2A15A

X-ray crystal structure of rv0760 from mycobacterium tuberculosis at 1.68 angstrom resolution
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
133
structure length
133
Chain Sequence
TQSPALIASQSSWRCVQAHDREGWLALMADDVVIEDPIGKSVTNPDGSGIKGKEAVGAFFDTHIAANRLTVTCEETFPSSSPDEIAHILVLHSEFDGGFTSEVRGVFTYRVNKAGLITNMRGYWNLDMMTFGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords HYPOTHETICAL PROTEIN Rv0760c
publication title Crystal structure of Mycobacterium tuberculosis Rv0760c at 1.50 A resolution, a structural homolog of Delta(5)-3-ketosteroid isomerase
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 41
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2005-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2a15A00
3M8CA 3NV0B 4XDWA 4K1UA 4HM1B 3GZRA 4HM8B 3LZAA 3DM8A 3DMCA 2HMOB 5DREA 3F7SA 1JB4A 3OXAA 1ISKA 2PZVA 3ER7A 4RZMA 4HM2B 3CNXA 3Q90A 2W2CA 1QMAA 4ORLA 4XB5A 5AI1A 4HM3B 3S5CA 3I0YA 4LGQA 4WYKB 2RFRA 1EG9B 3B4PA 2YFLB 3MHEA 1OHSA 3EN8A 1OHOA 3NUVA 5AEWB 3RGRA 5STDA 3NV0A 3IPTA 3BLZA 3G0KA 5IG3A 3HX8A 3CPOA 4L8PA 3LYGA 4GB5A 3SOYA 1K41A 3UJMA 1O7MB 1GY6A 4XDVA 3OWUA 1DMMA 1WQLB 2YFIB 1JB2A 1GY5A 3NHXA 1NWWA 5BVBA 2GEYA 3EQQB 4WP5A 2BMQB 1BUQA 3F8XA 5KP4A 3CNMA 5KP1A 3ROBA 1IDPA 2F98A 1UUWB 3GZBA 2Z7AA 6STDA 3MG3A 3NXJA 2F86B 4R1KA 3UNLA 5IG5A 3OV4A 2UX0A 2QIYA 3MG2A 4IIAA 1DMNA 4LMIA 1OHPA 3DXOA 3FKAA 5DRVA 5CLKA 1CQSA 4HM5B 3NM2A 3F9SA 2GEXA 3EHCA 4L8OA 3MG1A 4HM7B 2BNGA 3VGNA 5AEUB 4XBXA 2XRXB 3CU3A 4Q53A 2IMJA 5AIFA 1O7GB 5IEOA 1NU3A 4MJDA 4OUQA 2A15A 1U5OA 4U13A 5TGNA 3F8HA 5HGRA 3KKGA 8CHOA 3T8NA 2Z76A 4L7KA 2BMRB 2BMOB 5CF1A 3KZTA 1HKXA 4HVNA 3F40A 1AR0A 2XSOB 3F7XA 2HMJB 2HMMB 4WWUC 2K54A 1W6YA 1DMQA 3H51A 1TP6A 4R9LA 2XSHB 3FF2A 3MKIA 2I9WA 1SJWA 3SEDA 1QJGA 3OWYA 5AIGA 3GZYB 4HM6B 1GS3A 4R9KA 1E97A 4FCMA 3HZPA 5IENA 4KVHA 1O7NB 1ASKA 4STDA 3K7CA 4PEJA 3T8UA 4HJLB 1JB5A 1W02A 1E3VA 4J9AA 3EN1B 4I4KA 2RCDA 4HZBB 1JN5A 3B4OA 1GYBA 5EVHA 1OH0A 2F99A 1EA2A 3FGYA 2GBXB 3MYTA 3H3HA 3EX9A 1W01A 1ULJB 3FH1A 1NDOB 3EBTA 4HZ9B 5AIIA 2RGQA 2Z77A 3JUPA 4XM4A 1Z1SA 3EF8A 3JUOA 1OGZA 3FSDA 3D9RA 5IG4A 3B8LA 4HKVB 2GXFA 3G16A 1JKGA 5IF6A 4N3VA 5KP3A 3GZXB 5FW5A 3SOAA 2JQ5A 3EJVA 1STDA 1TUHA 4CDLA 3VSYA 1Q40A 5IEPA 3K0ZA 1JN5B 3JUNA 3F14A 3STDA 5AIHA 3JUMA 1VZZA 3WMDA 4XBTA 4XBYA 3B7CA 1OPYA 3DUKA 4LEHA 3MSOA 3FZWA 1GY7A 2HMNB 1Q42A 3KSPA 2B24B 3ECFA 3E99A 1O7WB 4K1VA 1OGXA 5D81A 2CHCA 3GRDA 5JPPA 3KE7A 4FCJA 2HMLB 2R4IA 1S5AA 1C7HA 4X2HA 1A2KA 1JKGB 1ZO2A 1ZX2A 3A76A 2XR8B 3FLJA 1OF5B 5CXOA 5IG0A 1UUVB 1O7HB 5JPUA 3BB9A 5CF2A 2HMKB 1W00A 2B1XB 3DZLA 1O7PB 1E3RA 1ULIB 1Q40B 3RGAA 7STDA 2STDA 5IERA 2INXA 3JUQA 2OWPA 4WYKA 5CK6A 3G8ZA 1OUNA 2QGUA 5D82A 2YFJB 3FF0A 3NBRA 3EBYA 4H3UA 2CKFB 2GBWB 3GWRA 3HK4A 1OCVA 5BXQA 4OVMA 3OWSA 3OX9A 4X2OA 5G2GA 3EC9A 4HM0B 4HM4B 1OF5A 4J8TA 5D83A
chains in the Genus database with same CATH superfamily
3M8CA 3NV0B 4XDWA 5JBSA 1LOWA 1FGOA 3NQYA 1VQN3 1FGMA 4K1UA 3SYUA 2IUKA 6GSPA 5BIRA 4HM1B 3GZRA 3BNBA 4HM8B 3LZAA 6RNTA 2KRTA 1EKMA 4K61A 1FW7A 1DETA 4KFFA 1BVIA 1IVWA 1MWSA 1AV4A 4FMBA 4TX4A 1VQ63 3DM8A 3DMCA 2HMOB 3PYJA 4DKIA 1VQO3 4NREA 5DREA 2J8XB 3F7SA 1JB4A 3OXAA 2MC8A 4N6V0 2XGLA 1Q824 2PZVA 2WOFA 3ER7A 1ISKA 4RZMA 1PU4A 2P05A 3VF1A 4BL3A 1YHQ3 1W4NA 3X40A 1M1K4 2BO9B 1MNLA 2F4YA 2Y74A 4HM2B 1YJ93 3CNXA 1QAFA 3Q90A 3IJEB 4EXRA 1SPUA 1GD4A 2K0MA 4H61A 2W2CA 3RNTA 1QMAA 1KWIA 4ORLA 4XB5A 2SBLA 5AI1A 1LQGC 4HM3B 3S5CA 1K28A 4N6UA 3I0YA 2ZHXB 4LGQA 4WYKB 5AIGA 3FG3A 3K9MC 5HOHA 1G96A 1UI7A 2RFRA 1EG9B 3B4PA 2YFLB 4JF8A 3MHEA 1OHSA 4MMXB 3EN8A 3UB1A 1DVDA 3CPW2 1TTOA 1DVCA 1OHOA 2F5WA 3EE1A 3NUVA 4BTYA 1KQS2 5AEWB 1DE3A 3RGRA 5STDA 1QAKA 3NV0A 1IU7A 3BLZA 3IPTA 4FMAA 1B2XA 1G02A 1LVNA 1STFI 4O02B 4HAAA 1UUGB 3G0KA 4O8SA 1I2GA 5IG3A 3HX8A 1PY3A 1BRGA 3CPOA 4L8PA 1RLSA 5EEOA 3LYGA 3IMAB 2OTL3 4GB5A 2Y73A 3SOYA 1K41A 3UJMA 1NNVA 1CEWI 1O7MB 1GY6A 4XDVA 3OWUA 4R80A 1DMMA 2ZL8A 1W2ZA 1WQLB 1HU9A 2XH9A 2YFIB 3AHWA 4GL6A 1JB2A 1GY5A 3NHXA 3SX1A 1NWWA 1M904 1BNSA 2GEYA 5BVBA 3EQQB 4WP5A 1BRJA 2O9UX 2BMQB 1IQYA 1RSNA 1TIJA 3KSED 1X1WA 2Z6BA 1TU5A 1YJW3 2OTJ3 2CFKA 4EV5A 1BUQA 1JRQA 3F8XA 4J5KA 1W6CA 3CCL3 2ZA4A 5KP4A 3CNMA 5KP1A 1VQ53 3ROBA 1IDPA 2F98A 4WHAA 1UUWB 1ZGXA 2E2TA 4HBRA 1EQKA 2UUGC 3NQZA 1I70A 4NPBA 3GZBA 1YNVX 2Z7AA 2K3DA 1AVKA 1IT7A 2W04A 6STDA 3MG3A 1EUIC 3NXJA 3WDGB 1B3SA 2F86B 3SVAA 1K8A4 5A0OB 4R1KA 1ZS7A 1A2PA 3KN4A 1OACA 1SIIA 1TJDA 3LTAA 3PZWA 4RNYA 4HOHA 3UNLA 1B27A 5IG5A 3OV4A 2AAEA 1S723 2UX0A 3MPHA 1D6YA 1BIRA 2QIYA 3KCHA 4LYLB 1KD14 3MG2A 4IIAA 1Q7HA 1DMNA 1BANA 2H0IA 4GHOA 4LMIA 1BUJA 3LXUX 4J5GA 3CCM3 1OHPA 3DXOA 2P0XA 3FKAA 2W03A 3A5EA 5DRVA 1IQXA 3PXMA 3Q2PA 1MGRA 4FR9A 2RNTA 3AMOB 1ROAA 5CLKA 4IT7A 1CQSA 4HM5B 3NM2A 2LYXA 3F9SA 1UCIA 1VQQA 2GEXA 1PYLA 3EHCA 1X1YA 4L8OA 4N6TA 1BSDA 5M1AA 2FNQA 3MG1A 3URPA 4HM7B 4N6NB 2BNGA 3U97A 3VGNA 2C4BA 5AEUB 4XBXA 1R4CA 2XRXB 1I3IA 1FZUA 2AADA 3CU3A 4KZ1A 1MWUA 2PNCA 4Q53A 2IMJA 5AIFA 1YVSA 1O7GB 5IEOA 3CXC2 3CCR3 1FA3A 3WODG 1NU3A 3LT8A 3WA2X 4MJDA 4OUQA 2A15A 1W6GA 1U5OA 1RGKA 1IK3A 1VQL3 1T2IA 4U13A 5TGNA 1X1XA 3F8HA 4WFOA 5HGRA 3KKGA 2JDIH 4FCZA 2BIRA 4AKYA 4CCVA 2R41A 1TRPA 2CWVA 5M18A 8CHOA 3T8NA 1I3FA 3WR2A 1M9GA 2Z76A 4L7KA 3JVCA 1FYSA 1F8NA 2BMRB 2BMOB 8RNTA 2CWUA 5CF1A 1LQMB 1JZOA 1CYUA 3KZTA 1HKXA 4HVNA 3F40A 1AR0A 4MEIA 3FCSB 3WOFB 1UI8A 2XSOB 3F7XA 4G1MB 1HYFA 2CWTA 3S29A 2OOVA 1BRSA 2BT3A 1W7CA 2CFLA 2HMJB 3BNEA 1KC84 2E2VA 2HMMB 2CFWA 1TRQA 3AMOA 3S28A 1YVBI 1BSCA 4WWUC 2K54A 4IPBA 1SIHA 1W6YA 4EV2A 1GOVA 5AYRB 2GU3A 1B2UA 4BL2A 2IUJA 7GSPA 1DMQA 3H51A 1TP6A 4R9LA 1RGEA 3ZFZA 2FXTA 2XSHB 1KSIA 3FF2A 3MKIA 3N9HA 3LTDA 2I9WA 1FGRA 1SJWA 1BSAA 1RGHA 1A2VA 3SEDA 1QJGA 1VQ93 1IT8A 1V57A 3OWYA 1GSPA 1FUSA 2HOHA 2W6JH 1N9EA 3KFQC 1AQZA 1RJOA 3GZYB 1BNJA 1BNGA 4HM6B 3SXXA 4RNTA 3CC73 1V74A 2P09A 1GS3A 3DGNA 5IW9A 1BRHA 1RNBA 4R9KA 1E97A 1UGIA 4FCMA 3CME3 1VQM3 3HZPA 4KFEA 5IENA 5M19A 3ZG0A 4AKZA 1MGWA 3HIGA 4KVHA 5AYSC 3WA3A 1CYVA 1O7NB 1RDSA 2GSPA 3LT9A 1QVG2 1ASKA 1IYYA 2CX1A 3K7CA 4STDA 4AEQA 2XFTA 7RNTA 4PEJA 3T8UA 4HJLB 1B20A 2D1WA 1BSBA 3X3XA 1JB5A 2W0QA 2Q07A 1W02A 3J7Yd 1E3VA 4J9AA 2KF5A 1LOYA 3EN1B 4I4KA 1UCKA 2ML6A 2RCDA 1GOUA 1Y4KA 1IVVA 3U1WA 3WOEB 5EQLA 4HZBB 5G1KA 1JN5A 4BTWA 2OCTA 3V99A 4FMCA 1NO3A 2QEX3 1UGHI 4N6MA 3B4OA 3DY5A 1IV9A 1GYBA 5EVHA 1OH0A 1MOLA 2F99A 1RGAA 4QWTA 4HYZA 3N8BA 1EA2A 3FGYA 2GBXB 1FUWA 3MYTA 4EC6A 1FGTA 3H3HA 3EX9A 4N6LA 1W01A 3D3LA 1ULJB 1JJ22 1BU4A 3FH1A 1US1A 1GMPA 5G1LA 3GSPA 1NDOB 1RNTA 3EBTA 4HZ9B 2CH9A 5AIIA 2RGQA 2LQVA 3AHSA 4N6OB 2Z77A 3JUPA 1GD3A 1B2SA 3LTBA 2MF7A 2W9QA 4XM4A 1IVUA 2P38A 3BU4A 3GAXA 3K63A 1C54A 1JV2B 2ML5A 2KF3A 4RBNA 2CFDA 1T3BA 3HI7A 1BRIA 1T2HA 1Z1SA 3DGMA 4BU4A 3CC43 2W56A 1FGQA 2ZDJA 4LSOA 4RNZA 4NHFA 2XGNA 2FGTA 1SARA 3EF8A 1I0VA 1BNRA 3JUOA 3PCSA 1BOXA 1VQ43 1OGZA 1RHLA 1Q814 2IA7A 1LXEA 3I553 3FSDA 3QRDA 3D9RA 3NX0A 3ZG5A 5IG4A 3FG1A 1N5HA 3B8LA 2YX9A 1VQK3 3RDEA 4HKVB 1JZDA 2GXFA 3D5IA 3S27A 3G16A 1D6ZA 1BGSA 1JKGA 1JNQA 3DGOA 3HIIA 2KXGA 4N3VA 1RRLA 5KP3A 5IF6A 1RKYA 1JBSA 3GZXB 1HZ1A 3WHOA 1D6UA 2RBIA 5FW5A 1QALA 3SOAA 2JQ5A 1BNEA 1JBRA 1AVLA 1VQP3 2SARA 1I8VA 3NBBA 4KT3B 2KF6A 1T5YA 3BIRA 1YGWA 3G4S3 2QA43 4CJNA 1X1UA 1J2BA 2F5MA 3LTCA 3EJVA 3PS8A 3NM7A 1STDA 1TUHA 1PFPA 3NBJA 1N8QA 3VSYA 2H0HA 3LMLA 4MMZB 4CDLA 1Q40A 2KAAA 1N5PA 1W5ZA 2F56A 1WTHA 2O3OA 3K0ZA 3T0UA 5IEPA 1JN5B 3CCE3 3D4AA 1A90A 4OK0A 1R4YA 3DGLA 1FUTA 1RN7A 1BRKA 2C11A 2P0MA 3JUNA 3TDGA 3DGYA 3F14A 3CD63 1A67A 3STDA 1LNHA 2WGOA 3L0RA 5AIHA 3JUMA 3I563 1TFKA 3D5GA 1NB3I 1UDII 1VZZA 3WMDA 1RRHA 2XEPA 4EW5A 3Q1CA 4KFDA 4XBTA 2V1LA 1VQ73 2W9PA 3X3ZA 4XBYA 3B7CA 1OPYA 1RCKA 3UL5A 1RMSA 1YGEA 5I97A 3DUKA 2IY2A 1I2FA 4LEHA 3LOYA 3MSOA 4ZM8A 1LNIA 1WMOA 3FZWA 1GY7A 5ELUA 2HMNB 3X42A 2CW9A 4GSPA 1YIJ3 1Q42A 3KSPA 3X3YA 1RN4A 3G6E3 2B24B 3ECFA 5RNTA 1Q9EA 1DYUA 1MWTA 3E99A 1O7WB 4EBGA 4K1VA 1GMRA 2C10A 2KCDA 4EYCA 1OGXA 5D81A 2W56B 2CHCA 3GRDA 3CCU3 5JPPA 1G0TA 1B2ZA 3KE7A 2CIUA 4FCJA 3X41A 1TFOA 2HMLB 2OQEC 4BTXA 1LOVA 1RCLA 2R4IA 1RN1A 3D79A 1WMNA 3K5TA 4LZIA 1K9M4 1I2EA 1ROVA 2BU4A 1S5AA 3EB8A 1MWRA 1C7HA 4X2HA 3V92A 3G713 1A2KA 1JKGB 1VQ83 1M1XB 1ZO2A 2H0GA 1ZX2A 3A76A 2XR8B 1WNHA 3FLJA 1GOYA 1BNIA 2RSXA 1OF5B 3PGBA 5CXOA 3V98A 4CPKA 4R4KA 1AY7A 1UCLA 2XF3A 1UW1A 2XFSA 5IG0A 5LC7A 4O3VA 1U8CB 4MMYB 5GSPA 3OW22 1IVXA 3CCJ3 1RTUA 2IYJA 1UUVB 3FG4A 1YIT3 2KF4A 1RGGA 4ILFA 1O7HB 5JPUA 3Q3FA 1UCJA 3BB9A 5CF2A 2HMKB 3CCV3 1L5GB 1K734 1BSEA 1W00A 2B1XB 3DZLA 1IV7A 1O7PB 1E3RA 3CCQ3 1CH0A 1QVF2 1LRAA 4BIRA 1ULIB 1Q40B 3PCRA 3RGAA 7STDA 1I0XA 2CK3H 2STDA 3KIIA 5IERA 3ALAA 1BAOA 1GMQA 2INXA 4JRFA 1Q864 2D42A 3CCS3 1RGLA 3JUQA 2OWPA 9RNTA 4WYKA 1N9JA 3N54B 5CK6A 3G8ZA 1OUNA 2QGUA 1WMPA 3DH2A 5D82A 2M7OA 1B21A 2YFJB 1Q7Y4 3FF0A 1IQ8A 1SQWA 3HOHA 3NBRA 3BNDA 3LH4A 5BU4A 1B2MA 3EBYA 4H3UA 2CKFB 2GBWB 2OOVC 2CX0A 4O2HA 1RGFA 5FGOA 3GWRA 1YJN3 3HK4A 1OCVA 1W2B2 2BHMA 3O8YA 2CG1A 5ELJA 3QK9A 2GU1A 5BXQA 4OVMA 3CMA3 3CC23 1YI23 1NJI4 3MWZA 3OWSA 3OX9A 4X2OA 1N8R4 5G2GA 2OQEA 2L4VA 3SLUA 1NB5I 3EC9A 2UGIA 2WO0A 3S67A 2WOHA 2E2UA 2CG0A 1JBTA 3AGNA 1EEJA 1RGCA 4HM0B 1OF5A 4HM4B 1BRNL 1V58A 3AGOA 2L1SA 2CFGA 5LC6A 2CC3A 4J8TA 4I5QA 2WGQA 1BNFA 5D83A 4K90B 4FMDA 3UL6A 1LOXA 3BNCA
chains in the Genus database with same CATH topology
3M8CA 3NV0B 4XDWA 5JBSA 1FGOA 3NQYA 1VQN3 1FGMA 4K1UA 2IUKA 4HM1B 3GZRA 3BNBA 4HM8B 3LZAA 2KRTA 1EKMA 4K61A 4KFFA 1IVWA 1AV4A 4FMBA 4TX4A 1VQ63 3DM8A 3DMCA 2HMOB 3PYJA 1VQO3 4NREA 5DREA 3F7SA 1JB4A 3OXAA 2MC8A 4N6V0 2XGLA 1Q824 2PZVA 2WOFA 3ER7A 1ISKA 4RZMA 1PU4A 2P05A 3VF1A 1YHQ3 1W4NA 3X40A 1M1K4 2BO9B 1MNLA 2Y74A 4HM2B 1YJ93 3CNXA 1QAFA 3Q90A 3IJEB 4EXRA 1SPUA 1GD4A 2K0MA 4H61A 2W2CA 1QMAA 1KWIA 4ORLA 4XB5A 2SBLA 5AI1A 4HM3B 3S5CA 1K28A 4N6UA 3I0YA 4LGQA 4WYKB 3FG3A 3K9MC 1G96A 1UI7A 2RFRA 1EG9B 3B4PA 2YFLB 4JF8A 3MHEA 1OHSA 4MMXB 3EN8A 3UB1A 1DVDA 3CPW2 1DVCA 1OHOA 3EE1A 3NUVA 4BTYA 1KQS2 5AEWB 3RGRA 5STDA 1QAKA 3NV0A 1IU7A 3BLZA 3IPTA 4FMAA 1LVNA 1STFI 4O02B 4O8SA 3G0KA 5IG3A 3HX8A 3CPOA 4L8PA 5EEOA 3LYGA 3IMAB 2OTL3 4GB5A 2Y73A 3SOYA 1K41A 3UJMA 1CEWI 1O7MB 1GY6A 4XDVA 3OWUA 4R80A 1DMMA 2ZL8A 1W2ZA 1WQLB 1HU9A 2XH9A 2YFIB 4GL6A 1JB2A 1GY5A 3NHXA 3SX1A 1NWWA 1M904 5BVBA 2GEYA 3EQQB 4WP5A 2O9UX 2BMQB 1IQYA 1TU5A 1TIJA 3KSED 2Z6BA 1YJW3 2OTJ3 2CFKA 4EV5A 1BUQA 1JRQA 3F8XA 1W6CA 3CCL3 5KP4A 3CNMA 5KP1A 1VQ53 3ROBA 1IDPA 2F98A 4WHAA 1UUWB 2E2TA 4HBRA 1EQKA 3NQZA 3GZBA 2Z7AA 1AVKA 1IT7A 2W04A 6STDA 3MG3A 3NXJA 3WDGB 2F86B 3SVAA 1K8A4 5A0OB 4R1KA 3KN4A 1OACA 1SIIA 3LTAA 4RNYA 3PZWA 3UNLA 1S723 5IG5A 3OV4A 2UX0A 3MPHA 1D6YA 2QIYA 1KD14 3MG2A 4IIAA 1DMNA 4LMIA 3LXUX 3CCM3 1OHPA 3DXOA 2P0XA 3FKAA 2W03A 5DRVA 1IQXA 3PXMA 3Q2PA 4FR9A 3AMOB 1ROAA 5CLKA 4IT7A 1CQSA 4HM5B 3NM2A 2LYXA 3F9SA 2GEXA 3EHCA 4L8OA 4N6TA 2FNQA 3MG1A 4HM7B 4N6NB 2BNGA 3U97A 3VGNA 5AEUB 4XBXA 1R4CA 2XRXB 3CU3A 4KZ1A 2PNCA 4Q53A 2IMJA 5AIFA 1O7GB 5IEOA 3CXC2 3CCR3 1FA3A 3WODG 1NU3A 3LT8A 3WA2X 4MJDA 4OUQA 2A15A 1W6GA 1U5OA 1IK3A 1VQL3 4U13A 5TGNA 3F8HA 4WFOA 5HGRA 3KKGA 2JDIH 4FCZA 4AKYA 4CCVA 2CWVA 8CHOA 3T8NA 1M9GA 2Z76A 4L7KA 3JVCA 1F8NA 2BMRB 2BMOB 2CWUA 5CF1A 1CYUA 3KZTA 1HKXA 4HVNA 3F40A 1AR0A 4MEIA 3FCSB 3WOFB 1UI8A 2XSOB 3F7XA 4G1MB 3S29A 2CWTA 1KC84 2OOVA 2BT3A 1W7CA 2CFLA 2HMJB 3BNEA 2E2VA 2HMMB 2CFWA 3AMOA 3S28A 1YVBI 4WWUC 2K54A 4IPBA 1SIHA 1W6YA 4EV2A 5AYRB 2GU3A 2IUJA 1DMQA 3H51A 1TP6A 4R9LA 2FXTA 2XSHB 1KSIA 3FF2A 3MKIA 3N9HA 3LTDA 2I9WA 1FGRA 1SJWA 3SEDA 1A2VA 1VQ93 1QJGA 1IT8A 3OWYA 3KFQC 2W6JH 5AIGA 1N9EA 1RJOA 3GZYB 4HM6B 3SXXA 3CC73 1V74A 2P09A 1GS3A 3DGNA 5IW9A 4R9KA 1E97A 4FCMA 3CME3 1VQM3 3HZPA 4KFEA 5IENA 4AKZA 3HIGA 4KVHA 5AYSC 3WA3A 1CYVA 1O7NB 1QVG2 3LT9A 1ASKA 4STDA 3K7CA 4AEQA 2XFTA 4PEJA 3T8UA 4HJLB 3X3XA 2D1WA 1JB5A 2W0QA 2Q07A 1W02A 3J7Yd 1E3VA 4J9AA 3EN1B 4I4KA 2ML6A 2RCDA 1Y4KA 1IVVA 3U1WA 3WOEB 5EQLA 4HZBB 1JN5A 4BTWA 2OCTA 3V99A 4FMCA 1NO3A 2QEX3 4N6MA 3B4OA 3DY5A 1IV9A 1GYBA 5EVHA 1OH0A 1MOLA 2F99A 4QWTA 4HYZA 3N8BA 1EA2A 3FGYA 2GBXB 1FUWA 3MYTA 4EC6A 1FGTA 3H3HA 3EX9A 4N6LA 1W01A 3D3LA 1ULJB 1JJ22 3FH1A 1US1A 1NDOB 3EBTA 4HZ9B 2CH9A 5AIIA 2RGQA 2LQVA 4N6OB 2Z77A 3JUPA 1GD3A 3LTBA 2MF7A 2W9QA 4XM4A 1IVUA 2P38A 3GAXA 3K63A 1JV2B 2ML5A 4RBNA 2CFDA 3HI7A 3DGMA 3CC43 1Z1SA 2W56A 1FGQA 2ZDJA 4LSOA 4RNZA 4NHFA 2XGNA 2FGTA 3EF8A 3JUOA 3PCSA 1VQ43 1OGZA 1Q814 2IA7A 1LXEA 3I553 3FSDA 3QRDA 3D9RA 3NX0A 5IG4A 3FG1A 1N5HA 3B8LA 2YX9A 1VQK3 3RDEA 4HKVB 2GXFA 3S27A 3G16A 1D6ZA 1JKGA 1JNQA 3DGOA 3HIIA 2KXGA 4N3VA 1RRLA 5KP3A 5IF6A 1RKYA 3GZXB 1D6UA 5FW5A 1QALA 3SOAA 2JQ5A 1AVLA 1VQP3 3NBBA 1T5YA 3G4S3 2QA43 1J2BA 3LTCA 3EJVA 3PS8A 3NM7A 1STDA 1TUHA 1PFPA 3NBJA 1N8QA 3VSYA 3LMLA 4MMZB 4CDLA 1Q40A 1N5PA 1W5ZA 5IEPA 1WTHA 2O3OA 3K0ZA 3T0UA 1JN5B 3CCE3 1A90A 4OK0A 3DGLA 1RN7A 2C11A 2P0MA 3JUNA 3TDGA 3CD63 1A67A 3F14A 3STDA 1LNHA 2WGOA 3L0RA 5AIHA 3JUMA 3I563 1TFKA 1NB3I 1VZZA 3WMDA 1RRHA 2XEPA 3Q1CA 4KFDA 4XBTA 2V1LA 1VQ73 2W9PA 3X3ZA 4XBYA 3B7CA 1OPYA 3UL5A 1YGEA 5I97A 3DUKA 4LEHA 3LOYA 3MSOA 4ZM8A 1WMOA 3FZWA 1GY7A 5ELUA 2HMNB 3X42A 2CW9A 1YIJ3 1Q42A 3KSPA 3X3YA 3G6E3 2B24B 3ECFA 1DYUA 3E99A 1O7WB 4EBGA 4K1VA 2C10A 2KCDA 4EYCA 1OGXA 5D81A 2W56B 2CHCA 3GRDA 3CCU3 5JPPA 3KE7A 2CIUA 4FCJA 3X41A 1TFOA 2HMLB 2OQEC 4BTXA 2R4IA 1WMNA 3K5TA 4LZIA 1K9M4 1ROVA 1S5AA 3EB8A 3V92A 1C7HA 4X2HA 3G713 1VQ83 1A2KA 1JKGB 1M1XB 1ZO2A 1ZX2A 3A76A 2XR8B 1WNHA 3FLJA 2RSXA 1OF5B 3PGBA 5CXOA 3V98A 4R4KA 2XF3A 1UW1A 2XFSA 5IG0A 5LC7A 4O3VA 1U8CB 4MMYB 3OW22 1IVXA 3CCJ3 1UUVB 3FG4A 1YIT3 1O7HB 5JPUA 3BB9A 5CF2A 2HMKB 3CCV3 1L5GB 1K734 1W00A 2B1XB 3DZLA 1IV7A 1O7PB 1E3RA 3CCQ3 1QVF2 1ULIB 1Q40B 3PCRA 3RGAA 7STDA 2CK3H 2STDA 3KIIA 5IERA 3ALAA 2INXA 4JRFA 1Q864 2D42A 3CCS3 3JUQA 2OWPA 4WYKA 1N9JA 3N54B 5CK6A 3G8ZA 1OUNA 2QGUA 1WMPA 5D82A 2M7OA 2YFJB 1Q7Y4 3FF0A 1IQ8A 1SQWA 3NBRA 3BNDA 3LH4A 3EBYA 4H3UA 2CKFB 2GBWB 2OOVC 4O2HA 5FGOA 3GWRA 1YJN3 3HK4A 1OCVA 1W2B2 2BHMA 3O8YA 2CG1A 5ELJA 3QK9A 2GU1A 5BXQA 4OVMA 3CMA3 3CC23 1YI23 1NJI4 3MWZA 3OWSA 3OX9A 4X2OA 1N8R4 5G2GA 2OQEA 2L4VA 3SLUA 1NB5I 3EC9A 2WO0A 3S67A 2WOHA 2E2UA 2CG0A 4HM0B 4HM4B 1OF5A 2CFGA 5LC6A 2CC3A 4J8TA 2WGQA 5D83A 4K90B 4FMDA 3UL6A 1LOXA 3BNCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M8C A;  3NV0 B;  4XDW A;  4K1U A;  4HM1 B;  3GZR A;  4HM8 B;  3LZA A;  3DM8 A;  3DMC A;  2HMO B;  5DRE A;  3F7S A;  1JB4 A;  3OXA A;  1ISK A;  2PZV A;  3ER7 A;  4RZM A;  4HM2 B;  3CNX A;  3Q90 A;  2W2C A;  1QMA A;  4ORL A;  4XB5 A;  5AI1 A;  4HM3 B;  3S5C A;  3I0Y A;  4LGQ A;  4WYK B;  2RFR A;  1EG9 B;  3B4P A;  2YFL B;  3MHE A;  1OHS A;  3EN8 A;  1OHO A;  3NUV A;  5AEW B;  3RGR A;  5STD A;  3NV0 A;  3IPT A;  3BLZ A;  3G0K A;  5IG3 A;  3HX8 A;  3CPO A;  4L8P A;  3LYG A;  4GB5 A;  3SOY A;  1K41 A;  3UJM A;  1O7M B;  1GY6 A;  4XDV A;  3OWU A;  1DMM A;  1WQL B;  2YFI B;  1JB2 A;  1GY5 A;  3NHX A;  1NWW A;  5BVB A;  2GEY A;  3EQQ B;  4WP5 A;  2BMQ B;  1BUQ A;  3F8X A;  5KP4 A;  3CNM A;  5KP1 A;  3ROB A;  1IDP A;  2F98 A;  1UUW B;  3GZB A;  2Z7A A;  6STD A;  3MG3 A;  3NXJ A;  2F86 B;  4R1K A;  3UNL A;  5IG5 A;  3OV4 A;  2UX0 A;  2QIY A;  3MG2 A;  4IIA A;  1DMN A;  4LMI A;  1OHP A;  3DXO A;  3FKA A;  5DRV A;  5CLK A;  1CQS A;  4HM5 B;  3NM2 A;  3F9S A;  2GEX A;  3EHC A;  4L8O A;  3MG1 A;  4HM7 B;  2BNG A;  3VGN A;  5AEU B;  4XBX A;  2XRX B;  3CU3 A;  4Q53 A;  2IMJ A;  5AIF A;  1O7G B;  5IEO A;  1NU3 A;  4MJD A;  4OUQ A;  2A15 A;  1U5O A;  4U13 A;  5TGN A;  3F8H A;  5HGR A;  3KKG A;  8CHO A;  3T8N A;  2Z76 A;  4L7K A;  2BMR B;  2BMO B;  5CF1 A;  3KZT A;  1HKX A;  4HVN A;  3F40 A;  1AR0 A;  2XSO B;  3F7X A;  2HMJ B;  2HMM B;  4WWU C;  2K54 A;  1W6Y A;  1DMQ A;  3H51 A;  1TP6 A;  4R9L A;  2XSH B;  3FF2 A;  3MKI A;  2I9W A;  1SJW A;  3SED A;  1QJG A;  3OWY A;  5AIG A;  3GZY B;  4HM6 B;  1GS3 A;  4R9K A;  1E97 A;  4FCM A;  3HZP A;  5IEN A;  4KVH A;  1O7N B;  1ASK A;  4STD A;  3K7C A;  4PEJ A;  3T8U A;  4HJL B;  1JB5 A;  1W02 A;  1E3V A;  4J9A A;  3EN1 B;  4I4K A;  2RCD A;  4HZB B;  1JN5 A;  3B4O A;  1GYB A;  5EVH A;  1OH0 A;  2F99 A;  1EA2 A;  3FGY A;  2GBX B;  3MYT A;  3H3H A;  3EX9 A;  1W01 A;  1ULJ B;  3FH1 A;  1NDO B;  3EBT A;  4HZ9 B;  5AII A;  2RGQ A;  2Z77 A;  3JUP A;  4XM4 A;  1Z1S A;  3EF8 A;  3JUO A;  1OGZ A;  3FSD A;  3D9R A;  5IG4 A;  3B8L A;  4HKV B;  2GXF A;  3G16 A;  1JKG A;  5IF6 A;  4N3V A;  5KP3 A;  3GZX B;  5FW5 A;  3SOA A;  2JQ5 A;  3EJV A;  1STD A;  1TUH A;  4CDL A;  3VSY A;  1Q40 A;  5IEP A;  3K0Z A;  1JN5 B;  3JUN A;  3F14 A;  3STD A;  5AIH A;  3JUM A;  1VZZ A;  3WMD A;  4XBT A;  4XBY A;  3B7C A;  1OPY A;  3DUK A;  4LEH A;  3MSO A;  3FZW A;  1GY7 A;  2HMN B;  1Q42 A;  3KSP A;  2B24 B;  3ECF A;  3E99 A;  1O7W B;  4K1V A;  1OGX A;  5D81 A;  2CHC A;  3GRD A;  5JPP A;  3KE7 A;  4FCJ A;  2HML B;  2R4I A;  1S5A A;  1C7H A;  4X2H A;  1A2K A;  1JKG B;  1ZO2 A;  1ZX2 A;  3A76 A;  2XR8 B;  3FLJ A;  1OF5 B;  5CXO A;  5IG0 A;  1UUV B;  1O7H B;  5JPU A;  3BB9 A;  5CF2 A;  2HMK B;  1W00 A;  2B1X B;  3DZL A;  1O7P B;  1E3R A;  1ULI B;  1Q40 B;  3RGA A;  7STD A;  2STD A;  5IER A;  2INX A;  3JUQ A;  2OWP A;  4WYK A;  5CK6 A;  3G8Z A;  1OUN A;  2QGU A;  5D82 A;  2YFJ B;  3FF0 A;  3NBR A;  3EBY A;  4H3U A;  2CKF B;  2GBW B;  3GWR A;  3HK4 A;  1OCV A;  5BXQ A;  4OVM A;  3OWS A;  3OX9 A;  4X2O A;  5G2G A;  3EC9 A;  4HM0 B;  4HM4 B;  1OF5 A;  4J8T A;  5D83 A; 
#chains in the Genus database with same CATH topology
 3M8C A;  3NV0 B;  4XDW A;  5JBS A;  1LOW A;  1FGO A;  3NQY A;  1VQN 3;  1FGM A;  4K1U A;  3SYU A;  2IUK A;  6GSP A;  5BIR A;  4HM1 B;  3GZR A;  3BNB A;  4HM8 B;  3LZA A;  6RNT A;  2KRT A;  1EKM A;  4K61 A;  1FW7 A;  1DET A;  4KFF A;  1BVI A;  1IVW A;  1MWS A;  1AV4 A;  4FMB A;  4TX4 A;  1VQ6 3;  3DM8 A;  3DMC A;  2HMO B;  3PYJ A;  4DKI A;  1VQO 3;  4NRE A;  5DRE A;  2J8X B;  3F7S A;  1JB4 A;  3OXA A;  2MC8 A;  4N6V 0;  2XGL A;  1Q82 4;  2PZV A;  2WOF A;  3ER7 A;  1ISK A;  4RZM A;  1PU4 A;  2P05 A;  3VF1 A;  4BL3 A;  1YHQ 3;  1W4N A;  3X40 A;  1M1K 4;  2BO9 B;  1MNL A;  2F4Y A;  2Y74 A;  4HM2 B;  1YJ9 3;  3CNX A;  1QAF A;  3Q90 A;  3IJE B;  4EXR A;  1SPU A;  1GD4 A;  2K0M A;  4H61 A;  2W2C A;  3RNT A;  1QMA A;  1KWI A;  4ORL A;  4XB5 A;  2SBL A;  5AI1 A;  1LQG C;  4HM3 B;  3S5C A;  1K28 A;  4N6U A;  3I0Y A;  2ZHX B;  4LGQ A;  4WYK B;  5AIG A;  3FG3 A;  3K9M C;  5HOH A;  1G96 A;  1UI7 A;  2RFR A;  1EG9 B;  3B4P A;  2YFL B;  4JF8 A;  3MHE A;  1OHS A;  4MMX B;  3EN8 A;  3UB1 A;  1DVD A;  3CPW 2;  1TTO A;  1DVC A;  1OHO A;  2F5W A;  3EE1 A;  3NUV A;  4BTY A;  1KQS 2;  5AEW B;  1DE3 A;  3RGR A;  5STD A;  1QAK A;  3NV0 A;  1IU7 A;  3BLZ A;  3IPT A;  4FMA A;  1B2X A;  1G02 A;  1LVN A;  1STF I;  4O02 B;  4HAA A;  1UUG B;  3G0K A;  4O8S A;  1I2G A;  5IG3 A;  3HX8 A;  1PY3 A;  1BRG A;  3CPO A;  4L8P A;  1RLS A;  5EEO A;  3LYG A;  3IMA B;  2OTL 3;  4GB5 A;  2Y73 A;  3SOY A;  1K41 A;  3UJM A;  1NNV A;  1CEW I;  1O7M B;  1GY6 A;  4XDV A;  3OWU A;  4R80 A;  1DMM A;  2ZL8 A;  1W2Z A;  1WQL B;  1HU9 A;  2XH9 A;  2YFI B;  3AHW A;  4GL6 A;  1JB2 A;  1GY5 A;  3NHX A;  3SX1 A;  1NWW A;  1M90 4;  1BNS A;  2GEY A;  5BVB A;  3EQQ B;  4WP5 A;  1BRJ A;  2O9U X;  2BMQ B;  1IQY A;  1RSN A;  1TIJ A;  3KSE D;  1X1W A;  2Z6B A;  1TU5 A;  1YJW 3;  2OTJ 3;  2CFK A;  4EV5 A;  1BUQ A;  1JRQ A;  3F8X A;  4J5K A;  1W6C A;  3CCL 3;  2ZA4 A;  5KP4 A;  3CNM A;  5KP1 A;  1VQ5 3;  3ROB A;  1IDP A;  2F98 A;  4WHA A;  1UUW B;  1ZGX A;  2E2T A;  4HBR A;  1EQK A;  2UUG C;  3NQZ A;  1I70 A;  4NPB A;  3GZB A;  1YNV X;  2Z7A A;  2K3D A;  1AVK A;  1IT7 A;  2W04 A;  6STD A;  3MG3 A;  1EUI C;  3NXJ A;  3WDG B;  1B3S A;  2F86 B;  3SVA A;  1K8A 4;  5A0O B;  4R1K A;  1ZS7 A;  1A2P A;  3KN4 A;  1OAC A;  1SII A;  1TJD A;  3LTA A;  3PZW A;  4RNY A;  4HOH A;  3UNL A;  1B27 A;  5IG5 A;  3OV4 A;  2AAE A;  1S72 3;  2UX0 A;  3MPH A;  1D6Y A;  1BIR A;  2QIY A;  3KCH A;  4LYL B;  1KD1 4;  3MG2 A;  4IIA A;  1Q7H A;  1DMN A;  1BAN A;  2H0I A;  4GHO A;  4LMI A;  1BUJ A;  3LXU X;  4J5G A;  3CCM 3;  1OHP A;  3DXO A;  2P0X A;  3FKA A;  2W03 A;  3A5E A;  5DRV A;  1IQX A;  3PXM A;  3Q2P A;  1MGR A;  4FR9 A;  2RNT A;  3AMO B;  1ROA A;  5CLK A;  4IT7 A;  1CQS A;  4HM5 B;  3NM2 A;  2LYX A;  3F9S A;  1UCI A;  1VQQ A;  2GEX A;  1PYL A;  3EHC A;  1X1Y A;  4L8O A;  4N6T A;  1BSD A;  5M1A A;  2FNQ A;  3MG1 A;  3URP A;  4HM7 B;  4N6N B;  2BNG A;  3U97 A;  3VGN A;  2C4B A;  5AEU B;  4XBX A;  1R4C A;  2XRX B;  1I3I A;  1FZU A;  2AAD A;  3CU3 A;  4KZ1 A;  1MWU A;  2PNC A;  4Q53 A;  2IMJ A;  5AIF A;  1YVS A;  1O7G B;  5IEO A;  3CXC 2;  3CCR 3;  1FA3 A;  3WOD G;  1NU3 A;  3LT8 A;  3WA2 X;  4MJD A;  4OUQ A;  2A15 A;  1W6G A;  1U5O A;  1RGK A;  1IK3 A;  1VQL 3;  1T2I A;  4U13 A;  5TGN A;  1X1X A;  3F8H A;  4WFO A;  5HGR A;  3KKG A;  2JDI H;  4FCZ A;  2BIR A;  4AKY A;  4CCV A;  2R41 A;  1TRP A;  2CWV A;  5M18 A;  8CHO A;  3T8N A;  1I3F A;  3WR2 A;  1M9G A;  2Z76 A;  4L7K A;  3JVC A;  1FYS A;  1F8N A;  2BMR B;  2BMO B;  8RNT A;  2CWU A;  5CF1 A;  1LQM B;  1JZO A;  1CYU A;  3KZT A;  1HKX A;  4HVN A;  3F40 A;  1AR0 A;  4MEI A;  3FCS B;  3WOF B;  1UI8 A;  2XSO B;  3F7X A;  4G1M B;  1HYF A;  2CWT A;  3S29 A;  2OOV A;  1BRS A;  2BT3 A;  1W7C A;  2CFL A;  2HMJ B;  3BNE A;  1KC8 4;  2E2V A;  2HMM B;  2CFW A;  1TRQ A;  3AMO A;  3S28 A;  1YVB I;  1BSC A;  4WWU C;  2K54 A;  4IPB A;  1SIH A;  1W6Y A;  4EV2 A;  1GOV A;  5AYR B;  2GU3 A;  1B2U A;  4BL2 A;  2IUJ A;  7GSP A;  1DMQ A;  3H51 A;  1TP6 A;  4R9L A;  1RGE A;  3ZFZ A;  2FXT A;  2XSH B;  1KSI A;  3FF2 A;  3MKI A;  3N9H A;  3LTD A;  2I9W A;  1FGR A;  1SJW A;  1BSA A;  1RGH A;  1A2V A;  3SED A;  1QJG A;  1VQ9 3;  1IT8 A;  1V57 A;  3OWY A;  1GSP A;  1FUS A;  2HOH A;  2W6J H;  1N9E A;  3KFQ C;  1AQZ A;  1RJO A;  3GZY B;  1BNJ A;  1BNG A;  4HM6 B;  3SXX A;  4RNT A;  3CC7 3;  1V74 A;  2P09 A;  1GS3 A;  3DGN A;  5IW9 A;  1BRH A;  1RNB A;  4R9K A;  1E97 A;  1UGI A;  4FCM A;  3CME 3;  1VQM 3;  3HZP A;  4KFE A;  5IEN A;  5M19 A;  3ZG0 A;  4AKZ A;  1MGW A;  3HIG A;  4KVH A;  5AYS C;  3WA3 A;  1CYV A;  1O7N B;  1RDS A;  2GSP A;  3LT9 A;  1QVG 2;  1ASK A;  1IYY A;  2CX1 A;  3K7C A;  4STD A;  4AEQ A;  2XFT A;  7RNT A;  4PEJ A;  3T8U A;  4HJL B;  1B20 A;  2D1W A;  1BSB A;  3X3X A;  1JB5 A;  2W0Q A;  2Q07 A;  1W02 A;  3J7Y d;  1E3V A;  4J9A A;  2KF5 A;  1LOY A;  3EN1 B;  4I4K A;  1UCK A;  2ML6 A;  2RCD A;  1GOU A;  1Y4K A;  1IVV A;  3U1W A;  3WOE B;  5EQL A;  4HZB B;  5G1K A;  1JN5 A;  4BTW A;  2OCT A;  3V99 A;  4FMC A;  1NO3 A;  2QEX 3;  1UGH I;  4N6M A;  3B4O A;  3DY5 A;  1IV9 A;  1GYB A;  5EVH A;  1OH0 A;  1MOL A;  2F99 A;  1RGA A;  4QWT A;  4HYZ A;  3N8B A;  1EA2 A;  3FGY A;  2GBX B;  1FUW A;  3MYT A;  4EC6 A;  1FGT A;  3H3H A;  3EX9 A;  4N6L A;  1W01 A;  3D3L A;  1ULJ B;  1JJ2 2;  1BU4 A;  3FH1 A;  1US1 A;  1GMP A;  5G1L A;  3GSP A;  1NDO B;  1RNT A;  3EBT A;  4HZ9 B;  2CH9 A;  5AII A;  2RGQ A;  2LQV A;  3AHS A;  4N6O B;  2Z77 A;  3JUP A;  1GD3 A;  1B2S A;  3LTB A;  2MF7 A;  2W9Q A;  4XM4 A;  1IVU A;  2P38 A;  3BU4 A;  3GAX A;  3K63 A;  1C54 A;  1JV2 B;  2ML5 A;  2KF3 A;  4RBN A;  2CFD A;  1T3B A;  3HI7 A;  1BRI A;  1T2H A;  1Z1S A;  3DGM A;  4BU4 A;  3CC4 3;  2W56 A;  1FGQ A;  2ZDJ A;  4LSO A;  4RNZ A;  4NHF A;  2XGN A;  2FGT A;  1SAR A;  3EF8 A;  1I0V A;  1BNR A;  3JUO A;  3PCS A;  1BOX A;  1VQ4 3;  1OGZ A;  1RHL A;  1Q81 4;  2IA7 A;  1LXE A;  3I55 3;  3FSD A;  3QRD A;  3D9R A;  3NX0 A;  3ZG5 A;  5IG4 A;  3FG1 A;  1N5H A;  3B8L A;  2YX9 A;  1VQK 3;  3RDE A;  4HKV B;  1JZD A;  2GXF A;  3D5I A;  3S27 A;  3G16 A;  1D6Z A;  1BGS A;  1JKG A;  1JNQ A;  3DGO A;  3HII A;  2KXG A;  4N3V A;  1RRL A;  5KP3 A;  5IF6 A;  1RKY A;  1JBS A;  3GZX B;  1HZ1 A;  3WHO A;  1D6U A;  2RBI A;  5FW5 A;  1QAL A;  3SOA A;  2JQ5 A;  1BNE A;  1JBR A;  1AVL A;  1VQP 3;  2SAR A;  1I8V A;  3NBB A;  4KT3 B;  2KF6 A;  1T5Y A;  3BIR A;  1YGW A;  3G4S 3;  2QA4 3;  4CJN A;  1X1U A;  1J2B A;  2F5M A;  3LTC A;  3EJV A;  3PS8 A;  3NM7 A;  1STD A;  1TUH A;  1PFP A;  3NBJ A;  1N8Q A;  3VSY A;  2H0H A;  3LML A;  4MMZ B;  4CDL A;  1Q40 A;  2KAA A;  1N5P A;  1W5Z A;  2F56 A;  1WTH A;  2O3O A;  3K0Z A;  3T0U A;  5IEP A;  1JN5 B;  3CCE 3;  3D4A A;  1A90 A;  4OK0 A;  1R4Y A;  3DGL A;  1FUT A;  1RN7 A;  1BRK A;  2C11 A;  2P0M A;  3JUN A;  3TDG A;  3DGY A;  3F14 A;  3CD6 3;  1A67 A;  3STD A;  1LNH A;  2WGO A;  3L0R A;  5AIH A;  3JUM A;  3I56 3;  1TFK A;  3D5G A;  1NB3 I;  1UDI I;  1VZZ A;  3WMD A;  1RRH A;  2XEP A;  4EW5 A;  3Q1C A;  4KFD A;  4XBT A;  2V1L A;  1VQ7 3;  2W9P A;  3X3Z A;  4XBY A;  3B7C A;  1OPY A;  1RCK A;  3UL5 A;  1RMS A;  1YGE A;  5I97 A;  3DUK A;  2IY2 A;  1I2F A;  4LEH A;  3LOY A;  3MSO A;  4ZM8 A;  1LNI A;  1WMO A;  3FZW A;  1GY7 A;  5ELU A;  2HMN B;  3X42 A;  2CW9 A;  4GSP A;  1YIJ 3;  1Q42 A;  3KSP A;  3X3Y A;  1RN4 A;  3G6E 3;  2B24 B;  3ECF A;  5RNT A;  1Q9E A;  1DYU A;  1MWT A;  3E99 A;  1O7W B;  4EBG A;  4K1V A;  1GMR A;  2C10 A;  2KCD A;  4EYC A;  1OGX A;  5D81 A;  2W56 B;  2CHC A;  3GRD A;  3CCU 3;  5JPP A;  1G0T A;  1B2Z A;  3KE7 A;  2CIU A;  4FCJ A;  3X41 A;  1TFO A;  2HML B;  2OQE C;  4BTX A;  1LOV A;  1RCL A;  2R4I A;  1RN1 A;  3D79 A;  1WMN A;  3K5T A;  4LZI A;  1K9M 4;  1I2E A;  1ROV A;  2BU4 A;  1S5A A;  3EB8 A;  1MWR A;  1C7H A;  4X2H A;  3V92 A;  3G71 3;  1A2K A;  1JKG B;  1VQ8 3;  1M1X B;  1ZO2 A;  2H0G A;  1ZX2 A;  3A76 A;  2XR8 B;  1WNH A;  3FLJ A;  1GOY A;  1BNI A;  2RSX A;  1OF5 B;  3PGB A;  5CXO A;  3V98 A;  4CPK A;  4R4K A;  1AY7 A;  1UCL A;  2XF3 A;  1UW1 A;  2XFS A;  5IG0 A;  5LC7 A;  4O3V A;  1U8C B;  4MMY B;  5GSP A;  3OW2 2;  1IVX A;  3CCJ 3;  1RTU A;  2IYJ A;  1UUV B;  3FG4 A;  1YIT 3;  2KF4 A;  1RGG A;  4ILF A;  1O7H B;  5JPU A;  3Q3F A;  1UCJ A;  3BB9 A;  5CF2 A;  2HMK B;  3CCV 3;  1L5G B;  1K73 4;  1BSE A;  1W00 A;  2B1X B;  3DZL A;  1IV7 A;  1O7P B;  1E3R A;  3CCQ 3;  1CH0 A;  1QVF 2;  1LRA A;  4BIR A;  1ULI B;  1Q40 B;  3PCR A;  3RGA A;  7STD A;  1I0X A;  2CK3 H;  2STD A;  3KII A;  5IER A;  3ALA A;  1BAO A;  1GMQ A;  2INX A;  4JRF A;  1Q86 4;  2D42 A;  3CCS 3;  1RGL A;  3JUQ A;  2OWP A;  9RNT A;  4WYK A;  1N9J A;  3N54 B;  5CK6 A;  3G8Z A;  1OUN A;  2QGU A;  1WMP A;  3DH2 A;  5D82 A;  2M7O A;  1B21 A;  2YFJ B;  1Q7Y 4;  3FF0 A;  1IQ8 A;  1SQW A;  3HOH A;  3NBR A;  3BND A;  3LH4 A;  5BU4 A;  1B2M A;  3EBY A;  4H3U A;  2CKF B;  2GBW B;  2OOV C;  2CX0 A;  4O2H A;  1RGF A;  5FGO A;  3GWR A;  1YJN 3;  3HK4 A;  1OCV A;  1W2B 2;  2BHM A;  3O8Y A;  2CG1 A;  5ELJ A;  3QK9 A;  2GU1 A;  5BXQ A;  4OVM A;  3CMA 3;  3CC2 3;  1YI2 3;  1NJI 4;  3MWZ A;  3OWS A;  3OX9 A;  4X2O A;  1N8R 4;  5G2G A;  2OQE A;  2L4V A;  3SLU A;  1NB5 I;  3EC9 A;  2UGI A;  2WO0 A;  3S67 A;  2WOH A;  2E2U A;  2CG0 A;  1JBT A;  3AGN A;  1EEJ A;  1RGC A;  4HM0 B;  1OF5 A;  4HM4 B;  1BRN L;  1V58 A;  3AGO A;  2L1S A;  2CFG A;  5LC6 A;  2CC3 A;  4J8T A;  4I5Q A;  2WGQ A;  1BNF A;  5D83 A;  4K90 B;  4FMD A;  3UL6 A;  1LOX A;  3BNC A; 
#chains in the Genus database with same CATH homology
 3M8C A;  3NV0 B;  4XDW A;  5JBS A;  1FGO A;  3NQY A;  1VQN 3;  1FGM A;  4K1U A;  2IUK A;  4HM1 B;  3GZR A;  3BNB A;  4HM8 B;  3LZA A;  2KRT A;  1EKM A;  4K61 A;  4KFF A;  1IVW A;  1AV4 A;  4FMB A;  4TX4 A;  1VQ6 3;  3DM8 A;  3DMC A;  2HMO B;  3PYJ A;  1VQO 3;  4NRE A;  5DRE A;  3F7S A;  1JB4 A;  3OXA A;  2MC8 A;  4N6V 0;  2XGL A;  1Q82 4;  2PZV A;  2WOF A;  3ER7 A;  1ISK A;  4RZM A;  1PU4 A;  2P05 A;  3VF1 A;  1YHQ 3;  1W4N A;  3X40 A;  1M1K 4;  2BO9 B;  1MNL A;  2Y74 A;  4HM2 B;  1YJ9 3;  3CNX A;  1QAF A;  3Q90 A;  3IJE B;  4EXR A;  1SPU A;  1GD4 A;  2K0M A;  4H61 A;  2W2C A;  1QMA A;  1KWI A;  4ORL A;  4XB5 A;  2SBL A;  5AI1 A;  4HM3 B;  3S5C A;  1K28 A;  4N6U A;  3I0Y A;  4LGQ A;  4WYK B;  3FG3 A;  3K9M C;  1G96 A;  1UI7 A;  2RFR A;  1EG9 B;  3B4P A;  2YFL B;  4JF8 A;  3MHE A;  1OHS A;  4MMX B;  3EN8 A;  3UB1 A;  1DVD A;  3CPW 2;  1DVC A;  1OHO A;  3EE1 A;  3NUV A;  4BTY A;  1KQS 2;  5AEW B;  3RGR A;  5STD A;  1QAK A;  3NV0 A;  1IU7 A;  3BLZ A;  3IPT A;  4FMA A;  1LVN A;  1STF I;  4O02 B;  4O8S A;  3G0K A;  5IG3 A;  3HX8 A;  3CPO A;  4L8P A;  5EEO A;  3LYG A;  3IMA B;  2OTL 3;  4GB5 A;  2Y73 A;  3SOY A;  1K41 A;  3UJM A;  1CEW I;  1O7M B;  1GY6 A;  4XDV A;  3OWU A;  4R80 A;  1DMM A;  2ZL8 A;  1W2Z A;  1WQL B;  1HU9 A;  2XH9 A;  2YFI B;  4GL6 A;  1JB2 A;  1GY5 A;  3NHX A;  3SX1 A;  1NWW A;  1M90 4;  5BVB A;  2GEY A;  3EQQ B;  4WP5 A;  2O9U X;  2BMQ B;  1IQY A;  1TU5 A;  1TIJ A;  3KSE D;  2Z6B A;  1YJW 3;  2OTJ 3;  2CFK A;  4EV5 A;  1BUQ A;  1JRQ A;  3F8X A;  1W6C A;  3CCL 3;  5KP4 A;  3CNM A;  5KP1 A;  1VQ5 3;  3ROB A;  1IDP A;  2F98 A;  4WHA A;  1UUW B;  2E2T A;  4HBR A;  1EQK A;  3NQZ A;  3GZB A;  2Z7A A;  1AVK A;  1IT7 A;  2W04 A;  6STD A;  3MG3 A;  3NXJ A;  3WDG B;  2F86 B;  3SVA A;  1K8A 4;  5A0O B;  4R1K A;  3KN4 A;  1OAC A;  1SII A;  3LTA A;  4RNY A;  3PZW A;  3UNL A;  1S72 3;  5IG5 A;  3OV4 A;  2UX0 A;  3MPH A;  1D6Y A;  2QIY A;  1KD1 4;  3MG2 A;  4IIA A;  1DMN A;  4LMI A;  3LXU X;  3CCM 3;  1OHP A;  3DXO A;  2P0X A;  3FKA A;  2W03 A;  5DRV A;  1IQX A;  3PXM A;  3Q2P A;  4FR9 A;  3AMO B;  1ROA A;  5CLK A;  4IT7 A;  1CQS A;  4HM5 B;  3NM2 A;  2LYX A;  3F9S A;  2GEX A;  3EHC A;  4L8O A;  4N6T A;  2FNQ A;  3MG1 A;  4HM7 B;  4N6N B;  2BNG A;  3U97 A;  3VGN A;  5AEU B;  4XBX A;  1R4C A;  2XRX B;  3CU3 A;  4KZ1 A;  2PNC A;  4Q53 A;  2IMJ A;  5AIF A;  1O7G B;  5IEO A;  3CXC 2;  3CCR 3;  1FA3 A;  3WOD G;  1NU3 A;  3LT8 A;  3WA2 X;  4MJD A;  4OUQ A;  2A15 A;  1W6G A;  1U5O A;  1IK3 A;  1VQL 3;  4U13 A;  5TGN A;  3F8H A;  4WFO A;  5HGR A;  3KKG A;  2JDI H;  4FCZ A;  4AKY A;  4CCV A;  2CWV A;  8CHO A;  3T8N A;  1M9G A;  2Z76 A;  4L7K A;  3JVC A;  1F8N A;  2BMR B;  2BMO B;  2CWU A;  5CF1 A;  1CYU A;  3KZT A;  1HKX A;  4HVN A;  3F40 A;  1AR0 A;  4MEI A;  3FCS B;  3WOF B;  1UI8 A;  2XSO B;  3F7X A;  4G1M B;  3S29 A;  2CWT A;  1KC8 4;  2OOV A;  2BT3 A;  1W7C A;  2CFL A;  2HMJ B;  3BNE A;  2E2V A;  2HMM B;  2CFW A;  3AMO A;  3S28 A;  1YVB I;  4WWU C;  2K54 A;  4IPB A;  1SIH A;  1W6Y A;  4EV2 A;  5AYR B;  2GU3 A;  2IUJ A;  1DMQ A;  3H51 A;  1TP6 A;  4R9L A;  2FXT A;  2XSH B;  1KSI A;  3FF2 A;  3MKI A;  3N9H A;  3LTD A;  2I9W A;  1FGR A;  1SJW A;  3SED A;  1A2V A;  1VQ9 3;  1QJG A;  1IT8 A;  3OWY A;  3KFQ C;  2W6J H;  5AIG A;  1N9E A;  1RJO A;  3GZY B;  4HM6 B;  3SXX A;  3CC7 3;  1V74 A;  2P09 A;  1GS3 A;  3DGN A;  5IW9 A;  4R9K A;  1E97 A;  4FCM A;  3CME 3;  1VQM 3;  3HZP A;  4KFE A;  5IEN A;  4AKZ A;  3HIG A;  4KVH A;  5AYS C;  3WA3 A;  1CYV A;  1O7N B;  1QVG 2;  3LT9 A;  1ASK A;  4STD A;  3K7C A;  4AEQ A;  2XFT A;  4PEJ A;  3T8U A;  4HJL B;  3X3X A;  2D1W A;  1JB5 A;  2W0Q A;  2Q07 A;  1W02 A;  3J7Y d;  1E3V A;  4J9A A;  3EN1 B;  4I4K A;  2ML6 A;  2RCD A;  1Y4K A;  1IVV A;  3U1W A;  3WOE B;  5EQL A;  4HZB B;  1JN5 A;  4BTW A;  2OCT A;  3V99 A;  4FMC A;  1NO3 A;  2QEX 3;  4N6M A;  3B4O A;  3DY5 A;  1IV9 A;  1GYB A;  5EVH A;  1OH0 A;  1MOL A;  2F99 A;  4QWT A;  4HYZ A;  3N8B A;  1EA2 A;  3FGY A;  2GBX B;  1FUW A;  3MYT A;  4EC6 A;  1FGT A;  3H3H A;  3EX9 A;  4N6L A;  1W01 A;  3D3L A;  1ULJ B;  1JJ2 2;  3FH1 A;  1US1 A;  1NDO B;  3EBT A;  4HZ9 B;  2CH9 A;  5AII A;  2RGQ A;  2LQV A;  4N6O B;  2Z77 A;  3JUP A;  1GD3 A;  3LTB A;  2MF7 A;  2W9Q A;  4XM4 A;  1IVU A;  2P38 A;  3GAX A;  3K63 A;  1JV2 B;  2ML5 A;  4RBN A;  2CFD A;  3HI7 A;  3DGM A;  3CC4 3;  1Z1S A;  2W56 A;  1FGQ A;  2ZDJ A;  4LSO A;  4RNZ A;  4NHF A;  2XGN A;  2FGT A;  3EF8 A;  3JUO A;  3PCS A;  1VQ4 3;  1OGZ A;  1Q81 4;  2IA7 A;  1LXE A;  3I55 3;  3FSD A;  3QRD A;  3D9R A;  3NX0 A;  5IG4 A;  3FG1 A;  1N5H A;  3B8L A;  2YX9 A;  1VQK 3;  3RDE A;  4HKV B;  2GXF A;  3S27 A;  3G16 A;  1D6Z A;  1JKG A;  1JNQ A;  3DGO A;  3HII A;  2KXG A;  4N3V A;  1RRL A;  5KP3 A;  5IF6 A;  1RKY A;  3GZX B;  1D6U A;  5FW5 A;  1QAL A;  3SOA A;  2JQ5 A;  1AVL A;  1VQP 3;  3NBB A;  1T5Y A;  3G4S 3;  2QA4 3;  1J2B A;  3LTC A;  3EJV A;  3PS8 A;  3NM7 A;  1STD A;  1TUH A;  1PFP A;  3NBJ A;  1N8Q A;  3VSY A;  3LML A;  4MMZ B;  4CDL A;  1Q40 A;  1N5P A;  1W5Z A;  5IEP A;  1WTH A;  2O3O A;  3K0Z A;  3T0U A;  1JN5 B;  3CCE 3;  1A90 A;  4OK0 A;  3DGL A;  1RN7 A;  2C11 A;  2P0M A;  3JUN A;  3TDG A;  3CD6 3;  1A67 A;  3F14 A;  3STD A;  1LNH A;  2WGO A;  3L0R A;  5AIH A;  3JUM A;  3I56 3;  1TFK A;  1NB3 I;  1VZZ A;  3WMD A;  1RRH A;  2XEP A;  3Q1C A;  4KFD A;  4XBT A;  2V1L A;  1VQ7 3;  2W9P A;  3X3Z A;  4XBY A;  3B7C A;  1OPY A;  3UL5 A;  1YGE A;  5I97 A;  3DUK A;  4LEH A;  3LOY A;  3MSO A;  4ZM8 A;  1WMO A;  3FZW A;  1GY7 A;  5ELU A;  2HMN B;  3X42 A;  2CW9 A;  1YIJ 3;  1Q42 A;  3KSP A;  3X3Y A;  3G6E 3;  2B24 B;  3ECF A;  1DYU A;  3E99 A;  1O7W B;  4EBG A;  4K1V A;  2C10 A;  2KCD A;  4EYC A;  1OGX A;  5D81 A;  2W56 B;  2CHC A;  3GRD A;  3CCU 3;  5JPP A;  3KE7 A;  2CIU A;  4FCJ A;  3X41 A;  1TFO A;  2HML B;  2OQE C;  4BTX A;  2R4I A;  1WMN A;  3K5T A;  4LZI A;  1K9M 4;  1ROV A;  1S5A A;  3EB8 A;  3V92 A;  1C7H A;  4X2H A;  3G71 3;  1VQ8 3;  1A2K A;  1JKG B;  1M1X B;  1ZO2 A;  1ZX2 A;  3A76 A;  2XR8 B;  1WNH A;  3FLJ A;  2RSX A;  1OF5 B;  3PGB A;  5CXO A;  3V98 A;  4R4K A;  2XF3 A;  1UW1 A;  2XFS A;  5IG0 A;  5LC7 A;  4O3V A;  1U8C B;  4MMY B;  3OW2 2;  1IVX A;  3CCJ 3;  1UUV B;  3FG4 A;  1YIT 3;  1O7H B;  5JPU A;  3BB9 A;  5CF2 A;  2HMK B;  3CCV 3;  1L5G B;  1K73 4;  1W00 A;  2B1X B;  3DZL A;  1IV7 A;  1O7P B;  1E3R A;  3CCQ 3;  1QVF 2;  1ULI B;  1Q40 B;  3PCR A;  3RGA A;  7STD A;  2CK3 H;  2STD A;  3KII A;  5IER A;  3ALA A;  2INX A;  4JRF A;  1Q86 4;  2D42 A;  3CCS 3;  3JUQ A;  2OWP A;  4WYK A;  1N9J A;  3N54 B;  5CK6 A;  3G8Z A;  1OUN A;  2QGU A;  1WMP A;  5D82 A;  2M7O A;  2YFJ B;  1Q7Y 4;  3FF0 A;  1IQ8 A;  1SQW A;  3NBR A;  3BND A;  3LH4 A;  3EBY A;  4H3U A;  2CKF B;  2GBW B;  2OOV C;  4O2H A;  5FGO A;  3GWR A;  1YJN 3;  3HK4 A;  1OCV A;  1W2B 2;  2BHM A;  3O8Y A;  2CG1 A;  5ELJ A;  3QK9 A;  2GU1 A;  5BXQ A;  4OVM A;  3CMA 3;  3CC2 3;  1YI2 3;  1NJI 4;  3MWZ A;  3OWS A;  3OX9 A;  4X2O A;  1N8R 4;  5G2G A;  2OQE A;  2L4V A;  3SLU A;  1NB5 I;  3EC9 A;  2WO0 A;  3S67 A;  2WOH A;  2E2U A;  2CG0 A;  4HM0 B;  4HM4 B;  1OF5 A;  2CFG A;  5LC6 A;  2CC3 A;  4J8T A;  2WGQ A;  5D83 A;  4K90 B;  4FMD A;  3UL6 A;  1LOX A;  3BNC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...