2OTL3

Girodazole bound to the large subunit of haloarcula marismortui
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
molecule tags Ribosome
total genus 16
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2otl300
2QA43 3CC23 1Q824 3CC73 3CCV3 1YIJ3 1Q864 1KQS2 1KC84 1VQ83 3OW22 1VQ93 1VQP3 1YJ93 1M904 3CCE3 3G713 3CD63 2OTL3 1VQ43 1QVF2 1VQ53 3G4S3 3CC43 1VQN3 3I553 1VQK3 1VQO3 1VQM3 2OTJ3 1M1K4 1JJ22 3CME3 1Q814 1QVG2 3CCM3 1YI23 1N8R4 1KD14 1K9M4 3CXC2 1S723 3G6E3 1YJW3 1VQ73 2QEX3 1YJN3 3CCU3 3CMA3 1YHQ3 3CCJ3 3CPW2 1W2B2 1K8A4 3CCR3 3CCQ3 3I563 1NJI4 1VQL3 3CCS3 1VQ63 1K734 3CCL3 1Q7Y4 1YIT3
chains in the Genus database with same CATH superfamily
2QA43 1R4YA 1UCJA 1RGKA 1UI7A 2RCDA 3IMAB 4PEJA 1JB5A 1LQGC 1B2ZA 2HMOB 4J9AA 2O9UX 4XDWA 3BU4A 1BSAA 3JUNA 3DMCA 3SLUA 1RN4A 1YJ93 2HMLB 4KT3B 3G713 3NUVA 3OWYA 3UJMA 2OTL3 2XR8B 1PYLA 3CC43 3TDGA 1E3RA 1IVUA 3FZWA 2BIRA 1UI8A 1Q814 1O7NB 2D1WA 2BMQB 1FGRA 3OX9A 4R1KA 1IQXA 2K0MA 1A90A 1JN5A 5HGRA 3I563 1GMRA 1GD4A 1JBRA 3EBYA 4HM6B 4BIRA 1LOYA 3CCS3 1VQQA 3NBBA 4EC6A 5CF1A 2LYXA 2W9PA 2RFRA 1BRKA 2OQEC 1JV2B 1RN7A 2W04A 4HOHA 4LZIA 3HI7A 2IUJA 2C10A 1UDII 1V58A 3WOEB 1M1XB 2F4YA 1RDSA 5LC6A 1K28A 1RN1A 4OK0A 5IG0A 2BO9B 3EB8A 4ILFA 1SIHA 4N3VA 1KWIA 2F5MA 1OUNA 2STDA 2W56A 3A5EA 3KN4A 1EA2A 3PYJA 1AQZA 1RTUA 2W56B 1YGWA 2O3OA 1OH0A 1WQLB 1HKXA 1MGWA 3KE7A 3SYUA 1HZ1A 2I9WA 4O2HA 1JZOA 1BIRA 3X3YA 1VQL3 1RNTA 4O8SA 1BANA 3EHCA 3ZG0A 6RNTA 2CFLA 1E97A 1RRLA 3GZBA 1YVSA 1TIJA 2ZL8A 3FG3A 3K0ZA 1OHPA 1W01A 3KZTA 4J8TA 1AV4A 2KCDA 2SARA 1GSPA 2XEPA 3KSED 5IW9A 1WMPA 4X2OA 1FYSA 1OF5A 5BVBA 4HBRA 1O7GB 1N8QA 1OF5B 1QVF2 2ZA4A 4HM5B 2UUGC 3EBTA 1BSBA 3FKAA 1RGHA 1X1WA 3X42A 1VZZA 3VF1A 3CME3 3PS8A 6STDA 4HJLB 4FR9A 3EX9A 4HM2B 4STDA 3CCM3 2CWUA 1YI23 1DETA 4HM7B 5LC7A 1B3SA 1DMQA 1JNQA 1I70A 1KD14 4MMYB 4JF8A 1YGEA 2K54A 1JBSA 1JKGB 5AI1A 1YHQ3 1BUJA 5JBSA 3D5IA 4BL2A 2AAEA 1BSCA 2CWTA 4RNYA 1BRGA 1B20A 1RGEA 2GEYA 4NREA 4EV5A 9RNTA 2KAAA 3JVCA 1JRQA 1OGXA 1FUWA 1EG9B 1BRJA 3E99A 1IVWA 7RNTA 3DXOA 3Q90A 3OW22 1FGQA 3B4PA 2ZDJA 3GRDA 3DGYA 3F14A 4LSOA 3LTAA 3OV4A 3K9MC 1ULJB 4LGQA 2GBXB 1NU3A 1ZX2A 1BNEA 2W03A 3DGOA 3NV0B 3UL6A 4I4KA 2R4IA 1BNRA 4FMCA 4CDLA 1JB4A 3V92A 1S723 1Z1SA 1O7WB 3GSPA 3X40A 2CH9A 3MPHA 3FLJA 1W6YA 3NX0A 5D83A 5DRVA 3WHOA 1LOXA 3WA2X 1BOXA 1B21A 1MWSA 2W6JH 2GU3A 1QAKA 3Q3FA 4XBTA 3UB1A 2R41A 1UUWB 2V1LA 3IJEB 4U13A 1STFI 4XB5A 1LXEA 1M9GA 1FUTA 1NWWA 3JUMA 2JDIH 5M18A 1IVVA 1ZO2A 1CYVA 1ZS7A 4HM0B 4K90B 1FZUA 4X2HA 1GOVA 4HM3B 3DGLA 3S29A 1VQO3 4KZ1A 1LRAA 1T2IA 1UCLA 2XFSA 2XSOB 2C11A 1W6CA 2W9QA 3OWSA 5KP1A 1JJ22 2UX0A 1Q9EA 2CK3H 1IVXA 2OOVA 1W6GA 3Q1CA 3KKGA 4CCVA 3N54B 5G2GA 1BSEA 1FA3A 1GYBA 1Q7HA 4HVNA 1MWUA 1B2XA 5CXOA 2WOFA 3EQQB 2HOHA 2BNGA 1W4NA 6GSPA 2MC8A 3GZRA 3UL5A 3JUQA 1M904 2PZVA 1EUIC 1OGZA 1CEWI 2P05A 3PXMA 3GAXA 5BIRA 1UCKA 1MGRA 3I553 2AADA 3LT9A 5FW5A 4EV2A 3B4OA 3HK4A 1IK3A 3AGOA 1B2SA 2E2UA 4GL6A 2B1XB 5D82A 3S27A 1SQWA 2XGNA 1W7CA 3F9SA 5DREA 4ZM8A 1AVKA 3QK9A 3CPW2 3BNCA 4GB5A 4K1VA 4WFOA 1CQSA 2OCTA 3ECFA 1BUQA 2M7OA 3T8UA 1CH0A 1K734 2H0HA 3LH4A 1BAOA 1B2MA 1BNGA 2YFIB 1NDOB 1RGCA 2OQEA 1LOWA 1I3IA 4JRFA 1RMSA 3FGYA 4FCJA 3MKIA 2K3DA 1LNHA 1AY7A 2IA7A 1TJDA 5KP3A 5IG5A 1DVDA 5AIHA 1QALA 3D9RA 3KSPA 4HZBB 3NQYA 1VQN3 3MYTA 3F8XA 3WDGB 2PNCA 4G1MB 1N8R4 1J2BA 5RNTA 1ASKA 2Q07A 3UNLA 3SXXA 4XM4A 2KXGA 1GY5A 1RGAA 1RHLA 5AEUB 2H0GA 3WMDA 4BTYA 2FGTA 5IF6A 1TU5A 4H3UA 1G02A 3EC9A 3HOHA 2IYJA 3EN8A 3LZAA 3NXJA 3SOYA 3A76A 3H51A 1Q824 1TFOA 2W0QA 2IUKA 3CCV3 1CYUA 1D6ZA 2BT3A 3AMOA 3AMOB 2CWVA 2P0XA 3FF0A 1GY7A 3GZYB 3N8BA 1V57A 3V98A 3SEDA 3V99A 1WMOA 1BGSA 2CG0A 3OWUA 4N6NB 4IIAA 1WTHA 1GD3A 1TP6A 2B24B 1Q42A 2BHMA 2OTJ3 1BRHA 7GSPA 5JPUA 1R4CA 8CHOA 5IG3A 1NB5I 3O8YA 3T8NA 2H0IA 5IERA 1VQ73 1ISKA 4BTWA 1JKGA 4HM1B 2CKFB 2BU4A 3PCRA 5G1LA 3LTCA 4LYLB 1AVLA 1JZDA 4XDVA 1I2GA 3B8LA 2HMNB 3MG2A 5HOHA 2F5WA 4FMBA 3PGBA 4GHOA 1PFPA 3MG1A 5CF2A 1RJOA 1YIT3 5CLKA 1HU9A 2F86B 1YIJ3 3FG1A 1DVCA 1IQ8A 4BTXA 1X1UA 4KFFA 5AIFA 3S67A 3MG3A 4AKYA 1VQ83 1W2ZA 4FCMA 3WODG 4NHFA 4AKZA 1FUSA 3CD63 1LNIA 2CFGA 1VQK3 3HZPA 1W02A 1RGLA 3ROBA 3NV0A 1OHSA 1TFKA 1QVG2 2GEXA 3BNDA 3KIIA 3H3HA 1TTOA 3WOFB 3U97A 3GZXB 3CCU3 2HMMB 5IG4A 4EBGA 2INXA 1S5AA 1OCVA 2FXTA 1UW1A 1K8A4 1D6YA 1RCKA 2KF6A 2CX1A 2Z7AA 2CW9A 3FCSB 1I2FA 5FGOA 1BRIA 1RGFA 1TRPA 2OWPA 2W2CA 3BNEA 3EJVA 5ELJA 3F7XA 4KFDA 1D6UA 1U5OA 1SARA 4TX4A 1PU4A 8RNTA 3CNXA 1HYFA 2F56A 3X3ZA 3PCSA 2XH9A 1B27A 4R4KA 1DMNA 2QIYA 3U1WA 2P0MA 3JUPA 3MSOA 5ELUA 1TUHA 4FMDA 5AEWB 3DGMA 1N9JA 3X3XA 4OUQA 2QEX3 1YJN3 1FGTA 2IMJA 1BNFA 1QAFA 2XRXB 3EE1A 4HAAA 5M1AA 3RGAA 2CFDA 3CMA3 2MF7A 3LOYA 3EF8A 3KCHA 1X1XA 3STDA 3DZLA 1MWRA 4RNTA 3J7Yd 1IU7A 4BL3A 1OACA 3HIGA 2QGUA 4RZMA 2E2VA 5AYSC 1LQMB 7STDA 4WHAA 4WYKA 2RBIA 1IDPA 3FG4A 1RGGA 1NO3A 4WYKB 3SX1A 2P09A 2RGQA 2KF3A 5CK6A 4QWTA 3RNTA 2ML5A 2Z76A 1JBTA 2ML6A 1I3FA 5IEOA 1RKYA 1M1K4 2GXFA 2WGQA 1BSDA 1IT7A 1E3VA 3B7CA 3FH1A 1K9M4 4N6OB 4N6MA 5AIGA 1B2UA 3JUOA 4FMAA 4K61A 1MOLA 2CHCA 3HX8A 4EW5A 1ROAA 3SVAA 1UCIA 1SPUA 3DM8A 3F7SA 4EYCA 4N6TA 1V74A 3LYGA 3QRDA 3N9HA 3CC73 1Q864 3SOAA 4HM8B 2F98A 5EQLA 3LMLA 1YVBI 3CNMA 4O3VA 4MJDA 1EQKA 3AHSA 3BB9A 2D42A 2RSXA 3I0YA 1VQ53 2Y73A 1UGIA 5AYRB 1BNJA 1FGMA 4HM4B 3NBJA 3NM2A 1EEJA 1L5GB 4DKIA 3LTBA 2YFJB 3CXC2 1NB3I 3MWZA 3K7CA 2F99A 1A2PA 3S5CA 5G1KA 1FW7A 1JN5B 2RNTA 1N5PA 4N6UA 3K63A 1RCLA 1GY6A 2C4BA 4R80A 4WWUC 4CJNA 1VQ63 2YX9A 5BXQA 3CCL3 5EEOA 3WR2A 3F8HA 3DY5A 4O02B 3CC23 1IQYA 1O7MB 1T2HA 4K1UA 2XGLA 4N6V0 2ZHXB 1FGOA 3AGNA 1BU4A 5AIIA 2CIUA 1OHOA 1MWTA 3D79A 5IENA 4L8OA 2LQVA 2Y74A 5A0OB 4FCZA 5KP4A 3M8CA 4J5KA 5GSPA 4MEIA 1GOYA 3BLZA 1DYUA 3LXUX 2JQ5A 4Q53A 5M19A 3DUKA 3EN1B 1GS3A 3S28A 1OPYA 4KVHA 1RLSA 3LT8A 1I2EA 4LEHA 2P38A 1W2B2 1QJGA 3CCR3 2BMRB 4I5QA 3DGNA 1PY3A 2CC3A 2BMOB 3BNBA 1UUGB 3WA3A 1G96A 1Q7Y4 2HMJB 4HZ9B 4XBXA 3K5TA 4OVMA 1STDA 2CX0A 3FF2A 2SBLA 5IEPA 4MMZB 3CPOA 1N9EA 1K41A 3NQZA 1I0XA 3DH2A 2GU1A 3KFQC 2YFLB 2UGIA 1GOUA 1U8CB 2Z77A 2KF5A 1IT8A 4R9KA 1EKMA 4IPBA 3ZG5A 1BRSA 4H61A 4EXRA 3F40A 3D3LA 1WMNA 3MHEA 1I8VA 1ZGXA 1ROVA 3FSDA 1C7HA 4WP5A 1ULIB 1DE3A 1LOVA 4LMIA 5TGNA 4AEQA 3BIRA 4CPKA 4XBYA 2HMKB 3ALAA 1KC84 1T3BA 3NBRA 1X1YA 4L8PA 1A67A 1YNVX 1AR0A 4RNZA 1BNIA 1O7HB 2CFKA 2KRTA 1VQP3 1C54A 3NHXA 3RDEA 3Q2PA 1VQ43 1QMAA 1TRQA 2XF3A 5EVHA 3VGNA 5JPPA 1UGHI 1MNLA 5STDA 2GBWB 1JB2A 2IY2A 2CFWA 1N5HA 3G6E3 1YJW3 1UUVB 4KFEA 3NM7A 4N6LA 3G0KA 3CCJ3 2KF4A 1NNVA 4MMXB 1W5ZA 2L1SA 3CCQ3 2A15A 3ER7A 4ORLA 3CU3A 2CG1A 1GMQA 1DMMA 1SJWA 1G0TA 5I97A 5BU4A 4L7KA 1Q40A 1KSIA 1A2KA 1IV9A 2FNQA 1RRHA 1Q40B 3T0UA 3ZFZA 1KQS2 4NPBA 1BRNL 1BVIA 1I0VA 1RSNA 1GMPA 3IPTA 1VQ93 3RGRA 1IYYA 2XFTA 1W00A 1RNBA 3G16A 3CCE3 3VSYA 3X41A 4GSPA 3G4S3 4R9LA 2E2TA 1VQM3 3LTDA 3HIIA 4RBNA 3OXAA 5D81A 1IV7A 1LVNA 3L0RA 2XSHB 3URPA 2WGOA 3PZWA 3G8ZA 1T5YA 1WNHA 2OOVC 4HKVB 1US1A 3GWRA 3D5GA 3D4AA 1BNSA 2WOHA 4BU4A 2GSPA 1SIIA 2L4VA 4HYZA 4J5GA 1NJI4 1F8NA 1Y4KA 2Z6BA 1A2VA 2WO0A 3AHWA 2J8XB 4IT7A 1O7PB
chains in the Genus database with same CATH topology
2QA43 4PEJA 1UI7A 2RCDA 3IMAB 5D83A 1JB5A 4J9AA 4XDWA 2HMOB 2O9UX 3JUNA 3DMCA 3SLUA 1YJ93 2HMLB 3G713 3NUVA 3OWYA 3UJMA 2OTL3 2XR8B 3CC43 3TDGA 1E3RA 1IVUA 3FZWA 1UI8A 1Q814 1O7NB 2D1WA 2BMQB 1FGRA 3OX9A 4R1KA 1IQXA 2K0MA 1A90A 1JN5A 5HGRA 3I563 1GD4A 3EBYA 4HM6B 3CCS3 3NBBA 4EC6A 5CF1A 2LYXA 2W9PA 2RFRA 2OQEC 1JV2B 1RN7A 2W04A 4LZIA 3HI7A 2IUJA 2C10A 3WOEB 1M1XB 5LC6A 1K28A 4OK0A 5IG0A 2BO9B 3EB8A 1SIHA 4N3VA 1KWIA 1OUNA 2STDA 2W56A 3KN4A 3PYJA 1EA2A 2W56B 2O3OA 1OH0A 1WQLB 1HKXA 3KE7A 2I9WA 4O2HA 3X3YA 1VQL3 4O8SA 3EHCA 2CFLA 1E97A 1RRLA 3GZBA 1TIJA 2ZL8A 3FG3A 3K0ZA 1OHPA 1W01A 3KZTA 4J8TA 1AV4A 2KCDA 2XEPA 3KSED 5IW9A 1WMPA 4X2OA 1OF5A 5BVBA 4HBRA 1O7GB 1N8QA 1OF5B 1QVF2 4HM5B 3EBTA 3FKAA 3X42A 1VZZA 3VF1A 3CME3 3PS8A 6STDA 4HJLB 4FR9A 3EX9A 4HM2B 4STDA 3CCM3 2CWUA 1YI23 1KD14 4HM7B 5LC7A 1DMQA 1JNQA 4MMYB 4JF8A 1YGEA 2K54A 1JKGB 5AI1A 1YHQ3 5JBSA 2CWTA 4RNYA 2GEYA 4NREA 4EV5A 3JVCA 1JRQA 1OGXA 1FUWA 1EG9B 3E99A 1IVWA 3DXOA 3Q90A 3OW22 1FGQA 3B4PA 2ZDJA 3GRDA 3F14A 4LSOA 3LTAA 3OV4A 3K9MC 1ULJB 4LGQA 2GBXB 1NU3A 1ZX2A 2W03A 3NV0B 3DGOA 3UL6A 4I4KA 2R4IA 4FMCA 4CDLA 1JB4A 3V92A 1S723 1Z1SA 1O7WB 3X40A 2CH9A 3MPHA 3FLJA 1W6YA 3NX0A 5DRVA 1LOXA 3WA2X 4XBTA 3UB1A 2W6JH 2GU3A 1QAKA 1UUWB 2V1LA 3IJEB 4U13A 1STFI 4XB5A 1LXEA 1M9GA 1NWWA 3JUMA 2JDIH 1IVVA 1ZO2A 1CYVA 4HM0B 4K90B 4X2HA 4HM3B 3DGLA 3S29A 1VQO3 4KZ1A 2XSOB 1JJ22 2XFSA 5KP1A 2C11A 1W6CA 2W9QA 3OWSA 2UX0A 2CK3H 1IVXA 2OOVA 1W6GA 3Q1CA 3KKGA 4CCVA 3N54B 5G2GA 1FA3A 1GYBA 4HVNA 5CXOA 2WOFA 3EQQB 2BNGA 1W4NA 2MC8A 3GZRA 3UL5A 3JUQA 1M904 2PZVA 1OGZA 1CEWI 2P05A 3PXMA 3GAXA 3I553 3LT9A 5FW5A 4EV2A 3B4OA 3HK4A 1IK3A 2E2UA 4GL6A 5D82A 2B1XB 3S27A 1SQWA 2XGNA 1W7CA 3F9SA 5DREA 4ZM8A 1AVKA 3QK9A 3CPW2 3BNCA 4GB5A 4K1VA 4WFOA 1CQSA 2OCTA 3ECFA 1BUQA 2M7OA 3T8UA 1K734 3LH4A 2YFIB 1NDOB 2OQEA 4JRFA 3FGYA 4FCJA 3MKIA 1LNHA 2IA7A 5IG5A 5KP3A 1DVDA 5AIHA 1QALA 3D9RA 3KSPA 4HZBB 3NQYA 1VQN3 3MYTA 3F8XA 3WDGB 2PNCA 4G1MB 1N8R4 1J2BA 1ASKA 2Q07A 3UNLA 3SXXA 4XM4A 2KXGA 1GY5A 5AEUB 3WMDA 4BTYA 5IF6A 2FGTA 1TU5A 4H3UA 3EC9A 3EN8A 3LZAA 3NXJA 3SOYA 3A76A 3H51A 1Q824 1TFOA 2W0QA 2IUKA 3CCV3 1CYUA 1D6ZA 2BT3A 3AMOA 3AMOB 2CWVA 2P0XA 3FF0A 1GY7A 3GZYB 3N8BA 3V98A 3SEDA 3V99A 1WMOA 3OWUA 2CG0A 4N6NB 4IIAA 1WTHA 1GD3A 1TP6A 2B24B 1Q42A 2BHMA 2OTJ3 5JPUA 1R4CA 8CHOA 5IG3A 1NB5I 3O8YA 3T8NA 5IERA 1VQ73 1ISKA 4BTWA 1JKGA 4HM1B 2CKFB 3PCRA 3LTCA 1AVLA 4XDVA 3B8LA 2HMNB 3MG2A 4FMBA 3PGBA 5CF2A 1PFPA 3MG1A 1YIT3 1RJOA 5CLKA 1HU9A 2F86B 1YIJ3 3FG1A 1DVCA 1IQ8A 4BTXA 3S67A 4KFFA 5AIFA 4AKYA 3MG3A 1VQ83 1W2ZA 4FCMA 3WODG 4NHFA 4AKZA 3CD63 2CFGA 1VQK3 3HZPA 1W02A 3ROBA 3NV0A 1OHSA 1TFKA 1QVG2 2GEXA 3BNDA 3KIIA 3H3HA 3WOFB 3U97A 3GZXB 3CCU3 2HMMB 5IG4A 4EBGA 2INXA 1S5AA 1OCVA 2FXTA 1UW1A 1K8A4 1D6YA 2Z7AA 2CW9A 3FCSB 5FGOA 2OWPA 3EJVA 2W2CA 3BNEA 5ELJA 3F7XA 4KFDA 1D6UA 1U5OA 4TX4A 1PU4A 3CNXA 3X3ZA 3PCSA 2XH9A 4R4KA 1DMNA 2QIYA 3U1WA 2P0MA 3JUPA 3MSOA 5ELUA 1TUHA 4FMDA 5AEWB 3DGMA 1N9JA 3X3XA 4OUQA 2QEX3 1YJN3 1FGTA 2IMJA 2XRXB 1QAFA 3EE1A 3RGAA 3CMA3 2CFDA 2MF7A 3LOYA 3EF8A 3STDA 3DZLA 3J7Yd 1IU7A 1OACA 3HIGA 2QGUA 4RZMA 2E2VA 5AYSC 7STDA 4WHAA 4WYKA 1IDPA 3FG4A 1NO3A 4WYKB 3SX1A 2P09A 2RGQA 5CK6A 4QWTA 2ML5A 2Z76A 2ML6A 5IEOA 1RKYA 1M1K4 2GXFA 2WGQA 1IT7A 1E3VA 3B7CA 3FH1A 1K9M4 4N6OB 4N6MA 5AIGA 3JUOA 4FMAA 4K61A 1MOLA 2CHCA 3HX8A 1ROAA 3SVAA 1SPUA 3DM8A 3F7SA 4EYCA 4N6TA 1V74A 3LYGA 3QRDA 3N9HA 3CC73 1Q864 3SOAA 4HM8B 2F98A 5EQLA 3LMLA 1YVBI 3CNMA 4O3VA 4MJDA 1EQKA 3BB9A 2D42A 2RSXA 3I0YA 1VQ53 2Y73A 5AYRB 1FGMA 4HM4B 3NBJA 3NM2A 1L5GB 3LTBA 2YFJB 3CXC2 1NB3I 3MWZA 3K7CA 2F99A 3S5CA 1JN5B 1N5PA 4N6UA 3K63A 1GY6A 4R80A 4WWUC 1VQ63 2YX9A 5BXQA 3CCL3 5EEOA 3F8HA 3DY5A 4O02B 3CC23 1IQYA 1O7MB 4K1UA 2XGLA 4N6V0 1FGOA 5AIIA 2CIUA 1OHOA 5IENA 4L8OA 2LQVA 2Y74A 5A0OB 4FCZA 5KP4A 3M8CA 4MEIA 3BLZA 1DYUA 3LXUX 2JQ5A 4Q53A 3DUKA 3EN1B 1GS3A 3S28A 1OPYA 4KVHA 3LT8A 4LEHA 2P38A 1W2B2 1QJGA 3CCR3 2BMRB 3DGNA 2CC3A 2BMOB 3BNBA 3WA3A 1Q7Y4 1G96A 2HMJB 4HZ9B 4XBXA 3K5TA 4OVMA 1STDA 3FF2A 2SBLA 5IEPA 4MMZB 3CPOA 1N9EA 1K41A 3NQZA 2GU1A 3KFQC 2YFLB 1U8CB 2Z77A 1IT8A 4R9KA 1EKMA 4IPBA 4EXRA 4H61A 3F40A 3D3LA 1WMNA 3MHEA 1ROVA 3FSDA 1C7HA 4WP5A 1ULIB 4LMIA 5TGNA 4AEQA 4XBYA 2HMKB 3ALAA 1KC84 3NBRA 4L8PA 1A67A 1AR0A 4RNZA 1VQP3 1O7HB 2CFKA 2KRTA 3NHXA 3RDEA 3Q2PA 1VQ43 1QMAA 5EVHA 2XF3A 3VGNA 5JPPA 1MNLA 5STDA 2GBWB 1JB2A 2CFWA 1N5HA 3G6E3 1YJW3 1UUVB 4KFEA 3NM7A 4N6LA 3G0KA 3CCJ3 4MMXB 1W5ZA 3CCQ3 2A15A 3ER7A 4ORLA 3CU3A 2CG1A 1DMMA 1SJWA 5I97A 4L7KA 1Q40A 1KSIA 1A2KA 1IV9A 2FNQA 1RRHA 1Q40B 3T0UA 1KQS2 3IPTA 1VQ93 3RGRA 2XFTA 1W00A 3G16A 3CCE3 3VSYA 3X41A 3G4S3 4R9LA 2E2TA 1VQM3 3LTDA 3HIIA 4RBNA 3OXAA 5D81A 1IV7A 1LVNA 3L0RA 2XSHB 2WGOA 3PZWA 3G8ZA 1T5YA 1WNHA 2OOVC 4HKVB 1US1A 3GWRA 2WOHA 1SIIA 2L4VA 4HYZA 1NJI4 1F8NA 1Y4KA 2Z6BA 1A2VA 2WO0A 4IT7A 1O7PB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QA4 3;  3CC2 3;  1Q82 4;  3CC7 3;  3CCV 3;  1YIJ 3;  1Q86 4;  1KQS 2;  1KC8 4;  1VQ8 3;  3OW2 2;  1VQ9 3;  1VQP 3;  1YJ9 3;  1M90 4;  3CCE 3;  3G71 3;  3CD6 3;  2OTL 3;  1VQ4 3;  1QVF 2;  1VQ5 3;  3G4S 3;  3CC4 3;  1VQN 3;  3I55 3;  1VQK 3;  1VQO 3;  1VQM 3;  2OTJ 3;  1M1K 4;  1JJ2 2;  3CME 3;  1Q81 4;  1QVG 2;  3CCM 3;  1YI2 3;  1N8R 4;  1KD1 4;  1K9M 4;  3CXC 2;  1S72 3;  3G6E 3;  1YJW 3;  1VQ7 3;  2QEX 3;  1YJN 3;  3CCU 3;  3CMA 3;  1YHQ 3;  3CCJ 3;  3CPW 2;  1W2B 2;  1K8A 4;  3CCR 3;  3CCQ 3;  3I56 3;  1NJI 4;  1VQL 3;  3CCS 3;  1VQ6 3;  1K73 4;  3CCL 3;  1Q7Y 4;  1YIT 3; 
#chains in the Genus database with same CATH topology
 2QA4 3;  1R4Y A;  1UCJ A;  1RGK A;  1UI7 A;  2RCD A;  3IMA B;  4PEJ A;  1JB5 A;  1LQG C;  1B2Z A;  2HMO B;  4J9A A;  2O9U X;  4XDW A;  3BU4 A;  1BSA A;  3JUN A;  3DMC A;  3SLU A;  1RN4 A;  1YJ9 3;  2HML B;  4KT3 B;  3G71 3;  3NUV A;  3OWY A;  3UJM A;  2OTL 3;  2XR8 B;  1PYL A;  3CC4 3;  3TDG A;  1E3R A;  1IVU A;  3FZW A;  2BIR A;  1UI8 A;  1Q81 4;  1O7N B;  2D1W A;  2BMQ B;  1FGR A;  3OX9 A;  4R1K A;  1IQX A;  2K0M A;  1A90 A;  1JN5 A;  5HGR A;  3I56 3;  1GMR A;  1GD4 A;  1JBR A;  3EBY A;  4HM6 B;  4BIR A;  1LOY A;  3CCS 3;  1VQQ A;  3NBB A;  4EC6 A;  5CF1 A;  2LYX A;  2W9P A;  2RFR A;  1BRK A;  2OQE C;  1JV2 B;  1RN7 A;  2W04 A;  4HOH A;  4LZI A;  3HI7 A;  2IUJ A;  2C10 A;  1UDI I;  1V58 A;  3WOE B;  1M1X B;  2F4Y A;  1RDS A;  5LC6 A;  1K28 A;  1RN1 A;  4OK0 A;  5IG0 A;  2BO9 B;  3EB8 A;  4ILF A;  1SIH A;  4N3V A;  1KWI A;  2F5M A;  1OUN A;  2STD A;  2W56 A;  3A5E A;  3KN4 A;  1EA2 A;  3PYJ A;  1AQZ A;  1RTU A;  2W56 B;  1YGW A;  2O3O A;  1OH0 A;  1WQL B;  1HKX A;  1MGW A;  3KE7 A;  3SYU A;  1HZ1 A;  2I9W A;  4O2H A;  1JZO A;  1BIR A;  3X3Y A;  1VQL 3;  1RNT A;  4O8S A;  1BAN A;  3EHC A;  3ZG0 A;  6RNT A;  2CFL A;  1E97 A;  1RRL A;  3GZB A;  1YVS A;  1TIJ A;  2ZL8 A;  3FG3 A;  3K0Z A;  1OHP A;  1W01 A;  3KZT A;  4J8T A;  1AV4 A;  2KCD A;  2SAR A;  1GSP A;  2XEP A;  3KSE D;  5IW9 A;  1WMP A;  4X2O A;  1FYS A;  1OF5 A;  5BVB A;  4HBR A;  1O7G B;  1N8Q A;  1OF5 B;  1QVF 2;  2ZA4 A;  4HM5 B;  2UUG C;  3EBT A;  1BSB A;  3FKA A;  1RGH A;  1X1W A;  3X42 A;  1VZZ A;  3VF1 A;  3CME 3;  3PS8 A;  6STD A;  4HJL B;  4FR9 A;  3EX9 A;  4HM2 B;  4STD A;  3CCM 3;  2CWU A;  1YI2 3;  1DET A;  4HM7 B;  5LC7 A;  1B3S A;  1DMQ A;  1JNQ A;  1I70 A;  1KD1 4;  4MMY B;  4JF8 A;  1YGE A;  2K54 A;  1JBS A;  1JKG B;  5AI1 A;  1YHQ 3;  1BUJ A;  5JBS A;  3D5I A;  4BL2 A;  2AAE A;  1BSC A;  2CWT A;  4RNY A;  1BRG A;  1B20 A;  1RGE A;  2GEY A;  4NRE A;  4EV5 A;  9RNT A;  2KAA A;  3JVC A;  1JRQ A;  1OGX A;  1FUW A;  1EG9 B;  1BRJ A;  3E99 A;  1IVW A;  7RNT A;  3DXO A;  3Q90 A;  3OW2 2;  1FGQ A;  3B4P A;  2ZDJ A;  3GRD A;  3DGY A;  3F14 A;  4LSO A;  3LTA A;  3OV4 A;  3K9M C;  1ULJ B;  4LGQ A;  2GBX B;  1NU3 A;  1ZX2 A;  1BNE A;  2W03 A;  3DGO A;  3NV0 B;  3UL6 A;  4I4K A;  2R4I A;  1BNR A;  4FMC A;  4CDL A;  1JB4 A;  3V92 A;  1S72 3;  1Z1S A;  1O7W B;  3GSP A;  3X40 A;  2CH9 A;  3MPH A;  3FLJ A;  1W6Y A;  3NX0 A;  5D83 A;  5DRV A;  3WHO A;  1LOX A;  3WA2 X;  1BOX A;  1B21 A;  1MWS A;  2W6J H;  2GU3 A;  1QAK A;  3Q3F A;  4XBT A;  3UB1 A;  2R41 A;  1UUW B;  2V1L A;  3IJE B;  4U13 A;  1STF I;  4XB5 A;  1LXE A;  1M9G A;  1FUT A;  1NWW A;  3JUM A;  2JDI H;  5M18 A;  1IVV A;  1ZO2 A;  1CYV A;  1ZS7 A;  4HM0 B;  4K90 B;  1FZU A;  4X2H A;  1GOV A;  4HM3 B;  3DGL A;  3S29 A;  1VQO 3;  4KZ1 A;  1LRA A;  1T2I A;  1UCL A;  2XFS A;  2XSO B;  2C11 A;  1W6C A;  2W9Q A;  3OWS A;  5KP1 A;  1JJ2 2;  2UX0 A;  1Q9E A;  2CK3 H;  1IVX A;  2OOV A;  1W6G A;  3Q1C A;  3KKG A;  4CCV A;  3N54 B;  5G2G A;  1BSE A;  1FA3 A;  1GYB A;  1Q7H A;  4HVN A;  1MWU A;  1B2X A;  5CXO A;  2WOF A;  3EQQ B;  2HOH A;  2BNG A;  1W4N A;  6GSP A;  2MC8 A;  3GZR A;  3UL5 A;  3JUQ A;  1M90 4;  2PZV A;  1EUI C;  1OGZ A;  1CEW I;  2P05 A;  3PXM A;  3GAX A;  5BIR A;  1UCK A;  1MGR A;  3I55 3;  2AAD A;  3LT9 A;  5FW5 A;  4EV2 A;  3B4O A;  3HK4 A;  1IK3 A;  3AGO A;  1B2S A;  2E2U A;  4GL6 A;  2B1X B;  5D82 A;  3S27 A;  1SQW A;  2XGN A;  1W7C A;  3F9S A;  5DRE A;  4ZM8 A;  1AVK A;  3QK9 A;  3CPW 2;  3BNC A;  4GB5 A;  4K1V A;  4WFO A;  1CQS A;  2OCT A;  3ECF A;  1BUQ A;  2M7O A;  3T8U A;  1CH0 A;  1K73 4;  2H0H A;  3LH4 A;  1BAO A;  1B2M A;  1BNG A;  2YFI B;  1NDO B;  1RGC A;  2OQE A;  1LOW A;  1I3I A;  4JRF A;  1RMS A;  3FGY A;  4FCJ A;  3MKI A;  2K3D A;  1LNH A;  1AY7 A;  2IA7 A;  1TJD A;  5KP3 A;  5IG5 A;  1DVD A;  5AIH A;  1QAL A;  3D9R A;  3KSP A;  4HZB B;  3NQY A;  1VQN 3;  3MYT A;  3F8X A;  3WDG B;  2PNC A;  4G1M B;  1N8R 4;  1J2B A;  5RNT A;  1ASK A;  2Q07 A;  3UNL A;  3SXX A;  4XM4 A;  2KXG A;  1GY5 A;  1RGA A;  1RHL A;  5AEU B;  2H0G A;  3WMD A;  4BTY A;  2FGT A;  5IF6 A;  1TU5 A;  4H3U A;  1G02 A;  3EC9 A;  3HOH A;  2IYJ A;  3EN8 A;  3LZA A;  3NXJ A;  3SOY A;  3A76 A;  3H51 A;  1Q82 4;  1TFO A;  2W0Q A;  2IUK A;  3CCV 3;  1CYU A;  1D6Z A;  2BT3 A;  3AMO A;  3AMO B;  2CWV A;  2P0X A;  3FF0 A;  1GY7 A;  3GZY B;  3N8B A;  1V57 A;  3V98 A;  3SED A;  3V99 A;  1WMO A;  1BGS A;  2CG0 A;  3OWU A;  4N6N B;  4IIA A;  1WTH A;  1GD3 A;  1TP6 A;  2B24 B;  1Q42 A;  2BHM A;  2OTJ 3;  1BRH A;  7GSP A;  5JPU A;  1R4C A;  8CHO A;  5IG3 A;  1NB5 I;  3O8Y A;  3T8N A;  2H0I A;  5IER A;  1VQ7 3;  1ISK A;  4BTW A;  1JKG A;  4HM1 B;  2CKF B;  2BU4 A;  3PCR A;  5G1L A;  3LTC A;  4LYL B;  1AVL A;  1JZD A;  4XDV A;  1I2G A;  3B8L A;  2HMN B;  3MG2 A;  5HOH A;  2F5W A;  4FMB A;  3PGB A;  4GHO A;  1PFP A;  3MG1 A;  5CF2 A;  1RJO A;  1YIT 3;  5CLK A;  1HU9 A;  2F86 B;  1YIJ 3;  3FG1 A;  1DVC A;  1IQ8 A;  4BTX A;  1X1U A;  4KFF A;  5AIF A;  3S67 A;  3MG3 A;  4AKY A;  1VQ8 3;  1W2Z A;  4FCM A;  3WOD G;  4NHF A;  4AKZ A;  1FUS A;  3CD6 3;  1LNI A;  2CFG A;  1VQK 3;  3HZP A;  1W02 A;  1RGL A;  3ROB A;  3NV0 A;  1OHS A;  1TFK A;  1QVG 2;  2GEX A;  3BND A;  3KII A;  3H3H A;  1TTO A;  3WOF B;  3U97 A;  3GZX B;  3CCU 3;  2HMM B;  5IG4 A;  4EBG A;  2INX A;  1S5A A;  1OCV A;  2FXT A;  1UW1 A;  1K8A 4;  1D6Y A;  1RCK A;  2KF6 A;  2CX1 A;  2Z7A A;  2CW9 A;  3FCS B;  1I2F A;  5FGO A;  1BRI A;  1RGF A;  1TRP A;  2OWP A;  2W2C A;  3BNE A;  3EJV A;  5ELJ A;  3F7X A;  4KFD A;  1D6U A;  1U5O A;  1SAR A;  4TX4 A;  1PU4 A;  8RNT A;  3CNX A;  1HYF A;  2F56 A;  3X3Z A;  3PCS A;  2XH9 A;  1B27 A;  4R4K A;  1DMN A;  2QIY A;  3U1W A;  2P0M A;  3JUP A;  3MSO A;  5ELU A;  1TUH A;  4FMD A;  5AEW B;  3DGM A;  1N9J A;  3X3X A;  4OUQ A;  2QEX 3;  1YJN 3;  1FGT A;  2IMJ A;  1BNF A;  1QAF A;  2XRX B;  3EE1 A;  4HAA A;  5M1A A;  3RGA A;  2CFD A;  3CMA 3;  2MF7 A;  3LOY A;  3EF8 A;  3KCH A;  1X1X A;  3STD A;  3DZL A;  1MWR A;  4RNT A;  3J7Y d;  1IU7 A;  4BL3 A;  1OAC A;  3HIG A;  2QGU A;  4RZM A;  2E2V A;  5AYS C;  1LQM B;  7STD A;  4WHA A;  4WYK A;  2RBI A;  1IDP A;  3FG4 A;  1RGG A;  1NO3 A;  4WYK B;  3SX1 A;  2P09 A;  2RGQ A;  2KF3 A;  5CK6 A;  4QWT A;  3RNT A;  2ML5 A;  2Z76 A;  1JBT A;  2ML6 A;  1I3F A;  5IEO A;  1RKY A;  1M1K 4;  2GXF A;  2WGQ A;  1BSD A;  1IT7 A;  1E3V A;  3B7C A;  3FH1 A;  1K9M 4;  4N6O B;  4N6M A;  5AIG A;  1B2U A;  3JUO A;  4FMA A;  4K61 A;  1MOL A;  2CHC A;  3HX8 A;  4EW5 A;  1ROA A;  3SVA A;  1UCI A;  1SPU A;  3DM8 A;  3F7S A;  4EYC A;  4N6T A;  1V74 A;  3LYG A;  3QRD A;  3N9H A;  3CC7 3;  1Q86 4;  3SOA A;  4HM8 B;  2F98 A;  5EQL A;  3LML A;  1YVB I;  3CNM A;  4O3V A;  4MJD A;  1EQK A;  3AHS A;  3BB9 A;  2D42 A;  2RSX A;  3I0Y A;  1VQ5 3;  2Y73 A;  1UGI A;  5AYR B;  1BNJ A;  1FGM A;  4HM4 B;  3NBJ A;  3NM2 A;  1EEJ A;  1L5G B;  4DKI A;  3LTB A;  2YFJ B;  3CXC 2;  1NB3 I;  3MWZ A;  3K7C A;  2F99 A;  1A2P A;  3S5C A;  5G1K A;  1FW7 A;  1JN5 B;  2RNT A;  1N5P A;  4N6U A;  3K63 A;  1RCL A;  1GY6 A;  2C4B A;  4R80 A;  4WWU C;  4CJN A;  1VQ6 3;  2YX9 A;  5BXQ A;  3CCL 3;  5EEO A;  3WR2 A;  3F8H A;  3DY5 A;  4O02 B;  3CC2 3;  1IQY A;  1O7M B;  1T2H A;  4K1U A;  2XGL A;  4N6V 0;  2ZHX B;  1FGO A;  3AGN A;  1BU4 A;  5AII A;  2CIU A;  1OHO A;  1MWT A;  3D79 A;  5IEN A;  4L8O A;  2LQV A;  2Y74 A;  5A0O B;  4FCZ A;  5KP4 A;  3M8C A;  4J5K A;  5GSP A;  4MEI A;  1GOY A;  3BLZ A;  1DYU A;  3LXU X;  2JQ5 A;  4Q53 A;  5M19 A;  3DUK A;  3EN1 B;  1GS3 A;  3S28 A;  1OPY A;  4KVH A;  1RLS A;  3LT8 A;  1I2E A;  4LEH A;  2P38 A;  1W2B 2;  1QJG A;  3CCR 3;  2BMR B;  4I5Q A;  3DGN A;  1PY3 A;  2CC3 A;  2BMO B;  3BNB A;  1UUG B;  3WA3 A;  1G96 A;  1Q7Y 4;  2HMJ B;  4HZ9 B;  4XBX A;  3K5T A;  4OVM A;  1STD A;  2CX0 A;  3FF2 A;  2SBL A;  5IEP A;  4MMZ B;  3CPO A;  1N9E A;  1K41 A;  3NQZ A;  1I0X A;  3DH2 A;  2GU1 A;  3KFQ C;  2YFL B;  2UGI A;  1GOU A;  1U8C B;  2Z77 A;  2KF5 A;  1IT8 A;  4R9K A;  1EKM A;  4IPB A;  3ZG5 A;  1BRS A;  4H61 A;  4EXR A;  3F40 A;  3D3L A;  1WMN A;  3MHE A;  1I8V A;  1ZGX A;  1ROV A;  3FSD A;  1C7H A;  4WP5 A;  1ULI B;  1DE3 A;  1LOV A;  4LMI A;  5TGN A;  4AEQ A;  3BIR A;  4CPK A;  4XBY A;  2HMK B;  3ALA A;  1KC8 4;  1T3B A;  3NBR A;  1X1Y A;  4L8P A;  1A67 A;  1YNV X;  1AR0 A;  4RNZ A;  1BNI A;  1O7H B;  2CFK A;  2KRT A;  1VQP 3;  1C54 A;  3NHX A;  3RDE A;  3Q2P A;  1VQ4 3;  1QMA A;  1TRQ A;  2XF3 A;  5EVH A;  3VGN A;  5JPP A;  1UGH I;  1MNL A;  5STD A;  2GBW B;  1JB2 A;  2IY2 A;  2CFW A;  1N5H A;  3G6E 3;  1YJW 3;  1UUV B;  4KFE A;  3NM7 A;  4N6L A;  3G0K A;  3CCJ 3;  2KF4 A;  1NNV A;  4MMX B;  1W5Z A;  2L1S A;  3CCQ 3;  2A15 A;  3ER7 A;  4ORL A;  3CU3 A;  2CG1 A;  1GMQ A;  1DMM A;  1SJW A;  1G0T A;  5I97 A;  5BU4 A;  4L7K A;  1Q40 A;  1KSI A;  1A2K A;  1IV9 A;  2FNQ A;  1RRH A;  1Q40 B;  3T0U A;  3ZFZ A;  1KQS 2;  4NPB A;  1BRN L;  1BVI A;  1I0V A;  1RSN A;  1GMP A;  3IPT A;  1VQ9 3;  3RGR A;  1IYY A;  2XFT A;  1W00 A;  1RNB A;  3G16 A;  3CCE 3;  3VSY A;  3X41 A;  4GSP A;  3G4S 3;  4R9L A;  2E2T A;  1VQM 3;  3LTD A;  3HII A;  4RBN A;  3OXA A;  5D81 A;  1IV7 A;  1LVN A;  3L0R A;  2XSH B;  3URP A;  2WGO A;  3PZW A;  3G8Z A;  1T5Y A;  1WNH A;  2OOV C;  4HKV B;  1US1 A;  3GWR A;  3D5G A;  3D4A A;  1BNS A;  2WOH A;  4BU4 A;  2GSP A;  1SII A;  2L4V A;  4HYZ A;  4J5G A;  1NJI 4;  1F8N A;  1Y4K A;  2Z6B A;  1A2V A;  2WO0 A;  3AHW A;  2J8X B;  4IT7 A;  1O7P B; 
#chains in the Genus database with same CATH homology
 2QA4 3;  4PEJ A;  1UI7 A;  2RCD A;  3IMA B;  5D83 A;  1JB5 A;  4J9A A;  4XDW A;  2HMO B;  2O9U X;  3JUN A;  3DMC A;  3SLU A;  1YJ9 3;  2HML B;  3G71 3;  3NUV A;  3OWY A;  3UJM A;  2OTL 3;  2XR8 B;  3CC4 3;  3TDG A;  1E3R A;  1IVU A;  3FZW A;  1UI8 A;  1Q81 4;  1O7N B;  2D1W A;  2BMQ B;  1FGR A;  3OX9 A;  4R1K A;  1IQX A;  2K0M A;  1A90 A;  1JN5 A;  5HGR A;  3I56 3;  1GD4 A;  3EBY A;  4HM6 B;  3CCS 3;  3NBB A;  4EC6 A;  5CF1 A;  2LYX A;  2W9P A;  2RFR A;  2OQE C;  1JV2 B;  1RN7 A;  2W04 A;  4LZI A;  3HI7 A;  2IUJ A;  2C10 A;  3WOE B;  1M1X B;  5LC6 A;  1K28 A;  4OK0 A;  5IG0 A;  2BO9 B;  3EB8 A;  1SIH A;  4N3V A;  1KWI A;  1OUN A;  2STD A;  2W56 A;  3KN4 A;  3PYJ A;  1EA2 A;  2W56 B;  2O3O A;  1OH0 A;  1WQL B;  1HKX A;  3KE7 A;  2I9W A;  4O2H A;  3X3Y A;  1VQL 3;  4O8S A;  3EHC A;  2CFL A;  1E97 A;  1RRL A;  3GZB A;  1TIJ A;  2ZL8 A;  3FG3 A;  3K0Z A;  1OHP A;  1W01 A;  3KZT A;  4J8T A;  1AV4 A;  2KCD A;  2XEP A;  3KSE D;  5IW9 A;  1WMP A;  4X2O A;  1OF5 A;  5BVB A;  4HBR A;  1O7G B;  1N8Q A;  1OF5 B;  1QVF 2;  4HM5 B;  3EBT A;  3FKA A;  3X42 A;  1VZZ A;  3VF1 A;  3CME 3;  3PS8 A;  6STD A;  4HJL B;  4FR9 A;  3EX9 A;  4HM2 B;  4STD A;  3CCM 3;  2CWU A;  1YI2 3;  1KD1 4;  4HM7 B;  5LC7 A;  1DMQ A;  1JNQ A;  4MMY B;  4JF8 A;  1YGE A;  2K54 A;  1JKG B;  5AI1 A;  1YHQ 3;  5JBS A;  2CWT A;  4RNY A;  2GEY A;  4NRE A;  4EV5 A;  3JVC A;  1JRQ A;  1OGX A;  1FUW A;  1EG9 B;  3E99 A;  1IVW A;  3DXO A;  3Q90 A;  3OW2 2;  1FGQ A;  3B4P A;  2ZDJ A;  3GRD A;  3F14 A;  4LSO A;  3LTA A;  3OV4 A;  3K9M C;  1ULJ B;  4LGQ A;  2GBX B;  1NU3 A;  1ZX2 A;  2W03 A;  3NV0 B;  3DGO A;  3UL6 A;  4I4K A;  2R4I A;  4FMC A;  4CDL A;  1JB4 A;  3V92 A;  1S72 3;  1Z1S A;  1O7W B;  3X40 A;  2CH9 A;  3MPH A;  3FLJ A;  1W6Y A;  3NX0 A;  5DRV A;  1LOX A;  3WA2 X;  4XBT A;  3UB1 A;  2W6J H;  2GU3 A;  1QAK A;  1UUW B;  2V1L A;  3IJE B;  4U13 A;  1STF I;  4XB5 A;  1LXE A;  1M9G A;  1NWW A;  3JUM A;  2JDI H;  1IVV A;  1ZO2 A;  1CYV A;  4HM0 B;  4K90 B;  4X2H A;  4HM3 B;  3DGL A;  3S29 A;  1VQO 3;  4KZ1 A;  2XSO B;  1JJ2 2;  2XFS A;  5KP1 A;  2C11 A;  1W6C A;  2W9Q A;  3OWS A;  2UX0 A;  2CK3 H;  1IVX A;  2OOV A;  1W6G A;  3Q1C A;  3KKG A;  4CCV A;  3N54 B;  5G2G A;  1FA3 A;  1GYB A;  4HVN A;  5CXO A;  2WOF A;  3EQQ B;  2BNG A;  1W4N A;  2MC8 A;  3GZR A;  3UL5 A;  3JUQ A;  1M90 4;  2PZV A;  1OGZ A;  1CEW I;  2P05 A;  3PXM A;  3GAX A;  3I55 3;  3LT9 A;  5FW5 A;  4EV2 A;  3B4O A;  3HK4 A;  1IK3 A;  2E2U A;  4GL6 A;  5D82 A;  2B1X B;  3S27 A;  1SQW A;  2XGN A;  1W7C A;  3F9S A;  5DRE A;  4ZM8 A;  1AVK A;  3QK9 A;  3CPW 2;  3BNC A;  4GB5 A;  4K1V A;  4WFO A;  1CQS A;  2OCT A;  3ECF A;  1BUQ A;  2M7O A;  3T8U A;  1K73 4;  3LH4 A;  2YFI B;  1NDO B;  2OQE A;  4JRF A;  3FGY A;  4FCJ A;  3MKI A;  1LNH A;  2IA7 A;  5IG5 A;  5KP3 A;  1DVD A;  5AIH A;  1QAL A;  3D9R A;  3KSP A;  4HZB B;  3NQY A;  1VQN 3;  3MYT A;  3F8X A;  3WDG B;  2PNC A;  4G1M B;  1N8R 4;  1J2B A;  1ASK A;  2Q07 A;  3UNL A;  3SXX A;  4XM4 A;  2KXG A;  1GY5 A;  5AEU B;  3WMD A;  4BTY A;  5IF6 A;  2FGT A;  1TU5 A;  4H3U A;  3EC9 A;  3EN8 A;  3LZA A;  3NXJ A;  3SOY A;  3A76 A;  3H51 A;  1Q82 4;  1TFO A;  2W0Q A;  2IUK A;  3CCV 3;  1CYU A;  1D6Z A;  2BT3 A;  3AMO A;  3AMO B;  2CWV A;  2P0X A;  3FF0 A;  1GY7 A;  3GZY B;  3N8B A;  3V98 A;  3SED A;  3V99 A;  1WMO A;  3OWU A;  2CG0 A;  4N6N B;  4IIA A;  1WTH A;  1GD3 A;  1TP6 A;  2B24 B;  1Q42 A;  2BHM A;  2OTJ 3;  5JPU A;  1R4C A;  8CHO A;  5IG3 A;  1NB5 I;  3O8Y A;  3T8N A;  5IER A;  1VQ7 3;  1ISK A;  4BTW A;  1JKG A;  4HM1 B;  2CKF B;  3PCR A;  3LTC A;  1AVL A;  4XDV A;  3B8L A;  2HMN B;  3MG2 A;  4FMB A;  3PGB A;  5CF2 A;  1PFP A;  3MG1 A;  1YIT 3;  1RJO A;  5CLK A;  1HU9 A;  2F86 B;  1YIJ 3;  3FG1 A;  1DVC A;  1IQ8 A;  4BTX A;  3S67 A;  4KFF A;  5AIF A;  4AKY A;  3MG3 A;  1VQ8 3;  1W2Z A;  4FCM A;  3WOD G;  4NHF A;  4AKZ A;  3CD6 3;  2CFG A;  1VQK 3;  3HZP A;  1W02 A;  3ROB A;  3NV0 A;  1OHS A;  1TFK A;  1QVG 2;  2GEX A;  3BND A;  3KII A;  3H3H A;  3WOF B;  3U97 A;  3GZX B;  3CCU 3;  2HMM B;  5IG4 A;  4EBG A;  2INX A;  1S5A A;  1OCV A;  2FXT A;  1UW1 A;  1K8A 4;  1D6Y A;  2Z7A A;  2CW9 A;  3FCS B;  5FGO A;  2OWP A;  3EJV A;  2W2C A;  3BNE A;  5ELJ A;  3F7X A;  4KFD A;  1D6U A;  1U5O A;  4TX4 A;  1PU4 A;  3CNX A;  3X3Z A;  3PCS A;  2XH9 A;  4R4K A;  1DMN A;  2QIY A;  3U1W A;  2P0M A;  3JUP A;  3MSO A;  5ELU A;  1TUH A;  4FMD A;  5AEW B;  3DGM A;  1N9J A;  3X3X A;  4OUQ A;  2QEX 3;  1YJN 3;  1FGT A;  2IMJ A;  2XRX B;  1QAF A;  3EE1 A;  3RGA A;  3CMA 3;  2CFD A;  2MF7 A;  3LOY A;  3EF8 A;  3STD A;  3DZL A;  3J7Y d;  1IU7 A;  1OAC A;  3HIG A;  2QGU A;  4RZM A;  2E2V A;  5AYS C;  7STD A;  4WHA A;  4WYK A;  1IDP A;  3FG4 A;  1NO3 A;  4WYK B;  3SX1 A;  2P09 A;  2RGQ A;  5CK6 A;  4QWT A;  2ML5 A;  2Z76 A;  2ML6 A;  5IEO A;  1RKY A;  1M1K 4;  2GXF A;  2WGQ A;  1IT7 A;  1E3V A;  3B7C A;  3FH1 A;  1K9M 4;  4N6O B;  4N6M A;  5AIG A;  3JUO A;  4FMA A;  4K61 A;  1MOL A;  2CHC A;  3HX8 A;  1ROA A;  3SVA A;  1SPU A;  3DM8 A;  3F7S A;  4EYC A;  4N6T A;  1V74 A;  3LYG A;  3QRD A;  3N9H A;  3CC7 3;  1Q86 4;  3SOA A;  4HM8 B;  2F98 A;  5EQL A;  3LML A;  1YVB I;  3CNM A;  4O3V A;  4MJD A;  1EQK A;  3BB9 A;  2D42 A;  2RSX A;  3I0Y A;  1VQ5 3;  2Y73 A;  5AYR B;  1FGM A;  4HM4 B;  3NBJ A;  3NM2 A;  1L5G B;  3LTB A;  2YFJ B;  3CXC 2;  1NB3 I;  3MWZ A;  3K7C A;  2F99 A;  3S5C A;  1JN5 B;  1N5P A;  4N6U A;  3K63 A;  1GY6 A;  4R80 A;  4WWU C;  1VQ6 3;  2YX9 A;  5BXQ A;  3CCL 3;  5EEO A;  3F8H A;  3DY5 A;  4O02 B;  3CC2 3;  1IQY A;  1O7M B;  4K1U A;  2XGL A;  4N6V 0;  1FGO A;  5AII A;  2CIU A;  1OHO A;  5IEN A;  4L8O A;  2LQV A;  2Y74 A;  5A0O B;  4FCZ A;  5KP4 A;  3M8C A;  4MEI A;  3BLZ A;  1DYU A;  3LXU X;  2JQ5 A;  4Q53 A;  3DUK A;  3EN1 B;  1GS3 A;  3S28 A;  1OPY A;  4KVH A;  3LT8 A;  4LEH A;  2P38 A;  1W2B 2;  1QJG A;  3CCR 3;  2BMR B;  3DGN A;  2CC3 A;  2BMO B;  3BNB A;  3WA3 A;  1Q7Y 4;  1G96 A;  2HMJ B;  4HZ9 B;  4XBX A;  3K5T A;  4OVM A;  1STD A;  3FF2 A;  2SBL A;  5IEP A;  4MMZ B;  3CPO A;  1N9E A;  1K41 A;  3NQZ A;  2GU1 A;  3KFQ C;  2YFL B;  1U8C B;  2Z77 A;  1IT8 A;  4R9K A;  1EKM A;  4IPB A;  4EXR A;  4H61 A;  3F40 A;  3D3L A;  1WMN A;  3MHE A;  1ROV A;  3FSD A;  1C7H A;  4WP5 A;  1ULI B;  4LMI A;  5TGN A;  4AEQ A;  4XBY A;  2HMK B;  3ALA A;  1KC8 4;  3NBR A;  4L8P A;  1A67 A;  1AR0 A;  4RNZ A;  1VQP 3;  1O7H B;  2CFK A;  2KRT A;  3NHX A;  3RDE A;  3Q2P A;  1VQ4 3;  1QMA A;  5EVH A;  2XF3 A;  3VGN A;  5JPP A;  1MNL A;  5STD A;  2GBW B;  1JB2 A;  2CFW A;  1N5H A;  3G6E 3;  1YJW 3;  1UUV B;  4KFE A;  3NM7 A;  4N6L A;  3G0K A;  3CCJ 3;  4MMX B;  1W5Z A;  3CCQ 3;  2A15 A;  3ER7 A;  4ORL A;  3CU3 A;  2CG1 A;  1DMM A;  1SJW A;  5I97 A;  4L7K A;  1Q40 A;  1KSI A;  1A2K A;  1IV9 A;  2FNQ A;  1RRH A;  1Q40 B;  3T0U A;  1KQS 2;  3IPT A;  1VQ9 3;  3RGR A;  2XFT A;  1W00 A;  3G16 A;  3CCE 3;  3VSY A;  3X41 A;  3G4S 3;  4R9L A;  2E2T A;  1VQM 3;  3LTD A;  3HII A;  4RBN A;  3OXA A;  5D81 A;  1IV7 A;  1LVN A;  3L0R A;  2XSH B;  2WGO A;  3PZW A;  3G8Z A;  1T5Y A;  1WNH A;  2OOV C;  4HKV B;  1US1 A;  3GWR A;  2WOH A;  1SII A;  2L4V A;  4HYZ A;  1NJI 4;  1F8N A;  1Y4K A;  2Z6B A;  1A2V A;  2WO0 A;  4IT7 A;  1O7P B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...