2OTL3

Girodazole bound to the large subunit of haloarcula marismortui
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
total genus 16
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2otl300
1YIT3 1YJN3 3CCS3 3CC23 1Q7Y4 3CCQ3 3CC43 1YHQ3 1Q824 1VQ73 3CCU3 1K734 3CD63 3I563 1KQS2 1W2B2 1Q814 1K8A4 3CCJ3 1YIJ3 1VQ43 2OTL3 1YI23 1NJI4 1QVG2 2QEX3 3CMA3 3G713 3CC73 3CCL3 1S723 3CCE3 1VQ93 1Q864 1VQK3 3CCV3 1VQ53 3CME3 1VQN3 1VQ63 1M1K4 3G4S3 2QA43 1VQM3 1YJW3 3OW22 3I553 1VQP3 2OTJ3 1N8R4 1QVF2 1YJ93 1M904 3G6E3 1VQL3 1JJ22 3CCM3 3CXC2 3CPW2 1VQO3 1K9M4 1VQ83 1KD14 3CCR3 1KC84
chains in the Genus database with same CATH superfamily
1RGAA 2ZHXB 1JZDA 2W2CA 3FH1A 4RNZA 5CLKA 1B20A 2OQEC 2CWVA 4EYCA 3CCU3 1LNIA 3F14A 3HIGA 3MG1A 5D81A 1M1XB 4HJLB 4K1VA 2GSPA 2W9QA 3X42A 3CMA3 1I2FA 1L5GB 3WA2X 1C54A 2Y74A 1AQZA 1BSEA 3HIIA 7STDA 1LRAA 1ROAA 1UGIA 1BNFA 3D4AA 1STDA 4IT7A 4BTYA 1UI7A 1DMQA 1QAKA 3I0YA 3MPHA 4H3UA 4MMYB 5AYRB 1BNEA 2FGTA 2OOVC 4FMDA 1BRGA 3EJVA 2CWTA 1IV9A 3S27A 4FCZA 6RNTA 3I553 3RGAA 1BNIA 1RGGA 3EN8A 3DZLA 4NPBA 1JN5A 4FMCA 4BL2A 2CX0A 1RHLA 2B1XB 1J2BA 3BNDA 1CYUA 1IDPA 1KD14 2HMLB 3DMCA 1GD3A 3U97A 2E2TA 1EUIC 3D3LA 4OVMA 3U1WA 3FG1A 1YHQ3 3MYTA 1OCVA 1W5ZA 1CYVA 1NNVA 2BMRB 3FF0A 1RDSA 1JN5B 3OXAA 3S67A 1QAFA 3A76A 3JUMA 4BIRA 1BRSA 1QVG2 1ISKA 2MF7A 1N9EA 1RNTA 4FMAA 3QRDA 4FR9A 4WWUC 3UL5A 3OV4A 1EEJA 1RLSA 5GSPA 1VQ93 3CNMA 2P0XA 1IQ8A 2OCTA 1RGFA 3CCV3 1BGSA 2C4BA 3B4PA 1Q7HA 2BO9B 3EX9A 4N6LA 2JQ5A 4N6V0 1FGTA 4OUQA 5LC7A 1LXEA 1JBTA 8RNTA 2XRXB 5IERA 1E3VA 2F4YA 4PEJA 1X1WA 2XSHB 1ULJB 1C7HA 5RNTA 1JRQA 2KXGA 2P0MA 3K9MC 1VQO3 5M19A 3EQQB 4AKYA 1FA3A 3WR2A 3N9HA 2HOHA 3PYJA 5BXQA 4R9LA 2GU1A 1LNHA 4O02B 1B2SA 5EQLA 6GSPA 2BNGA 2GBWB 1T3BA 1N9JA 1SIIA 3KIIA 3F8XA 4FCJA 1G02A 2Z76A 2F5WA 4XB5A 1ZS7A 1D6UA 3RGRA 2LYXA 3WODG 3FF2A 3NBJA 3Q3FA 4HKVB 3AGNA 3SX1A 5HGRA 5JBSA 3G4S3 1F8NA 2AAEA 3SOYA 1WMNA 3EBYA 1OHOA 1OH0A 1X1UA 5M18A 3WA3A 2GU3A 2B24B 1BSAA 4LZIA 1FUSA 2ML5A 2P05A 4HM6B 1CQSA 1ULIB 2L4VA 1MGWA 4WFOA 1RCKA 2FNQA 1TTOA 4FCMA 5ELUA 2RCDA 1BUQA 1FYSA 1YI23 3KKGA 4MJDA 2R4IA 1JNQA 3CCE3 3EN1B 4HOHA 1BANA 1IYYA 3GZRA 2BMOB 2IY2A 1BNRA 1JV2B 1GOUA 1QJGA 2J8XB 2WO0A 1GY5A 1JB2A 3DUKA 3B8LA 4OK0A 4XBTA 3EF8A 1YGEA 5IEPA 1Q42A 3NQZA 3MG2A 2OQEA 3STDA 1UCKA 2D42A 3CNXA 1W7CA 2CW9A 4MEIA 5AIGA 3D5IA 1GOYA 1JKGA 1BRKA 2O9UX 3O8YA 3EHCA 1BOXA 4CCVA 1R4CA 5IF6A 1DE3A 4HM0B 1E97A 2W04A 1KQS2 4R1KA 4EC6A 2D1WA 1IVWA 3D9RA 1GY7A 1ZX2A 1EKMA 1BNSA 1W6CA 2W9PA 3F9SA 1KWIA 3TDGA 4CJNA 1JKGB 1NO3A 1RGKA 3FGYA 4G1MB 1JBSA 5ELJA 2P38A 3RDEA 3DH2A 3LOYA 4L8PA 1BSDA 5AI1A 3HOHA 1IQYA 3V92A 3KN4A 1RN1A 4XBXA 1DYUA 1DVDA 1OGXA 1O7HB 1OHPA 1RRHA 2E2VA 2QIYA 1VQM3 3OW22 1YJW3 1WTHA 1NWWA 1B3SA 1RGEA 3EC9A 1JBRA 1GMQA 2IUKA 3JUQA 1FZUA 3CXC2 1I8VA 4L8OA 3WMDA 3OX9A 5EEOA 4AKZA 3GSPA 5EVHA 1QMAA 2STDA 3BLZA 4HM5B 1HZ1A 1YVSA 3DGOA 1W2B2 4AEQA 3S28A 2H0GA 2SARA 1AY7A 2YFIB 4HVNA 4I4KA 4N3VA 1V57A 3LTBA 1TIJA 4LSOA 1O7MB 2OTL3 3MSOA 3SYUA 1IQXA 1LOVA 1SIHA 1NDOB 3KE7A 1LOXA 2HMNB 4KFEA 5FW5A 2BU4A 4RNTA 1BRHA 3NBBA 3BIRA 2RSXA 1VQP3 2A15A 3S29A 3G6E3 1E3RA 4NREA 4BL3A 1JJ22 5JPUA 1BIRA 2KF3A 2UGIA 2ZDJA 1TP6A 1UDII 3DGLA 3IMAB 5AEUB 1RMSA 1B2MA 3URPA 3GZYB 1Q824 2ZA4A 3H3HA 1HU9A 1TUHA 5KP4A 2OTJ3 3VGNA 3G16A 1V74A 3DY5A 1VQ43 4HM1B 3ECFA 2H0HA 3EE1A 3FSDA 5AEWB 3CCL3 1S723 4H61A 2O3OA 1LQGC 4KZ1A 1I70A 1X1XA 3LZAA 5BU4A 2RFRA 1O7NB 3NHXA 4CDLA 4CPKA 4DKIA 4O3VA 3DGYA 3KSED 4QWTA 3WDGB 1SJWA 3B7CA 1M9GA 2BHMA 5AIHA 1QALA 2CG1A 1ZO2A 1MWRA 2IMJA 6STDA 1B2ZA 3X40A 3MWZA 1NB5I 4GL6A 1SQWA 4J5KA 5IEOA 5IG0A 1RNBA 1A2VA 1TRQA 1MNLA 3CCM3 1YNVX 2CWUA 1PYLA 1DMNA 3CC73 1IV7A 1I3IA 2XR8B 1EA2A 8CHOA 4JF8A 1TFOA 2JDIH 4XBYA 4LYLB 1R4YA 3WOEB 7GSPA 1K734 2CHCA 4K1UA 1T5YA 3T8NA 3I563 3JUPA 1AVKA 3N54B 1AVLA 1BU4A 1K8A4 5AIFA 1A2PA 3L0RA 1TU5A 1YIJ3 4R80A 3F8HA 2QEX3 1UUGB 1S5AA 3JUNA 3LT8A 2PZVA 3FLJA 2H0IA 4KFDA 1IK3A 1VQ53 4JRFA 3BB9A 3NXJA 5IG3A 1US1A 3FZWA 3B4OA 3X3XA 3PGBA 4HYZA 1OGZA 1YJ93 3IPTA 3SEDA 3MHEA 4LEHA 1MWUA 1I0VA 1HYFA 1TJDA 4HM4B 1BRJA 1N5HA 3VSYA 1KC84 1RRLA 3FG4A 1W6GA 2F56A 2BIRA 4LGQA 3X3YA 1B2UA 3FCSB 2CH9A 2Z6BA 1BNGA 1K28A 1OACA 4NHFA 1BNJA 1GD4A 3LXUX 4K90B 1BVIA 3V99A 3T8UA 1O7WB 1UW1A 4XM4A 3RNTA 2YFJB 4J5GA 2GEXA 4EV5A 4K61A 2F86B 3DM8A 5LC6A 4HM2B 1VZZA 1UUWB 1W01A 1UCLA 3AHSA 3HX8A 1I0XA 3KFQC 4XDWA 3GRDA 1CEWI 1KSIA 3UB1A 4LMIA 1B2XA 2HMMB 2K0MA 1DMMA 2KAAA 1ASKA 3CD63 3NQYA 2FXTA 1GYBA 3BU4A 5AYSC 4J9AA 4EW5A 4IIAA 3M8CA 2L1SA 1VQ73 4EV2A 2KF4A 3SVAA 1RN7A 5D82A 4N6TA 1Q40A 3K5TA 2KRTA 2E2UA 1UCJA 3K0ZA 2F99A 2OOVA 3VF1A 4EBGA 1B21A 2WOHA 4R4KA 5IW9A 4O8SA 5D83A 3V98A 4HM7B 2XFTA 4KFFA 2MC8A 3GWRA 3KZTA 3MKIA 2HMJB 4HM8B 1WMOA 3AMOA 1U8CB 2F5MA 3JUOA 3LTDA 1Q40B 3JVCA 2CFGA 4KT3B 1WMPA 1RJOA 4ILFA 1IT7A 4GSPA 3NX0A 5TGNA 3T0UA 1N8R4 5CXOA 1QVF2 5STDA 1M904 2Q07A 1RSNA 3FG3A 3NM2A 1YIT3 2ZL8A 1HKXA 3GZBA 3MG3A 4WHAA 2XGNA 3K7CA 3AMOB 3N8BA 1N8QA 4RBNA 3ROBA 3HI7A 1IT8A 4TX4A 1BRNL 3ZFZA 1PY3A 3X3ZA 5DRVA 5M1AA 2W0QA 3NV0A 2XFSA 3DGMA 4HZ9B 3NBRA 1GY6A 1PFPA 1LOYA 2W56A 3GZXB 3G713 1VQK3 3D79A 3EB8A 2I9WA 1SARA 2YFLB 2RGQA 2WGQA 2SBLA 3D5GA 1U5OA 3NV0B 3KCHA 3HK4A 2HMKB 4BTXA 2F98A 3LTAA 5CF2A 3OWSA 2W56B 1A67A 1RGHA 1UCIA 2Y73A 2UUGC 2LQVA 9RNTA 1Q7Y4 3E99A 2GXFA 2W6JH 4L7KA 1A2KA 3CC43 3SOAA 1FUWA 4I5QA 2PNCA 1DVCA 3BNBA 4WYKA 1UUVB 1N5PA 5AIIA 3LTCA 3Q1CA 1G96A 1K41A 1RN4A 2K54A 2HMOB 3UL6A 3NM7A 3LYGA 3OWUA 1BAOA 4WYKB 4Q53A 3ALAA 1D6YA 4O2HA 5IG5A 1Q9EA 2CFLA 3ER7A 1BUJA 3IJEB 3PS8A 1MWSA 4MMXB 2WGOA 1X1YA 2GBXB 1RGCA 2V1LA 1GMPA 2BT3A 3S5CA 2CX1A 5G2GA 1I3FA 5KP1A 1MOLA 5G1KA 3GAXA 7RNTA 2XEPA 1D6ZA 1WQLB 5HOHA 3CCJ3 1OPYA 1T2IA 1FUTA 1ZGXA 3LMLA 3X41A 2IUJA 2INXA 5IENA 4HBRA 3PZWA 1Q864 2KF6A 5IG4A 3Q2PA 1VQN3 4IPBA 2C11A 3UNLA 1NB3I 3CU3A 3ZG0A 2Z77A 4XDVA 4R9KA 1BRIA 2CIUA 1I2EA 2AADA 3CPOA 3UJMA 1W4NA 5DREA 1GMRA 1MWTA 1VQL3 2CG0A 1UGHI 3H51A 3K63A 1YVBI 2W03A 1BSCA 3PXMA 4RZMA 1K9M4 1FGRA 1JB4A 1OF5A 3CCS3 1WNHA 2KCDA 2XF3A 5FGOA 1RGLA 5CF1A 3CCQ3 3PCRA 4MMZB 1EQKA 5CK6A 1Z1SA 1JB5A 3F7XA 1MGRA 2CK3H 4EXRA 2CFKA 1OF5B 1LOWA 1W02A 3SXXA 1RKYA 3PCSA 3WHOA 3DGNA 1IVUA 1YGWA 3BNCA 1VQ63 5G1LA 1O7PB 1RCLA 2WOFA 1DETA 2ML6A 4HAAA 3F40A 3LH4A 5A0OB 1OUNA 1PU4A 1V58A 1W2ZA 2QGUA 4N6MA 3CCR3 1STFI 1AR0A 2IYJA 1G0TA 4GHOA 1ROVA 3EBTA 1NU3A 1GOVA 1UI8A 1IVXA 4RNYA 2M7OA 4HM3B 2YX9A 1LQMB 1W00A 1Q814 2Z7AA 3HZPA 2OWPA 3Q90A 1W6YA 4N6NB 2XGLA 1EG9B 4N6UA 2RBIA 3J7Yd 1M1K4 4GB5A 2GEYA 3A5EA 4FMBA 3ZG5A 4HZBB 1SPUA 1TRPA 3BNEA 4J8TA 1GSPA 1OHSA 2RNTA 4ZM8A 4BU4A 3G8ZA 4BTWA 1BSBA 4N6OB 1T2HA 1FW7A 3KSPA 3CPW2 1B27A 3AGOA 4ORLA 4X2HA 1YJN3 2XSOB 2IA7A 3CC23 4WP5A 3DXOA 4X2OA 3OWYA 2C10A 2UX0A 5BIRA 3SLUA 2P09A 2CC3A 3G0KA 2R41A 3WOFB 1NJI4 1FGOA 1VQQA 5I97A 1GS3A 1JZOA 1TFKA 3QK9A 2K3DA 3LT9A 3AHWA 4STDA 3CME3 4KVHA 1CH0A 3FKAA 1Y4KA 1IVVA 1LVNA 2XH9A 4U13A 1IU7A 2BMQB 1RTUA 2QA43 1FGQA 1I2GA 1AV4A 1O7GB 2KF5A 3NUVA 5KP3A 5JPPA 2CFDA 1FGMA 2CKFB 1A90A 3F7SA 1VQ83 5BVBA 2CFWA
chains in the Genus database with same CATH topology
3FH1A 2W2CA 4RNZA 5CLKA 2OQEC 2CWVA 4EYCA 3CCU3 3F14A 3HIGA 3MG1A 5D81A 1M1XB 4HJLB 4K1VA 3X42A 2W9QA 3CMA3 1L5GB 3WA2X 2Y74A 3HIIA 7STDA 1ROAA 4IT7A 1STDA 4BTYA 1UI7A 1DMQA 1QAKA 3I0YA 3MPHA 4H3UA 4MMYB 5AYRB 2FGTA 2OOVC 4FMDA 3S27A 3EJVA 2CWTA 1IV9A 4FCZA 3I553 3RGAA 3EN8A 3DZLA 1JN5A 4FMCA 2B1XB 1J2BA 3BNDA 1CYUA 1IDPA 1KD14 2HMLB 3DMCA 1GD3A 3U97A 2E2TA 3U1WA 3D3LA 4OVMA 3FG1A 1YHQ3 3MYTA 1OCVA 1W5ZA 1CYVA 2BMRB 3FF0A 3OXAA 3S67A 1JN5B 1QAFA 3A76A 3JUMA 1QVG2 1ISKA 2MF7A 1N9EA 4FR9A 4FMAA 3QRDA 4WWUC 3UL5A 3G713 3OV4A 3CC73 1VQ93 3CNMA 2P0XA 1IQ8A 2OCTA 3CCV3 3B4PA 2BO9B 3EX9A 4N6LA 4OUQA 2JQ5A 4N6V0 1FGTA 5LC7A 1LXEA 2XRXB 5IERA 1E3VA 4PEJA 2XSHB 1ULJB 1C7HA 1JRQA 2KXGA 2P0MA 3K9MC 1VQO3 1FA3A 3EQQB 4AKYA 3N9HA 3PYJA 5BXQA 4R9LA 2GU1A 1LNHA 4O02B 5EQLA 2BNGA 2GBWB 1N9JA 1SIIA 3KIIA 3F8XA 4FCJA 2Z76A 4XB5A 1D6UA 3RGRA 2LYXA 3WODG 3FF2A 3NBJA 4HKVB 3SX1A 5HGRA 5JBSA 3G4S3 1F8NA 3SOYA 1WMNA 3EBYA 1OHOA 1OH0A 3WA3A 2GU3A 2B24B 4LZIA 2ML5A 2P05A 4HM6B 1CQSA 1ULIB 2L4VA 4WFOA 2FNQA 4FCMA 5ELUA 2RCDA 1BUQA 1YI23 3KKGA 4MJDA 2R4IA 1JNQA 3CCE3 3EN1B 3GZRA 2BMOB 1JV2B 1QJGA 2WO0A 1GY5A 1JB2A 3DUKA 3B8LA 4OK0A 4XBTA 3EF8A 1YGEA 5IEPA 1Q42A 3NQZA 3MG2A 2OQEA 3STDA 3CNXA 2D42A 1W7CA 2CW9A 4MEIA 5AIGA 2O9UX 1JKGA 3O8YA 3EHCA 4CCVA 1R4CA 5IF6A 4HM0B 1E97A 2W04A 1KQS2 4R1KA 4EC6A 2D1WA 1IVWA 3D9RA 1GY7A 1ZX2A 1EKMA 3F9SA 1W6CA 2W9PA 3TDGA 1KWIA 1JKGB 1NO3A 3FGYA 4G1MB 5ELJA 2P38A 3RDEA 3LOYA 4L8PA 5AI1A 3V92A 1IQYA 3KN4A 4XBXA 1DYUA 1DVDA 1OGXA 1O7HB 1OHPA 1RRHA 2E2VA 2QIYA 1VQM3 3OW22 1YJW3 1WTHA 1NWWA 3EC9A 2IUKA 3JUQA 3CXC2 4L8OA 3WMDA 3OX9A 5EEOA 4AKZA 5EVHA 1QMAA 2STDA 3BLZA 4HM5B 3DGOA 1W2B2 4AEQA 3S28A 4HVNA 4I4KA 2YFIB 4N3VA 3LTBA 1TIJA 4LSOA 1O7MB 2OTL3 3MSOA 1IQXA 1SIHA 1NDOB 3KE7A 1LOXA 2HMNB 4KFEA 5FW5A 3NBBA 2RSXA 1VQP3 2A15A 3S29A 3G6E3 1E3RA 4NREA 1JJ22 5JPUA 2ZDJA 1TP6A 3IMAB 3DGLA 5AEUB 3GZYB 1Q824 3H3HA 1HU9A 1TUHA 5KP4A 3VGNA 3G16A 1V74A 3DY5A 1VQ43 4HM1B 3ECFA 3EE1A 5AEWB 3FSDA 3CCL3 1S723 4H61A 2O3OA 4KZ1A 3LZAA 2RFRA 1O7NB 3NHXA 4CDLA 4O3VA 3KSED 4QWTA 3WDGB 1SJWA 3B7CA 1M9GA 2BHMA 5AIHA 1QALA 2CG1A 1ZO2A 2IMJA 6STDA 3X40A 3MWZA 1NB5I 4GL6A 1SQWA 5IEOA 5IG0A 1A2VA 1MNLA 3CCM3 2CWUA 1DMNA 1IV7A 2XR8B 1EA2A 8CHOA 4JF8A 1TFOA 2JDIH 4XBYA 3WOEB 1K734 2CHCA 4K1UA 1T5YA 3T8NA 3I563 3JUPA 1AVKA 3N54B 1AVLA 1K8A4 5AIFA 3L0RA 1TU5A 1YIJ3 4R80A 3F8HA 2QEX3 1S5AA 3JUNA 3LT8A 2PZVA 3FLJA 4KFDA 1IK3A 1VQ53 4JRFA 3BB9A 3NXJA 5IG3A 1US1A 3FZWA 3B4OA 3X3XA 3PGBA 4HYZA 1OGZA 1YJ93 3IPTA 3SEDA 3MHEA 4LEHA 3VSYA 4HM4B 1KC84 1N5HA 1RRLA 3FG4A 1W6GA 4LGQA 3X3YA 3FCSB 2CH9A 2Z6BA 1K28A 4NHFA 1OACA 1GD4A 3LXUX 4K90B 3V99A 3T8UA 1O7WB 1UW1A 4XM4A 2YFJB 2GEXA 4EV5A 4K61A 2F86B 3DM8A 5LC6A 4HM2B 1VZZA 1UUWB 1W01A 3HX8A 4XDWA 3KFQC 3GRDA 1CEWI 1KSIA 3UB1A 4LMIA 2HMMB 2K0MA 1DMMA 1ASKA 3CD63 3NQYA 2FXTA 1GYBA 5AYSC 4J9AA 4IIAA 3M8CA 1VQ73 4EV2A 3SVAA 1RN7A 5D82A 4N6TA 1Q40A 3K5TA 2KRTA 2E2UA 3K0ZA 2OOVA 2F99A 3VF1A 4EBGA 2WOHA 5IW9A 4R4KA 4O8SA 5D83A 3V98A 4HM7B 2XFTA 4KFFA 2MC8A 3GWRA 3KZTA 3MKIA 2HMJB 4HM8B 1WMOA 3AMOA 1U8CB 3JUOA 3LTDA 1Q40B 3JVCA 2CFGA 1WMPA 1RJOA 2OTJ3 1IT7A 5TGNA 3NX0A 1N8R4 3T0UA 1QVF2 5CXOA 5STDA 1M904 2Q07A 3FG3A 3NM2A 1YIT3 2ZL8A 1HKXA 3GZBA 3MG3A 4WHAA 2XGNA 3K7CA 3AMOB 3N8BA 1N8QA 4RBNA 3ROBA 3HI7A 1IT8A 4TX4A 3X3ZA 5DRVA 2W0QA 3NV0A 2XFSA 3DGMA 4HZ9B 3NBRA 1GY6A 1PFPA 2W56A 3GZXB 1VQK3 3EB8A 2I9WA 2YFLB 2RGQA 2WGQA 2SBLA 1U5OA 3NV0B 3HK4A 2HMKB 4BTXA 2F98A 3LTAA 5CF2A 3OWSA 2W56B 1A67A 2Y73A 2LQVA 1Q7Y4 3E99A 2GXFA 2W6JH 4L7KA 1A2KA 3CC43 3SOAA 1FUWA 2PNCA 1DVCA 3BNBA 4WYKA 1UUVB 1N5PA 5AIIA 3LTCA 3Q1CA 1G96A 1K41A 2K54A 2HMOB 3UL6A 3NM7A 3LYGA 3OWUA 4WYKB 4Q53A 3ALAA 1D6YA 4O2HA 5IG5A 2CFLA 3ER7A 3IJEB 3PS8A 4MMXB 2WGOA 2GBXB 2V1LA 2BT3A 3S5CA 5G2GA 5KP1A 1MOLA 3GAXA 2XEPA 1D6ZA 1WQLB 3CCJ3 1OPYA 3LMLA 3X41A 2IUJA 2INXA 5IENA 4HBRA 3PZWA 1Q864 5IG4A 3Q2PA 1VQN3 4IPBA 2C11A 3UNLA 1NB3I 3CU3A 2Z77A 4XDVA 4R9KA 2CIUA 3UJMA 3CPOA 1W4NA 5DREA 1VQL3 2CG0A 3H51A 3K63A 1YVBI 2W03A 1K9M4 3PXMA 4RZMA 1FGRA 1JB4A 1OF5A 3CCS3 1WNHA 2KCDA 2XF3A 5FGOA 5CF1A 3CCQ3 3PCRA 4MMZB 1EQKA 5CK6A 1Z1SA 1JB5A 3F7XA 2CK3H 4EXRA 2CFKA 1OF5B 1W02A 3SXXA 1RKYA 3PCSA 3DGNA 1IVUA 1VQ63 3BNCA 1O7PB 2WOFA 2ML6A 3F40A 3LH4A 5A0OB 1OUNA 1PU4A 1W2ZA 2QGUA 4N6MA 3CCR3 1STFI 1AR0A 1ROVA 3EBTA 1NU3A 1UI8A 1IVXA 4RNYA 2M7OA 4HM3B 2YX9A 1W00A 1Q814 2Z7AA 3HZPA 2OWPA 3Q90A 1W6YA 4N6NB 2XGLA 1EG9B 4N6UA 3J7Yd 1M1K4 4GB5A 2GEYA 4FMBA 4HZBB 1SPUA 3BNEA 4J8TA 1OHSA 4ZM8A 4BTWA 3G8ZA 4N6OB 3KSPA 3CPW2 4ORLA 4X2HA 1YJN3 2XSOB 2IA7A 3CC23 4WP5A 3DXOA 4X2OA 3OWYA 2C10A 2UX0A 3SLUA 2P09A 2CC3A 3G0KA 3WOFB 1NJI4 1FGOA 5I97A 1GS3A 1TFKA 3QK9A 3LT9A 4STDA 3CME3 4KVHA 3FKAA 1Y4KA 1IVVA 1LVNA 2XH9A 4U13A 1IU7A 2BMQB 2QA43 1FGQA 1AV4A 1O7GB 3NUVA 5KP3A 5JPPA 2CFDA 1FGMA 2CKFB 1A90A 3F7SA 1VQ83 5BVBA 2CFWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIT 3;  1YJN 3;  3CCS 3;  3CC2 3;  1Q7Y 4;  3CCQ 3;  3CC4 3;  1YHQ 3;  1Q82 4;  1VQ7 3;  3CCU 3;  1K73 4;  3CD6 3;  3I56 3;  1KQS 2;  1W2B 2;  1Q81 4;  1K8A 4;  3CCJ 3;  1YIJ 3;  1VQ4 3;  2OTL 3;  1YI2 3;  1NJI 4;  1QVG 2;  2QEX 3;  3CMA 3;  3G71 3;  3CC7 3;  3CCL 3;  1S72 3;  3CCE 3;  1VQ9 3;  1Q86 4;  1VQK 3;  3CCV 3;  1VQ5 3;  3CME 3;  1VQN 3;  1VQ6 3;  1M1K 4;  3G4S 3;  2QA4 3;  1VQM 3;  1YJW 3;  3OW2 2;  3I55 3;  1VQP 3;  2OTJ 3;  1N8R 4;  1QVF 2;  1YJ9 3;  1M90 4;  3G6E 3;  1VQL 3;  1JJ2 2;  3CCM 3;  3CXC 2;  3CPW 2;  1VQO 3;  1K9M 4;  1VQ8 3;  1KD1 4;  3CCR 3;  1KC8 4; 
#chains in the Genus database with same CATH topology
 1RGA A;  2ZHX B;  1JZD A;  2W2C A;  3FH1 A;  4RNZ A;  5CLK A;  1B20 A;  2OQE C;  2CWV A;  4EYC A;  3CCU 3;  1LNI A;  3F14 A;  3HIG A;  3MG1 A;  5D81 A;  1M1X B;  4HJL B;  4K1V A;  2GSP A;  2W9Q A;  3X42 A;  3CMA 3;  1I2F A;  1L5G B;  3WA2 X;  1C54 A;  2Y74 A;  1AQZ A;  1BSE A;  3HII A;  7STD A;  1LRA A;  1ROA A;  1UGI A;  1BNF A;  3D4A A;  1STD A;  4IT7 A;  4BTY A;  1UI7 A;  1DMQ A;  1QAK A;  3I0Y A;  3MPH A;  4H3U A;  4MMY B;  5AYR B;  1BNE A;  2FGT A;  2OOV C;  4FMD A;  1BRG A;  3EJV A;  2CWT A;  1IV9 A;  3S27 A;  4FCZ A;  6RNT A;  3I55 3;  3RGA A;  1BNI A;  1RGG A;  3EN8 A;  3DZL A;  4NPB A;  1JN5 A;  4FMC A;  4BL2 A;  2CX0 A;  1RHL A;  2B1X B;  1J2B A;  3BND A;  1CYU A;  1IDP A;  1KD1 4;  2HML B;  3DMC A;  1GD3 A;  3U97 A;  2E2T A;  1EUI C;  3D3L A;  4OVM A;  3U1W A;  3FG1 A;  1YHQ 3;  3MYT A;  1OCV A;  1W5Z A;  1CYV A;  1NNV A;  2BMR B;  3FF0 A;  1RDS A;  1JN5 B;  3OXA A;  3S67 A;  1QAF A;  3A76 A;  3JUM A;  4BIR A;  1BRS A;  1QVG 2;  1ISK A;  2MF7 A;  1N9E A;  1RNT A;  4FMA A;  3QRD A;  4FR9 A;  4WWU C;  3UL5 A;  3OV4 A;  1EEJ A;  1RLS A;  5GSP A;  1VQ9 3;  3CNM A;  2P0X A;  1IQ8 A;  2OCT A;  1RGF A;  3CCV 3;  1BGS A;  2C4B A;  3B4P A;  1Q7H A;  2BO9 B;  3EX9 A;  4N6L A;  2JQ5 A;  4N6V 0;  1FGT A;  4OUQ A;  5LC7 A;  1LXE A;  1JBT A;  8RNT A;  2XRX B;  5IER A;  1E3V A;  2F4Y A;  4PEJ A;  1X1W A;  2XSH B;  1ULJ B;  1C7H A;  5RNT A;  1JRQ A;  2KXG A;  2P0M A;  3K9M C;  1VQO 3;  5M19 A;  3EQQ B;  4AKY A;  1FA3 A;  3WR2 A;  3N9H A;  2HOH A;  3PYJ A;  5BXQ A;  4R9L A;  2GU1 A;  1LNH A;  4O02 B;  1B2S A;  5EQL A;  6GSP A;  2BNG A;  2GBW B;  1T3B A;  1N9J A;  1SII A;  3KII A;  3F8X A;  4FCJ A;  1G02 A;  2Z76 A;  2F5W A;  4XB5 A;  1ZS7 A;  1D6U A;  3RGR A;  2LYX A;  3WOD G;  3FF2 A;  3NBJ A;  3Q3F A;  4HKV B;  3AGN A;  3SX1 A;  5HGR A;  5JBS A;  3G4S 3;  1F8N A;  2AAE A;  3SOY A;  1WMN A;  3EBY A;  1OHO A;  1OH0 A;  1X1U A;  5M18 A;  3WA3 A;  2GU3 A;  2B24 B;  1BSA A;  4LZI A;  1FUS A;  2ML5 A;  2P05 A;  4HM6 B;  1CQS A;  1ULI B;  2L4V A;  1MGW A;  4WFO A;  1RCK A;  2FNQ A;  1TTO A;  4FCM A;  5ELU A;  2RCD A;  1BUQ A;  1FYS A;  1YI2 3;  3KKG A;  4MJD A;  2R4I A;  1JNQ A;  3CCE 3;  3EN1 B;  4HOH A;  1BAN A;  1IYY A;  3GZR A;  2BMO B;  2IY2 A;  1BNR A;  1JV2 B;  1GOU A;  1QJG A;  2J8X B;  2WO0 A;  1GY5 A;  1JB2 A;  3DUK A;  3B8L A;  4OK0 A;  4XBT A;  3EF8 A;  1YGE A;  5IEP A;  1Q42 A;  3NQZ A;  3MG2 A;  2OQE A;  3STD A;  1UCK A;  2D42 A;  3CNX A;  1W7C A;  2CW9 A;  4MEI A;  5AIG A;  3D5I A;  1GOY A;  1JKG A;  1BRK A;  2O9U X;  3O8Y A;  3EHC A;  1BOX A;  4CCV A;  1R4C A;  5IF6 A;  1DE3 A;  4HM0 B;  1E97 A;  2W04 A;  1KQS 2;  4R1K A;  4EC6 A;  2D1W A;  1IVW A;  3D9R A;  1GY7 A;  1ZX2 A;  1EKM A;  1BNS A;  1W6C A;  2W9P A;  3F9S A;  1KWI A;  3TDG A;  4CJN A;  1JKG B;  1NO3 A;  1RGK A;  3FGY A;  4G1M B;  1JBS A;  5ELJ A;  2P38 A;  3RDE A;  3DH2 A;  3LOY A;  4L8P A;  1BSD A;  5AI1 A;  3HOH A;  1IQY A;  3V92 A;  3KN4 A;  1RN1 A;  4XBX A;  1DYU A;  1DVD A;  1OGX A;  1O7H B;  1OHP A;  1RRH A;  2E2V A;  2QIY A;  1VQM 3;  3OW2 2;  1YJW 3;  1WTH A;  1NWW A;  1B3S A;  1RGE A;  3EC9 A;  1JBR A;  1GMQ A;  2IUK A;  3JUQ A;  1FZU A;  3CXC 2;  1I8V A;  4L8O A;  3WMD A;  3OX9 A;  5EEO A;  4AKZ A;  3GSP A;  5EVH A;  1QMA A;  2STD A;  3BLZ A;  4HM5 B;  1HZ1 A;  1YVS A;  3DGO A;  1W2B 2;  4AEQ A;  3S28 A;  2H0G A;  2SAR A;  1AY7 A;  2YFI B;  4HVN A;  4I4K A;  4N3V A;  1V57 A;  3LTB A;  1TIJ A;  4LSO A;  1O7M B;  2OTL 3;  3MSO A;  3SYU A;  1IQX A;  1LOV A;  1SIH A;  1NDO B;  3KE7 A;  1LOX A;  2HMN B;  4KFE A;  5FW5 A;  2BU4 A;  4RNT A;  1BRH A;  3NBB A;  3BIR A;  2RSX A;  1VQP 3;  2A15 A;  3S29 A;  3G6E 3;  1E3R A;  4NRE A;  4BL3 A;  1JJ2 2;  5JPU A;  1BIR A;  2KF3 A;  2UGI A;  2ZDJ A;  1TP6 A;  1UDI I;  3DGL A;  3IMA B;  5AEU B;  1RMS A;  1B2M A;  3URP A;  3GZY B;  1Q82 4;  2ZA4 A;  3H3H A;  1HU9 A;  1TUH A;  5KP4 A;  2OTJ 3;  3VGN A;  3G16 A;  1V74 A;  3DY5 A;  1VQ4 3;  4HM1 B;  3ECF A;  2H0H A;  3EE1 A;  3FSD A;  5AEW B;  3CCL 3;  1S72 3;  4H61 A;  2O3O A;  1LQG C;  4KZ1 A;  1I70 A;  1X1X A;  3LZA A;  5BU4 A;  2RFR A;  1O7N B;  3NHX A;  4CDL A;  4CPK A;  4DKI A;  4O3V A;  3DGY A;  3KSE D;  4QWT A;  3WDG B;  1SJW A;  3B7C A;  1M9G A;  2BHM A;  5AIH A;  1QAL A;  2CG1 A;  1ZO2 A;  1MWR A;  2IMJ A;  6STD A;  1B2Z A;  3X40 A;  3MWZ A;  1NB5 I;  4GL6 A;  1SQW A;  4J5K A;  5IEO A;  5IG0 A;  1RNB A;  1A2V A;  1TRQ A;  1MNL A;  3CCM 3;  1YNV X;  2CWU A;  1PYL A;  1DMN A;  3CC7 3;  1IV7 A;  1I3I A;  2XR8 B;  1EA2 A;  8CHO A;  4JF8 A;  1TFO A;  2JDI H;  4XBY A;  4LYL B;  1R4Y A;  3WOE B;  7GSP A;  1K73 4;  2CHC A;  4K1U A;  1T5Y A;  3T8N A;  3I56 3;  3JUP A;  1AVK A;  3N54 B;  1AVL A;  1BU4 A;  1K8A 4;  5AIF A;  1A2P A;  3L0R A;  1TU5 A;  1YIJ 3;  4R80 A;  3F8H A;  2QEX 3;  1UUG B;  1S5A A;  3JUN A;  3LT8 A;  2PZV A;  3FLJ A;  2H0I A;  4KFD A;  1IK3 A;  1VQ5 3;  4JRF A;  3BB9 A;  3NXJ A;  5IG3 A;  1US1 A;  3FZW A;  3B4O A;  3X3X A;  3PGB A;  4HYZ A;  1OGZ A;  1YJ9 3;  3IPT A;  3SED A;  3MHE A;  4LEH A;  1MWU A;  1I0V A;  1HYF A;  1TJD A;  4HM4 B;  1BRJ A;  1N5H A;  3VSY A;  1KC8 4;  1RRL A;  3FG4 A;  1W6G A;  2F56 A;  2BIR A;  4LGQ A;  3X3Y A;  1B2U A;  3FCS B;  2CH9 A;  2Z6B A;  1BNG A;  1K28 A;  1OAC A;  4NHF A;  1BNJ A;  1GD4 A;  3LXU X;  4K90 B;  1BVI A;  3V99 A;  3T8U A;  1O7W B;  1UW1 A;  4XM4 A;  3RNT A;  2YFJ B;  4J5G A;  2GEX A;  4EV5 A;  4K61 A;  2F86 B;  3DM8 A;  5LC6 A;  4HM2 B;  1VZZ A;  1UUW B;  1W01 A;  1UCL A;  3AHS A;  3HX8 A;  1I0X A;  3KFQ C;  4XDW A;  3GRD A;  1CEW I;  1KSI A;  3UB1 A;  4LMI A;  1B2X A;  2HMM B;  2K0M A;  1DMM A;  2KAA A;  1ASK A;  3CD6 3;  3NQY A;  2FXT A;  1GYB A;  3BU4 A;  5AYS C;  4J9A A;  4EW5 A;  4IIA A;  3M8C A;  2L1S A;  1VQ7 3;  4EV2 A;  2KF4 A;  3SVA A;  1RN7 A;  5D82 A;  4N6T A;  1Q40 A;  3K5T A;  2KRT A;  2E2U A;  1UCJ A;  3K0Z A;  2F99 A;  2OOV A;  3VF1 A;  4EBG A;  1B21 A;  2WOH A;  4R4K A;  5IW9 A;  4O8S A;  5D83 A;  3V98 A;  4HM7 B;  2XFT A;  4KFF A;  2MC8 A;  3GWR A;  3KZT A;  3MKI A;  2HMJ B;  4HM8 B;  1WMO A;  3AMO A;  1U8C B;  2F5M A;  3JUO A;  3LTD A;  1Q40 B;  3JVC A;  2CFG A;  4KT3 B;  1WMP A;  1RJO A;  4ILF A;  1IT7 A;  4GSP A;  3NX0 A;  5TGN A;  3T0U A;  1N8R 4;  5CXO A;  1QVF 2;  5STD A;  1M90 4;  2Q07 A;  1RSN A;  3FG3 A;  3NM2 A;  1YIT 3;  2ZL8 A;  1HKX A;  3GZB A;  3MG3 A;  4WHA A;  2XGN A;  3K7C A;  3AMO B;  3N8B A;  1N8Q A;  4RBN A;  3ROB A;  3HI7 A;  1IT8 A;  4TX4 A;  1BRN L;  3ZFZ A;  1PY3 A;  3X3Z A;  5DRV A;  5M1A A;  2W0Q A;  3NV0 A;  2XFS A;  3DGM A;  4HZ9 B;  3NBR A;  1GY6 A;  1PFP A;  1LOY A;  2W56 A;  3GZX B;  3G71 3;  1VQK 3;  3D79 A;  3EB8 A;  2I9W A;  1SAR A;  2YFL B;  2RGQ A;  2WGQ A;  2SBL A;  3D5G A;  1U5O A;  3NV0 B;  3KCH A;  3HK4 A;  2HMK B;  4BTX A;  2F98 A;  3LTA A;  5CF2 A;  3OWS A;  2W56 B;  1A67 A;  1RGH A;  1UCI A;  2Y73 A;  2UUG C;  2LQV A;  9RNT A;  1Q7Y 4;  3E99 A;  2GXF A;  2W6J H;  4L7K A;  1A2K A;  3CC4 3;  3SOA A;  1FUW A;  4I5Q A;  2PNC A;  1DVC A;  3BNB A;  4WYK A;  1UUV B;  1N5P A;  5AII A;  3LTC A;  3Q1C A;  1G96 A;  1K41 A;  1RN4 A;  2K54 A;  2HMO B;  3UL6 A;  3NM7 A;  3LYG A;  3OWU A;  1BAO A;  4WYK B;  4Q53 A;  3ALA A;  1D6Y A;  4O2H A;  5IG5 A;  1Q9E A;  2CFL A;  3ER7 A;  1BUJ A;  3IJE B;  3PS8 A;  1MWS A;  4MMX B;  2WGO A;  1X1Y A;  2GBX B;  1RGC A;  2V1L A;  1GMP A;  2BT3 A;  3S5C A;  2CX1 A;  5G2G A;  1I3F A;  5KP1 A;  1MOL A;  5G1K A;  3GAX A;  7RNT A;  2XEP A;  1D6Z A;  1WQL B;  5HOH A;  3CCJ 3;  1OPY A;  1T2I A;  1FUT A;  1ZGX A;  3LML A;  3X41 A;  2IUJ A;  2INX A;  5IEN A;  4HBR A;  3PZW A;  1Q86 4;  2KF6 A;  5IG4 A;  3Q2P A;  1VQN 3;  4IPB A;  2C11 A;  3UNL A;  1NB3 I;  3CU3 A;  3ZG0 A;  2Z77 A;  4XDV A;  4R9K A;  1BRI A;  2CIU A;  1I2E A;  2AAD A;  3CPO A;  3UJM A;  1W4N A;  5DRE A;  1GMR A;  1MWT A;  1VQL 3;  2CG0 A;  1UGH I;  3H51 A;  3K63 A;  1YVB I;  2W03 A;  1BSC A;  3PXM A;  4RZM A;  1K9M 4;  1FGR A;  1JB4 A;  1OF5 A;  3CCS 3;  1WNH A;  2KCD A;  2XF3 A;  5FGO A;  1RGL A;  5CF1 A;  3CCQ 3;  3PCR A;  4MMZ B;  1EQK A;  5CK6 A;  1Z1S A;  1JB5 A;  3F7X A;  1MGR A;  2CK3 H;  4EXR A;  2CFK A;  1OF5 B;  1LOW A;  1W02 A;  3SXX A;  1RKY A;  3PCS A;  3WHO A;  3DGN A;  1IVU A;  1YGW A;  3BNC A;  1VQ6 3;  5G1L A;  1O7P B;  1RCL A;  2WOF A;  1DET A;  2ML6 A;  4HAA A;  3F40 A;  3LH4 A;  5A0O B;  1OUN A;  1PU4 A;  1V58 A;  1W2Z A;  2QGU A;  4N6M A;  3CCR 3;  1STF I;  1AR0 A;  2IYJ A;  1G0T A;  4GHO A;  1ROV A;  3EBT A;  1NU3 A;  1GOV A;  1UI8 A;  1IVX A;  4RNY A;  2M7O A;  4HM3 B;  2YX9 A;  1LQM B;  1W00 A;  1Q81 4;  2Z7A A;  3HZP A;  2OWP A;  3Q90 A;  1W6Y A;  4N6N B;  2XGL A;  1EG9 B;  4N6U A;  2RBI A;  3J7Y d;  1M1K 4;  4GB5 A;  2GEY A;  3A5E A;  4FMB A;  3ZG5 A;  4HZB B;  1SPU A;  1TRP A;  3BNE A;  4J8T A;  1GSP A;  1OHS A;  2RNT A;  4ZM8 A;  4BU4 A;  3G8Z A;  4BTW A;  1BSB A;  4N6O B;  1T2H A;  1FW7 A;  3KSP A;  3CPW 2;  1B27 A;  3AGO A;  4ORL A;  4X2H A;  1YJN 3;  2XSO B;  2IA7 A;  3CC2 3;  4WP5 A;  3DXO A;  4X2O A;  3OWY A;  2C10 A;  2UX0 A;  5BIR A;  3SLU A;  2P09 A;  2CC3 A;  3G0K A;  2R41 A;  3WOF B;  1NJI 4;  1FGO A;  1VQQ A;  5I97 A;  1GS3 A;  1JZO A;  1TFK A;  3QK9 A;  2K3D A;  3LT9 A;  3AHW A;  4STD A;  3CME 3;  4KVH A;  1CH0 A;  3FKA A;  1Y4K A;  1IVV A;  1LVN A;  2XH9 A;  4U13 A;  1IU7 A;  2BMQ B;  1RTU A;  2QA4 3;  1FGQ A;  1I2G A;  1AV4 A;  1O7G B;  2KF5 A;  3NUV A;  5KP3 A;  5JPP A;  2CFD A;  1FGM A;  2CKF B;  1A90 A;  3F7S A;  1VQ8 3;  5BVB A;  2CFW A; 
#chains in the Genus database with same CATH homology
 3FH1 A;  2W2C A;  4RNZ A;  5CLK A;  2OQE C;  2CWV A;  4EYC A;  3CCU 3;  3F14 A;  3HIG A;  3MG1 A;  5D81 A;  1M1X B;  4HJL B;  4K1V A;  3X42 A;  2W9Q A;  3CMA 3;  1L5G B;  3WA2 X;  2Y74 A;  3HII A;  7STD A;  1ROA A;  4IT7 A;  1STD A;  4BTY A;  1UI7 A;  1DMQ A;  1QAK A;  3I0Y A;  3MPH A;  4H3U A;  4MMY B;  5AYR B;  2FGT A;  2OOV C;  4FMD A;  3S27 A;  3EJV A;  2CWT A;  1IV9 A;  4FCZ A;  3I55 3;  3RGA A;  3EN8 A;  3DZL A;  1JN5 A;  4FMC A;  2B1X B;  1J2B A;  3BND A;  1CYU A;  1IDP A;  1KD1 4;  2HML B;  3DMC A;  1GD3 A;  3U97 A;  2E2T A;  3U1W A;  3D3L A;  4OVM A;  3FG1 A;  1YHQ 3;  3MYT A;  1OCV A;  1W5Z A;  1CYV A;  2BMR B;  3FF0 A;  3OXA A;  3S67 A;  1JN5 B;  1QAF A;  3A76 A;  3JUM A;  1QVG 2;  1ISK A;  2MF7 A;  1N9E A;  4FR9 A;  4FMA A;  3QRD A;  4WWU C;  3UL5 A;  3G71 3;  3OV4 A;  3CC7 3;  1VQ9 3;  3CNM A;  2P0X A;  1IQ8 A;  2OCT A;  3CCV 3;  3B4P A;  2BO9 B;  3EX9 A;  4N6L A;  4OUQ A;  2JQ5 A;  4N6V 0;  1FGT A;  5LC7 A;  1LXE A;  2XRX B;  5IER A;  1E3V A;  4PEJ A;  2XSH B;  1ULJ B;  1C7H A;  1JRQ A;  2KXG A;  2P0M A;  3K9M C;  1VQO 3;  1FA3 A;  3EQQ B;  4AKY A;  3N9H A;  3PYJ A;  5BXQ A;  4R9L A;  2GU1 A;  1LNH A;  4O02 B;  5EQL A;  2BNG A;  2GBW B;  1N9J A;  1SII A;  3KII A;  3F8X A;  4FCJ A;  2Z76 A;  4XB5 A;  1D6U A;  3RGR A;  2LYX A;  3WOD G;  3FF2 A;  3NBJ A;  4HKV B;  3SX1 A;  5HGR A;  5JBS A;  3G4S 3;  1F8N A;  3SOY A;  1WMN A;  3EBY A;  1OHO A;  1OH0 A;  3WA3 A;  2GU3 A;  2B24 B;  4LZI A;  2ML5 A;  2P05 A;  4HM6 B;  1CQS A;  1ULI B;  2L4V A;  4WFO A;  2FNQ A;  4FCM A;  5ELU A;  2RCD A;  1BUQ A;  1YI2 3;  3KKG A;  4MJD A;  2R4I A;  1JNQ A;  3CCE 3;  3EN1 B;  3GZR A;  2BMO B;  1JV2 B;  1QJG A;  2WO0 A;  1GY5 A;  1JB2 A;  3DUK A;  3B8L A;  4OK0 A;  4XBT A;  3EF8 A;  1YGE A;  5IEP A;  1Q42 A;  3NQZ A;  3MG2 A;  2OQE A;  3STD A;  3CNX A;  2D42 A;  1W7C A;  2CW9 A;  4MEI A;  5AIG A;  2O9U X;  1JKG A;  3O8Y A;  3EHC A;  4CCV A;  1R4C A;  5IF6 A;  4HM0 B;  1E97 A;  2W04 A;  1KQS 2;  4R1K A;  4EC6 A;  2D1W A;  1IVW A;  3D9R A;  1GY7 A;  1ZX2 A;  1EKM A;  3F9S A;  1W6C A;  2W9P A;  3TDG A;  1KWI A;  1JKG B;  1NO3 A;  3FGY A;  4G1M B;  5ELJ A;  2P38 A;  3RDE A;  3LOY A;  4L8P A;  5AI1 A;  3V92 A;  1IQY A;  3KN4 A;  4XBX A;  1DYU A;  1DVD A;  1OGX A;  1O7H B;  1OHP A;  1RRH A;  2E2V A;  2QIY A;  1VQM 3;  3OW2 2;  1YJW 3;  1WTH A;  1NWW A;  3EC9 A;  2IUK A;  3JUQ A;  3CXC 2;  4L8O A;  3WMD A;  3OX9 A;  5EEO A;  4AKZ A;  5EVH A;  1QMA A;  2STD A;  3BLZ A;  4HM5 B;  3DGO A;  1W2B 2;  4AEQ A;  3S28 A;  4HVN A;  4I4K A;  2YFI B;  4N3V A;  3LTB A;  1TIJ A;  4LSO A;  1O7M B;  2OTL 3;  3MSO A;  1IQX A;  1SIH A;  1NDO B;  3KE7 A;  1LOX A;  2HMN B;  4KFE A;  5FW5 A;  3NBB A;  2RSX A;  1VQP 3;  2A15 A;  3S29 A;  3G6E 3;  1E3R A;  4NRE A;  1JJ2 2;  5JPU A;  2ZDJ A;  1TP6 A;  3IMA B;  3DGL A;  5AEU B;  3GZY B;  1Q82 4;  3H3H A;  1HU9 A;  1TUH A;  5KP4 A;  3VGN A;  3G16 A;  1V74 A;  3DY5 A;  1VQ4 3;  4HM1 B;  3ECF A;  3EE1 A;  5AEW B;  3FSD A;  3CCL 3;  1S72 3;  4H61 A;  2O3O A;  4KZ1 A;  3LZA A;  2RFR A;  1O7N B;  3NHX A;  4CDL A;  4O3V A;  3KSE D;  4QWT A;  3WDG B;  1SJW A;  3B7C A;  1M9G A;  2BHM A;  5AIH A;  1QAL A;  2CG1 A;  1ZO2 A;  2IMJ A;  6STD A;  3X40 A;  3MWZ A;  1NB5 I;  4GL6 A;  1SQW A;  5IEO A;  5IG0 A;  1A2V A;  1MNL A;  3CCM 3;  2CWU A;  1DMN A;  1IV7 A;  2XR8 B;  1EA2 A;  8CHO A;  4JF8 A;  1TFO A;  2JDI H;  4XBY A;  3WOE B;  1K73 4;  2CHC A;  4K1U A;  1T5Y A;  3T8N A;  3I56 3;  3JUP A;  1AVK A;  3N54 B;  1AVL A;  1K8A 4;  5AIF A;  3L0R A;  1TU5 A;  1YIJ 3;  4R80 A;  3F8H A;  2QEX 3;  1S5A A;  3JUN A;  3LT8 A;  2PZV A;  3FLJ A;  4KFD A;  1IK3 A;  1VQ5 3;  4JRF A;  3BB9 A;  3NXJ A;  5IG3 A;  1US1 A;  3FZW A;  3B4O A;  3X3X A;  3PGB A;  4HYZ A;  1OGZ A;  1YJ9 3;  3IPT A;  3SED A;  3MHE A;  4LEH A;  3VSY A;  4HM4 B;  1KC8 4;  1N5H A;  1RRL A;  3FG4 A;  1W6G A;  4LGQ A;  3X3Y A;  3FCS B;  2CH9 A;  2Z6B A;  1K28 A;  4NHF A;  1OAC A;  1GD4 A;  3LXU X;  4K90 B;  3V99 A;  3T8U A;  1O7W B;  1UW1 A;  4XM4 A;  2YFJ B;  2GEX A;  4EV5 A;  4K61 A;  2F86 B;  3DM8 A;  5LC6 A;  4HM2 B;  1VZZ A;  1UUW B;  1W01 A;  3HX8 A;  4XDW A;  3KFQ C;  3GRD A;  1CEW I;  1KSI A;  3UB1 A;  4LMI A;  2HMM B;  2K0M A;  1DMM A;  1ASK A;  3CD6 3;  3NQY A;  2FXT A;  1GYB A;  5AYS C;  4J9A A;  4IIA A;  3M8C A;  1VQ7 3;  4EV2 A;  3SVA A;  1RN7 A;  5D82 A;  4N6T A;  1Q40 A;  3K5T A;  2KRT A;  2E2U A;  3K0Z A;  2OOV A;  2F99 A;  3VF1 A;  4EBG A;  2WOH A;  5IW9 A;  4R4K A;  4O8S A;  5D83 A;  3V98 A;  4HM7 B;  2XFT A;  4KFF A;  2MC8 A;  3GWR A;  3KZT A;  3MKI A;  2HMJ B;  4HM8 B;  1WMO A;  3AMO A;  1U8C B;  3JUO A;  3LTD A;  1Q40 B;  3JVC A;  2CFG A;  1WMP A;  1RJO A;  2OTJ 3;  1IT7 A;  5TGN A;  3NX0 A;  1N8R 4;  3T0U A;  1QVF 2;  5CXO A;  5STD A;  1M90 4;  2Q07 A;  3FG3 A;  3NM2 A;  1YIT 3;  2ZL8 A;  1HKX A;  3GZB A;  3MG3 A;  4WHA A;  2XGN A;  3K7C A;  3AMO B;  3N8B A;  1N8Q A;  4RBN A;  3ROB A;  3HI7 A;  1IT8 A;  4TX4 A;  3X3Z A;  5DRV A;  2W0Q A;  3NV0 A;  2XFS A;  3DGM A;  4HZ9 B;  3NBR A;  1GY6 A;  1PFP A;  2W56 A;  3GZX B;  1VQK 3;  3EB8 A;  2I9W A;  2YFL B;  2RGQ A;  2WGQ A;  2SBL A;  1U5O A;  3NV0 B;  3HK4 A;  2HMK B;  4BTX A;  2F98 A;  3LTA A;  5CF2 A;  3OWS A;  2W56 B;  1A67 A;  2Y73 A;  2LQV A;  1Q7Y 4;  3E99 A;  2GXF A;  2W6J H;  4L7K A;  1A2K A;  3CC4 3;  3SOA A;  1FUW A;  2PNC A;  1DVC A;  3BNB A;  4WYK A;  1UUV B;  1N5P A;  5AII A;  3LTC A;  3Q1C A;  1G96 A;  1K41 A;  2K54 A;  2HMO B;  3UL6 A;  3NM7 A;  3LYG A;  3OWU A;  4WYK B;  4Q53 A;  3ALA A;  1D6Y A;  4O2H A;  5IG5 A;  2CFL A;  3ER7 A;  3IJE B;  3PS8 A;  4MMX B;  2WGO A;  2GBX B;  2V1L A;  2BT3 A;  3S5C A;  5G2G A;  5KP1 A;  1MOL A;  3GAX A;  2XEP A;  1D6Z A;  1WQL B;  3CCJ 3;  1OPY A;  3LML A;  3X41 A;  2IUJ A;  2INX A;  5IEN A;  4HBR A;  3PZW A;  1Q86 4;  5IG4 A;  3Q2P A;  1VQN 3;  4IPB A;  2C11 A;  3UNL A;  1NB3 I;  3CU3 A;  2Z77 A;  4XDV A;  4R9K A;  2CIU A;  3UJM A;  3CPO A;  1W4N A;  5DRE A;  1VQL 3;  2CG0 A;  3H51 A;  3K63 A;  1YVB I;  2W03 A;  1K9M 4;  3PXM A;  4RZM A;  1FGR A;  1JB4 A;  1OF5 A;  3CCS 3;  1WNH A;  2KCD A;  2XF3 A;  5FGO A;  5CF1 A;  3CCQ 3;  3PCR A;  4MMZ B;  1EQK A;  5CK6 A;  1Z1S A;  1JB5 A;  3F7X A;  2CK3 H;  4EXR A;  2CFK A;  1OF5 B;  1W02 A;  3SXX A;  1RKY A;  3PCS A;  3DGN A;  1IVU A;  1VQ6 3;  3BNC A;  1O7P B;  2WOF A;  2ML6 A;  3F40 A;  3LH4 A;  5A0O B;  1OUN A;  1PU4 A;  1W2Z A;  2QGU A;  4N6M A;  3CCR 3;  1STF I;  1AR0 A;  1ROV A;  3EBT A;  1NU3 A;  1UI8 A;  1IVX A;  4RNY A;  2M7O A;  4HM3 B;  2YX9 A;  1W00 A;  1Q81 4;  2Z7A A;  3HZP A;  2OWP A;  3Q90 A;  1W6Y A;  4N6N B;  2XGL A;  1EG9 B;  4N6U A;  3J7Y d;  1M1K 4;  4GB5 A;  2GEY A;  4FMB A;  4HZB B;  1SPU A;  3BNE A;  4J8T A;  1OHS A;  4ZM8 A;  4BTW A;  3G8Z A;  4N6O B;  3KSP A;  3CPW 2;  4ORL A;  4X2H A;  1YJN 3;  2XSO B;  2IA7 A;  3CC2 3;  4WP5 A;  3DXO A;  4X2O A;  3OWY A;  2C10 A;  2UX0 A;  3SLU A;  2P09 A;  2CC3 A;  3G0K A;  3WOF B;  1NJI 4;  1FGO A;  5I97 A;  1GS3 A;  1TFK A;  3QK9 A;  3LT9 A;  4STD A;  3CME 3;  4KVH A;  3FKA A;  1Y4K A;  1IVV A;  1LVN A;  2XH9 A;  4U13 A;  1IU7 A;  2BMQ B;  2QA4 3;  1FGQ A;  1AV4 A;  1O7G B;  3NUV A;  5KP3 A;  5JPP A;  2CFD A;  1FGM A;  2CKF B;  1A90 A;  3F7S A;  1VQ8 3;  5BVB A;  2CFW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...