5A0OB

Adhiron raised against p300
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
93
structure length
93
Chain Sequence
ASNSLEIEELARFAVDEHNKKENALLEFVRVVKAKEQANLYLSTPIDTMYYLTLEAKDGGKKKLYEAKVWVKHIMYYPKTANFKELQEFKPVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADHIRON
publication title Exploration of the Hif-1Alpha.P300 Interface Using Peptide and Adhiron Phage Display Technologies
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 16
structure length 93
sequence length 93
chains with identical sequence S
ec nomenclature
pdb deposition date 2015-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5a0oB00
4N6NB 1GD3A 1WNHA 2O9UX 4TX4A 4N6OB 1A90A 2OCTA 4N6MA 1MOLA 4N6TA 1MNLA 1RN7A 1N5HA 5A0OB 2W9PA 3UL5A 1G96A 2BO9B 3L0RA 2CH9A 3Q2PA 4N6LA 4LZIA 3LH4A 3K9MC 1A67A 1FA3A 1LXEA 1N5PA 1CYVA 1DVCA 4IT7A 3MWZA 3IMAB 1IV7A 3PS8A 5EQLA 4ZM8A 3PYJA 3KFQC 1IV9A 4N6UA 3KSED 1GD4A 1M9GA 3S67A 1ROAA 3GAXA 1FUWA 1YVBI 5ELUA 5LC6A 3UL6A 1CYUA 5LC7A 1NB5I 1TIJA 1NB3I 1KWIA 3PXMA 1DVDA 1N9JA 2W9QA 3QRDA 1EQKA 1PFPA 4EYCA 3NX0A 1CEWI 4N6V0 5ELJA 4CCVA 1R4CA 2KXGA 1STFI 3SVAA
chains in the Genus database with same CATH superfamily
1BANA 3GZBA 1RGAA 1GD3A 1UUWB 3EBYA 2RBIA 3MKIA 1OHSA 3JUNA 5D83A 1ISKA 1JBRA 4HM3B 1X1UA 2K54A 1UDII 1W5ZA 2E2VA 1BNGA 5STDA 1Q42A 1B2XA 2W9PA 2C4BA 1T5YA 3SYUA 3BB9A 3UB1A 2HMMB 4WYKB 2OOVC 3DGMA 5EVHA 3NM2A 3DH2A 5D82A 3L0RA 2CH9A 2RNTA 2XGLA 1I70A 3CPOA 2CWTA 1BU4A 3EB8A 1FZUA 3SXXA 4J8TA 1O7PB 4HM2B 1BNEA 3CCU3 2ML5A 2FXTA 3CCV3 1JB5A 3KIIA 5DRVA 1YIT3 3S27A 4LZIA 1IVVA 1RDSA 2F5MA 2D1WA 1JB2A 4L7KA 1IVUA 5M18A 7GSPA 1RGCA 1DMNA 5IEPA 1UGHI 1C7HA 4L8PA 1VQP3 3U97A 4R9KA 1LXEA 1NU3A 2H0HA 1JKGB 1BAOA 1WMPA 2KAAA 1A2PA 4IT7A 2SARA 3OXAA 3IMAB 4HKVB 2UGIA 4HM0B 1O7MB 1ULIB 3NQZA 3HIGA 3SOAA 1YIJ3 1UCLA 3HX8A 1OPYA 1IV9A 1PYLA 1IVWA 1UI8A 1HZ1A 3A5EA 3CXC2 1LQGC 1VQO3 2QA43 4HOHA 1N8QA 1JZDA 3NV0B 4K90B 4JRFA 4KT3B 1KD14 2CW9A 1Q7HA 3D5IA 1M9GA 2KF6A 3EQQB 1ASKA 3LZAA 4LEHA 4EXRA 2W0QA 6GSPA 1K734 2INXA 3BNCA 2ZDJA 2M7OA 1B3SA 1B2ZA 1KQS2 4GB5A 1BNJA 1A2VA 1I3FA 1ROAA 5IEOA 2GXFA 1M1XB 2CX1A 1G0TA 2AADA 1YGWA 1OACA 1OUNA 3B4OA 3OV4A 5EEOA 5BU4A 3JUPA 3WDGB 1PU4A 3G4S3 2RGQA 2F4YA 3CME3 3OWSA 3VF1A 3IJEB 4R80A 4O8SA 1SQWA 3JUMA 1FYSA 2H0IA 3F40A 1OH0A 2WO0A 4X2HA 1GYBA 4KZ1A 1FW7A 1I0XA 1NNVA 3J7Yd 1SIHA 1OF5A 3I553 4FMBA 2IUKA 3VSYA 1W4NA 2CWVA 3D4AA 3MG2A 3K0ZA 3NQYA 2GU1A 1R4YA 1NB3I 2CFDA 4Q53A 3URPA 3LTBA 3KKGA 3PXMA 1DVDA 1N9JA 2IA7A 1O7HB 4FCMA 1L5GB 1IK3A 1WQLB 4XB5A 1G02A 1IQXA 1HU9A 2O3OA 2Q07A 1FUSA 3D9RA 2CFKA 2XFTA 4K1VA 1MGRA 3NX0A 3ALAA 5HGRA 1IYYA 3LOYA 3E99A 1IT8A 1N8R4 4N6V0 1GOVA 5ELJA 3LTDA 4RNYA 4CCVA 1Q814 3M8CA 4FMAA 3F14A 1YVSA 1AR0A 1BRNL 4ILFA 1NO3A 4HAAA 1B2SA 1K28A 1QVF2 1STFI 1IQYA 2CFGA 1QMAA 5IG4A 1OHOA 2ZA4A 2BU4A 3F8XA 3S29A 5HOHA 3LYGA 3DMCA 1TFKA 5KP4A 2O9UX 1BNSA 1OCVA 3BIRA 4N6OB 3FG4A 5I97A 1BSAA 1VQ53 1GS3A 2CG0A 4N6MA 4RBNA 3EX9A 1EKMA 4N3VA 4NPBA 9RNTA 4N6TA 4LMIA 4BL2A 1MWSA 3NXJA 5RNTA 5G1KA 1RN7A 3BNEA 3MYTA 3N9HA 3KSPA 3ZG0A 3Q90A 3I0YA 3UL5A 2C11A 1K41A 2OTJ3 3LT9A 3OWYA 5CK6A 2CC3A 5CF2A 1SPUA 2PNCA 1MWUA 3JVCA 2W56A 7STDA 2GEYA 2Z77A 2P09A 1ULJB 2KCDA 3BU4A 3Q2PA 1X1YA 1LQMB 3FGYA 3NBJA 5IG5A 1D6UA 2JQ5A 1BRGA 5JPUA 2CX0A 2OQEC 2BT3A 4HM8B 1WMNA 3AMOA 3CCE3 3WODG 1RLSA 3B8LA 3UNLA 3EN1B 2J8XB 2GSPA 5M1AA 3S28A 1DVCA 2WGOA 1VQ83 4AKYA 3DY5A 1O7NB 2WGQA 3MWZA 1KC84 1IV7A 3F8HA 2E2TA 3G8ZA 4IIAA 3X3XA 3H51A 2BHMA 1VQ93 4HM7B 5EQLA 1I2FA 3PYJA 3WHOA 2WOHA 1JBSA 2HMKB 2YFIB 5FGOA 3HIIA 1D6ZA 1LOWA 1UCIA 3GSPA 1B2MA 1FGOA 3EE1A 3D5GA 3DZLA 3NUVA 5AYRB 1GD4A 1TTOA 1Q40B 2P05A 3S67A 1KSIA 3PZWA 2GU3A 3SLUA 1ROVA 4PEJA 4HVNA 1I0VA 1BGSA 1GY6A 3MPHA 1J2BA 3X3YA 3G6E3 1IQ8A 3FF0A 3EF8A 2FGTA 1RN4A 3PCRA 1Q864 4K1UA 1ZS7A 2LYXA 3GZXB 1HYFA 2ZL8A 1GMQA 3KE7A 1E3VA 1UI7A 4JF8A 5LC6A 2OQEA 3UL6A 1TU5A 3DGLA 1S723 1DMMA 1CYUA 1A2KA 3CU3A 2K3DA 1YI23 5JBSA 4HM1B 5CLKA 2LQVA 1KWIA 1VQ43 3ER7A 1C54A 3FG1A 1BOXA 1RNTA 1LRAA 4KFFA 5TGNA 3FZWA 1FUTA 1OF5B 2YFJB 5AEUB 4HBRA 1LOVA 1PFPA 2R41A 4NHFA 2OOVA 3SEDA 1AV4A 2E2UA 1GY7A 1UCJA 1RCKA 1AQZA 2RFRA 2WOFA 4KFEA 3ZFZA 1CEWI 1O7GB 1Q824 1VQK3 4H3UA 3DXOA 4FMCA 1CH0A 1RGEA 3BNDA 1B27A 4XBTA 2Z76A 1BSCA 2CFWA 1BUJA 3CCJ3 1DE3A 3MG3A 1RRHA 3G16A 3SVAA 3SOYA 1SARA 4MJDA 4N6NB 5JPPA 1Y4KA 1CQSA 1JKGA 1STDA 8RNTA 2KRTA 3TDGA 1B21A 1GMPA 4TX4A 1EUIC 1T2IA 3Q3FA 2P0XA 3FCSB 2UUGC 2MF7A 3V98A 2H0GA 1BSEA 2HOHA 5BXQA 1A90A 3CMA3 1EEJA 1K8A4 1BRHA 5KP3A 1YJN3 1BSDA 1BSBA 1MOLA 1FGTA 3LTAA 1LOYA 4K61A 5IW9A 1M1K4 1JV2B 3DUKA 1GY5A 1MNLA 2F99A 4LGQA 3NV0A 5IERA 5IG0A 3RDEA 4BTWA 5A0OB 2CIUA 4MMZB 2F98A 1UW1A 2BIRA 3AGOA 2Z7AA 3CD63 4BIRA 5AIGA 4OUQA 2JDIH 1VZZA 4GL6A 1TFOA 3CCL3 4BU4A 1LNIA 3QK9A 1BIRA 3U1WA 4I5QA 3EBTA 1FGQA 2XF3A 1BVIA 1RRLA 2W2CA 1JRQA 3A76A 4HYZA 2IY2A 1DETA 3PGBA 1IU7A 1JN5B 2OTL3 2R4IA 1RN1A 1JB4A 1W6YA 3BNBA 3N8BA 4O3VA 3HI7A 2RSXA 1IDPA 4CPKA 4WWUC 1A67A 2GBWB 3HZPA 1FA3A 2XRXB 3EC9A 2BMOB 2KF5A 1N5PA 3JUQA 1BRIA 3LT8A 3OWUA 1BNRA 1E97A 2XSOB 2STDA 5AIIA 1S5AA 1FGRA 4H61A 6RNTA 1B2UA 2L1SA 1LNHA 3AHWA 4DKIA 4RNTA 3KFQC 2F56A 1NDOB 1RGLA 1N9EA 4N6UA 3GWRA 2W03A 2YX9A 5IENA 1VQM3 2QGUA 3KSED 4STDA 1W02A 1UUVB 1V74A 3RNTA 3HK4A 3LMLA 4J5KA 1W00A 2AAEA 4U13A 4WHAA 2W04A 1U5OA 3GZRA 1I3IA 2KF3A 3K63A 2ML6A 3F9SA 2YFLB 3RGRA 3FG3A 1IVXA 3JUOA 2XFSA 3EHCA 1T3BA 1DYUA 1MGWA 2W6JH 4FCZA 4AEQA 1NWWA 3G713 1I2GA 2B1XB 3FH1A 3GAXA 1TRPA 3X42A 1W2B2 1RCLA 2CKFB 3K5TA 4X2OA 3AGNA 1VQ73 1ZX2A 4XDVA 1W2ZA 1RTUA 1Q7Y4 1US1A 2RCDA 4LYLB 1JNQA 3NBRA 4EBGA 2P0MA 3UJMA 2HMNB 3GZYB 1YHQ3 3X40A 3CNXA 4EV5A 4AKZA 4KVHA 1X1XA 3GRDA 3CPW2 4HM4B 2XGNA 3DM8A 3MSOA 5BVBA 2HMLB 4IPBA 4HZBB 4R1KA 4EC6A 3O8YA 1EQKA 4FCJA 3B4PA 1QVG2 1IT7A 1TJDA 4EYCA 1RSNA 2HMJB 4EW5A 2QEX3 5M19A 1RGKA 1PY3A 3RGAA 3WA3A 4GHOA 7RNTA 2GBXB 3CC73 1QALA 3WOEB 4HZ9B 1AVKA 2XEPA 2Z6BA 1JJ22 1QAFA 2QIYA 2KXGA 2UX0A 4R4KA 2SBLA 3FF2A 4QWTA 1FGMA 2OWPA 3STDA 3SX1A 1WNHA 1W6CA 4MMXB 1VQQA 3KCHA 1T2HA 1UUGB 2XH9A 3NHXA 1RHLA 2OCTA 1RGFA 4HM5B 3CCR3 4WYKA 1B20A 3CCS3 3EN8A 4HJLB 5AIFA 5AEWB 6STDA 1F8NA 3HOHA 4CDLA 1GOYA 1RNBA 5CF1A 1V58A 3FLJA 3CC23 1N5HA 3KN4A 3WA2X 3DGYA 1OHPA 2D42A 4WFOA 1Q40A 2F5WA 1WTHA 2ZHXB 5DREA 1Q9EA 3EJVA 3Q1CA 1G96A 1GOUA 1AY7A 1GSPA 1QJGA 2BO9B 2CK3H 2L4VA 2IUJA 1JBTA 4ORLA 4J9AA 3ZG5A 3NBBA 5KP1A 3I563 4RZMA 2K0MA 1ZGXA 1O7WB 5GSPA 8CHOA 2F86B 2KF4A 3IPTA 1BUQA 3LXUX 3DGNA 4N6LA 2IYJA 1D6YA 3VGNA 3LH4A 1MWRA 4GSPA 4O02B 1VQL3 3BLZA 4XM4A 3T8UA 3FKAA 3T8NA 1RMSA 3X41A 3N54B 3K9MC 4MMYB 2MC8A 3S5CA 1Z1SA 4BL3A 4EV2A 2IMJA 3OX9A 1M904 2CWUA 1CYVA 2P38A 2PZVA 3FSDA 1U8CB 1DMQA 2CG1A 1GMRA 4NREA 4XBXA 1QAKA 2XSHB 1W7CA 1RKYA 1ZO2A 4HM6B 3PS8A 1TP6A 3V92A 4ZM8A 5IG3A 3MHEA 1OGZA 4CJNA 1AVLA 3CCQ3 1RGHA 3F7XA 3K7CA 2BMQB 4J5GA 2B24B 1BRJA 3B7CA 1SIIA 4LSOA 5AI1A 4KFDA 3PCSA 3V99A 2C10A 3X3ZA 2GEXA 1LVNA 3KZTA 4XBYA 3WR2A 3D79A 4OVMA 4R9LA 4FR9A 1E3RA 5CXOA 1EG9B 5AIHA 1OGXA 2FNQA 3T0UA 1TUHA 3WOFB 2W56B 3LTCA 2A15A 1YJW3 1RGGA 5AYSC 2BNGA 1FUWA 1YVBI 5ELUA 1VQN3 3AHSA 2V1LA 1SJWA 1TRQA 1WMOA 2CHCA 5IF6A 2Y74A 1W01A 1V57A 1EA2A 3H3HA 1BNFA 3AMOB 1UGIA 1BRSA 2HMOB 1HKXA 4G1MB 1YGEA 5LC7A 1NB5I 5G2GA 1W6GA 1K9M4 1TIJA 1BRKA 5BIRA 1UCKA 4OK0A 4RNZA 3WMDA 3ROBA 5G1LA 4BTYA 2W9QA 3MG1A 2BMRB 1MWTA 1YNVX 1X1WA 3CNMA 3QRDA 4WP5A 1I2EA 3G0KA 4O2HA 1LOXA 5FW5A 4BTXA 1JZOA 3CCM3 4FMDA 1JN5A 2Y73A 3CC43 3NM7A 3D3LA 1BNIA 2I9WA 1NJI4 2CFLA 3ECFA 4L8OA 3DGOA 1YJ93 1R4CA 1VQ63 4I4KA 4MEIA 4XDWA 3OW22 1RJOA 5D81A 3F7SA 2XR8B 1I8VA
chains in the Genus database with same CATH topology
3GZBA 1UUWB 1GD3A 3EBYA 3MKIA 1OHSA 3JUNA 5D83A 1ISKA 4HM3B 2K54A 1W5ZA 2E2VA 5STDA 1Q42A 2W9PA 1T5YA 3BB9A 3UB1A 2HMMB 4WYKB 2OOVC 3DGMA 5EVHA 3NM2A 5D82A 3L0RA 2CH9A 2XGLA 3CPOA 2CWTA 3EB8A 3SXXA 4J8TA 1O7PB 4HM2B 3CCU3 2ML5A 2FXTA 3CCV3 1JB5A 3KIIA 5DRVA 1YIT3 3S27A 4LZIA 1IVVA 2D1WA 1JB2A 4L7KA 1IVUA 5IEPA 1DMNA 4L8PA 1C7HA 1VQP3 3U97A 4R9KA 1LXEA 1NU3A 1JKGB 1WMPA 4IT7A 3OXAA 3IMAB 4HKVB 4HM0B 1O7MB 1ULIB 3NQZA 3HIGA 3SOAA 1YIJ3 3HX8A 1OPYA 1IV9A 1IVWA 1UI8A 3CXC2 1VQO3 2QA43 1N8QA 3NV0B 4K90B 4JRFA 1KD14 2CW9A 3EQQB 3LZAA 1M9GA 4LEHA 1ASKA 4EXRA 1K734 2W0QA 2INXA 3BNCA 2ZDJA 2M7OA 1KQS2 4GB5A 1A2VA 5IEOA 1ROAA 2GXFA 1M1XB 4MEIA 3B4OA 1OACA 1OUNA 3OV4A 5EEOA 1PU4A 3JUPA 3WDGB 3G4S3 2RGQA 3CME3 3OWSA 3VF1A 3IJEB 4R80A 4O8SA 1SQWA 3JUMA 3F40A 1OH0A 2WO0A 4X2HA 1GYBA 4KZ1A 1SIHA 1OF5A 3I553 4FMBA 2IUKA 3VSYA 1W4NA 2CWVA 3MG2A 3K0ZA 3NQYA 2GU1A 1NB3I 2CFDA 4Q53A 3LTBA 3KKGA 3PXMA 1DVDA 1N9JA 2IA7A 1O7HB 4FCMA 1L5GB 1IK3A 1WQLB 4XB5A 1IQXA 1HU9A 2O3OA 2Q07A 3D9RA 2CFKA 2XFTA 4K1VA 3NX0A 3ALAA 5HGRA 3LOYA 3E99A 1IT8A 1N8R4 4N6V0 5ELJA 4CCVA 3LTDA 4RNYA 1Q814 3M8CA 4FMAA 3F14A 1AR0A 1NO3A 1K28A 1QVF2 1STFI 1IQYA 2CFGA 1QMAA 5IG4A 1OHOA 3F8XA 3S29A 3LYGA 3DMCA 1TFKA 5KP4A 2O9UX 1OCVA 4N6OB 3FG4A 5I97A 1VQ53 1GS3A 2CG0A 4N6MA 4RBNA 3EX9A 1EKMA 4N3VA 4N6TA 4LMIA 3NXJA 1RN7A 3BNEA 3MYTA 3N9HA 3KSPA 3Q90A 3I0YA 3UL5A 2C11A 1K41A 2OTJ3 3LT9A 3OWYA 5CK6A 2CC3A 5CF2A 1SPUA 2PNCA 3JVCA 7STDA 2W56A 2GEYA 2Z77A 2P09A 1ULJB 2KCDA 3Q2PA 5IG5A 3FGYA 3NBJA 1D6UA 2JQ5A 5JPUA 2OQEC 2BT3A 4HM8B 1WMNA 3AMOA 3CCE3 3WODG 3B8LA 3UNLA 3EN1B 3S28A 1DVCA 2WGOA 1VQ83 4AKYA 3DY5A 1O7NB 2WGQA 3MWZA 1KC84 1IV7A 3F8HA 2E2TA 3G8ZA 4IIAA 3X3XA 3H51A 2BHMA 1VQ93 4HM7B 5EQLA 3PYJA 2WOHA 2HMKB 2YFIB 5FGOA 3HIIA 1D6ZA 1FGOA 3EE1A 3DZLA 3NUVA 5AYRB 1GD4A 1Q40B 2P05A 3S67A 1KSIA 3PZWA 2GU3A 3SLUA 1ROVA 4PEJA 4HVNA 1GY6A 3MPHA 1J2BA 3X3YA 3G6E3 1IQ8A 3FF0A 3EF8A 2FGTA 3PCRA 1Q864 4K1UA 3GZXB 2LYXA 2ZL8A 5LC6A 3KE7A 1E3VA 1UI7A 4JF8A 3UL6A 2OQEA 1TU5A 1S723 3DGLA 1CYUA 1DMMA 1A2KA 3CU3A 1YI23 5JBSA 4HM1B 5CLKA 2LQVA 1KWIA 1VQ43 3ER7A 3FG1A 4KFFA 5TGNA 3FZWA 5AEUB 1OF5B 2YFJB 4HBRA 4NHFA 1PFPA 2OOVA 3SEDA 1AV4A 2E2UA 1GY7A 2RFRA 3J7Yd 1M1K4 4KFEA 2WOFA 1Q824 1CEWI 1O7GB 1VQK3 4H3UA 3DXOA 4FMCA 3BNDA 4XBTA 2Z76A 2CFWA 3CCJ3 3MG3A 1RRHA 3G16A 3SVAA 3SOYA 4N6NB 4MJDA 5JPPA 1Y4KA 1CQSA 1JKGA 1STDA 2KRTA 3TDGA 4TX4A 2P0XA 3FCSB 2MF7A 3V98A 5BXQA 1A90A 3CMA3 1K8A4 5KP3A 1YJN3 4K61A 1MOLA 1FGTA 3LTAA 5IW9A 1JV2B 3DUKA 1GY5A 1MNLA 2F99A 4LGQA 3NV0A 5IERA 5IG0A 3RDEA 4BTWA 5A0OB 2CIUA 4MMZB 2F98A 1UW1A 2Z7AA 3CD63 5AIGA 4OUQA 2JDIH 1VZZA 4GL6A 1TFOA 3CCL3 3QK9A 3U1WA 3EBTA 1FGQA 2XF3A 2W2CA 1RRLA 4HYZA 1JRQA 3A76A 3PGBA 1IU7A 1JN5B 2OTL3 2R4IA 1JB4A 1W6YA 3BNBA 3N8BA 4O3VA 3HI7A 2RSXA 1IDPA 4WWUC 1A67A 2GBWB 3HZPA 1FA3A 2XRXB 3EC9A 2BMOB 1N5PA 3JUQA 3LT8A 3OWUA 1E97A 2XSOB 2STDA 5AIIA 1S5AA 1FGRA 4H61A 1LNHA 3KFQC 1NDOB 1N9EA 4N6UA 3GWRA 2W03A 2YX9A 5IENA 1VQM3 2QGUA 3KSED 4STDA 1W02A 1UUVB 1V74A 3HK4A 3LMLA 1W00A 4U13A 4WHAA 2W04A 1U5OA 3GZRA 3K63A 2ML6A 3F9SA 2YFLB 3RGRA 3FG3A 1IVXA 3JUOA 2XFSA 3EHCA 4AEQA 1DYUA 2W6JH 4FCZA 3G713 1NWWA 2B1XB 3FH1A 3GAXA 1W2B2 3X42A 2CKFB 3K5TA 4X2OA 1VQ73 1ZX2A 4XDVA 1W2ZA 1Q7Y4 1US1A 2RCDA 1JNQA 3NBRA 4EBGA 2P0MA 3UJMA 2HMNB 3GZYB 1YHQ3 3X40A 3CNXA 4EV5A 4AKZA 4KVHA 3CPW2 3GRDA 4HM4B 2XGNA 3DM8A 3MSOA 5BVBA 2HMLB 4IPBA 4HZBB 4R1KA 4EC6A 3O8YA 1EQKA 4FCJA 3B4PA 1QVG2 1IT7A 4EYCA 2HMJB 2QEX3 3RGAA 3WA3A 2GBXB 3CC73 1QALA 3WOEB 4HZ9B 1AVKA 2XEPA 2Z6BA 1JJ22 1QAFA 2QIYA 2KXGA 2UX0A 4R4KA 2SBLA 3FF2A 4QWTA 1FGMA 2OWPA 3STDA 3SX1A 1WNHA 1W6CA 4MMXB 2XH9A 4HM5B 3NHXA 3CCR3 2OCTA 4WYKA 3CCS3 3EN8A 4HJLB 5AIFA 5AEWB 6STDA 1F8NA 4CDLA 5CF1A 3FLJA 3CC23 1N5HA 3KN4A 3WA2X 1OHPA 2D42A 4WFOA 1Q40A 5DREA 1WTHA 3EJVA 3Q1CA 1G96A 2CK3H 1QJGA 2BO9B 2L4VA 2IUJA 4ORLA 4J9AA 5KP1A 3NBBA 3I563 4RZMA 2K0MA 1O7WB 8CHOA 2F86B 3IPTA 1BUQA 3LXUX 3DGNA 4N6LA 1D6YA 3VGNA 3LH4A 4O02B 1VQL3 3BLZA 4XM4A 3T8UA 3FKAA 3T8NA 3X41A 3N54B 3K9MC 4MMYB 2MC8A 3S5CA 1Z1SA 4EV2A 2IMJA 3OX9A 1M904 2CWUA 1CYVA 2P38A 2PZVA 3FSDA 1U8CB 1DMQA 2CG1A 4NREA 4XBXA 1QAKA 2XSHB 1W7CA 1RKYA 1ZO2A 4HM6B 3PS8A 1TP6A 3V92A 4ZM8A 5IG3A 3MHEA 1OGZA 1AVLA 3CCQ3 3F7XA 3K7CA 2BMQB 2B24B 5AI1A 3B7CA 1SIIA 4LSOA 3V99A 4KFDA 3PCSA 2C10A 3X3ZA 2GEXA 1LVNA 3KZTA 4XBYA 4OVMA 4R9LA 4FR9A 1E3RA 5CXOA 1EG9B 5AIHA 1OGXA 2FNQA 3T0UA 1TUHA 3WOFB 2W56B 3LTCA 2A15A 1YJW3 5AYSC 2BNGA 1FUWA 1YVBI 5ELUA 1VQN3 2V1LA 1SJWA 1WMOA 2CHCA 5IF6A 2Y74A 1W01A 1EA2A 3H3HA 3AMOB 2HMOB 1HKXA 4G1MB 1YGEA 5LC7A 1NB5I 5G2GA 1W6GA 1K9M4 1TIJA 4OK0A 4RNZA 3WMDA 3ROBA 4BTYA 2W9QA 3MG1A 2BMRB 3CNMA 4WP5A 3QRDA 3G0KA 4O2HA 1LOXA 5FW5A 4BTXA 3CCM3 4FMDA 1JN5A 2Y73A 3CC43 3NM7A 3D3LA 2I9WA 1NJI4 2CFLA 3ECFA 4L8OA 3DGOA 1YJ93 1R4CA 1VQ63 4I4KA 4XDWA 3OW22 1RJOA 5D81A 3F7SA 2XR8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N6N B;  1GD3 A;  1WNH A;  2O9U X;  4TX4 A;  4N6O B;  1A90 A;  2OCT A;  4N6M A;  1MOL A;  4N6T A;  1MNL A;  1RN7 A;  1N5H A;  5A0O B;  2W9P A;  3UL5 A;  1G96 A;  2BO9 B;  3L0R A;  2CH9 A;  3Q2P A;  4N6L A;  4LZI A;  3LH4 A;  3K9M C;  1A67 A;  1FA3 A;  1LXE A;  1N5P A;  1CYV A;  1DVC A;  4IT7 A;  3MWZ A;  3IMA B;  1IV7 A;  3PS8 A;  5EQL A;  4ZM8 A;  3PYJ A;  3KFQ C;  1IV9 A;  4N6U A;  3KSE D;  1GD4 A;  1M9G A;  3S67 A;  1ROA A;  3GAX A;  1FUW A;  1YVB I;  5ELU A;  5LC6 A;  3UL6 A;  1CYU A;  5LC7 A;  1NB5 I;  1TIJ A;  1NB3 I;  1KWI A;  3PXM A;  1DVD A;  1N9J A;  2W9Q A;  3QRD A;  1EQK A;  1PFP A;  4EYC A;  3NX0 A;  1CEW I;  4N6V 0;  5ELJ A;  4CCV A;  1R4C A;  2KXG A;  1STF I;  3SVA A; 
#chains in the Genus database with same CATH topology
 1BAN A;  3GZB A;  1RGA A;  1GD3 A;  1UUW B;  3EBY A;  2RBI A;  3MKI A;  1OHS A;  3JUN A;  5D83 A;  1ISK A;  1JBR A;  4HM3 B;  1X1U A;  2K54 A;  1UDI I;  1W5Z A;  2E2V A;  1BNG A;  5STD A;  1Q42 A;  1B2X A;  2W9P A;  2C4B A;  1T5Y A;  3SYU A;  3BB9 A;  3UB1 A;  2HMM B;  4WYK B;  2OOV C;  3DGM A;  5EVH A;  3NM2 A;  3DH2 A;  5D82 A;  3L0R A;  2CH9 A;  2RNT A;  2XGL A;  1I70 A;  3CPO A;  2CWT A;  1BU4 A;  3EB8 A;  1FZU A;  3SXX A;  4J8T A;  1O7P B;  4HM2 B;  1BNE A;  3CCU 3;  2ML5 A;  2FXT A;  3CCV 3;  1JB5 A;  3KII A;  5DRV A;  1YIT 3;  3S27 A;  4LZI A;  1IVV A;  1RDS A;  2F5M A;  2D1W A;  1JB2 A;  4L7K A;  1IVU A;  5M18 A;  7GSP A;  1RGC A;  1DMN A;  5IEP A;  1UGH I;  1C7H A;  4L8P A;  1VQP 3;  3U97 A;  4R9K A;  1LXE A;  1NU3 A;  2H0H A;  1JKG B;  1BAO A;  1WMP A;  2KAA A;  1A2P A;  4IT7 A;  2SAR A;  3OXA A;  3IMA B;  4HKV B;  2UGI A;  4HM0 B;  1O7M B;  1ULI B;  3NQZ A;  3HIG A;  3SOA A;  1YIJ 3;  1UCL A;  3HX8 A;  1OPY A;  1IV9 A;  1PYL A;  1IVW A;  1UI8 A;  1HZ1 A;  3A5E A;  3CXC 2;  1LQG C;  1VQO 3;  2QA4 3;  4HOH A;  1N8Q A;  1JZD A;  3NV0 B;  4K90 B;  4JRF A;  4KT3 B;  1KD1 4;  2CW9 A;  1Q7H A;  3D5I A;  1M9G A;  2KF6 A;  3EQQ B;  1ASK A;  3LZA A;  4LEH A;  4EXR A;  2W0Q A;  6GSP A;  1K73 4;  2INX A;  3BNC A;  2ZDJ A;  2M7O A;  1B3S A;  1B2Z A;  1KQS 2;  4GB5 A;  1BNJ A;  1A2V A;  1I3F A;  1ROA A;  5IEO A;  2GXF A;  1M1X B;  2CX1 A;  1G0T A;  2AAD A;  1YGW A;  1OAC A;  1OUN A;  3B4O A;  3OV4 A;  5EEO A;  5BU4 A;  3JUP A;  3WDG B;  1PU4 A;  3G4S 3;  2RGQ A;  2F4Y A;  3CME 3;  3OWS A;  3VF1 A;  3IJE B;  4R80 A;  4O8S A;  1SQW A;  3JUM A;  1FYS A;  2H0I A;  3F40 A;  1OH0 A;  2WO0 A;  4X2H A;  1GYB A;  4KZ1 A;  1FW7 A;  1I0X A;  1NNV A;  3J7Y d;  1SIH A;  1OF5 A;  3I55 3;  4FMB A;  2IUK A;  3VSY A;  1W4N A;  2CWV A;  3D4A A;  3MG2 A;  3K0Z A;  3NQY A;  2GU1 A;  1R4Y A;  1NB3 I;  2CFD A;  4Q53 A;  3URP A;  3LTB A;  3KKG A;  3PXM A;  1DVD A;  1N9J A;  2IA7 A;  1O7H B;  4FCM A;  1L5G B;  1IK3 A;  1WQL B;  4XB5 A;  1G02 A;  1IQX A;  1HU9 A;  2O3O A;  2Q07 A;  1FUS A;  3D9R A;  2CFK A;  2XFT A;  4K1V A;  1MGR A;  3NX0 A;  3ALA A;  5HGR A;  1IYY A;  3LOY A;  3E99 A;  1IT8 A;  1N8R 4;  4N6V 0;  1GOV A;  5ELJ A;  3LTD A;  4RNY A;  4CCV A;  1Q81 4;  3M8C A;  4FMA A;  3F14 A;  1YVS A;  1AR0 A;  1BRN L;  4ILF A;  1NO3 A;  4HAA A;  1B2S A;  1K28 A;  1QVF 2;  1STF I;  1IQY A;  2CFG A;  1QMA A;  5IG4 A;  1OHO A;  2ZA4 A;  2BU4 A;  3F8X A;  3S29 A;  5HOH A;  3LYG A;  3DMC A;  1TFK A;  5KP4 A;  2O9U X;  1BNS A;  1OCV A;  3BIR A;  4N6O B;  3FG4 A;  5I97 A;  1BSA A;  1VQ5 3;  1GS3 A;  2CG0 A;  4N6M A;  4RBN A;  3EX9 A;  1EKM A;  4N3V A;  4NPB A;  9RNT A;  4N6T A;  4LMI A;  4BL2 A;  1MWS A;  3NXJ A;  5RNT A;  5G1K A;  1RN7 A;  3BNE A;  3MYT A;  3N9H A;  3KSP A;  3ZG0 A;  3Q90 A;  3I0Y A;  3UL5 A;  2C11 A;  1K41 A;  2OTJ 3;  3LT9 A;  3OWY A;  5CK6 A;  2CC3 A;  5CF2 A;  1SPU A;  2PNC A;  1MWU A;  3JVC A;  2W56 A;  7STD A;  2GEY A;  2Z77 A;  2P09 A;  1ULJ B;  2KCD A;  3BU4 A;  3Q2P A;  1X1Y A;  1LQM B;  3FGY A;  3NBJ A;  5IG5 A;  1D6U A;  2JQ5 A;  1BRG A;  5JPU A;  2CX0 A;  2OQE C;  2BT3 A;  4HM8 B;  1WMN A;  3AMO A;  3CCE 3;  3WOD G;  1RLS A;  3B8L A;  3UNL A;  3EN1 B;  2J8X B;  2GSP A;  5M1A A;  3S28 A;  1DVC A;  2WGO A;  1VQ8 3;  4AKY A;  3DY5 A;  1O7N B;  2WGQ A;  3MWZ A;  1KC8 4;  1IV7 A;  3F8H A;  2E2T A;  3G8Z A;  4IIA A;  3X3X A;  3H51 A;  2BHM A;  1VQ9 3;  4HM7 B;  5EQL A;  1I2F A;  3PYJ A;  3WHO A;  2WOH A;  1JBS A;  2HMK B;  2YFI B;  5FGO A;  3HII A;  1D6Z A;  1LOW A;  1UCI A;  3GSP A;  1B2M A;  1FGO A;  3EE1 A;  3D5G A;  3DZL A;  3NUV A;  5AYR B;  1GD4 A;  1TTO A;  1Q40 B;  2P05 A;  3S67 A;  1KSI A;  3PZW A;  2GU3 A;  3SLU A;  1ROV A;  4PEJ A;  4HVN A;  1I0V A;  1BGS A;  1GY6 A;  3MPH A;  1J2B A;  3X3Y A;  3G6E 3;  1IQ8 A;  3FF0 A;  3EF8 A;  2FGT A;  1RN4 A;  3PCR A;  1Q86 4;  4K1U A;  1ZS7 A;  2LYX A;  3GZX B;  1HYF A;  2ZL8 A;  1GMQ A;  3KE7 A;  1E3V A;  1UI7 A;  4JF8 A;  5LC6 A;  2OQE A;  3UL6 A;  1TU5 A;  3DGL A;  1S72 3;  1DMM A;  1CYU A;  1A2K A;  3CU3 A;  2K3D A;  1YI2 3;  5JBS A;  4HM1 B;  5CLK A;  2LQV A;  1KWI A;  1VQ4 3;  3ER7 A;  1C54 A;  3FG1 A;  1BOX A;  1RNT A;  1LRA A;  4KFF A;  5TGN A;  3FZW A;  1FUT A;  1OF5 B;  2YFJ B;  5AEU B;  4HBR A;  1LOV A;  1PFP A;  2R41 A;  4NHF A;  2OOV A;  3SED A;  1AV4 A;  2E2U A;  1GY7 A;  1UCJ A;  1RCK A;  1AQZ A;  2RFR A;  2WOF A;  4KFE A;  3ZFZ A;  1CEW I;  1O7G B;  1Q82 4;  1VQK 3;  4H3U A;  3DXO A;  4FMC A;  1CH0 A;  1RGE A;  3BND A;  1B27 A;  4XBT A;  2Z76 A;  1BSC A;  2CFW A;  1BUJ A;  3CCJ 3;  1DE3 A;  3MG3 A;  1RRH A;  3G16 A;  3SVA A;  3SOY A;  1SAR A;  4MJD A;  4N6N B;  5JPP A;  1Y4K A;  1CQS A;  1JKG A;  1STD A;  8RNT A;  2KRT A;  3TDG A;  1B21 A;  1GMP A;  4TX4 A;  1EUI C;  1T2I A;  3Q3F A;  2P0X A;  3FCS B;  2UUG C;  2MF7 A;  3V98 A;  2H0G A;  1BSE A;  2HOH A;  5BXQ A;  1A90 A;  3CMA 3;  1EEJ A;  1K8A 4;  1BRH A;  5KP3 A;  1YJN 3;  1BSD A;  1BSB A;  1MOL A;  1FGT A;  3LTA A;  1LOY A;  4K61 A;  5IW9 A;  1M1K 4;  1JV2 B;  3DUK A;  1GY5 A;  1MNL A;  2F99 A;  4LGQ A;  3NV0 A;  5IER A;  5IG0 A;  3RDE A;  4BTW A;  5A0O B;  2CIU A;  4MMZ B;  2F98 A;  1UW1 A;  2BIR A;  3AGO A;  2Z7A A;  3CD6 3;  4BIR A;  5AIG A;  4OUQ A;  2JDI H;  1VZZ A;  4GL6 A;  1TFO A;  3CCL 3;  4BU4 A;  1LNI A;  3QK9 A;  1BIR A;  3U1W A;  4I5Q A;  3EBT A;  1FGQ A;  2XF3 A;  1BVI A;  1RRL A;  2W2C A;  1JRQ A;  3A76 A;  4HYZ A;  2IY2 A;  1DET A;  3PGB A;  1IU7 A;  1JN5 B;  2OTL 3;  2R4I A;  1RN1 A;  1JB4 A;  1W6Y A;  3BNB A;  3N8B A;  4O3V A;  3HI7 A;  2RSX A;  1IDP A;  4CPK A;  4WWU C;  1A67 A;  2GBW B;  3HZP A;  1FA3 A;  2XRX B;  3EC9 A;  2BMO B;  2KF5 A;  1N5P A;  3JUQ A;  1BRI A;  3LT8 A;  3OWU A;  1BNR A;  1E97 A;  2XSO B;  2STD A;  5AII A;  1S5A A;  1FGR A;  4H61 A;  6RNT A;  1B2U A;  2L1S A;  1LNH A;  3AHW A;  4DKI A;  4RNT A;  3KFQ C;  2F56 A;  1NDO B;  1RGL A;  1N9E A;  4N6U A;  3GWR A;  2W03 A;  2YX9 A;  5IEN A;  1VQM 3;  2QGU A;  3KSE D;  4STD A;  1W02 A;  1UUV B;  1V74 A;  3RNT A;  3HK4 A;  3LML A;  4J5K A;  1W00 A;  2AAE A;  4U13 A;  4WHA A;  2W04 A;  1U5O A;  3GZR A;  1I3I A;  2KF3 A;  3K63 A;  2ML6 A;  3F9S A;  2YFL B;  3RGR A;  3FG3 A;  1IVX A;  3JUO A;  2XFS A;  3EHC A;  1T3B A;  1DYU A;  1MGW A;  2W6J H;  4FCZ A;  4AEQ A;  1NWW A;  3G71 3;  1I2G A;  2B1X B;  3FH1 A;  3GAX A;  1TRP A;  3X42 A;  1W2B 2;  1RCL A;  2CKF B;  3K5T A;  4X2O A;  3AGN A;  1VQ7 3;  1ZX2 A;  4XDV A;  1W2Z A;  1RTU A;  1Q7Y 4;  1US1 A;  2RCD A;  4LYL B;  1JNQ A;  3NBR A;  4EBG A;  2P0M A;  3UJM A;  2HMN B;  3GZY B;  1YHQ 3;  3X40 A;  3CNX A;  4EV5 A;  4AKZ A;  4KVH A;  1X1X A;  3GRD A;  3CPW 2;  4HM4 B;  2XGN A;  3DM8 A;  3MSO A;  5BVB A;  2HML B;  4IPB A;  4HZB B;  4R1K A;  4EC6 A;  3O8Y A;  1EQK A;  4FCJ A;  3B4P A;  1QVG 2;  1IT7 A;  1TJD A;  4EYC A;  1RSN A;  2HMJ B;  4EW5 A;  2QEX 3;  5M19 A;  1RGK A;  1PY3 A;  3RGA A;  3WA3 A;  4GHO A;  7RNT A;  2GBX B;  3CC7 3;  1QAL A;  3WOE B;  4HZ9 B;  1AVK A;  2XEP A;  2Z6B A;  1JJ2 2;  1QAF A;  2QIY A;  2KXG A;  2UX0 A;  4R4K A;  2SBL A;  3FF2 A;  4QWT A;  1FGM A;  2OWP A;  3STD A;  3SX1 A;  1WNH A;  1W6C A;  4MMX B;  1VQQ A;  3KCH A;  1T2H A;  1UUG B;  2XH9 A;  3NHX A;  1RHL A;  2OCT A;  1RGF A;  4HM5 B;  3CCR 3;  4WYK A;  1B20 A;  3CCS 3;  3EN8 A;  4HJL B;  5AIF A;  5AEW B;  6STD A;  1F8N A;  3HOH A;  4CDL A;  1GOY A;  1RNB A;  5CF1 A;  1V58 A;  3FLJ A;  3CC2 3;  1N5H A;  3KN4 A;  3WA2 X;  3DGY A;  1OHP A;  2D42 A;  4WFO A;  1Q40 A;  2F5W A;  1WTH A;  2ZHX B;  5DRE A;  1Q9E A;  3EJV A;  3Q1C A;  1G96 A;  1GOU A;  1AY7 A;  1GSP A;  1QJG A;  2BO9 B;  2CK3 H;  2L4V A;  2IUJ A;  1JBT A;  4ORL A;  4J9A A;  3ZG5 A;  3NBB A;  5KP1 A;  3I56 3;  4RZM A;  2K0M A;  1ZGX A;  1O7W B;  5GSP A;  8CHO A;  2F86 B;  2KF4 A;  3IPT A;  1BUQ A;  3LXU X;  3DGN A;  4N6L A;  2IYJ A;  1D6Y A;  3VGN A;  3LH4 A;  1MWR A;  4GSP A;  4O02 B;  1VQL 3;  3BLZ A;  4XM4 A;  3T8U A;  3FKA A;  3T8N A;  1RMS A;  3X41 A;  3N54 B;  3K9M C;  4MMY B;  2MC8 A;  3S5C A;  1Z1S A;  4BL3 A;  4EV2 A;  2IMJ A;  3OX9 A;  1M90 4;  2CWU A;  1CYV A;  2P38 A;  2PZV A;  3FSD A;  1U8C B;  1DMQ A;  2CG1 A;  1GMR A;  4NRE A;  4XBX A;  1QAK A;  2XSH B;  1W7C A;  1RKY A;  1ZO2 A;  4HM6 B;  3PS8 A;  1TP6 A;  3V92 A;  4ZM8 A;  5IG3 A;  3MHE A;  1OGZ A;  4CJN A;  1AVL A;  3CCQ 3;  1RGH A;  3F7X A;  3K7C A;  2BMQ B;  4J5G A;  2B24 B;  1BRJ A;  3B7C A;  1SII A;  4LSO A;  5AI1 A;  4KFD A;  3PCS A;  3V99 A;  2C10 A;  3X3Z A;  2GEX A;  1LVN A;  3KZT A;  4XBY A;  3WR2 A;  3D79 A;  4OVM A;  4R9L A;  4FR9 A;  1E3R A;  5CXO A;  1EG9 B;  5AIH A;  1OGX A;  2FNQ A;  3T0U A;  1TUH A;  3WOF B;  2W56 B;  3LTC A;  2A15 A;  1YJW 3;  1RGG A;  5AYS C;  2BNG A;  1FUW A;  1YVB I;  5ELU A;  1VQN 3;  3AHS A;  2V1L A;  1SJW A;  1TRQ A;  1WMO A;  2CHC A;  5IF6 A;  2Y74 A;  1W01 A;  1V57 A;  1EA2 A;  3H3H A;  1BNF A;  3AMO B;  1UGI A;  1BRS A;  2HMO B;  1HKX A;  4G1M B;  1YGE A;  5LC7 A;  1NB5 I;  5G2G A;  1W6G A;  1K9M 4;  1TIJ A;  1BRK A;  5BIR A;  1UCK A;  4OK0 A;  4RNZ A;  3WMD A;  3ROB A;  5G1L A;  4BTY A;  2W9Q A;  3MG1 A;  2BMR B;  1MWT A;  1YNV X;  1X1W A;  3CNM A;  3QRD A;  4WP5 A;  1I2E A;  3G0K A;  4O2H A;  1LOX A;  5FW5 A;  4BTX A;  1JZO A;  3CCM 3;  4FMD A;  1JN5 A;  2Y73 A;  3CC4 3;  3NM7 A;  3D3L A;  1BNI A;  2I9W A;  1NJI 4;  2CFL A;  3ECF A;  4L8O A;  3DGO A;  1YJ9 3;  1R4C A;  1VQ6 3;  4I4K A;  4MEI A;  4XDW A;  3OW2 2;  1RJO A;  5D81 A;  3F7S A;  2XR8 B;  1I8V A; 
#chains in the Genus database with same CATH homology
 3GZB A;  1UUW B;  1GD3 A;  3EBY A;  3MKI A;  1OHS A;  3JUN A;  5D83 A;  1ISK A;  4HM3 B;  2K54 A;  1W5Z A;  2E2V A;  5STD A;  1Q42 A;  2W9P A;  1T5Y A;  3BB9 A;  3UB1 A;  2HMM B;  4WYK B;  2OOV C;  3DGM A;  5EVH A;  3NM2 A;  5D82 A;  3L0R A;  2CH9 A;  2XGL A;  3CPO A;  2CWT A;  3EB8 A;  3SXX A;  4J8T A;  1O7P B;  4HM2 B;  3CCU 3;  2ML5 A;  2FXT A;  3CCV 3;  1JB5 A;  3KII A;  5DRV A;  1YIT 3;  3S27 A;  4LZI A;  1IVV A;  2D1W A;  1JB2 A;  4L7K A;  1IVU A;  5IEP A;  1DMN A;  4L8P A;  1C7H A;  1VQP 3;  3U97 A;  4R9K A;  1LXE A;  1NU3 A;  1JKG B;  1WMP A;  4IT7 A;  3OXA A;  3IMA B;  4HKV B;  4HM0 B;  1O7M B;  1ULI B;  3NQZ A;  3HIG A;  3SOA A;  1YIJ 3;  3HX8 A;  1OPY A;  1IV9 A;  1IVW A;  1UI8 A;  3CXC 2;  1VQO 3;  2QA4 3;  1N8Q A;  3NV0 B;  4K90 B;  4JRF A;  1KD1 4;  2CW9 A;  3EQQ B;  3LZA A;  1M9G A;  4LEH A;  1ASK A;  4EXR A;  1K73 4;  2W0Q A;  2INX A;  3BNC A;  2ZDJ A;  2M7O A;  1KQS 2;  4GB5 A;  1A2V A;  5IEO A;  1ROA A;  2GXF A;  1M1X B;  4MEI A;  3B4O A;  1OAC A;  1OUN A;  3OV4 A;  5EEO A;  1PU4 A;  3JUP A;  3WDG B;  3G4S 3;  2RGQ A;  3CME 3;  3OWS A;  3VF1 A;  3IJE B;  4R80 A;  4O8S A;  1SQW A;  3JUM A;  3F40 A;  1OH0 A;  2WO0 A;  4X2H A;  1GYB A;  4KZ1 A;  1SIH A;  1OF5 A;  3I55 3;  4FMB A;  2IUK A;  3VSY A;  1W4N A;  2CWV A;  3MG2 A;  3K0Z A;  3NQY A;  2GU1 A;  1NB3 I;  2CFD A;  4Q53 A;  3LTB A;  3KKG A;  3PXM A;  1DVD A;  1N9J A;  2IA7 A;  1O7H B;  4FCM A;  1L5G B;  1IK3 A;  1WQL B;  4XB5 A;  1IQX A;  1HU9 A;  2O3O A;  2Q07 A;  3D9R A;  2CFK A;  2XFT A;  4K1V A;  3NX0 A;  3ALA A;  5HGR A;  3LOY A;  3E99 A;  1IT8 A;  1N8R 4;  4N6V 0;  5ELJ A;  4CCV A;  3LTD A;  4RNY A;  1Q81 4;  3M8C A;  4FMA A;  3F14 A;  1AR0 A;  1NO3 A;  1K28 A;  1QVF 2;  1STF I;  1IQY A;  2CFG A;  1QMA A;  5IG4 A;  1OHO A;  3F8X A;  3S29 A;  3LYG A;  3DMC A;  1TFK A;  5KP4 A;  2O9U X;  1OCV A;  4N6O B;  3FG4 A;  5I97 A;  1VQ5 3;  1GS3 A;  2CG0 A;  4N6M A;  4RBN A;  3EX9 A;  1EKM A;  4N3V A;  4N6T A;  4LMI A;  3NXJ A;  1RN7 A;  3BNE A;  3MYT A;  3N9H A;  3KSP A;  3Q90 A;  3I0Y A;  3UL5 A;  2C11 A;  1K41 A;  2OTJ 3;  3LT9 A;  3OWY A;  5CK6 A;  2CC3 A;  5CF2 A;  1SPU A;  2PNC A;  3JVC A;  7STD A;  2W56 A;  2GEY A;  2Z77 A;  2P09 A;  1ULJ B;  2KCD A;  3Q2P A;  5IG5 A;  3FGY A;  3NBJ A;  1D6U A;  2JQ5 A;  5JPU A;  2OQE C;  2BT3 A;  4HM8 B;  1WMN A;  3AMO A;  3CCE 3;  3WOD G;  3B8L A;  3UNL A;  3EN1 B;  3S28 A;  1DVC A;  2WGO A;  1VQ8 3;  4AKY A;  3DY5 A;  1O7N B;  2WGQ A;  3MWZ A;  1KC8 4;  1IV7 A;  3F8H A;  2E2T A;  3G8Z A;  4IIA A;  3X3X A;  3H51 A;  2BHM A;  1VQ9 3;  4HM7 B;  5EQL A;  3PYJ A;  2WOH A;  2HMK B;  2YFI B;  5FGO A;  3HII A;  1D6Z A;  1FGO A;  3EE1 A;  3DZL A;  3NUV A;  5AYR B;  1GD4 A;  1Q40 B;  2P05 A;  3S67 A;  1KSI A;  3PZW A;  2GU3 A;  3SLU A;  1ROV A;  4PEJ A;  4HVN A;  1GY6 A;  3MPH A;  1J2B A;  3X3Y A;  3G6E 3;  1IQ8 A;  3FF0 A;  3EF8 A;  2FGT A;  3PCR A;  1Q86 4;  4K1U A;  3GZX B;  2LYX A;  2ZL8 A;  5LC6 A;  3KE7 A;  1E3V A;  1UI7 A;  4JF8 A;  3UL6 A;  2OQE A;  1TU5 A;  1S72 3;  3DGL A;  1CYU A;  1DMM A;  1A2K A;  3CU3 A;  1YI2 3;  5JBS A;  4HM1 B;  5CLK A;  2LQV A;  1KWI A;  1VQ4 3;  3ER7 A;  3FG1 A;  4KFF A;  5TGN A;  3FZW A;  5AEU B;  1OF5 B;  2YFJ B;  4HBR A;  4NHF A;  1PFP A;  2OOV A;  3SED A;  1AV4 A;  2E2U A;  1GY7 A;  2RFR A;  3J7Y d;  1M1K 4;  4KFE A;  2WOF A;  1Q82 4;  1CEW I;  1O7G B;  1VQK 3;  4H3U A;  3DXO A;  4FMC A;  3BND A;  4XBT A;  2Z76 A;  2CFW A;  3CCJ 3;  3MG3 A;  1RRH A;  3G16 A;  3SVA A;  3SOY A;  4N6N B;  4MJD A;  5JPP A;  1Y4K A;  1CQS A;  1JKG A;  1STD A;  2KRT A;  3TDG A;  4TX4 A;  2P0X A;  3FCS B;  2MF7 A;  3V98 A;  5BXQ A;  1A90 A;  3CMA 3;  1K8A 4;  5KP3 A;  1YJN 3;  4K61 A;  1MOL A;  1FGT A;  3LTA A;  5IW9 A;  1JV2 B;  3DUK A;  1GY5 A;  1MNL A;  2F99 A;  4LGQ A;  3NV0 A;  5IER A;  5IG0 A;  3RDE A;  4BTW A;  5A0O B;  2CIU A;  4MMZ B;  2F98 A;  1UW1 A;  2Z7A A;  3CD6 3;  5AIG A;  4OUQ A;  2JDI H;  1VZZ A;  4GL6 A;  1TFO A;  3CCL 3;  3QK9 A;  3U1W A;  3EBT A;  1FGQ A;  2XF3 A;  2W2C A;  1RRL A;  4HYZ A;  1JRQ A;  3A76 A;  3PGB A;  1IU7 A;  1JN5 B;  2OTL 3;  2R4I A;  1JB4 A;  1W6Y A;  3BNB A;  3N8B A;  4O3V A;  3HI7 A;  2RSX A;  1IDP A;  4WWU C;  1A67 A;  2GBW B;  3HZP A;  1FA3 A;  2XRX B;  3EC9 A;  2BMO B;  1N5P A;  3JUQ A;  3LT8 A;  3OWU A;  1E97 A;  2XSO B;  2STD A;  5AII A;  1S5A A;  1FGR A;  4H61 A;  1LNH A;  3KFQ C;  1NDO B;  1N9E A;  4N6U A;  3GWR A;  2W03 A;  2YX9 A;  5IEN A;  1VQM 3;  2QGU A;  3KSE D;  4STD A;  1W02 A;  1UUV B;  1V74 A;  3HK4 A;  3LML A;  1W00 A;  4U13 A;  4WHA A;  2W04 A;  1U5O A;  3GZR A;  3K63 A;  2ML6 A;  3F9S A;  2YFL B;  3RGR A;  3FG3 A;  1IVX A;  3JUO A;  2XFS A;  3EHC A;  4AEQ A;  1DYU A;  2W6J H;  4FCZ A;  3G71 3;  1NWW A;  2B1X B;  3FH1 A;  3GAX A;  1W2B 2;  3X42 A;  2CKF B;  3K5T A;  4X2O A;  1VQ7 3;  1ZX2 A;  4XDV A;  1W2Z A;  1Q7Y 4;  1US1 A;  2RCD A;  1JNQ A;  3NBR A;  4EBG A;  2P0M A;  3UJM A;  2HMN B;  3GZY B;  1YHQ 3;  3X40 A;  3CNX A;  4EV5 A;  4AKZ A;  4KVH A;  3CPW 2;  3GRD A;  4HM4 B;  2XGN A;  3DM8 A;  3MSO A;  5BVB A;  2HML B;  4IPB A;  4HZB B;  4R1K A;  4EC6 A;  3O8Y A;  1EQK A;  4FCJ A;  3B4P A;  1QVG 2;  1IT7 A;  4EYC A;  2HMJ B;  2QEX 3;  3RGA A;  3WA3 A;  2GBX B;  3CC7 3;  1QAL A;  3WOE B;  4HZ9 B;  1AVK A;  2XEP A;  2Z6B A;  1JJ2 2;  1QAF A;  2QIY A;  2KXG A;  2UX0 A;  4R4K A;  2SBL A;  3FF2 A;  4QWT A;  1FGM A;  2OWP A;  3STD A;  3SX1 A;  1WNH A;  1W6C A;  4MMX B;  2XH9 A;  4HM5 B;  3NHX A;  3CCR 3;  2OCT A;  4WYK A;  3CCS 3;  3EN8 A;  4HJL B;  5AIF A;  5AEW B;  6STD A;  1F8N A;  4CDL A;  5CF1 A;  3FLJ A;  3CC2 3;  1N5H A;  3KN4 A;  3WA2 X;  1OHP A;  2D42 A;  4WFO A;  1Q40 A;  5DRE A;  1WTH A;  3EJV A;  3Q1C A;  1G96 A;  2CK3 H;  1QJG A;  2BO9 B;  2L4V A;  2IUJ A;  4ORL A;  4J9A A;  5KP1 A;  3NBB A;  3I56 3;  4RZM A;  2K0M A;  1O7W B;  8CHO A;  2F86 B;  3IPT A;  1BUQ A;  3LXU X;  3DGN A;  4N6L A;  1D6Y A;  3VGN A;  3LH4 A;  4O02 B;  1VQL 3;  3BLZ A;  4XM4 A;  3T8U A;  3FKA A;  3T8N A;  3X41 A;  3N54 B;  3K9M C;  4MMY B;  2MC8 A;  3S5C A;  1Z1S A;  4EV2 A;  2IMJ A;  3OX9 A;  1M90 4;  2CWU A;  1CYV A;  2P38 A;  2PZV A;  3FSD A;  1U8C B;  1DMQ A;  2CG1 A;  4NRE A;  4XBX A;  1QAK A;  2XSH B;  1W7C A;  1RKY A;  1ZO2 A;  4HM6 B;  3PS8 A;  1TP6 A;  3V92 A;  4ZM8 A;  5IG3 A;  3MHE A;  1OGZ A;  1AVL A;  3CCQ 3;  3F7X A;  3K7C A;  2BMQ B;  2B24 B;  5AI1 A;  3B7C A;  1SII A;  4LSO A;  3V99 A;  4KFD A;  3PCS A;  2C10 A;  3X3Z A;  2GEX A;  1LVN A;  3KZT A;  4XBY A;  4OVM A;  4R9L A;  4FR9 A;  1E3R A;  5CXO A;  1EG9 B;  5AIH A;  1OGX A;  2FNQ A;  3T0U A;  1TUH A;  3WOF B;  2W56 B;  3LTC A;  2A15 A;  1YJW 3;  5AYS C;  2BNG A;  1FUW A;  1YVB I;  5ELU A;  1VQN 3;  2V1L A;  1SJW A;  1WMO A;  2CHC A;  5IF6 A;  2Y74 A;  1W01 A;  1EA2 A;  3H3H A;  3AMO B;  2HMO B;  1HKX A;  4G1M B;  1YGE A;  5LC7 A;  1NB5 I;  5G2G A;  1W6G A;  1K9M 4;  1TIJ A;  4OK0 A;  4RNZ A;  3WMD A;  3ROB A;  4BTY A;  2W9Q A;  3MG1 A;  2BMR B;  3CNM A;  4WP5 A;  3QRD A;  3G0K A;  4O2H A;  1LOX A;  5FW5 A;  4BTX A;  3CCM 3;  4FMD A;  1JN5 A;  2Y73 A;  3CC4 3;  3NM7 A;  3D3L A;  2I9W A;  1NJI 4;  2CFL A;  3ECF A;  4L8O A;  3DGO A;  1YJ9 3;  1R4C A;  1VQ6 3;  4I4K A;  4XDW A;  3OW2 2;  1RJO A;  5D81 A;  3F7S A;  2XR8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...