2OTL3

Girodazole bound to the large subunit of haloarcula marismortui
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
92
structure length
92
Chain Sequence
b'MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
molecule tags Ribosome
total genus 16
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2otl300
1M1K4 3CME3 1YI23 1VQ83 2OTL3 1VQ63 1YJW3 1VQM3 1K9M4 3CC73 1YJN3 3CCM3 2QA43 1VQ93 1VQ43 1YIT3 3CC23 1Q864 3CCU3 1N8R4 3CXC2 1VQO3 3G6E3 1VQN3 3CD63 1JJ22 1YJ93 1YIJ3 3CCL3 1S723 3CCE3 1K8A4 3CMA3 3G713 2OTJ3 1Q824 3CCJ3 1VQL3 1VQP3 3CCV3 1Q814 3I553 3CCS3 1Q7Y4 3CC43 1W2B2 1VQ73 1QVG2 1NJI4 1QVF2 1VQ53 3I563 2QEX3 3OW22 1YHQ3 1KC84 3CCQ3 1VQK3 1KQS2 1KD14 3G4S3 1M904 3CCR3 1K734 3CPW2
chains in the Genus database with same CATH superfamily
5IF6A 1X1YA 2I9WA 3HI7A 1IK3A 2GEXA 2E2VA 1W02A 5LC6A 4K61A 3GZYB 4N6NB 3K0ZA 3BNEA 4CPKA 2CWTA 3A5EA 3CCU3 1LOXA 3WA3A 1KWIA 1OGXA 1AR0A 3OWSA 4H3UA 3RGRA 1AV4A 1BIRA 1BNEA 2BHMA 2XH9A 3V92A 5IEOA 1RNBA 3NM2A 1J2BA 3AMOB 1DMMA 3ECFA 2H0HA 1E97A 1G02A 1FGOA 1I2GA 4FCZA 4LMIA 4R1KA 1YGEA 5AIIA 2CHCA 1W00A 2OWPA 1A2KA 3KSED 4N6UA 4WYKA 1ULJB 3HZPA 1T2HA 1BRJA 1AQZA 3MG2A 7RNTA 1GMQA 1KQS2 1QJGA 1K28A 1KD14 4J5GA 1IQ8A 1RHLA 2OTL3 2C4BA 5RNTA 1TRQA 3OX9A 1DMQA 3NQZA 1UCJA 3LT9A 4LYLB 3CCM3 2CH9A 4STDA 1Z1SA 1CYVA 5IERA 1LNHA 3NQYA 3KCHA 1BOXA 5EVHA 1PFPA 3IMAB 3OXAA 3EBTA 5CF2A 1RLSA 2E2UA 2A15A 2OTJ3 2RSXA 2E2TA 3CNXA 3HIGA 3BU4A 3V98A 1IVXA 1QVG2 2RBIA 2KF3A 2WGOA 1RDSA 4JF8A 1LNIA 5AI1A 5CF1A 2QEX3 3OW22 3X42A 3CU3A 1LQMB 1OHPA 1W6GA 2HMKB 4I4KA 1SIIA 4L8OA 4GL6A 1O7MB 1VQK3 3X3XA 3JUMA 3DXOA 1RRLA 3HOHA 4U13A 2CC3A 2UUGC 1X1WA 2W04A 2F99A 1NNVA 3CNMA 2CK3H 2H0GA 2K3DA 2O9UX 3URPA 3D79A 3KE7A 1Q42A 1IV7A 3MKIA 4R80A 5KP4A 3LZAA 3FG4A 3CC23 3FF2A 2L4VA 3ZG0A 1AVLA 2GEYA 4HVNA 5KP1A 1W5ZA 5BXQA 5CK6A 1OF5B 4LSOA 3B7CA 8RNTA 3FGYA 2PNCA 4NHFA 1BSAA 3H51A 3BNBA 2LQVA 5D81A 4RZMA 3WODG 1RKYA 1VQ73 1JBSA 2C11A 5LC7A 3S27A 4J8TA 1B27A 2YX9A 2KF4A 4MJDA 1BAOA 4JRFA 1GY7A 3M8CA 2CFWA 5I97A 1W7CA 1VZZA 2RFRA 1EUIC 4WHAA 3CPW2 3VGNA 4LZIA 4MMZB 4HM3B 5IEPA 2R41A 2F5MA 5EQLA 2CIUA 3Q2PA 1Q9EA 2CFLA 3N8BA 1ULIB 1RGFA 5A0OB 4FMCA 1OUNA 3EBYA 4L7KA 3K63A 3KKGA 1YJ93 2CFGA 3K9MC 2M7OA 3FCSB 1JN5A 2P38A 4RNZA 1S723 1EQKA 4ZM8A 5EEOA 4XM4A 1VQP3 2JQ5A 4FMAA 4HKVB 3S29A 2KAAA 1O7NB 3PGBA 1A2VA 1MGWA 1LQGC 3S28A 3QK9A 3S5CA 5IG3A 2ML6A 1HU9A 1JNQA 1B20A 3OWUA 5G1LA 1RGLA 3FLJA 5M18A 1LRAA 4HM1B 4KFEA 1W6CA 1ROVA 5D82A 2W56B 4O02B 1YIT3 1OH0A 3BB9A 1N8QA 1VQN3 2W0QA 2CWUA 1B2UA 6STDA 2J8XB 3D3LA 1RCKA 5ELJA 3FSDA 1YIJ3 2LYXA 1QAKA 3G713 1B2MA 1FUTA 3FH1A 5IG4A 4DKIA 1CH0A 1ZGXA 3BNCA 1UCIA 1WMPA 3IPTA 1CYUA 5D83A 1BGSA 1U8CB 2STDA 2GU1A 4OVMA 1NB5I 3LYGA 1M904 1I70A 2GU3A 4BTWA 4EXRA 4HM4B 1BRIA 1I0VA 1UCKA 4R9KA 3DM8A 2UX0A 3CC73 4AKYA 3FKAA 4GB5A 1X1UA 3F40A 1FGQA 3A76A 1MGRA 4ORLA 1S5AA 4FMDA 2KXGA 3NBJA 1C54A 2Z7AA 1RNTA 4OUQA 1GMPA 2XGLA 3DUKA 3GSPA 1FW7A 1JKGA 1VQQA 1EKMA 5BIRA 2CWVA 3DGNA 1VQL3 1A90A 3CCV3 1MNLA 1I2EA 5G2GA 2SARA 3B4PA 1AY7A 1E3VA 3K7CA 3WDGB 1OGZA 1I8VA 1ASKA 2IA7A 3NUVA 3HK4A 3JUQA 3PZWA 3RGAA 5STDA 1SIHA 2IYJA 4KT3B 1KSIA 1DVDA 3MG1A 1BUQA 3AMOA 4EV5A 1MWUA 3SLUA 2OQEA 3SYUA 1MOLA 1TP6A 3FZWA 1Y4KA 3K5TA 4HM7B 3CD63 1BSEA 4KVHA 2CX0A 3F7SA 1IU7A 1IQYA 1O7GB 2W6JH 2AAEA 1LVNA 4RBNA 2YFLB 1R4YA 3NV0B 3CCJ3 3B8LA 5AEWB 3SEDA 3I553 1Q814 1A67A 2ML5A 2XSOB 3OWYA 3L0RA 3I563 4LEHA 1UUVB 4MEIA 1OCVA 3AHSA 3AGNA 2F98A 1RMSA 2CW9A 3UB1A 4N6V0 1UI8A 2SBLA 1FA3A 2XEPA 4N6TA 1N9JA 7STDA 1KC84 1B3SA 2WOHA 3J7Yd 2ZL8A 2BMRB 2H0IA 4HOHA 1DE3A 1VQ83 1IQXA 4FMBA 2Q07A 1K9M4 1VQ43 1DYUA 1Q864 1BVIA 3H3HA 1W01A 3STDA 1JB2A 3NXJA 1BRKA 2FGTA 3EJVA 4WP5A 1G96A 1GMRA 5GSPA 3CMA3 1OHOA 1RTUA 2Z77A 2PZVA 2Z76A 1BSDA 4CDLA 1PY3A 1GOVA 3D4AA 3WOEB 1YHQ3 1BSBA 3IJEB 1IVUA 4EBGA 4H61A 2BMOB 4CCVA 1YVSA 2IMJA 1NWWA 3VF1A 1RGHA 1FZUA 3F7XA 1YVBI 3LOYA 3NX0A 1EG9B 3WMDA 4HZBB 1YI23 2HMMB 4HM2B 5HGRA 4LGQA 1OF5A 2ZHXB 4N6MA 1GY6A 4QWTA 3LTDA 1B21A 2W9PA 1VQO3 3LH4A 2KF6A 4MMYB 3AGOA 3NM7A 1JB5A 2ZDJA 1OHSA 2CFDA 4RNYA 2QIYA 3U97A 4EYCA 1BNJA 2CKFB 3B4OA 1NO3A 4XBTA 1I3FA 1SJWA 2BT3A 4K1VA 2W2CA 1RCLA 1YGWA 1TJDA 4R4KA 4G1MB 1VQ53 1JBRA 2OOVC 2K54A 1BNRA 1RGGA 6RNTA 9RNTA 5BVBA 2OCTA 3HIIA 3D5IA 4IT7A 1FUSA 2WO0A 3CCR3 1ZX2A 3U1WA 1K734 1LXEA 1M1K4 3CME3 1VQ63 1TTOA 1K41A 1WNHA 1JV2B 5CLKA 1GSPA 1DMNA 1TRPA 1V58A 3GWRA 2GSPA 1WMOA 1RSNA 4O2HA 5JPPA 3DGMA 1US1A 1BU4A 1OPYA 2BNGA 3JUPA 3MSOA 1BUJA 3RNTA 3O8YA 3CC43 1O7PB 4J5KA 3DH2A 1UI7A 4ILFA 1MWSA 3F8HA 3EE1A 3CCQ3 2CG1A 1F8NA 2W56A 4RNTA 3DGLA 3G4S3 5IG5A 1IVWA 2OQEC 3DZLA 4IIAA 1LOYA 2CG0A 1BNIA 2Y73A 2IY2A 1B2SA 1T3BA 3EN1B 5AYSC 1WQLB 3SOAA 3BNDA 1GY5A 1HKXA 1I3IA 1Q40B 2KF5A 1RRHA 4HM8B 2K0MA 1BNFA 1RGEA 4HM6B 1UW1A 3PS8A 2BU4A 1N9EA 3PYJA 1L5GB 3KSPA 3GRDA 2QGUA 3MYTA 3GZBA 2B1XB 3CCE3 3DMCA 3S67A 3G16A 3VSYA 1B2ZA 4Q53A 3NBBA 3CCS3 1GD4A 1GOUA 1JRQA 1V74A 3E99A 3FG3A 1QAFA 3NHXA 3ROBA 5ELUA 1FYSA 2UGIA 1MWTA 5M1AA 2GXFA 1ZO2A 3T8NA 2YFJB 3MPHA 4NPBA 1D6YA 3UL5A 4BTYA 1G0TA 2BIRA 4HAAA 4WYKB 3X41A 6GSPA 1YJN3 1T2IA 1BSCA 2JDIH 5AIGA 2BO9B 2IUKA 3LTAA 8CHOA 3G6E3 1FUWA 4O3VA 1E3RA 2C10A 5IG0A 3X3YA 3AHWA 1JJ22 2YFIB 3N54B 1CQSA 1RGKA 2D42A 3FF0A 3GAXA 4N3VA 1N5PA 4BL2A 1X1XA 3EB8A 5KP3A 1HYFA 1GD3A 2XRXB 3PCSA 4XDWA 2D1WA 5FGOA 3EQQB 3ZG5A 1Q7Y4 1IYYA 3F9SA 1IT8A 3JUOA 2HOHA 4WWUC 4KFDA 1STDA 1ISKA 5DREA 1UUGB 4FCJA 3WOFB 2CX1A 1NU3A 3QRDA 3RDEA 1RGAA 1A2PA 1DVCA 1BNSA 1LOVA 2XR8B 1PYLA 3LXUX 2HMOB 1BRNL 4O8SA 1RN7A 2RNTA 1Q7HA 1SQWA 2HMLB 2WOFA 5G1KA 3UNLA 1NDOB 1WMNA 4BL3A 3HX8A 1TFOA 3NV0A 4XDVA 3N9HA 3Q3FA 3T0UA 1RN1A 4AEQA 1OACA 1RGCA 2P09A 3TDGA 4GSPA 1IVVA 5AIHA 3GZRA 4GHOA 3MHEA 2FNQA 5FW5A 1SPUA 4HJLB 1BRHA 3KFQC 4BTXA 1IV9A 4X2OA 5CXOA 1UDII 1I0XA 3D9RA 4N6LA 2F5WA 3V99A 1BANA 1TFKA 5HOHA 5IENA 1IDPA 1M1XB 3CPOA 1RJOA 2F56A 3KIIA 1U5OA 1QALA 3BLZA 1JB4A 3DY5A 1JZDA 3WA2X 1HZ1A 2V1LA 1D6UA 1GOYA 3Q90A 3WHOA 1YJW3 4IPBA 2Y74A 2HMNB 3CXC2 3DGOA 3X40A 1RN4A 5M19A 2MF7A 3FG1A 1BRGA 3T8UA 3EHCA 4EC6A 3MWZA 1TUHA 1PU4A 2P0MA 1FGMA 4XB5A 1LOWA 3MG3A 4XBXA 4NREA 1NB3I 2XFTA 1W2B2 4EV2A 1AVKA 3EN8A 2AADA 3F14A 2IUJA 4HM5B 1GYBA 4R9LA 1JN5B 2XFSA 3OV4A 1JBTA 1W4NA 2B24B 3UL6A 4L8PA 4KZ1A 1O7WB 1W6YA 4EW5A 1M9GA 5JBSA 3LT8A 1FGRA 1ROAA 1T5YA 4KFFA 2W03A 1JZOA 1STFI 2Z6BA 1UCLA 4FCMA 4J9AA 1VQM3 2QA43 3PCRA 1VQ93 1C7HA 3G8ZA 2GBWB 1UGIA 3SXXA 1N8R4 3ZFZA 4BIRA 2RGQA 2XSHB 1TIJA 1V57A 4HBRA 5DRVA 3LTCA 2W9QA 1B2XA 1BNGA 1EEJA 4I5QA 5IW9A 2XGNA 3SVAA 2P0XA 7GSPA 3EX9A 1K8A4 2FXTA 3KN4A 1SARA 3PXMA 1FGTA 3SX1A 1QVF2 3JVCA 4HYZA 2P05A 1NJI4 5AYRB 3X3ZA 1MWRA 3EF8A 2HMJB 3NBRA 1BRSA 1D6ZA 2F4YA 4CJNA 2XF3A 3GZXB 5JPUA 2GBXB 3D5GA 1I2FA 2O3OA 1QMAA 3DGYA 3G0KA 3JUNA 5AEUB 1YNVX 3LTBA 2MC8A 4HZ9B 1R4CA 1EA2A 2RCDA 3ER7A 2ZA4A 3F8XA 1O7HB 1CEWI 4K90B 3Q1CA 4HM0B 4K1UA 4AKZA 2L1SA 5TGNA 4BU4A 2WGQA 1DETA 3UJMA 3CCL3 1ZS7A 1UGHI 2KRTA 4PEJA 3WR2A 1UUWB 1Q824 3I0YA 4OK0A 1WTHA 4WFOA 2BMQB 5AIFA 3LMLA 4FR9A 4MMXB 4XBYA 1GS3A 2F86B 3KZTA 2CFKA 1IT7A 1TU5A 2R4IA 3BIRA 4TX4A 1N5HA 1JKGB 1W2ZA 3EC9A 3ALAA 1Q40A 3SOYA 4N6OB 5BU4A 2INXA 2KCDA 2OOVA 4X2HA
chains in the Genus database with same CATH topology
5IF6A 2I9WA 3HI7A 1IK3A 2GEXA 2E2VA 1W02A 5LC6A 4K61A 3GZYB 4N6NB 3K0ZA 3BNEA 2CWTA 3CCU3 1LOXA 3WA3A 1KWIA 1OGXA 1AR0A 3OWSA 4H3UA 3RGRA 1AV4A 2XH9A 2BHMA 3V92A 5IEOA 3NM2A 1J2BA 3AMOB 1DMMA 3ECFA 1E97A 1FGOA 4FCZA 4LMIA 4R1KA 5AIIA 4BTWA 1YGEA 2CHCA 1W00A 2OWPA 1A2KA 3KSED 4N6UA 4WYKA 1ULJB 3HZPA 3MG2A 1KQS2 1QJGA 1K28A 1KD14 1IQ8A 2OTL3 3OX9A 1DMQA 3NQZA 3LT9A 3CCM3 2CH9A 4STDA 1Z1SA 1CYVA 5IERA 1LNHA 3NQYA 5EVHA 1PFPA 3IMAB 3OXAA 3EBTA 5CF2A 2E2UA 2A15A 2OTJ3 2RSXA 2E2TA 3CNXA 3HIGA 3V98A 1IVXA 1QVG2 4JF8A 5AI1A 2WGOA 5CF1A 2QEX3 3OW22 3X42A 3CU3A 1OHPA 1W6GA 2HMKB 4I4KA 1VQK3 1SIIA 4L8OA 4GL6A 1O7MB 3X3XA 3JUMA 3DXOA 1RRLA 4U13A 2CC3A 2W04A 2F99A 3CNMA 2CK3H 2O9UX 3KE7A 3MKIA 1Q42A 1IV7A 4R80A 5KP4A 3LZAA 3FG4A 3CC23 3FF2A 2L4VA 1AVLA 2GEYA 4HVNA 5KP1A 1W5ZA 5BXQA 5CK6A 1OF5B 4LSOA 3B7CA 3FGYA 2PNCA 4NHFA 3H51A 3BNBA 2LQVA 5D81A 4RZMA 3WODG 1RKYA 1VQ73 2C11A 5LC7A 3S27A 4J8TA 2YX9A 4MJDA 4JRFA 1GY7A 3M8CA 2CFWA 5I97A 1W7CA 1VZZA 2RFRA 4WHAA 3CPW2 3VGNA 4LZIA 4MMZB 4HM3B 5IEPA 5EQLA 2CIUA 3Q2PA 2CFLA 3N8BA 1ULIB 5A0OB 4FMCA 1OUNA 3EBYA 4L7KA 3K63A 3KKGA 1YJ93 2CFGA 3K9MC 2M7OA 3FCSB 1JN5A 2P38A 4RNZA 1S723 1EQKA 4ZM8A 5EEOA 4XM4A 1VQP3 2JQ5A 4FMAA 4HKVB 3S29A 1O7NB 3PGBA 1A2VA 3S28A 3QK9A 3S5CA 5IG3A 2ML6A 1HU9A 1JNQA 3OWUA 3FLJA 4HM1B 4KFEA 1W6CA 1ROVA 5D82A 2W56B 4O02B 1YIT3 1OH0A 3BB9A 1N8QA 1VQN3 2W0QA 2CWUA 6STDA 3D3LA 5ELJA 3FSDA 1YIJ3 2LYXA 1QAKA 3G713 3FH1A 5IG4A 3BNCA 1WMPA 1CYUA 3IPTA 5D83A 1U8CB 2STDA 2GU1A 4OVMA 1NB5I 3LYGA 1M904 2GU3A 4EXRA 4HM4B 4R9KA 3DM8A 2UX0A 3CC73 4AKYA 3FKAA 4GB5A 3F40A 1FGQA 3A76A 4ORLA 1S5AA 4FMDA 2KXGA 3NBJA 2Z7AA 4OUQA 2XGLA 3DUKA 1JKGA 1EKMA 2CWVA 3DGNA 1VQL3 1A90A 3CCV3 1MNLA 5G2GA 3B4PA 1E3VA 3K7CA 3WDGB 1OGZA 1ASKA 2IA7A 3NUVA 3HK4A 3JUQA 3PZWA 3RGAA 5STDA 1SIHA 1KSIA 1DVDA 3MG1A 1BUQA 3AMOA 4EV5A 3SLUA 2OQEA 1MOLA 1TP6A 3FZWA 1Y4KA 3K5TA 4HM7B 3CD63 4KVHA 3F7SA 1IU7A 1IQYA 1O7GB 2W6JH 1LVNA 4RBNA 2YFLB 3NV0B 3CCJ3 3B8LA 5AEWB 3SEDA 3I553 1Q814 1A67A 2ML5A 2XSOB 3OWYA 3L0RA 3I563 4LEHA 1UUVB 4MEIA 1OCVA 2F98A 2CW9A 3UB1A 4N6V0 1UI8A 2SBLA 1FA3A 2XEPA 4N6TA 1N9JA 7STDA 1KC84 2WOHA 3J7Yd 2ZL8A 2BMRB 1VQ83 1IQXA 4FMBA 2Q07A 1K9M4 1VQ43 1DYUA 1Q864 3H3HA 1W01A 3STDA 1JB2A 3NXJA 2FGTA 3EJVA 4WP5A 1G96A 3CMA3 1OHOA 2Z77A 2PZVA 2Z76A 4CDLA 1YHQ3 3WOEB 3IJEB 1IVUA 4EBGA 4H61A 2BMOB 4CCVA 2IMJA 1NWWA 3VF1A 3NX0A 3F7XA 1YVBI 3LOYA 1EG9B 3WMDA 4HZBB 1YI23 2HMMB 4HM2B 5HGRA 4LGQA 1OF5A 4N6MA 1GY6A 4QWTA 3LTDA 2W9PA 1VQO3 3LH4A 4MMYB 3NM7A 1JB5A 2ZDJA 1OHSA 2CFDA 4RNYA 2QIYA 3U97A 4EYCA 2CKFB 3B4OA 1NO3A 4XBTA 1SJWA 2BT3A 4K1VA 2W2CA 4R4KA 1VQ53 4G1MB 2OOVC 2K54A 5BVBA 2OCTA 3HIIA 4IT7A 2WO0A 3CCR3 1ZX2A 3U1WA 1K734 1LXEA 1M1K4 3CME3 1VQ63 1K41A 1WNHA 1JV2B 5CLKA 1DMNA 3GWRA 1WMOA 4O2HA 5JPPA 3DGMA 1US1A 1OPYA 2BNGA 3JUPA 3MSOA 3O8YA 3CC43 1O7PB 1UI7A 3F8HA 3EE1A 3CCQ3 2CG1A 1F8NA 2W56A 3DGLA 3G4S3 5IG5A 1IVWA 2OQEC 3DZLA 4IIAA 2CG0A 2Y73A 3EN1B 5AYSC 1WQLB 3SOAA 3BNDA 1GY5A 1HKXA 1Q40B 4HM8B 1RRHA 2K0MA 4HM6B 1UW1A 3PS8A 1N9EA 3PYJA 1L5GB 3KSPA 3GRDA 2QGUA 3MYTA 3GZBA 2B1XB 3CCE3 3DMCA 3S67A 3G16A 3VSYA 4Q53A 3NBBA 3CCS3 1GD4A 1V74A 1JRQA 3E99A 3FG3A 1QAFA 3NHXA 3ROBA 5ELUA 2GXFA 1ZO2A 3T8NA 2YFJB 3MPHA 3UL5A 1D6YA 4BTYA 4WYKB 3X41A 1YJN3 2JDIH 5AIGA 2BO9B 2IUKA 3LTAA 8CHOA 3G6E3 1FUWA 4O3VA 1E3RA 2C10A 5IG0A 3X3YA 1JJ22 2YFIB 3N54B 1CQSA 2D42A 3GAXA 3FF0A 4N3VA 1N5PA 3EB8A 5KP3A 1GD3A 2XRXB 3PCSA 4XDWA 2D1WA 5FGOA 3EQQB 1Q7Y4 3F9SA 1IT8A 3JUOA 4WWUC 4KFDA 1STDA 1ISKA 5DREA 4FCJA 3WOFB 1NU3A 3QRDA 3RDEA 1DVCA 2XR8B 3LXUX 2HMOB 4O8SA 1RN7A 1SQWA 2HMLB 2WOFA 3UNLA 1NDOB 1WMNA 3HX8A 1TFOA 3NV0A 4XDVA 3N9HA 3T0UA 4AEQA 1OACA 2P09A 3TDGA 1IVVA 5AIHA 3GZRA 3MHEA 2FNQA 5FW5A 1SPUA 4HJLB 3KFQC 4BTXA 1IV9A 4X2OA 5CXOA 3D9RA 4N6LA 3V99A 1TFKA 5IENA 1IDPA 1M1XB 3CPOA 1RJOA 3KIIA 1U5OA 1QALA 3BLZA 1JB4A 3DY5A 3WA2X 2V1LA 1D6UA 3Q90A 1YJW3 4IPBA 2Y74A 2HMNB 3CXC2 3DGOA 3X40A 2MF7A 3FG1A 3T8UA 3EHCA 4EC6A 3MWZA 1TUHA 1PU4A 2P0MA 1FGMA 4XB5A 4XBXA 3MG3A 4NREA 1NB3I 2XFTA 1W2B2 4EV2A 1AVKA 3EN8A 3F14A 2IUJA 4HM5B 1GYBA 4R9LA 1JN5B 2XFSA 3OV4A 1W4NA 2B24B 3UL6A 4L8PA 4KZ1A 1O7WB 1W6YA 1M9GA 5JBSA 3LT8A 1FGRA 1ROAA 1T5YA 4KFFA 2W03A 1STFI 2Z6BA 4J9AA 4FCMA 1VQM3 2QA43 3PCRA 1VQ93 1C7HA 3G8ZA 2GBWB 3SXXA 1N8R4 2RGQA 2XSHB 1TIJA 4HBRA 5DRVA 3LTCA 2W9QA 5IW9A 2XGNA 3SVAA 2P0XA 1K8A4 3EX9A 2FXTA 3KN4A 3PXMA 3SX1A 1FGTA 1QVF2 3JVCA 4HYZA 2P05A 1NJI4 5AYRB 3X3ZA 3EF8A 2HMJB 3NBRA 1D6ZA 2XF3A 3GZXB 5JPUA 2GBXB 3G0KA 3JUNA 2O3OA 1QMAA 5AEUB 3LTBA 2MC8A 4HZ9B 1R4CA 1EA2A 2RCDA 3ER7A 3F8XA 1O7HB 1CEWI 4K90B 3Q1CA 4HM0B 4K1UA 4AKZA 5TGNA 2WGQA 3UJMA 3CCL3 2KRTA 4PEJA 1UUWB 1Q824 3I0YA 4OK0A 1WTHA 4WFOA 2BMQB 5AIFA 3LMLA 4FR9A 4MMXB 4XBYA 1GS3A 2F86B 3KZTA 2CFKA 1IT7A 1TU5A 2R4IA 4TX4A 1N5HA 1JKGB 1W2ZA 3EC9A 3ALAA 1Q40A 3SOYA 4N6OB 2INXA 2KCDA 2OOVA 4X2HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1K 4;  3CME 3;  1YI2 3;  1VQ8 3;  2OTL 3;  1VQ6 3;  1YJW 3;  1VQM 3;  1K9M 4;  3CC7 3;  1YJN 3;  3CCM 3;  2QA4 3;  1VQ9 3;  1VQ4 3;  1YIT 3;  3CC2 3;  1Q86 4;  3CCU 3;  1N8R 4;  3CXC 2;  1VQO 3;  3G6E 3;  1VQN 3;  3CD6 3;  1JJ2 2;  1YJ9 3;  1YIJ 3;  3CCL 3;  1S72 3;  3CCE 3;  1K8A 4;  3CMA 3;  3G71 3;  2OTJ 3;  1Q82 4;  3CCJ 3;  1VQL 3;  1VQP 3;  3CCV 3;  1Q81 4;  3I55 3;  3CCS 3;  1Q7Y 4;  3CC4 3;  1W2B 2;  1VQ7 3;  1QVG 2;  1NJI 4;  1QVF 2;  1VQ5 3;  3I56 3;  2QEX 3;  3OW2 2;  1YHQ 3;  1KC8 4;  3CCQ 3;  1VQK 3;  1KQS 2;  1KD1 4;  3G4S 3;  1M90 4;  3CCR 3;  1K73 4;  3CPW 2; 
#chains in the Genus database with same CATH topology
 5IF6 A;  1X1Y A;  2I9W A;  3HI7 A;  1IK3 A;  2GEX A;  2E2V A;  1W02 A;  5LC6 A;  4K61 A;  3GZY B;  4N6N B;  3K0Z A;  3BNE A;  4CPK A;  2CWT A;  3A5E A;  3CCU 3;  1LOX A;  3WA3 A;  1KWI A;  1OGX A;  1AR0 A;  3OWS A;  4H3U A;  3RGR A;  1AV4 A;  1BIR A;  1BNE A;  2BHM A;  2XH9 A;  3V92 A;  5IEO A;  1RNB A;  3NM2 A;  1J2B A;  3AMO B;  1DMM A;  3ECF A;  2H0H A;  1E97 A;  1G02 A;  1FGO A;  1I2G A;  4FCZ A;  4LMI A;  4R1K A;  1YGE A;  5AII A;  2CHC A;  1W00 A;  2OWP A;  1A2K A;  3KSE D;  4N6U A;  4WYK A;  1ULJ B;  3HZP A;  1T2H A;  1BRJ A;  1AQZ A;  3MG2 A;  7RNT A;  1GMQ A;  1KQS 2;  1QJG A;  1K28 A;  1KD1 4;  4J5G A;  1IQ8 A;  1RHL A;  2OTL 3;  2C4B A;  5RNT A;  1TRQ A;  3OX9 A;  1DMQ A;  3NQZ A;  1UCJ A;  3LT9 A;  4LYL B;  3CCM 3;  2CH9 A;  4STD A;  1Z1S A;  1CYV A;  5IER A;  1LNH A;  3NQY A;  3KCH A;  1BOX A;  5EVH A;  1PFP A;  3IMA B;  3OXA A;  3EBT A;  5CF2 A;  1RLS A;  2E2U A;  2A15 A;  2OTJ 3;  2RSX A;  2E2T A;  3CNX A;  3HIG A;  3BU4 A;  3V98 A;  1IVX A;  1QVG 2;  2RBI A;  2KF3 A;  2WGO A;  1RDS A;  4JF8 A;  1LNI A;  5AI1 A;  5CF1 A;  2QEX 3;  3OW2 2;  3X42 A;  3CU3 A;  1LQM B;  1OHP A;  1W6G A;  2HMK B;  4I4K A;  1SII A;  4L8O A;  4GL6 A;  1O7M B;  1VQK 3;  3X3X A;  3JUM A;  3DXO A;  1RRL A;  3HOH A;  4U13 A;  2CC3 A;  2UUG C;  1X1W A;  2W04 A;  2F99 A;  1NNV A;  3CNM A;  2CK3 H;  2H0G A;  2K3D A;  2O9U X;  3URP A;  3D79 A;  3KE7 A;  1Q42 A;  1IV7 A;  3MKI A;  4R80 A;  5KP4 A;  3LZA A;  3FG4 A;  3CC2 3;  3FF2 A;  2L4V A;  3ZG0 A;  1AVL A;  2GEY A;  4HVN A;  5KP1 A;  1W5Z A;  5BXQ A;  5CK6 A;  1OF5 B;  4LSO A;  3B7C A;  8RNT A;  3FGY A;  2PNC A;  4NHF A;  1BSA A;  3H51 A;  3BNB A;  2LQV A;  5D81 A;  4RZM A;  3WOD G;  1RKY A;  1VQ7 3;  1JBS A;  2C11 A;  5LC7 A;  3S27 A;  4J8T A;  1B27 A;  2YX9 A;  2KF4 A;  4MJD A;  1BAO A;  4JRF A;  1GY7 A;  3M8C A;  2CFW A;  5I97 A;  1W7C A;  1VZZ A;  2RFR A;  1EUI C;  4WHA A;  3CPW 2;  3VGN A;  4LZI A;  4MMZ B;  4HM3 B;  5IEP A;  2R41 A;  2F5M A;  5EQL A;  2CIU A;  3Q2P A;  1Q9E A;  2CFL A;  3N8B A;  1ULI B;  1RGF A;  5A0O B;  4FMC A;  1OUN A;  3EBY A;  4L7K A;  3K63 A;  3KKG A;  1YJ9 3;  2CFG A;  3K9M C;  2M7O A;  3FCS B;  1JN5 A;  2P38 A;  4RNZ A;  1S72 3;  1EQK A;  4ZM8 A;  5EEO A;  4XM4 A;  1VQP 3;  2JQ5 A;  4FMA A;  4HKV B;  3S29 A;  2KAA A;  1O7N B;  3PGB A;  1A2V A;  1MGW A;  1LQG C;  3S28 A;  3QK9 A;  3S5C A;  5IG3 A;  2ML6 A;  1HU9 A;  1JNQ A;  1B20 A;  3OWU A;  5G1L A;  1RGL A;  3FLJ A;  5M18 A;  1LRA A;  4HM1 B;  4KFE A;  1W6C A;  1ROV A;  5D82 A;  2W56 B;  4O02 B;  1YIT 3;  1OH0 A;  3BB9 A;  1N8Q A;  1VQN 3;  2W0Q A;  2CWU A;  1B2U A;  6STD A;  2J8X B;  3D3L A;  1RCK A;  5ELJ A;  3FSD A;  1YIJ 3;  2LYX A;  1QAK A;  3G71 3;  1B2M A;  1FUT A;  3FH1 A;  5IG4 A;  4DKI A;  1CH0 A;  1ZGX A;  3BNC A;  1UCI A;  1WMP A;  3IPT A;  1CYU A;  5D83 A;  1BGS A;  1U8C B;  2STD A;  2GU1 A;  4OVM A;  1NB5 I;  3LYG A;  1M90 4;  1I70 A;  2GU3 A;  4BTW A;  4EXR A;  4HM4 B;  1BRI A;  1I0V A;  1UCK A;  4R9K A;  3DM8 A;  2UX0 A;  3CC7 3;  4AKY A;  3FKA A;  4GB5 A;  1X1U A;  3F40 A;  1FGQ A;  3A76 A;  1MGR A;  4ORL A;  1S5A A;  4FMD A;  2KXG A;  3NBJ A;  1C54 A;  2Z7A A;  1RNT A;  4OUQ A;  1GMP A;  2XGL A;  3DUK A;  3GSP A;  1FW7 A;  1JKG A;  1VQQ A;  1EKM A;  5BIR A;  2CWV A;  3DGN A;  1VQL 3;  1A90 A;  3CCV 3;  1MNL A;  1I2E A;  5G2G A;  2SAR A;  3B4P A;  1AY7 A;  1E3V A;  3K7C A;  3WDG B;  1OGZ A;  1I8V A;  1ASK A;  2IA7 A;  3NUV A;  3HK4 A;  3JUQ A;  3PZW A;  3RGA A;  5STD A;  1SIH A;  2IYJ A;  4KT3 B;  1KSI A;  1DVD A;  3MG1 A;  1BUQ A;  3AMO A;  4EV5 A;  1MWU A;  3SLU A;  2OQE A;  3SYU A;  1MOL A;  1TP6 A;  3FZW A;  1Y4K A;  3K5T A;  4HM7 B;  3CD6 3;  1BSE A;  4KVH A;  2CX0 A;  3F7S A;  1IU7 A;  1IQY A;  1O7G B;  2W6J H;  2AAE A;  1LVN A;  4RBN A;  2YFL B;  1R4Y A;  3NV0 B;  3CCJ 3;  3B8L A;  5AEW B;  3SED A;  3I55 3;  1Q81 4;  1A67 A;  2ML5 A;  2XSO B;  3OWY A;  3L0R A;  3I56 3;  4LEH A;  1UUV B;  4MEI A;  1OCV A;  3AHS A;  3AGN A;  2F98 A;  1RMS A;  2CW9 A;  3UB1 A;  4N6V 0;  1UI8 A;  2SBL A;  1FA3 A;  2XEP A;  4N6T A;  1N9J A;  7STD A;  1KC8 4;  1B3S A;  2WOH A;  3J7Y d;  2ZL8 A;  2BMR B;  2H0I A;  4HOH A;  1DE3 A;  1VQ8 3;  1IQX A;  4FMB A;  2Q07 A;  1K9M 4;  1VQ4 3;  1DYU A;  1Q86 4;  1BVI A;  3H3H A;  1W01 A;  3STD A;  1JB2 A;  3NXJ A;  1BRK A;  2FGT A;  3EJV A;  4WP5 A;  1G96 A;  1GMR A;  5GSP A;  3CMA 3;  1OHO A;  1RTU A;  2Z77 A;  2PZV A;  2Z76 A;  1BSD A;  4CDL A;  1PY3 A;  1GOV A;  3D4A A;  3WOE B;  1YHQ 3;  1BSB A;  3IJE B;  1IVU A;  4EBG A;  4H61 A;  2BMO B;  4CCV A;  1YVS A;  2IMJ A;  1NWW A;  3VF1 A;  1RGH A;  1FZU A;  3F7X A;  1YVB I;  3LOY A;  3NX0 A;  1EG9 B;  3WMD A;  4HZB B;  1YI2 3;  2HMM B;  4HM2 B;  5HGR A;  4LGQ A;  1OF5 A;  2ZHX B;  4N6M A;  1GY6 A;  4QWT A;  3LTD A;  1B21 A;  2W9P A;  1VQO 3;  3LH4 A;  2KF6 A;  4MMY B;  3AGO A;  3NM7 A;  1JB5 A;  2ZDJ A;  1OHS A;  2CFD A;  4RNY A;  2QIY A;  3U97 A;  4EYC A;  1BNJ A;  2CKF B;  3B4O A;  1NO3 A;  4XBT A;  1I3F A;  1SJW A;  2BT3 A;  4K1V A;  2W2C A;  1RCL A;  1YGW A;  1TJD A;  4R4K A;  4G1M B;  1VQ5 3;  1JBR A;  2OOV C;  2K54 A;  1BNR A;  1RGG A;  6RNT A;  9RNT A;  5BVB A;  2OCT A;  3HII A;  3D5I A;  4IT7 A;  1FUS A;  2WO0 A;  3CCR 3;  1ZX2 A;  3U1W A;  1K73 4;  1LXE A;  1M1K 4;  3CME 3;  1VQ6 3;  1TTO A;  1K41 A;  1WNH A;  1JV2 B;  5CLK A;  1GSP A;  1DMN A;  1TRP A;  1V58 A;  3GWR A;  2GSP A;  1WMO A;  1RSN A;  4O2H A;  5JPP A;  3DGM A;  1US1 A;  1BU4 A;  1OPY A;  2BNG A;  3JUP A;  3MSO A;  1BUJ A;  3RNT A;  3O8Y A;  3CC4 3;  1O7P B;  4J5K A;  3DH2 A;  1UI7 A;  4ILF A;  1MWS A;  3F8H A;  3EE1 A;  3CCQ 3;  2CG1 A;  1F8N A;  2W56 A;  4RNT A;  3DGL A;  3G4S 3;  5IG5 A;  1IVW A;  2OQE C;  3DZL A;  4IIA A;  1LOY A;  2CG0 A;  1BNI A;  2Y73 A;  2IY2 A;  1B2S A;  1T3B A;  3EN1 B;  5AYS C;  1WQL B;  3SOA A;  3BND A;  1GY5 A;  1HKX A;  1I3I A;  1Q40 B;  2KF5 A;  1RRH A;  4HM8 B;  2K0M A;  1BNF A;  1RGE A;  4HM6 B;  1UW1 A;  3PS8 A;  2BU4 A;  1N9E A;  3PYJ A;  1L5G B;  3KSP A;  3GRD A;  2QGU A;  3MYT A;  3GZB A;  2B1X B;  3CCE 3;  3DMC A;  3S67 A;  3G16 A;  3VSY A;  1B2Z A;  4Q53 A;  3NBB A;  3CCS 3;  1GD4 A;  1GOU A;  1JRQ A;  1V74 A;  3E99 A;  3FG3 A;  1QAF A;  3NHX A;  3ROB A;  5ELU A;  1FYS A;  2UGI A;  1MWT A;  5M1A A;  2GXF A;  1ZO2 A;  3T8N A;  2YFJ B;  3MPH A;  4NPB A;  1D6Y A;  3UL5 A;  4BTY A;  1G0T A;  2BIR A;  4HAA A;  4WYK B;  3X41 A;  6GSP A;  1YJN 3;  1T2I A;  1BSC A;  2JDI H;  5AIG A;  2BO9 B;  2IUK A;  3LTA A;  8CHO A;  3G6E 3;  1FUW A;  4O3V A;  1E3R A;  2C10 A;  5IG0 A;  3X3Y A;  3AHW A;  1JJ2 2;  2YFI B;  3N54 B;  1CQS A;  1RGK A;  2D42 A;  3FF0 A;  3GAX A;  4N3V A;  1N5P A;  4BL2 A;  1X1X A;  3EB8 A;  5KP3 A;  1HYF A;  1GD3 A;  2XRX B;  3PCS A;  4XDW A;  2D1W A;  5FGO A;  3EQQ B;  3ZG5 A;  1Q7Y 4;  1IYY A;  3F9S A;  1IT8 A;  3JUO A;  2HOH A;  4WWU C;  4KFD A;  1STD A;  1ISK A;  5DRE A;  1UUG B;  4FCJ A;  3WOF B;  2CX1 A;  1NU3 A;  3QRD A;  3RDE A;  1RGA A;  1A2P A;  1DVC A;  1BNS A;  1LOV A;  2XR8 B;  1PYL A;  3LXU X;  2HMO B;  1BRN L;  4O8S A;  1RN7 A;  2RNT A;  1Q7H A;  1SQW A;  2HML B;  2WOF A;  5G1K A;  3UNL A;  1NDO B;  1WMN A;  4BL3 A;  3HX8 A;  1TFO A;  3NV0 A;  4XDV A;  3N9H A;  3Q3F A;  3T0U A;  1RN1 A;  4AEQ A;  1OAC A;  1RGC A;  2P09 A;  3TDG A;  4GSP A;  1IVV A;  5AIH A;  3GZR A;  4GHO A;  3MHE A;  2FNQ A;  5FW5 A;  1SPU A;  4HJL B;  1BRH A;  3KFQ C;  4BTX A;  1IV9 A;  4X2O A;  5CXO A;  1UDI I;  1I0X A;  3D9R A;  4N6L A;  2F5W A;  3V99 A;  1BAN A;  1TFK A;  5HOH A;  5IEN A;  1IDP A;  1M1X B;  3CPO A;  1RJO A;  2F56 A;  3KII A;  1U5O A;  1QAL A;  3BLZ A;  1JB4 A;  3DY5 A;  1JZD A;  3WA2 X;  1HZ1 A;  2V1L A;  1D6U A;  1GOY A;  3Q90 A;  3WHO A;  1YJW 3;  4IPB A;  2Y74 A;  2HMN B;  3CXC 2;  3DGO A;  3X40 A;  1RN4 A;  5M19 A;  2MF7 A;  3FG1 A;  1BRG A;  3T8U A;  3EHC A;  4EC6 A;  3MWZ A;  1TUH A;  1PU4 A;  2P0M A;  1FGM A;  4XB5 A;  1LOW A;  3MG3 A;  4XBX A;  4NRE A;  1NB3 I;  2XFT A;  1W2B 2;  4EV2 A;  1AVK A;  3EN8 A;  2AAD A;  3F14 A;  2IUJ A;  4HM5 B;  1GYB A;  4R9L A;  1JN5 B;  2XFS A;  3OV4 A;  1JBT A;  1W4N A;  2B24 B;  3UL6 A;  4L8P A;  4KZ1 A;  1O7W B;  1W6Y A;  4EW5 A;  1M9G A;  5JBS A;  3LT8 A;  1FGR A;  1ROA A;  1T5Y A;  4KFF A;  2W03 A;  1JZO A;  1STF I;  2Z6B A;  1UCL A;  4FCM A;  4J9A A;  1VQM 3;  2QA4 3;  3PCR A;  1VQ9 3;  1C7H A;  3G8Z A;  2GBW B;  1UGI A;  3SXX A;  1N8R 4;  3ZFZ A;  4BIR A;  2RGQ A;  2XSH B;  1TIJ A;  1V57 A;  4HBR A;  5DRV A;  3LTC A;  2W9Q A;  1B2X A;  1BNG A;  1EEJ A;  4I5Q A;  5IW9 A;  2XGN A;  3SVA A;  2P0X A;  7GSP A;  3EX9 A;  1K8A 4;  2FXT A;  3KN4 A;  1SAR A;  3PXM A;  1FGT A;  3SX1 A;  1QVF 2;  3JVC A;  4HYZ A;  2P05 A;  1NJI 4;  5AYR B;  3X3Z A;  1MWR A;  3EF8 A;  2HMJ B;  3NBR A;  1BRS A;  1D6Z A;  2F4Y A;  4CJN A;  2XF3 A;  3GZX B;  5JPU A;  2GBX B;  3D5G A;  1I2F A;  2O3O A;  1QMA A;  3DGY A;  3G0K A;  3JUN A;  5AEU B;  1YNV X;  3LTB A;  2MC8 A;  4HZ9 B;  1R4C A;  1EA2 A;  2RCD A;  3ER7 A;  2ZA4 A;  3F8X A;  1O7H B;  1CEW I;  4K90 B;  3Q1C A;  4HM0 B;  4K1U A;  4AKZ A;  2L1S A;  5TGN A;  4BU4 A;  2WGQ A;  1DET A;  3UJM A;  3CCL 3;  1ZS7 A;  1UGH I;  2KRT A;  4PEJ A;  3WR2 A;  1UUW B;  1Q82 4;  3I0Y A;  4OK0 A;  1WTH A;  4WFO A;  2BMQ B;  5AIF A;  3LML A;  4FR9 A;  4MMX B;  4XBY A;  1GS3 A;  2F86 B;  3KZT A;  2CFK A;  1IT7 A;  1TU5 A;  2R4I A;  3BIR A;  4TX4 A;  1N5H A;  1JKG B;  1W2Z A;  3EC9 A;  3ALA A;  1Q40 A;  3SOY A;  4N6O B;  5BU4 A;  2INX A;  2KCD A;  2OOV A;  4X2H A; 
#chains in the Genus database with same CATH homology
 5IF6 A;  2I9W A;  3HI7 A;  1IK3 A;  2GEX A;  2E2V A;  1W02 A;  5LC6 A;  4K61 A;  3GZY B;  4N6N B;  3K0Z A;  3BNE A;  2CWT A;  3CCU 3;  1LOX A;  3WA3 A;  1KWI A;  1OGX A;  1AR0 A;  3OWS A;  4H3U A;  3RGR A;  1AV4 A;  2XH9 A;  2BHM A;  3V92 A;  5IEO A;  3NM2 A;  1J2B A;  3AMO B;  1DMM A;  3ECF A;  1E97 A;  1FGO A;  4FCZ A;  4LMI A;  4R1K A;  5AII A;  4BTW A;  1YGE A;  2CHC A;  1W00 A;  2OWP A;  1A2K A;  3KSE D;  4N6U A;  4WYK A;  1ULJ B;  3HZP A;  3MG2 A;  1KQS 2;  1QJG A;  1K28 A;  1KD1 4;  1IQ8 A;  2OTL 3;  3OX9 A;  1DMQ A;  3NQZ A;  3LT9 A;  3CCM 3;  2CH9 A;  4STD A;  1Z1S A;  1CYV A;  5IER A;  1LNH A;  3NQY A;  5EVH A;  1PFP A;  3IMA B;  3OXA A;  3EBT A;  5CF2 A;  2E2U A;  2A15 A;  2OTJ 3;  2RSX A;  2E2T A;  3CNX A;  3HIG A;  3V98 A;  1IVX A;  1QVG 2;  4JF8 A;  5AI1 A;  2WGO A;  5CF1 A;  2QEX 3;  3OW2 2;  3X42 A;  3CU3 A;  1OHP A;  1W6G A;  2HMK B;  4I4K A;  1VQK 3;  1SII A;  4L8O A;  4GL6 A;  1O7M B;  3X3X A;  3JUM A;  3DXO A;  1RRL A;  4U13 A;  2CC3 A;  2W04 A;  2F99 A;  3CNM A;  2CK3 H;  2O9U X;  3KE7 A;  3MKI A;  1Q42 A;  1IV7 A;  4R80 A;  5KP4 A;  3LZA A;  3FG4 A;  3CC2 3;  3FF2 A;  2L4V A;  1AVL A;  2GEY A;  4HVN A;  5KP1 A;  1W5Z A;  5BXQ A;  5CK6 A;  1OF5 B;  4LSO A;  3B7C A;  3FGY A;  2PNC A;  4NHF A;  3H51 A;  3BNB A;  2LQV A;  5D81 A;  4RZM A;  3WOD G;  1RKY A;  1VQ7 3;  2C11 A;  5LC7 A;  3S27 A;  4J8T A;  2YX9 A;  4MJD A;  4JRF A;  1GY7 A;  3M8C A;  2CFW A;  5I97 A;  1W7C A;  1VZZ A;  2RFR A;  4WHA A;  3CPW 2;  3VGN A;  4LZI A;  4MMZ B;  4HM3 B;  5IEP A;  5EQL A;  2CIU A;  3Q2P A;  2CFL A;  3N8B A;  1ULI B;  5A0O B;  4FMC A;  1OUN A;  3EBY A;  4L7K A;  3K63 A;  3KKG A;  1YJ9 3;  2CFG A;  3K9M C;  2M7O A;  3FCS B;  1JN5 A;  2P38 A;  4RNZ A;  1S72 3;  1EQK A;  4ZM8 A;  5EEO A;  4XM4 A;  1VQP 3;  2JQ5 A;  4FMA A;  4HKV B;  3S29 A;  1O7N B;  3PGB A;  1A2V A;  3S28 A;  3QK9 A;  3S5C A;  5IG3 A;  2ML6 A;  1HU9 A;  1JNQ A;  3OWU A;  3FLJ A;  4HM1 B;  4KFE A;  1W6C A;  1ROV A;  5D82 A;  2W56 B;  4O02 B;  1YIT 3;  1OH0 A;  3BB9 A;  1N8Q A;  1VQN 3;  2W0Q A;  2CWU A;  6STD A;  3D3L A;  5ELJ A;  3FSD A;  1YIJ 3;  2LYX A;  1QAK A;  3G71 3;  3FH1 A;  5IG4 A;  3BNC A;  1WMP A;  1CYU A;  3IPT A;  5D83 A;  1U8C B;  2STD A;  2GU1 A;  4OVM A;  1NB5 I;  3LYG A;  1M90 4;  2GU3 A;  4EXR A;  4HM4 B;  4R9K A;  3DM8 A;  2UX0 A;  3CC7 3;  4AKY A;  3FKA A;  4GB5 A;  3F40 A;  1FGQ A;  3A76 A;  4ORL A;  1S5A A;  4FMD A;  2KXG A;  3NBJ A;  2Z7A A;  4OUQ A;  2XGL A;  3DUK A;  1JKG A;  1EKM A;  2CWV A;  3DGN A;  1VQL 3;  1A90 A;  3CCV 3;  1MNL A;  5G2G A;  3B4P A;  1E3V A;  3K7C A;  3WDG B;  1OGZ A;  1ASK A;  2IA7 A;  3NUV A;  3HK4 A;  3JUQ A;  3PZW A;  3RGA A;  5STD A;  1SIH A;  1KSI A;  1DVD A;  3MG1 A;  1BUQ A;  3AMO A;  4EV5 A;  3SLU A;  2OQE A;  1MOL A;  1TP6 A;  3FZW A;  1Y4K A;  3K5T A;  4HM7 B;  3CD6 3;  4KVH A;  3F7S A;  1IU7 A;  1IQY A;  1O7G B;  2W6J H;  1LVN A;  4RBN A;  2YFL B;  3NV0 B;  3CCJ 3;  3B8L A;  5AEW B;  3SED A;  3I55 3;  1Q81 4;  1A67 A;  2ML5 A;  2XSO B;  3OWY A;  3L0R A;  3I56 3;  4LEH A;  1UUV B;  4MEI A;  1OCV A;  2F98 A;  2CW9 A;  3UB1 A;  4N6V 0;  1UI8 A;  2SBL A;  1FA3 A;  2XEP A;  4N6T A;  1N9J A;  7STD A;  1KC8 4;  2WOH A;  3J7Y d;  2ZL8 A;  2BMR B;  1VQ8 3;  1IQX A;  4FMB A;  2Q07 A;  1K9M 4;  1VQ4 3;  1DYU A;  1Q86 4;  3H3H A;  1W01 A;  3STD A;  1JB2 A;  3NXJ A;  2FGT A;  3EJV A;  4WP5 A;  1G96 A;  3CMA 3;  1OHO A;  2Z77 A;  2PZV A;  2Z76 A;  4CDL A;  1YHQ 3;  3WOE B;  3IJE B;  1IVU A;  4EBG A;  4H61 A;  2BMO B;  4CCV A;  2IMJ A;  1NWW A;  3VF1 A;  3NX0 A;  3F7X A;  1YVB I;  3LOY A;  1EG9 B;  3WMD A;  4HZB B;  1YI2 3;  2HMM B;  4HM2 B;  5HGR A;  4LGQ A;  1OF5 A;  4N6M A;  1GY6 A;  4QWT A;  3LTD A;  2W9P A;  1VQO 3;  3LH4 A;  4MMY B;  3NM7 A;  1JB5 A;  2ZDJ A;  1OHS A;  2CFD A;  4RNY A;  2QIY A;  3U97 A;  4EYC A;  2CKF B;  3B4O A;  1NO3 A;  4XBT A;  1SJW A;  2BT3 A;  4K1V A;  2W2C A;  4R4K A;  1VQ5 3;  4G1M B;  2OOV C;  2K54 A;  5BVB A;  2OCT A;  3HII A;  4IT7 A;  2WO0 A;  3CCR 3;  1ZX2 A;  3U1W A;  1K73 4;  1LXE A;  1M1K 4;  3CME 3;  1VQ6 3;  1K41 A;  1WNH A;  1JV2 B;  5CLK A;  1DMN A;  3GWR A;  1WMO A;  4O2H A;  5JPP A;  3DGM A;  1US1 A;  1OPY A;  2BNG A;  3JUP A;  3MSO A;  3O8Y A;  3CC4 3;  1O7P B;  1UI7 A;  3F8H A;  3EE1 A;  3CCQ 3;  2CG1 A;  1F8N A;  2W56 A;  3DGL A;  3G4S 3;  5IG5 A;  1IVW A;  2OQE C;  3DZL A;  4IIA A;  2CG0 A;  2Y73 A;  3EN1 B;  5AYS C;  1WQL B;  3SOA A;  3BND A;  1GY5 A;  1HKX A;  1Q40 B;  4HM8 B;  1RRH A;  2K0M A;  4HM6 B;  1UW1 A;  3PS8 A;  1N9E A;  3PYJ A;  1L5G B;  3KSP A;  3GRD A;  2QGU A;  3MYT A;  3GZB A;  2B1X B;  3CCE 3;  3DMC A;  3S67 A;  3G16 A;  3VSY A;  4Q53 A;  3NBB A;  3CCS 3;  1GD4 A;  1V74 A;  1JRQ A;  3E99 A;  3FG3 A;  1QAF A;  3NHX A;  3ROB A;  5ELU A;  2GXF A;  1ZO2 A;  3T8N A;  2YFJ B;  3MPH A;  3UL5 A;  1D6Y A;  4BTY A;  4WYK B;  3X41 A;  1YJN 3;  2JDI H;  5AIG A;  2BO9 B;  2IUK A;  3LTA A;  8CHO A;  3G6E 3;  1FUW A;  4O3V A;  1E3R A;  2C10 A;  5IG0 A;  3X3Y A;  1JJ2 2;  2YFI B;  3N54 B;  1CQS A;  2D42 A;  3GAX A;  3FF0 A;  4N3V A;  1N5P A;  3EB8 A;  5KP3 A;  1GD3 A;  2XRX B;  3PCS A;  4XDW A;  2D1W A;  5FGO A;  3EQQ B;  1Q7Y 4;  3F9S A;  1IT8 A;  3JUO A;  4WWU C;  4KFD A;  1STD A;  1ISK A;  5DRE A;  4FCJ A;  3WOF B;  1NU3 A;  3QRD A;  3RDE A;  1DVC A;  2XR8 B;  3LXU X;  2HMO B;  4O8S A;  1RN7 A;  1SQW A;  2HML B;  2WOF A;  3UNL A;  1NDO B;  1WMN A;  3HX8 A;  1TFO A;  3NV0 A;  4XDV A;  3N9H A;  3T0U A;  4AEQ A;  1OAC A;  2P09 A;  3TDG A;  1IVV A;  5AIH A;  3GZR A;  3MHE A;  2FNQ A;  5FW5 A;  1SPU A;  4HJL B;  3KFQ C;  4BTX A;  1IV9 A;  4X2O A;  5CXO A;  3D9R A;  4N6L A;  3V99 A;  1TFK A;  5IEN A;  1IDP A;  1M1X B;  3CPO A;  1RJO A;  3KII A;  1U5O A;  1QAL A;  3BLZ A;  1JB4 A;  3DY5 A;  3WA2 X;  2V1L A;  1D6U A;  3Q90 A;  1YJW 3;  4IPB A;  2Y74 A;  2HMN B;  3CXC 2;  3DGO A;  3X40 A;  2MF7 A;  3FG1 A;  3T8U A;  3EHC A;  4EC6 A;  3MWZ A;  1TUH A;  1PU4 A;  2P0M A;  1FGM A;  4XB5 A;  4XBX A;  3MG3 A;  4NRE A;  1NB3 I;  2XFT A;  1W2B 2;  4EV2 A;  1AVK A;  3EN8 A;  3F14 A;  2IUJ A;  4HM5 B;  1GYB A;  4R9L A;  1JN5 B;  2XFS A;  3OV4 A;  1W4N A;  2B24 B;  3UL6 A;  4L8P A;  4KZ1 A;  1O7W B;  1W6Y A;  1M9G A;  5JBS A;  3LT8 A;  1FGR A;  1ROA A;  1T5Y A;  4KFF A;  2W03 A;  1STF I;  2Z6B A;  4J9A A;  4FCM A;  1VQM 3;  2QA4 3;  3PCR A;  1VQ9 3;  1C7H A;  3G8Z A;  2GBW B;  3SXX A;  1N8R 4;  2RGQ A;  2XSH B;  1TIJ A;  4HBR A;  5DRV A;  3LTC A;  2W9Q A;  5IW9 A;  2XGN A;  3SVA A;  2P0X A;  1K8A 4;  3EX9 A;  2FXT A;  3KN4 A;  3PXM A;  3SX1 A;  1FGT A;  1QVF 2;  3JVC A;  4HYZ A;  2P05 A;  1NJI 4;  5AYR B;  3X3Z A;  3EF8 A;  2HMJ B;  3NBR A;  1D6Z A;  2XF3 A;  3GZX B;  5JPU A;  2GBX B;  3G0K A;  3JUN A;  2O3O A;  1QMA A;  5AEU B;  3LTB A;  2MC8 A;  4HZ9 B;  1R4C A;  1EA2 A;  2RCD A;  3ER7 A;  3F8X A;  1O7H B;  1CEW I;  4K90 B;  3Q1C A;  4HM0 B;  4K1U A;  4AKZ A;  5TGN A;  2WGQ A;  3UJM A;  3CCL 3;  2KRT A;  4PEJ A;  1UUW B;  1Q82 4;  3I0Y A;  4OK0 A;  1WTH A;  4WFO A;  2BMQ B;  5AIF A;  3LML A;  4FR9 A;  4MMX B;  4XBY A;  1GS3 A;  2F86 B;  3KZT A;  2CFK A;  1IT7 A;  1TU5 A;  2R4I A;  4TX4 A;  1N5H A;  1JKG B;  1W2Z A;  3EC9 A;  3ALA A;  1Q40 A;  3SOY A;  4N6O B;  2INX A;  2KCD A;  2OOV A;  4X2H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...