2A15A

X-ray crystal structure of rv0760 from mycobacterium tuberculosis at 1.68 angstrom resolution
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
133
structure length
133
Chain Sequence
TQSPALIASQSSWRCVQAHDREGWLALMADDVVIEDPIGKSVTNPDGSGIKGKEAVGAFFDTHIAANRLTVTCEETFPSSSPDEIAHILVLHSEFDGGFTSEVRGVFTYRVNKAGLITNMRGYWNLDMMTFGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Mycobacterium tuberculosis Rv0760c at 1.50 A resolution, a structural homolog of Delta(5)-3-ketosteroid isomerase
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Unknown function
molecule keywords HYPOTHETICAL PROTEIN Rv0760c
total genus 41
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2005-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2a15A00
1E97A 1QJGA 2JQ5A 3DZLA 3GZXB 4XDVA 2HMKB 1DMQA 2GBWB 3VSYA 5JPUA 3F7SA 2QGUA 3FF0A 3FH1A 3E99A 1JB2A 1OCVA 3HX8A 3T8UA 1EA2A 1ZO2A 3JUNA 4K1UA 5IG4A 3MSOA 8CHOA 3LYGA 2XSOB 4FCMA 1Q42A 3KSPA 2BMRB 2STDA 2W2CA 4HJLB 3HZPA 4KVHA 3F40A 5AIGA 5AIFA 4HZBB 5IENA 3I0YA 3F9SA 1HKXA 1QMAA 1CQSA 4H3UA 2RFRA 3DM8A 3KZTA 3NHXA 2Z7AA 4HM4B 5KP1A 1SJWA 3FKAA 4PEJA 5JPPA 3FLJA 1IDPA 2K54A 4ORLA 5AEWB 1NWWA 1DMNA 1Q40B 5IG5A 4HM3B 4X2HA 4HM5B 1W6YA 3GZRA 1GY7A 5D82A 3MG1A 5IG3A 3B4PA 4HM0B 1NDOB 3JUQA 2BMQB 6STDA 1OH0A 1U5OA 3KE7A 3EN1B 3GWRA 1W00A 1Z1SA 1TP6A 1O7WB 3CNMA 2IMJA 3G0KA 2I9WA 5AEUB 3EQQB 4HM7B 5STDA 1A2KA 3H51A 1ASKA 1OHSA 1DMMA 3ECFA 4RZMA 3S5CA 1JKGB 1JN5B 3B7CA 2CKFB 3EJVA 3EC9A 4HM1B 4XBXA 4XB5A 7STDA 2F99A 3EF8A 4WWUC 1TUHA 4LMIA 5CK6A 3DUKA 4LGQA 1ULIB 3ER7A 5D83A 2R4IA 5IEOA 3STDA 3T8NA 4WP5A 3MG3A 3BLZA 4HKVB 1O7HB 2CHCA 2PZVA 3D9RA 4R9LA 4X2OA 1GY5A 3F8HA 3MHEA 3NM2A 3OWYA 3DXOA 1O7MB 1JB4A 2YFJB 3H3HA 2HMNB 2B1XB 3NUVA 1OGXA 2B24B 3NV0A 4CDLA 3NBRA 5EVHA 1C7HA 5HGRA 2Z76A 2F86B 5G2GA 3A76A 2GXFA 3EHCA 5BXQA 5TGNA 5IEPA 4L8OA 3EBTA 5FW5A 2BNGA 3SOYA 1O7PB 1OHPA 1VZZA 3F7XA 2RCDA 3JUMA 3KKGA 3MG2A 4L7KA 4XBTA 3JUOA 3GRDA 5IERA 1OPYA 3B4OA 3HK4A 5AIIA 1OF5A 3DMCA 1E3VA 3LZAA 4WYKA 5DRVA 3UNLA 4WYKB 1OF5B 3CNXA 2GEXA 3EX9A 4HM6B 2HMJB 2HMOB 2UX0A 3ROBA 4I4KA 3OWSA 1OGZA 1O7NB 3WMDA 1W02A 1K41A 1GS3A 5CF1A 1WQLB 1AR0A 2HMMB 3F8XA 3EN8A 3GZBA 3IPTA 3K0ZA 1W01A 2HMLB 1NU3A 4STDA 4XDWA 3OXAA 3G16A 1Q40A 2OWPA 3MKIA 1UUVB 3K7CA 3NV0B 1GYBA 5DREA 4K1VA 3OV4A 3UJMA 2XSHB 3JUPA 1S5AA 2RGQA 4XBYA 4J8TA 5AI1A 1JN5A 1JKGA 4J9AA 3SEDA 1JB5A 4GB5A 2INXA 2XR8B 5CXOA 5CLKA 2BMOB 4R9KA 3Q90A 1E3RA 3FF2A 2XRXB 3FZWA 3FSDA 3OWUA 4MJDA 2Z77A 4FCJA 5KP3A 3CU3A 4U13A 1EG9B 3F14A 3SOAA 3BB9A 4XM4A 4HVNA 5IG0A 2F98A 1STDA 3MYTA 2YFIB 4N3VA 2GBXB 3G8ZA 4HZ9B 3M8CA 3FGYA 3NXJA 3RGAA 4Q53A 4IIAA 4R1KA 5D81A 5BVBA 1GY6A 1O7GB 1ULJB 4LEHA 3OX9A 3RGRA 1ZX2A 1UUWB 1OUNA 4HM8B 3VGNA 1OHOA 2QIYA 1ISKA 4HM2B 5IF6A 2YFLB 3B8LA 4OUQA 5CF2A 3CPOA 5AIHA 2GEYA 4L8PA 5KP4A 1BUQA 3EBYA 2A15A 4OVMA 3GZYB
chains in the Genus database with same CATH superfamily
4K90B 2JQ5A 1FA3A 7GSPA 1AQZA 3DZLA 1DYUA 3GZXB 5ELJA 2HMKB 5JPUA 2H0HA 2IA7A 1RTUA 2QGUA 3E99A 3CCS3 3HX8A 2KXGA 3T8UA 2E2UA 1ZO2A 4K1UA 3MPHA 1Q7Y4 4N6UA 1T2IA 1UGHI 1Q42A 4EV2A 3HZPA 5AIGA 4H3UA 3F9SA 1MGWA 1W7CA 1CQSA 2CG0A 1CYVA 2CWUA 1BRIA 2RFRA 2RNTA 1FUSA 3NQZA 1SJWA 1TFOA 2Q07A 4X2HA 1W6YA 2CFDA 3GZRA 3MG1A 3JUQA 6STDA 3KE7A 1T5YA 2LYXA 1SQWA 1YNVX 2BO9B 2KF3A 1A2KA 3ECFA 1GD4A 4NHFA 2KF6A 3EJVA 3EC9A 3N9HA 4EYCA 3KN4A 1PY3A 7STDA 3ZG0A 1TUHA 2O9UX 1BVIA 1UCJA 3MG3A 3BLZA 1GOVA 1RN4A 3ZFZA 2OCTA 2XEPA 9RNTA 1K28A 1MWTA 3KCHA 3CCJ3 3K63A 2B1XB 3NUVA 2B24B 2K0MA 3NV0A 3PGBA 5HGRA 1BUJA 4EW5A 1B21A 1W4NA 2F86B 1GMQA 3BNCA 4N6V0 4QWTA 7RNTA 2GXFA 5TGNA 1M1K4 3CXC2 1BNGA 3ALAA 3F7XA 3V98A 3I563 1WTHA 4XBTA 1BU4A 1W5ZA 3Q1CA 1V58A 1EKMA 3PZWA 3HK4A 5IERA 2OTL3 1IVUA 1AVKA 1NB5I 3FG1A 2XFTA 5M19A 4IT7A 3EX9A 2HMJB 2UX0A 1B27A 1BSEA 1RGCA 1O7NB 3CD63 2BIRA 3BNDA 4BTWA 3EN8A 2W9QA 1UUGB 3OXAA 3CC43 3HIIA 3NV0B 1IQYA 5AYSC 4LYLB 3S29A 3KSED 4GL6A 1IVWA 4NPBA 4O3VA 2XSHB 3JUPA 2RGQA 4KT3B 1KQS2 1KSIA 4J8TA 5AI1A 1TU5A 1CEWI 4J9AA 3SEDA 1YGEA 1JB5A 4MMZB 1SIIA 2XR8B 5CXOA 1MWSA 4R9KA 5CLKA 5KP3A 3OWUA 1IVVA 2Z77A 1N9EA 2BU4A 2CH9A 4O8SA 1QALA 1RGEA 1BOXA 1S723 1KD14 1WMNA 1W6CA 2F98A 2H0IA 1STDA 1YHQ3 1IYYA 1UCKA 1CYUA 1GMRA 3FGYA 3RGAA 1IU7A 4Q53A 4IIAA 2P09A 2UGIA 1O7GB 1ULJB 3X3XA 4LEHA 3OX9A 3RGRA 4BIRA 1ISKA 4EXRA 3AMOB 3GSPA 5AIHA 1X1YA 4L8PA 1VQP3 1FUWA 3D3LA 3RNTA 2IY2A 1QAFA 5G1LA 3CME3 4CPKA 2LQVA 3AGNA 5FGOA 5I97A 1DMQA 2GBWB 1IVXA 3FF0A 4HAAA 1D6ZA 1V74A 5IG4A 2PNCA 3LYGA 2XSOB 4IPBA 1B2SA 2BMRB 4HJLB 2Y73A 3FG4A 1QMAA 6GSPA 1R4YA 1ROVA 3GAXA 2W56B 3UL6A 5JPPA 4RNYA 1QVF2 3WA3A 1NWWA 1DMNA 1KWIA 1UDII 1JRQA 3X40A 4HM3B 2W6JH 3WR2A 4HM0B 3U97A 2BMQB 3DGMA 3EN1B 3PYJA 1W00A 2Y74A 2IMJA 2V1LA 3AHWA 2I9WA 5BIRA 1FGQA 3EQQB 1LOXA 1ZS7A 3CC23 1TRQA 1GSPA 1RNBA 3H51A 1LVNA 1V57A 3KIIA 4RZMA 3IMAB 3S5CA 1JN5B 4XBXA 2WOFA 1VQO3 3G4S3 3OW22 4HBRA 3EF8A 1MOLA 4LMIA 1BRSA 4WWUC 4LGQA 2C4BA 1B2MA 3D79A 5IEOA 4HKVB 1BNJA 3MWZA 2CW9A 2CHCA 4AKYA 1GY5A 1RSNA 2D42A 3F8HA 1SIHA 3NM2A 4LSOA 1Q824 1I3IA 1O7MB 1JB4A 3N8BA 4FMAA 5LC7A 5M1AA 3HI7A 4WHAA 1BRJA 1RKYA 2E2TA 4K61A 1W6GA 3CCM3 5EVHA 5ELUA 1RJOA 2ZHXB 4RNZA 2OQEA 4L8OA 2ML5A 2W03A 1TRPA 1BNRA 3KKGA 3N54B 2RCDA 1G0TA 1AY7A 1FGTA 5M18A 1ROAA 3D5GA 3JUOA 4FCZA 4J5GA 1OPYA 1VQ93 5AIIA 3SX1A 2KF4A 1E3VA 5IW9A 1UW1A 1VQ83 1LQMB 1OF5B 4HM6B 1I2GA 2R41A 1K41A 1RGGA 5CF1A 3UB1A 1WQLB 3F8XA 4MMXB 1W01A 2CX0A 2OWPA 3MKIA 2CX1A 1RGFA 1RN1A 2WGOA 3SVAA 3CCR3 3OV4A 8RNTA 1G02A 1JZOA 3WDGB 1S5AA 4N6NB 3T0UA 5RNTA 1YVBI 3CCV3 3LXUX 1K9M4 1JKGA 4EC6A 3ZG5A 4JF8A 1RRLA 1M1XB 2BMOB 1N8R4 3Q90A 1VQ63 1BNEA 2XRXB 3K5TA 3FSDA 4TX4A 5CF2A 3CC73 1EG9B 3F14A 3WOEB 4HVNA 6RNTA 3RDEA 1HYFA 3MYTA 3LTAA 1N9JA 4GSPA 4FMCA 2GBXB 3M8CA 4HOHA 1BRHA 1VQ43 2BT3A 1CH0A 1BRKA 1N8QA 1C54A 1OUNA 4JRFA 2C10A 1A67A 1NB3I 1RGLA 1YIJ3 1RHLA 2GEYA 1X1UA 2A15A 5EEOA 1LNHA 2WGQA 1QJGA 1BSAA 3GZYB 2MF7A 1EUIC 1TJDA 3CCQ3 1W2B2 2Z6BA 1MWRA 1LOVA 3F7SA 4KFEA 3FH1A 1JB2A 1IV9A 1OCVA 4H61A 5BU4A 4CJNA 1EA2A 3VF1A 1J2BA 8CHOA 1L5GB 4LZIA 2STDA 2W0QA 4KVHA 2RSXA 5AIFA 5IENA 4HZBB 1I70A 2OOVA 1HKXA 1RCLA 4ILFA 3NHXA 2FGTA 5KP1A 3DGNA 1MWUA 1F8NA 1NO3A 2KRTA 2K54A 4ORLA 5IG5A 3I553 1Q40B 2ZA4A 1PU4A 1RRHA 1GY7A 2CWTA 5IG3A 1IQ8A 1LOWA 2ML6A 1BNIA 1NDOB 1OH0A 1I2FA 3SLUA 1BNSA 1Z1SA 2F5WA 2IUKA 1O7WB 1YIT3 1U8CB 1R4CA 3BU4A 1YJ93 1WNHA 5STDA 3LTDA 2WO0A 1OHSA 2J8XB 2CKFB 4XB5A 2L1SA 3V92A 1T2HA 3FG3A 3PS8A 4GHOA 1I2EA 4EBGA 3PXMA 4N6LA 3X3YA 1MNLA 3DUKA 3STDA 1RGKA 1T3BA 3NM7A 2PZVA 3D5IA 3D9RA 4MMYB 4X2OA 4AEQA 3O8YA 3OWYA 1VQQA 4O2HA 4HYZA 4O02B 3U1WA 2YFJB 1M904 1OACA 1KC84 1OGXA 3NBRA 3CCE3 3NBBA 1DVCA 1DVDA 4N6MA 2GU1A 5G2GA 3FCSB 2CFWA 2C11A 1BIRA 3BNEA 4R80A 1DETA 2W9PA 3EE1A 5IEPA 2O3OA 4FMBA 3DGYA 1RCKA 1SARA 1OHPA 3JUMA 1EQKA 2XFSA 3LOYA 2GU3A 3KFQC 1RDSA 3BNBA 1STFI 3G713 5GSPA 3UNLA 1OF5A 3DMCA 3LZAA 4FMDA 4WYKA 1BSCA 5DRVA 2XGNA 3SYUA 4WYKB 3CNXA 1VQN3 3LT9A 2GEXA 3ROBA 2HMOB 4BTYA 4I4KA 3OWSA 1BAOA 1OGZA 2SBLA 1DE3A 3S27A 3IPTA 1AR0A 1I8VA 1BSBA 2HMMB 3HOHA 3K0ZA 4XDWA 1WMPA 2HMLB 1NU3A 2XGLA 3AGOA 4STDA 2W04A 2P0MA 3G16A 1N5PA 1UUVB 1LOYA 3LTCA 1VQM3 1GYBA 1UCIA 5DREA 1RLSA 3QK9A 4K1VA 2W56A 1GMPA 4I5QA 2SARA 4NREA 3UJMA 1US1A 4OK0A 1QAKA 2XH9A 3PCRA 4N6OB 4XBYA 1B2ZA 1B3SA 1BRGA 3DH2A 1HZ1A 5AYRB 4GB5A 2RBIA 4FR9A 3URPA 2L4VA 1B2XA 5G1KA 1IT7A 3FF2A 3FZWA 4MJDA 4FCJA 3WOFB 4U13A 1Q7HA 2JDIH 3AHSA 3BB9A 4XM4A 2QEX3 3G6E3 3CCL3 4WFOA 2CG1A 3S28A 1Q9EA 3G8ZA 1TFKA 4J5KA 2CWVA 3X3ZA 4KFFA 2P0XA 5BVBA 1FGMA 1GY6A 5IF6A 2P05A 1BRNL 1LXEA 1UUWB 4HM8B 2QIYA 2D1WA 2P38A 4HM2B 1NJI4 2OOVC 2YFLB 3NQYA 4OUQA 2F56A 1Q814 3LH4A 4CCVA 1BSDA 1BUQA 1GD3A 1JV2B 5D82A 1E97A 1UI8A 3X41A 1Q864 3SXXA 1B2UA 1QVG2 1WMOA 5LC6A 1GOUA 3Q3FA 1B20A 4XDVA 3VSYA 2H0GA 3NBJA 2IUJA 1I0VA 3WHOA 3JUNA 1AVLA 1I3FA 3MSOA 1BNFA 3IJEB 4FCMA 3KSPA 2W2CA 2XF3A 3F40A 2KCDA 3I0YA 1PFPA 3DM8A 3KZTA 3JVCA 1IQXA 2FNQA 2Z7AA 3LTBA 4HM4B 3FKAA 4PEJA 2UUGC 2OTJ3 3FLJA 1IDPA 5AEWB 2AADA 1LRAA 2MC8A 2ZL8A 4HM5B 4R4KA 1IT8A 2M7OA 4AKZA 1N5HA 3B4PA 3NX0A 2K3DA 1FUTA 3CPW2 4N6TA 1U5OA 3S67A 3GWRA 3WA2X 1TP6A 3CNMA 3QRDA 3G0KA 1MGRA 3TDGA 4RNTA 5AEUB 2IYJA 3V99A 4HM7B 3DY5A 2WOHA 1ASKA 4RBNA 1DMMA 1X1WA 1JKGB 3B7CA 3LT8A 4HM1B 1M9GA 1YGWA 1EEJA 1FYSA 1GOYA 2OQEC 2F99A 3PCSA 5CK6A 4ZM8A 1IK3A 1BGSA 1ULIB 1ZGXA 3ER7A 2R4IA 5D83A 3T8NA 4WP5A 2KF5A 2F5MA 1O7HB 1JZDA 1A2PA 4R9LA 3MHEA 1K8A4 1TIJA 1RN7A 3DXOA 1NNVA 1RGHA 3H3HA 2CC3A 2HMNB 2AAEA 3WODG 1YVSA 4G1MB 1A2VA 4CDLA 2BHMA 1UI7A 1VQL3 1K734 1C7HA 3CMA3 1JNQA 3LMLA 2Z76A 1FGOA 1Y4KA 1TTOA 3A76A 1UGIA 2YX9A 3EHCA 3J7Yd 1LQGC 1YI23 4BL2A 3EBTA 5FW5A 2BNGA 1A90A 3SOYA 1D6UA 2E2VA 4BL3A 3D4AA 1O7PB 1VZZA 4L7KA 2CFLA 1IV7A 3GRDA 1FZUA 3EB8A 3B4OA 1X1XA 3DGLA 1JBRA 3Q2PA 1SPUA 3WMDA 1W02A 1GS3A 3BIRA 3MG2A 1RGAA 2ZDJA 3GZBA 4KZ1A 2HOHA 1W2ZA 1Q40A 2F4YA 1PYLA 4BTXA 3K7CA 3CCU3 4DKIA 3K9MC 1AV4A 3HIGA 3A5EA 1JN5A 1I0XA 1JBSA 1HU9A 2INXA 2CIUA 2CFGA 2CK3H 1E3RA 1VQ53 4OVMA 5EQLA 5BXQA 3CU3A 3SOAA 1LNIA 2FXTA 1FGRA 1UCLA 4KFDA 5IG0A 5A0OB 3X42A 1RNTA 2YFIB 1G96A 4HZ9B 4N3VA 1FW7A 3NXJA 3L0RA 5JBSA 2QA43 1YJN3 1JJ22 1JBTA 4R1KA 5D81A 2KAAA 4MEIA 1VQ73 1ZX2A 3VGNA 1YJW3 1BANA 1D6YA 1OHOA 5HOHA 3DGOA 3B8LA 1VQK3 3AMOA 4EV5A 3CPOA 3UL5A 4BU4A 5KP4A 2GSPA 3EBYA 1RMSA 2CFKA
chains in the Genus database with same CATH topology
4K90B 2JQ5A 1FA3A 3DZLA 1DYUA 3GZXB 5ELJA 2HMKB 5JPUA 2IA7A 2QGUA 3E99A 3CCS3 3HX8A 2KXGA 3T8UA 2E2UA 1ZO2A 4K1UA 3MPHA 1Q7Y4 4N6UA 1Q42A 4EV2A 3HZPA 5AIGA 4H3UA 3F9SA 1W7CA 2CG0A 1CQSA 3NQZA 1CYVA 2CWUA 2RFRA 1SJWA 1TFOA 2Q07A 4X2HA 1W6YA 2CFDA 3GZRA 3MG1A 3JUQA 6STDA 3KE7A 1T5YA 2LYXA 1SQWA 2BO9B 1A2KA 3ECFA 1GD4A 4NHFA 3EJVA 3EC9A 3N9HA 4EYCA 3KN4A 7STDA 1TUHA 2O9UX 3MG3A 3BLZA 2OCTA 2XEPA 1K28A 3CCJ3 3K63A 2B1XB 3NUVA 2B24B 2K0MA 3NV0A 3PGBA 5HGRA 1W4NA 2F86B 3BNCA 4N6V0 4QWTA 2GXFA 5TGNA 1M1K4 3CXC2 3ALAA 3F7XA 3V98A 3I563 1WTHA 4XBTA 1W5ZA 3Q1CA 5IERA 1EKMA 3PZWA 3HK4A 2OTL3 1IVUA 1AVKA 1NB5I 3FG1A 2XFTA 4IT7A 3EX9A 2HMJB 2UX0A 1O7NB 3CD63 3BNDA 4BTWA 3EN8A 2W9QA 3OXAA 3CC43 3HIIA 3NV0B 1IQYA 5AYSC 3S29A 3KSED 4GL6A 1IVWA 4O3VA 2XSHB 3JUPA 2RGQA 1KQS2 1KSIA 4J8TA 5AI1A 1TU5A 1CEWI 4J9AA 3SEDA 1YGEA 1JB5A 4MMZB 1SIIA 2XR8B 5CXOA 5CLKA 4R9KA 5KP3A 3OWUA 1IVVA 2Z77A 1N9EA 2CH9A 4O8SA 1QALA 1S723 1KD14 1WMNA 1W6CA 2F98A 1YHQ3 1STDA 1CYUA 3FGYA 3RGAA 1IU7A 4Q53A 4IIAA 2P09A 1O7GB 1ULJB 3X3XA 4LEHA 3OX9A 3RGRA 1ISKA 4EXRA 3AMOB 5AIHA 1VQP3 4L8PA 1FUWA 3D3LA 1QAFA 3CME3 2LQVA 5FGOA 5I97A 1DMQA 2GBWB 1IVXA 3FF0A 1D6ZA 1V74A 5IG4A 2PNCA 3LYGA 2XSOB 4IPBA 2BMRB 4HJLB 2Y73A 3FG4A 1QMAA 3GAXA 1ROVA 2W56B 3UL6A 5JPPA 4RNYA 1QVF2 3WA3A 1NWWA 1DMNA 1KWIA 3X40A 1JRQA 4HM3B 2W6JH 4HM0B 3U97A 2BMQB 3DGMA 3EN1B 3PYJA 1W00A 2Y74A 2IMJA 2V1LA 2I9WA 1FGQA 3EQQB 1LOXA 3CC23 3H51A 1LVNA 3KIIA 4RZMA 3IMAB 3S5CA 1JN5B 4XBXA 2WOFA 1VQO3 3G4S3 3OW22 4HBRA 3EF8A 1MOLA 4LMIA 4WWUC 4LGQA 5IEOA 4HKVB 3MWZA 2CW9A 2CHCA 4AKYA 1GY5A 2D42A 3F8HA 3NM2A 1SIHA 4LSOA 1Q824 4FMAA 1O7MB 1JB4A 3N8BA 5LC7A 3HI7A 4WHAA 1RKYA 2E2TA 4K61A 1W6GA 3CCM3 5EVHA 5ELUA 1RJOA 4RNZA 2OQEA 4L8OA 2ML5A 2W03A 3KKGA 3N54B 2RCDA 1FGTA 1ROAA 3JUOA 4FCZA 1OPYA 1VQ93 5AIIA 3SX1A 1E3VA 5IW9A 1UW1A 1VQ83 1OF5B 4HM6B 1K41A 5CF1A 3UB1A 1WQLB 3F8XA 4MMXB 1W01A 2OWPA 3MKIA 2WGOA 3SVAA 3CCR3 3OV4A 3WDGB 1S5AA 4N6NB 3T0UA 3CCV3 1YVBI 3LXUX 1K9M4 1JKGA 4EC6A 4JF8A 1RRLA 1M1XB 2BMOB 1N8R4 3Q90A 1VQ63 4TX4A 2XRXB 3K5TA 3FSDA 5CF2A 3CC73 1EG9B 3F14A 3WOEB 4HVNA 3RDEA 3MYTA 3LTAA 1N9JA 4FMCA 2GBXB 3M8CA 1VQ43 2BT3A 1N8QA 1OUNA 4JRFA 2C10A 1A67A 1NB3I 1YIJ3 2GEYA 2A15A 5EEOA 2WGQA 1LNHA 1QJGA 3GZYB 3CCQ3 2MF7A 1W2B2 2Z6BA 3F7SA 4KFEA 3FH1A 1JB2A 1IV9A 1OCVA 4H61A 1EA2A 3VF1A 1J2BA 8CHOA 1L5GB 4LZIA 2STDA 2W0QA 4KVHA 2RSXA 5AIFA 5IENA 4HZBB 2OOVA 1HKXA 3NHXA 2FGTA 5KP1A 3DGNA 1F8NA 1NO3A 2KRTA 2K54A 4ORLA 5IG5A 3I553 1Q40B 1PU4A 1RRHA 1GY7A 2CWTA 5IG3A 1IQ8A 2ML6A 1NDOB 1OH0A 3SLUA 1Z1SA 1YIT3 2IUKA 1O7WB 1U8CB 1R4CA 1YJ93 1WNHA 5STDA 3LTDA 2WO0A 1OHSA 4XB5A 2CKFB 3V92A 3FG3A 3PS8A 4EBGA 3PXMA 4N6LA 3X3YA 1MNLA 3DUKA 3STDA 3NM7A 2PZVA 3D9RA 4MMYB 4X2OA 4AEQA 3O8YA 3OWYA 4O2HA 4HYZA 4O02B 3U1WA 2YFJB 1M904 1OACA 1KC84 1OGXA 3NBRA 3CCE3 3NBBA 1DVCA 1DVDA 4N6MA 2GU1A 5G2GA 3FCSB 2CFWA 2C11A 4R80A 3BNEA 3EE1A 2W9PA 5IEPA 2O3OA 4FMBA 1OHPA 3JUMA 1EQKA 2XFSA 3LOYA 2GU3A 3KFQC 3BNBA 1STFI 3G713 3UNLA 1OF5A 3DMCA 3LZAA 4FMDA 4WYKA 5DRVA 2XGNA 4WYKB 3CNXA 1VQN3 3LT9A 2GEXA 3ROBA 2HMOB 4BTYA 4I4KA 3OWSA 1OGZA 2SBLA 3S27A 3IPTA 1AR0A 2HMMB 3K0ZA 4XDWA 1WMPA 2HMLB 1NU3A 2XGLA 4STDA 2W04A 2P0MA 3G16A 1N5PA 1UUVB 3LTCA 1VQM3 1GYBA 5DREA 3QK9A 4K1VA 2W56A 3UJMA 4NREA 1US1A 4OK0A 1QAKA 2XH9A 3PCRA 4N6OB 4XBYA 5AYRB 4GB5A 4FR9A 2L4VA 1IT7A 3FF2A 3FZWA 4MJDA 4FCJA 3WOFB 4U13A 2JDIH 2QEX3 3BB9A 4XM4A 3G6E3 3CCL3 4WFOA 2CG1A 3S28A 3G8ZA 1TFKA 2CWVA 3X3ZA 4KFFA 2P0XA 5BVBA 1FGMA 1GY6A 5IF6A 2P05A 1LXEA 1UUWB 4HM8B 2QIYA 2D1WA 2P38A 4HM2B 1NJI4 2OOVC 2YFLB 3NQYA 4OUQA 1Q814 3LH4A 4CCVA 1BUQA 1GD3A 1JV2B 5D82A 1E97A 1UI8A 3X41A 1Q864 3SXXA 1QVG2 1WMOA 5LC6A 4XDVA 3VSYA 3NBJA 2IUJA 3JUNA 1AVLA 3MSOA 3IJEB 4FCMA 3KSPA 2W2CA 2XF3A 3F40A 2KCDA 3I0YA 1PFPA 3DM8A 3KZTA 3JVCA 1IQXA 2FNQA 2Z7AA 3LTBA 4HM4B 3FKAA 4PEJA 2OTJ3 3FLJA 1IDPA 5AEWB 2MC8A 2ZL8A 4HM5B 4R4KA 1IT8A 2M7OA 4AKZA 1N5HA 3B4PA 3NX0A 3CPW2 4N6TA 1U5OA 3S67A 3GWRA 3WA2X 1TP6A 3CNMA 3QRDA 3G0KA 3TDGA 5AEUB 3V99A 4HM7B 3DY5A 2WOHA 1ASKA 4RBNA 1DMMA 1JKGB 3B7CA 3LT8A 4HM1B 1M9GA 2OQEC 3PCSA 4ZM8A 1IK3A 2F99A 5CK6A 1ULIB 3ER7A 5D83A 2R4IA 3T8NA 4WP5A 1O7HB 4R9LA 3MHEA 1K8A4 1TIJA 1RN7A 3DXOA 3H3HA 2CC3A 2HMNB 3WODG 4G1MB 1A2VA 4CDLA 2BHMA 1UI7A 1VQL3 1K734 1C7HA 3CMA3 1JNQA 3LMLA 2Z76A 1FGOA 1Y4KA 3A76A 3EHCA 2YX9A 3J7Yd 1YI23 3EBTA 5FW5A 2BNGA 1A90A 3SOYA 1D6UA 2E2VA 1O7PB 1VZZA 4L7KA 2CFLA 1IV7A 3GRDA 3EB8A 3B4OA 3DGLA 3Q2PA 1SPUA 3WMDA 1W02A 1GS3A 3MG2A 2ZDJA 3GZBA 4KZ1A 4BTXA 1W2ZA 1Q40A 3CCU3 3K7CA 3K9MC 1AV4A 3HIGA 1JN5A 1HU9A 2INXA 2CIUA 2CFGA 2CK3H 1E3RA 1VQ53 5EQLA 5BXQA 3CU3A 3SOAA 2FXTA 1FGRA 4KFDA 5IG0A 5A0OB 3X42A 2YFIB 1G96A 4HZ9B 4N3VA 3NXJA 3L0RA 5JBSA 2QA43 1YJN3 1JJ22 4R1KA 5D81A 4MEIA 1VQ73 1ZX2A 3VGNA 1YJW3 1OHOA 1D6YA 3DGOA 3B8LA 1VQK3 3AMOA 4EV5A 3CPOA 3UL5A 5KP4A 3EBYA 4OVMA 2CFKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E97 A;  1QJG A;  2JQ5 A;  3DZL A;  3GZX B;  4XDV A;  2HMK B;  1DMQ A;  2GBW B;  3VSY A;  5JPU A;  3F7S A;  2QGU A;  3FF0 A;  3FH1 A;  3E99 A;  1JB2 A;  1OCV A;  3HX8 A;  3T8U A;  1EA2 A;  1ZO2 A;  3JUN A;  4K1U A;  5IG4 A;  3MSO A;  8CHO A;  3LYG A;  2XSO B;  4FCM A;  1Q42 A;  3KSP A;  2BMR B;  2STD A;  2W2C A;  4HJL B;  3HZP A;  4KVH A;  3F40 A;  5AIG A;  5AIF A;  4HZB B;  5IEN A;  3I0Y A;  3F9S A;  1HKX A;  1QMA A;  1CQS A;  4H3U A;  2RFR A;  3DM8 A;  3KZT A;  3NHX A;  2Z7A A;  4HM4 B;  5KP1 A;  1SJW A;  3FKA A;  4PEJ A;  5JPP A;  3FLJ A;  1IDP A;  2K54 A;  4ORL A;  5AEW B;  1NWW A;  1DMN A;  1Q40 B;  5IG5 A;  4HM3 B;  4X2H A;  4HM5 B;  1W6Y A;  3GZR A;  1GY7 A;  5D82 A;  3MG1 A;  5IG3 A;  3B4P A;  4HM0 B;  1NDO B;  3JUQ A;  2BMQ B;  6STD A;  1OH0 A;  1U5O A;  3KE7 A;  3EN1 B;  3GWR A;  1W00 A;  1Z1S A;  1TP6 A;  1O7W B;  3CNM A;  2IMJ A;  3G0K A;  2I9W A;  5AEU B;  3EQQ B;  4HM7 B;  5STD A;  1A2K A;  3H51 A;  1ASK A;  1OHS A;  1DMM A;  3ECF A;  4RZM A;  3S5C A;  1JKG B;  1JN5 B;  3B7C A;  2CKF B;  3EJV A;  3EC9 A;  4HM1 B;  4XBX A;  4XB5 A;  7STD A;  2F99 A;  3EF8 A;  4WWU C;  1TUH A;  4LMI A;  5CK6 A;  3DUK A;  4LGQ A;  1ULI B;  3ER7 A;  5D83 A;  2R4I A;  5IEO A;  3STD A;  3T8N A;  4WP5 A;  3MG3 A;  3BLZ A;  4HKV B;  1O7H B;  2CHC A;  2PZV A;  3D9R A;  4R9L A;  4X2O A;  1GY5 A;  3F8H A;  3MHE A;  3NM2 A;  3OWY A;  3DXO A;  1O7M B;  1JB4 A;  2YFJ B;  3H3H A;  2HMN B;  2B1X B;  3NUV A;  1OGX A;  2B24 B;  3NV0 A;  4CDL A;  3NBR A;  5EVH A;  1C7H A;  5HGR A;  2Z76 A;  2F86 B;  5G2G A;  3A76 A;  2GXF A;  3EHC A;  5BXQ A;  5TGN A;  5IEP A;  4L8O A;  3EBT A;  5FW5 A;  2BNG A;  3SOY A;  1O7P B;  1OHP A;  1VZZ A;  3F7X A;  2RCD A;  3JUM A;  3KKG A;  3MG2 A;  4L7K A;  4XBT A;  3JUO A;  3GRD A;  5IER A;  1OPY A;  3B4O A;  3HK4 A;  5AII A;  1OF5 A;  3DMC A;  1E3V A;  3LZA A;  4WYK A;  5DRV A;  3UNL A;  4WYK B;  1OF5 B;  3CNX A;  2GEX A;  3EX9 A;  4HM6 B;  2HMJ B;  2HMO B;  2UX0 A;  3ROB A;  4I4K A;  3OWS A;  1OGZ A;  1O7N B;  3WMD A;  1W02 A;  1K41 A;  1GS3 A;  5CF1 A;  1WQL B;  1AR0 A;  2HMM B;  3F8X A;  3EN8 A;  3GZB A;  3IPT A;  3K0Z A;  1W01 A;  2HML B;  1NU3 A;  4STD A;  4XDW A;  3OXA A;  3G16 A;  1Q40 A;  2OWP A;  3MKI A;  1UUV B;  3K7C A;  3NV0 B;  1GYB A;  5DRE A;  4K1V A;  3OV4 A;  3UJM A;  2XSH B;  3JUP A;  1S5A A;  2RGQ A;  4XBY A;  4J8T A;  5AI1 A;  1JN5 A;  1JKG A;  4J9A A;  3SED A;  1JB5 A;  4GB5 A;  2INX A;  2XR8 B;  5CXO A;  5CLK A;  2BMO B;  4R9K A;  3Q90 A;  1E3R A;  3FF2 A;  2XRX B;  3FZW A;  3FSD A;  3OWU A;  4MJD A;  2Z77 A;  4FCJ A;  5KP3 A;  3CU3 A;  4U13 A;  1EG9 B;  3F14 A;  3SOA A;  3BB9 A;  4XM4 A;  4HVN A;  5IG0 A;  2F98 A;  1STD A;  3MYT A;  2YFI B;  4N3V A;  2GBX B;  3G8Z A;  4HZ9 B;  3M8C A;  3FGY A;  3NXJ A;  3RGA A;  4Q53 A;  4IIA A;  4R1K A;  5D81 A;  5BVB A;  1GY6 A;  1O7G B;  1ULJ B;  4LEH A;  3OX9 A;  3RGR A;  1ZX2 A;  1UUW B;  1OUN A;  4HM8 B;  3VGN A;  1OHO A;  2QIY A;  1ISK A;  4HM2 B;  5IF6 A;  2YFL B;  3B8L A;  4OUQ A;  5CF2 A;  3CPO A;  5AIH A;  2GEY A;  4L8P A;  5KP4 A;  1BUQ A;  3EBY A;  2A15 A;  4OVM A;  3GZY B; 
#chains in the Genus database with same CATH topology
 4K90 B;  2JQ5 A;  1FA3 A;  7GSP A;  1AQZ A;  3DZL A;  1DYU A;  3GZX B;  5ELJ A;  2HMK B;  5JPU A;  2H0H A;  2IA7 A;  1RTU A;  2QGU A;  3E99 A;  3CCS 3;  3HX8 A;  2KXG A;  3T8U A;  2E2U A;  1ZO2 A;  4K1U A;  3MPH A;  1Q7Y 4;  4N6U A;  1T2I A;  1UGH I;  1Q42 A;  4EV2 A;  3HZP A;  5AIG A;  4H3U A;  3F9S A;  1MGW A;  1W7C A;  1CQS A;  2CG0 A;  1CYV A;  2CWU A;  1BRI A;  2RFR A;  2RNT A;  1FUS A;  3NQZ A;  1SJW A;  1TFO A;  2Q07 A;  4X2H A;  1W6Y A;  2CFD A;  3GZR A;  3MG1 A;  3JUQ A;  6STD A;  3KE7 A;  1T5Y A;  2LYX A;  1SQW A;  1YNV X;  2BO9 B;  2KF3 A;  1A2K A;  3ECF A;  1GD4 A;  4NHF A;  2KF6 A;  3EJV A;  3EC9 A;  3N9H A;  4EYC A;  3KN4 A;  1PY3 A;  7STD A;  3ZG0 A;  1TUH A;  2O9U X;  1BVI A;  1UCJ A;  3MG3 A;  3BLZ A;  1GOV A;  1RN4 A;  3ZFZ A;  2OCT A;  2XEP A;  9RNT A;  1K28 A;  1MWT A;  3KCH A;  3CCJ 3;  3K63 A;  2B1X B;  3NUV A;  2B24 B;  2K0M A;  3NV0 A;  3PGB A;  5HGR A;  1BUJ A;  4EW5 A;  1B21 A;  1W4N A;  2F86 B;  1GMQ A;  3BNC A;  4N6V 0;  4QWT A;  7RNT A;  2GXF A;  5TGN A;  1M1K 4;  3CXC 2;  1BNG A;  3ALA A;  3F7X A;  3V98 A;  3I56 3;  1WTH A;  4XBT A;  1BU4 A;  1W5Z A;  3Q1C A;  1V58 A;  1EKM A;  3PZW A;  3HK4 A;  5IER A;  2OTL 3;  1IVU A;  1AVK A;  1NB5 I;  3FG1 A;  2XFT A;  5M19 A;  4IT7 A;  3EX9 A;  2HMJ B;  2UX0 A;  1B27 A;  1BSE A;  1RGC A;  1O7N B;  3CD6 3;  2BIR A;  3BND A;  4BTW A;  3EN8 A;  2W9Q A;  1UUG B;  3OXA A;  3CC4 3;  3HII A;  3NV0 B;  1IQY A;  5AYS C;  4LYL B;  3S29 A;  3KSE D;  4GL6 A;  1IVW A;  4NPB A;  4O3V A;  2XSH B;  3JUP A;  2RGQ A;  4KT3 B;  1KQS 2;  1KSI A;  4J8T A;  5AI1 A;  1TU5 A;  1CEW I;  4J9A A;  3SED A;  1YGE A;  1JB5 A;  4MMZ B;  1SII A;  2XR8 B;  5CXO A;  1MWS A;  4R9K A;  5CLK A;  5KP3 A;  3OWU A;  1IVV A;  2Z77 A;  1N9E A;  2BU4 A;  2CH9 A;  4O8S A;  1QAL A;  1RGE A;  1BOX A;  1S72 3;  1KD1 4;  1WMN A;  1W6C A;  2F98 A;  2H0I A;  1STD A;  1YHQ 3;  1IYY A;  1UCK A;  1CYU A;  1GMR A;  3FGY A;  3RGA A;  1IU7 A;  4Q53 A;  4IIA A;  2P09 A;  2UGI A;  1O7G B;  1ULJ B;  3X3X A;  4LEH A;  3OX9 A;  3RGR A;  4BIR A;  1ISK A;  4EXR A;  3AMO B;  3GSP A;  5AIH A;  1X1Y A;  4L8P A;  1VQP 3;  1FUW A;  3D3L A;  3RNT A;  2IY2 A;  1QAF A;  5G1L A;  3CME 3;  4CPK A;  2LQV A;  3AGN A;  5FGO A;  5I97 A;  1DMQ A;  2GBW B;  1IVX A;  3FF0 A;  4HAA A;  1D6Z A;  1V74 A;  5IG4 A;  2PNC A;  3LYG A;  2XSO B;  4IPB A;  1B2S A;  2BMR B;  4HJL B;  2Y73 A;  3FG4 A;  1QMA A;  6GSP A;  1R4Y A;  1ROV A;  3GAX A;  2W56 B;  3UL6 A;  5JPP A;  4RNY A;  1QVF 2;  3WA3 A;  1NWW A;  1DMN A;  1KWI A;  1UDI I;  1JRQ A;  3X40 A;  4HM3 B;  2W6J H;  3WR2 A;  4HM0 B;  3U97 A;  2BMQ B;  3DGM A;  3EN1 B;  3PYJ A;  1W00 A;  2Y74 A;  2IMJ A;  2V1L A;  3AHW A;  2I9W A;  5BIR A;  1FGQ A;  3EQQ B;  1LOX A;  1ZS7 A;  3CC2 3;  1TRQ A;  1GSP A;  1RNB A;  3H51 A;  1LVN A;  1V57 A;  3KII A;  4RZM A;  3IMA B;  3S5C A;  1JN5 B;  4XBX A;  2WOF A;  1VQO 3;  3G4S 3;  3OW2 2;  4HBR A;  3EF8 A;  1MOL A;  4LMI A;  1BRS A;  4WWU C;  4LGQ A;  2C4B A;  1B2M A;  3D79 A;  5IEO A;  4HKV B;  1BNJ A;  3MWZ A;  2CW9 A;  2CHC A;  4AKY A;  1GY5 A;  1RSN A;  2D42 A;  3F8H A;  1SIH A;  3NM2 A;  4LSO A;  1Q82 4;  1I3I A;  1O7M B;  1JB4 A;  3N8B A;  4FMA A;  5LC7 A;  5M1A A;  3HI7 A;  4WHA A;  1BRJ A;  1RKY A;  2E2T A;  4K61 A;  1W6G A;  3CCM 3;  5EVH A;  5ELU A;  1RJO A;  2ZHX B;  4RNZ A;  2OQE A;  4L8O A;  2ML5 A;  2W03 A;  1TRP A;  1BNR A;  3KKG A;  3N54 B;  2RCD A;  1G0T A;  1AY7 A;  1FGT A;  5M18 A;  1ROA A;  3D5G A;  3JUO A;  4FCZ A;  4J5G A;  1OPY A;  1VQ9 3;  5AII A;  3SX1 A;  2KF4 A;  1E3V A;  5IW9 A;  1UW1 A;  1VQ8 3;  1LQM B;  1OF5 B;  4HM6 B;  1I2G A;  2R41 A;  1K41 A;  1RGG A;  5CF1 A;  3UB1 A;  1WQL B;  3F8X A;  4MMX B;  1W01 A;  2CX0 A;  2OWP A;  3MKI A;  2CX1 A;  1RGF A;  1RN1 A;  2WGO A;  3SVA A;  3CCR 3;  3OV4 A;  8RNT A;  1G02 A;  1JZO A;  3WDG B;  1S5A A;  4N6N B;  3T0U A;  5RNT A;  1YVB I;  3CCV 3;  3LXU X;  1K9M 4;  1JKG A;  4EC6 A;  3ZG5 A;  4JF8 A;  1RRL A;  1M1X B;  2BMO B;  1N8R 4;  3Q90 A;  1VQ6 3;  1BNE A;  2XRX B;  3K5T A;  3FSD A;  4TX4 A;  5CF2 A;  3CC7 3;  1EG9 B;  3F14 A;  3WOE B;  4HVN A;  6RNT A;  3RDE A;  1HYF A;  3MYT A;  3LTA A;  1N9J A;  4GSP A;  4FMC A;  2GBX B;  3M8C A;  4HOH A;  1BRH A;  1VQ4 3;  2BT3 A;  1CH0 A;  1BRK A;  1N8Q A;  1C54 A;  1OUN A;  4JRF A;  2C10 A;  1A67 A;  1NB3 I;  1RGL A;  1YIJ 3;  1RHL A;  2GEY A;  1X1U A;  2A15 A;  5EEO A;  1LNH A;  2WGQ A;  1QJG A;  1BSA A;  3GZY B;  2MF7 A;  1EUI C;  1TJD A;  3CCQ 3;  1W2B 2;  2Z6B A;  1MWR A;  1LOV A;  3F7S A;  4KFE A;  3FH1 A;  1JB2 A;  1IV9 A;  1OCV A;  4H61 A;  5BU4 A;  4CJN A;  1EA2 A;  3VF1 A;  1J2B A;  8CHO A;  1L5G B;  4LZI A;  2STD A;  2W0Q A;  4KVH A;  2RSX A;  5AIF A;  5IEN A;  4HZB B;  1I70 A;  2OOV A;  1HKX A;  1RCL A;  4ILF A;  3NHX A;  2FGT A;  5KP1 A;  3DGN A;  1MWU A;  1F8N A;  1NO3 A;  2KRT A;  2K54 A;  4ORL A;  5IG5 A;  3I55 3;  1Q40 B;  2ZA4 A;  1PU4 A;  1RRH A;  1GY7 A;  2CWT A;  5IG3 A;  1IQ8 A;  1LOW A;  2ML6 A;  1BNI A;  1NDO B;  1OH0 A;  1I2F A;  3SLU A;  1BNS A;  1Z1S A;  2F5W A;  2IUK A;  1O7W B;  1YIT 3;  1U8C B;  1R4C A;  3BU4 A;  1YJ9 3;  1WNH A;  5STD A;  3LTD A;  2WO0 A;  1OHS A;  2J8X B;  2CKF B;  4XB5 A;  2L1S A;  3V92 A;  1T2H A;  3FG3 A;  3PS8 A;  4GHO A;  1I2E A;  4EBG A;  3PXM A;  4N6L A;  3X3Y A;  1MNL A;  3DUK A;  3STD A;  1RGK A;  1T3B A;  3NM7 A;  2PZV A;  3D5I A;  3D9R A;  4MMY B;  4X2O A;  4AEQ A;  3O8Y A;  3OWY A;  1VQQ A;  4O2H A;  4HYZ A;  4O02 B;  3U1W A;  2YFJ B;  1M90 4;  1OAC A;  1KC8 4;  1OGX A;  3NBR A;  3CCE 3;  3NBB A;  1DVC A;  1DVD A;  4N6M A;  2GU1 A;  5G2G A;  3FCS B;  2CFW A;  2C11 A;  1BIR A;  3BNE A;  4R80 A;  1DET A;  2W9P A;  3EE1 A;  5IEP A;  2O3O A;  4FMB A;  3DGY A;  1RCK A;  1SAR A;  1OHP A;  3JUM A;  1EQK A;  2XFS A;  3LOY A;  2GU3 A;  3KFQ C;  1RDS A;  3BNB A;  1STF I;  3G71 3;  5GSP A;  3UNL A;  1OF5 A;  3DMC A;  3LZA A;  4FMD A;  4WYK A;  1BSC A;  5DRV A;  2XGN A;  3SYU A;  4WYK B;  3CNX A;  1VQN 3;  3LT9 A;  2GEX A;  3ROB A;  2HMO B;  4BTY A;  4I4K A;  3OWS A;  1BAO A;  1OGZ A;  2SBL A;  1DE3 A;  3S27 A;  3IPT A;  1AR0 A;  1I8V A;  1BSB A;  2HMM B;  3HOH A;  3K0Z A;  4XDW A;  1WMP A;  2HML B;  1NU3 A;  2XGL A;  3AGO A;  4STD A;  2W04 A;  2P0M A;  3G16 A;  1N5P A;  1UUV B;  1LOY A;  3LTC A;  1VQM 3;  1GYB A;  1UCI A;  5DRE A;  1RLS A;  3QK9 A;  4K1V A;  2W56 A;  1GMP A;  4I5Q A;  2SAR A;  4NRE A;  3UJM A;  1US1 A;  4OK0 A;  1QAK A;  2XH9 A;  3PCR A;  4N6O B;  4XBY A;  1B2Z A;  1B3S A;  1BRG A;  3DH2 A;  1HZ1 A;  5AYR B;  4GB5 A;  2RBI A;  4FR9 A;  3URP A;  2L4V A;  1B2X A;  5G1K A;  1IT7 A;  3FF2 A;  3FZW A;  4MJD A;  4FCJ A;  3WOF B;  4U13 A;  1Q7H A;  2JDI H;  3AHS A;  3BB9 A;  4XM4 A;  2QEX 3;  3G6E 3;  3CCL 3;  4WFO A;  2CG1 A;  3S28 A;  1Q9E A;  3G8Z A;  1TFK A;  4J5K A;  2CWV A;  3X3Z A;  4KFF A;  2P0X A;  5BVB A;  1FGM A;  1GY6 A;  5IF6 A;  2P05 A;  1BRN L;  1LXE A;  1UUW B;  4HM8 B;  2QIY A;  2D1W A;  2P38 A;  4HM2 B;  1NJI 4;  2OOV C;  2YFL B;  3NQY A;  4OUQ A;  2F56 A;  1Q81 4;  3LH4 A;  4CCV A;  1BSD A;  1BUQ A;  1GD3 A;  1JV2 B;  5D82 A;  1E97 A;  1UI8 A;  3X41 A;  1Q86 4;  3SXX A;  1B2U A;  1QVG 2;  1WMO A;  5LC6 A;  1GOU A;  3Q3F A;  1B20 A;  4XDV A;  3VSY A;  2H0G A;  3NBJ A;  2IUJ A;  1I0V A;  3WHO A;  3JUN A;  1AVL A;  1I3F A;  3MSO A;  1BNF A;  3IJE B;  4FCM A;  3KSP A;  2W2C A;  2XF3 A;  3F40 A;  2KCD A;  3I0Y A;  1PFP A;  3DM8 A;  3KZT A;  3JVC A;  1IQX A;  2FNQ A;  2Z7A A;  3LTB A;  4HM4 B;  3FKA A;  4PEJ A;  2UUG C;  2OTJ 3;  3FLJ A;  1IDP A;  5AEW B;  2AAD A;  1LRA A;  2MC8 A;  2ZL8 A;  4HM5 B;  4R4K A;  1IT8 A;  2M7O A;  4AKZ A;  1N5H A;  3B4P A;  3NX0 A;  2K3D A;  1FUT A;  3CPW 2;  4N6T A;  1U5O A;  3S67 A;  3GWR A;  3WA2 X;  1TP6 A;  3CNM A;  3QRD A;  3G0K A;  1MGR A;  3TDG A;  4RNT A;  5AEU B;  2IYJ A;  3V99 A;  4HM7 B;  3DY5 A;  2WOH A;  1ASK A;  4RBN A;  1DMM A;  1X1W A;  1JKG B;  3B7C A;  3LT8 A;  4HM1 B;  1M9G A;  1YGW A;  1EEJ A;  1FYS A;  1GOY A;  2OQE C;  2F99 A;  3PCS A;  5CK6 A;  4ZM8 A;  1IK3 A;  1BGS A;  1ULI B;  1ZGX A;  3ER7 A;  2R4I A;  5D83 A;  3T8N A;  4WP5 A;  2KF5 A;  2F5M A;  1O7H B;  1JZD A;  1A2P A;  4R9L A;  3MHE A;  1K8A 4;  1TIJ A;  1RN7 A;  3DXO A;  1NNV A;  1RGH A;  3H3H A;  2CC3 A;  2HMN B;  2AAE A;  3WOD G;  1YVS A;  4G1M B;  1A2V A;  4CDL A;  2BHM A;  1UI7 A;  1VQL 3;  1K73 4;  1C7H A;  3CMA 3;  1JNQ A;  3LML A;  2Z76 A;  1FGO A;  1Y4K A;  1TTO A;  3A76 A;  1UGI A;  2YX9 A;  3EHC A;  3J7Y d;  1LQG C;  1YI2 3;  4BL2 A;  3EBT A;  5FW5 A;  2BNG A;  1A90 A;  3SOY A;  1D6U A;  2E2V A;  4BL3 A;  3D4A A;  1O7P B;  1VZZ A;  4L7K A;  2CFL A;  1IV7 A;  3GRD A;  1FZU A;  3EB8 A;  3B4O A;  1X1X A;  3DGL A;  1JBR A;  3Q2P A;  1SPU A;  3WMD A;  1W02 A;  1GS3 A;  3BIR A;  3MG2 A;  1RGA A;  2ZDJ A;  3GZB A;  4KZ1 A;  2HOH A;  1W2Z A;  1Q40 A;  2F4Y A;  1PYL A;  4BTX A;  3K7C A;  3CCU 3;  4DKI A;  3K9M C;  1AV4 A;  3HIG A;  3A5E A;  1JN5 A;  1I0X A;  1JBS A;  1HU9 A;  2INX A;  2CIU A;  2CFG A;  2CK3 H;  1E3R A;  1VQ5 3;  4OVM A;  5EQL A;  5BXQ A;  3CU3 A;  3SOA A;  1LNI A;  2FXT A;  1FGR A;  1UCL A;  4KFD A;  5IG0 A;  5A0O B;  3X42 A;  1RNT A;  2YFI B;  1G96 A;  4HZ9 B;  4N3V A;  1FW7 A;  3NXJ A;  3L0R A;  5JBS A;  2QA4 3;  1YJN 3;  1JJ2 2;  1JBT A;  4R1K A;  5D81 A;  2KAA A;  4MEI A;  1VQ7 3;  1ZX2 A;  3VGN A;  1YJW 3;  1BAN A;  1D6Y A;  1OHO A;  5HOH A;  3DGO A;  3B8L A;  1VQK 3;  3AMO A;  4EV5 A;  3CPO A;  3UL5 A;  4BU4 A;  5KP4 A;  2GSP A;  3EBY A;  1RMS A;  2CFK A; 
#chains in the Genus database with same CATH homology
 4K90 B;  2JQ5 A;  1FA3 A;  3DZL A;  1DYU A;  3GZX B;  5ELJ A;  2HMK B;  5JPU A;  2IA7 A;  2QGU A;  3E99 A;  3CCS 3;  3HX8 A;  2KXG A;  3T8U A;  2E2U A;  1ZO2 A;  4K1U A;  3MPH A;  1Q7Y 4;  4N6U A;  1Q42 A;  4EV2 A;  3HZP A;  5AIG A;  4H3U A;  3F9S A;  1W7C A;  2CG0 A;  1CQS A;  3NQZ A;  1CYV A;  2CWU A;  2RFR A;  1SJW A;  1TFO A;  2Q07 A;  4X2H A;  1W6Y A;  2CFD A;  3GZR A;  3MG1 A;  3JUQ A;  6STD A;  3KE7 A;  1T5Y A;  2LYX A;  1SQW A;  2BO9 B;  1A2K A;  3ECF A;  1GD4 A;  4NHF A;  3EJV A;  3EC9 A;  3N9H A;  4EYC A;  3KN4 A;  7STD A;  1TUH A;  2O9U X;  3MG3 A;  3BLZ A;  2OCT A;  2XEP A;  1K28 A;  3CCJ 3;  3K63 A;  2B1X B;  3NUV A;  2B24 B;  2K0M A;  3NV0 A;  3PGB A;  5HGR A;  1W4N A;  2F86 B;  3BNC A;  4N6V 0;  4QWT A;  2GXF A;  5TGN A;  1M1K 4;  3CXC 2;  3ALA A;  3F7X A;  3V98 A;  3I56 3;  1WTH A;  4XBT A;  1W5Z A;  3Q1C A;  5IER A;  1EKM A;  3PZW A;  3HK4 A;  2OTL 3;  1IVU A;  1AVK A;  1NB5 I;  3FG1 A;  2XFT A;  4IT7 A;  3EX9 A;  2HMJ B;  2UX0 A;  1O7N B;  3CD6 3;  3BND A;  4BTW A;  3EN8 A;  2W9Q A;  3OXA A;  3CC4 3;  3HII A;  3NV0 B;  1IQY A;  5AYS C;  3S29 A;  3KSE D;  4GL6 A;  1IVW A;  4O3V A;  2XSH B;  3JUP A;  2RGQ A;  1KQS 2;  1KSI A;  4J8T A;  5AI1 A;  1TU5 A;  1CEW I;  4J9A A;  3SED A;  1YGE A;  1JB5 A;  4MMZ B;  1SII A;  2XR8 B;  5CXO A;  5CLK A;  4R9K A;  5KP3 A;  3OWU A;  1IVV A;  2Z77 A;  1N9E A;  2CH9 A;  4O8S A;  1QAL A;  1S72 3;  1KD1 4;  1WMN A;  1W6C A;  2F98 A;  1YHQ 3;  1STD A;  1CYU A;  3FGY A;  3RGA A;  1IU7 A;  4Q53 A;  4IIA A;  2P09 A;  1O7G B;  1ULJ B;  3X3X A;  4LEH A;  3OX9 A;  3RGR A;  1ISK A;  4EXR A;  3AMO B;  5AIH A;  1VQP 3;  4L8P A;  1FUW A;  3D3L A;  1QAF A;  3CME 3;  2LQV A;  5FGO A;  5I97 A;  1DMQ A;  2GBW B;  1IVX A;  3FF0 A;  1D6Z A;  1V74 A;  5IG4 A;  2PNC A;  3LYG A;  2XSO B;  4IPB A;  2BMR B;  4HJL B;  2Y73 A;  3FG4 A;  1QMA A;  3GAX A;  1ROV A;  2W56 B;  3UL6 A;  5JPP A;  4RNY A;  1QVF 2;  3WA3 A;  1NWW A;  1DMN A;  1KWI A;  3X40 A;  1JRQ A;  4HM3 B;  2W6J H;  4HM0 B;  3U97 A;  2BMQ B;  3DGM A;  3EN1 B;  3PYJ A;  1W00 A;  2Y74 A;  2IMJ A;  2V1L A;  2I9W A;  1FGQ A;  3EQQ B;  1LOX A;  3CC2 3;  3H51 A;  1LVN A;  3KII A;  4RZM A;  3IMA B;  3S5C A;  1JN5 B;  4XBX A;  2WOF A;  1VQO 3;  3G4S 3;  3OW2 2;  4HBR A;  3EF8 A;  1MOL A;  4LMI A;  4WWU C;  4LGQ A;  5IEO A;  4HKV B;  3MWZ A;  2CW9 A;  2CHC A;  4AKY A;  1GY5 A;  2D42 A;  3F8H A;  3NM2 A;  1SIH A;  4LSO A;  1Q82 4;  4FMA A;  1O7M B;  1JB4 A;  3N8B A;  5LC7 A;  3HI7 A;  4WHA A;  1RKY A;  2E2T A;  4K61 A;  1W6G A;  3CCM 3;  5EVH A;  5ELU A;  1RJO A;  4RNZ A;  2OQE A;  4L8O A;  2ML5 A;  2W03 A;  3KKG A;  3N54 B;  2RCD A;  1FGT A;  1ROA A;  3JUO A;  4FCZ A;  1OPY A;  1VQ9 3;  5AII A;  3SX1 A;  1E3V A;  5IW9 A;  1UW1 A;  1VQ8 3;  1OF5 B;  4HM6 B;  1K41 A;  5CF1 A;  3UB1 A;  1WQL B;  3F8X A;  4MMX B;  1W01 A;  2OWP A;  3MKI A;  2WGO A;  3SVA A;  3CCR 3;  3OV4 A;  3WDG B;  1S5A A;  4N6N B;  3T0U A;  3CCV 3;  1YVB I;  3LXU X;  1K9M 4;  1JKG A;  4EC6 A;  4JF8 A;  1RRL A;  1M1X B;  2BMO B;  1N8R 4;  3Q90 A;  1VQ6 3;  4TX4 A;  2XRX B;  3K5T A;  3FSD A;  5CF2 A;  3CC7 3;  1EG9 B;  3F14 A;  3WOE B;  4HVN A;  3RDE A;  3MYT A;  3LTA A;  1N9J A;  4FMC A;  2GBX B;  3M8C A;  1VQ4 3;  2BT3 A;  1N8Q A;  1OUN A;  4JRF A;  2C10 A;  1A67 A;  1NB3 I;  1YIJ 3;  2GEY A;  2A15 A;  5EEO A;  2WGQ A;  1LNH A;  1QJG A;  3GZY B;  3CCQ 3;  2MF7 A;  1W2B 2;  2Z6B A;  3F7S A;  4KFE A;  3FH1 A;  1JB2 A;  1IV9 A;  1OCV A;  4H61 A;  1EA2 A;  3VF1 A;  1J2B A;  8CHO A;  1L5G B;  4LZI A;  2STD A;  2W0Q A;  4KVH A;  2RSX A;  5AIF A;  5IEN A;  4HZB B;  2OOV A;  1HKX A;  3NHX A;  2FGT A;  5KP1 A;  3DGN A;  1F8N A;  1NO3 A;  2KRT A;  2K54 A;  4ORL A;  5IG5 A;  3I55 3;  1Q40 B;  1PU4 A;  1RRH A;  1GY7 A;  2CWT A;  5IG3 A;  1IQ8 A;  2ML6 A;  1NDO B;  1OH0 A;  3SLU A;  1Z1S A;  1YIT 3;  2IUK A;  1O7W B;  1U8C B;  1R4C A;  1YJ9 3;  1WNH A;  5STD A;  3LTD A;  2WO0 A;  1OHS A;  4XB5 A;  2CKF B;  3V92 A;  3FG3 A;  3PS8 A;  4EBG A;  3PXM A;  4N6L A;  3X3Y A;  1MNL A;  3DUK A;  3STD A;  3NM7 A;  2PZV A;  3D9R A;  4MMY B;  4X2O A;  4AEQ A;  3O8Y A;  3OWY A;  4O2H A;  4HYZ A;  4O02 B;  3U1W A;  2YFJ B;  1M90 4;  1OAC A;  1KC8 4;  1OGX A;  3NBR A;  3CCE 3;  3NBB A;  1DVC A;  1DVD A;  4N6M A;  2GU1 A;  5G2G A;  3FCS B;  2CFW A;  2C11 A;  4R80 A;  3BNE A;  3EE1 A;  2W9P A;  5IEP A;  2O3O A;  4FMB A;  1OHP A;  3JUM A;  1EQK A;  2XFS A;  3LOY A;  2GU3 A;  3KFQ C;  3BNB A;  1STF I;  3G71 3;  3UNL A;  1OF5 A;  3DMC A;  3LZA A;  4FMD A;  4WYK A;  5DRV A;  2XGN A;  4WYK B;  3CNX A;  1VQN 3;  3LT9 A;  2GEX A;  3ROB A;  2HMO B;  4BTY A;  4I4K A;  3OWS A;  1OGZ A;  2SBL A;  3S27 A;  3IPT A;  1AR0 A;  2HMM B;  3K0Z A;  4XDW A;  1WMP A;  2HML B;  1NU3 A;  2XGL A;  4STD A;  2W04 A;  2P0M A;  3G16 A;  1N5P A;  1UUV B;  3LTC A;  1VQM 3;  1GYB A;  5DRE A;  3QK9 A;  4K1V A;  2W56 A;  3UJM A;  4NRE A;  1US1 A;  4OK0 A;  1QAK A;  2XH9 A;  3PCR A;  4N6O B;  4XBY A;  5AYR B;  4GB5 A;  4FR9 A;  2L4V A;  1IT7 A;  3FF2 A;  3FZW A;  4MJD A;  4FCJ A;  3WOF B;  4U13 A;  2JDI H;  2QEX 3;  3BB9 A;  4XM4 A;  3G6E 3;  3CCL 3;  4WFO A;  2CG1 A;  3S28 A;  3G8Z A;  1TFK A;  2CWV A;  3X3Z A;  4KFF A;  2P0X A;  5BVB A;  1FGM A;  1GY6 A;  5IF6 A;  2P05 A;  1LXE A;  1UUW B;  4HM8 B;  2QIY A;  2D1W A;  2P38 A;  4HM2 B;  1NJI 4;  2OOV C;  2YFL B;  3NQY A;  4OUQ A;  1Q81 4;  3LH4 A;  4CCV A;  1BUQ A;  1GD3 A;  1JV2 B;  5D82 A;  1E97 A;  1UI8 A;  3X41 A;  1Q86 4;  3SXX A;  1QVG 2;  1WMO A;  5LC6 A;  4XDV A;  3VSY A;  3NBJ A;  2IUJ A;  3JUN A;  1AVL A;  3MSO A;  3IJE B;  4FCM A;  3KSP A;  2W2C A;  2XF3 A;  3F40 A;  2KCD A;  3I0Y A;  1PFP A;  3DM8 A;  3KZT A;  3JVC A;  1IQX A;  2FNQ A;  2Z7A A;  3LTB A;  4HM4 B;  3FKA A;  4PEJ A;  2OTJ 3;  3FLJ A;  1IDP A;  5AEW B;  2MC8 A;  2ZL8 A;  4HM5 B;  4R4K A;  1IT8 A;  2M7O A;  4AKZ A;  1N5H A;  3B4P A;  3NX0 A;  3CPW 2;  4N6T A;  1U5O A;  3S67 A;  3GWR A;  3WA2 X;  1TP6 A;  3CNM A;  3QRD A;  3G0K A;  3TDG A;  5AEU B;  3V99 A;  4HM7 B;  3DY5 A;  2WOH A;  1ASK A;  4RBN A;  1DMM A;  1JKG B;  3B7C A;  3LT8 A;  4HM1 B;  1M9G A;  2OQE C;  3PCS A;  4ZM8 A;  1IK3 A;  2F99 A;  5CK6 A;  1ULI B;  3ER7 A;  5D83 A;  2R4I A;  3T8N A;  4WP5 A;  1O7H B;  4R9L A;  3MHE A;  1K8A 4;  1TIJ A;  1RN7 A;  3DXO A;  3H3H A;  2CC3 A;  2HMN B;  3WOD G;  4G1M B;  1A2V A;  4CDL A;  2BHM A;  1UI7 A;  1VQL 3;  1K73 4;  1C7H A;  3CMA 3;  1JNQ A;  3LML A;  2Z76 A;  1FGO A;  1Y4K A;  3A76 A;  3EHC A;  2YX9 A;  3J7Y d;  1YI2 3;  3EBT A;  5FW5 A;  2BNG A;  1A90 A;  3SOY A;  1D6U A;  2E2V A;  1O7P B;  1VZZ A;  4L7K A;  2CFL A;  1IV7 A;  3GRD A;  3EB8 A;  3B4O A;  3DGL A;  3Q2P A;  1SPU A;  3WMD A;  1W02 A;  1GS3 A;  3MG2 A;  2ZDJ A;  3GZB A;  4KZ1 A;  4BTX A;  1W2Z A;  1Q40 A;  3CCU 3;  3K7C A;  3K9M C;  1AV4 A;  3HIG A;  1JN5 A;  1HU9 A;  2INX A;  2CIU A;  2CFG A;  2CK3 H;  1E3R A;  1VQ5 3;  5EQL A;  5BXQ A;  3CU3 A;  3SOA A;  2FXT A;  1FGR A;  4KFD A;  5IG0 A;  5A0O B;  3X42 A;  2YFI B;  1G96 A;  4HZ9 B;  4N3V A;  3NXJ A;  3L0R A;  5JBS A;  2QA4 3;  1YJN 3;  1JJ2 2;  4R1K A;  5D81 A;  4MEI A;  1VQ7 3;  1ZX2 A;  3VGN A;  1YJW 3;  1OHO A;  1D6Y A;  3DGO A;  3B8L A;  1VQK 3;  3AMO A;  4EV5 A;  3CPO A;  3UL5 A;  5KP4 A;  3EBY A;  4OVM A;  2CFK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...