74 A;  3NBJ A;  1K9M 4;  1OHO A;  3X42 A;  1OH0 A;  3EC9 A;  1JKG B;  3NBB A;  5ELJ A;  1NDO B;  2FNQ A;  1Q42 A;  2BNG A;  1IQ8 A;  3V92 A;  3MYT A;  5IW9 A;  4HJL B;  3RDE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...