1Q814

Crystal structure of minihelix with 3' puromycin bound to a-site of the 50s ribosomal subunit.
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into Peptide Bond Formation
pubmed doi rcsb
total genus 16
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1q81400
1VQ63 1K9M4 1VQL3 3CC23 3CCU3 1K734 1Q864 1Q7Y4 1VQ73 1S723 2QEX3 3CXC2 1VQO3 1K8A4 3CC43 3CD63 1YIJ3 1VQN3 3CPW2 1N8R4 1KD14 1M1K4 1VQK3 1JJ22 1VQ83 1YJ93 1VQ93 3CCS3 3CCL3 3G713 3CCJ3 3G4S3 3G6E3 3OW22 1YI23 1W2B2 1KQS2 1VQ53 1VQP3 2OTL3 2QA43 1VQM3 1NJI4 3CCM3 3CCQ3 3CCE3 1Q824 3CMA3 1VQ43 1YJW3 1YJN3 1YIT3 2OTJ3 3CC73 1QVF2 1QVG2 3I563 3CCV3 1KC84 3CCR3 3I553 1Q814 1M904 1YHQ3 3CME3
chains in the Genus database with same CATH superfamily
5CXOA 2W6JH 3WDGB 1L5GB 3LMLA 6GSPA 1UCJA 1BANA 5FGOA 1B2ZA 4BTWA 3WOFB 1VQ73 5DRVA 1TJDA 1TUHA 4ILFA 4XBYA 2KF3A 2JQ5A 1K8A4 4GSPA 1IDPA 1UDII 2RSXA 3OX9A 1BNSA 4LYLB 5IEOA 3S5CA 1VQN3 4HYZA 2XH9A 4BTXA 4HM6B 2OOVA 3X3XA 1SARA 1BAOA 1MNLA 3IPTA 3U97A 1I3IA 3DGLA 3QK9A 3KCHA 1OF5B 1EKMA 3HI7A 4BU4A 4FMAA 1ROVA 4AEQA 3NX0A 3DY5A 3HK4A 5BVBA 1RGGA 1BGSA 1T2IA 1VQQA 2PZVA 4G1MB 3NV0B 3SYUA 7GSPA 2GSPA 5JPUA 1ZS7A 1AVKA 3LTCA 4FMDA 1B3SA 4CCVA 1JZDA 4LZIA 5D82A 1WMNA 1EUIC 2P0XA 1A90A 2CG1A 4WWUC 1IU7A 1PYLA 1G02A 2GU1A 1VZZA 4JRFA 3CC43 1TRPA 3LTBA 3PCRA 1B21A 1N8R4 1GOVA 4K90B 4HKVB 1FUTA 1N5HA 1QAFA 1CQSA 3NM7A 1EA2A 1BSEA 2H0IA 2OTJ3 3BNDA 1YJW3 1MWRA 2CFDA 1OHOA 3JUNA 4HVNA 3DGOA 4RZMA 3U1WA 1HKXA 1QVF2 3KSED 3UNLA 1Q814 5IENA 2OCTA 2L1SA 3NQZA 1K9M4 2HMJB 3OWUA 1DETA 1R4YA 1FZUA 1I2FA 2IUKA 1I3FA 1BRSA 2ZA4A 1BRKA 1NNVA 3GZXB 1S723 1JBSA 4N6MA 2KF5A 3GWRA 1LOXA 1JKGA 2FNQA 4WYKA 2OOVC 1IQXA 1JB5A 1ULJB 4XM4A 1RNBA 3ZG5A 1YGWA 3CPW2 1GD3A 1UI8A 3ZG0A 4N6V0 1W2B2 2CWVA 1A2PA 1SQWA 3X40A 3BNEA 2KF4A 3MG1A 3TDGA 3NM2A 1QVG2 2LQVA 2CHCA 3AGNA 5I97A 1ZO2A 1N9JA 4EV2A 1B2UA 1W2ZA 4XBTA 3SVAA 1W00A 2BIRA 3QRDA 1RN1A 5M1AA 1W4NA 4HM4B 4EW5A 2GXFA 3F14A 4N6LA 4MEIA 3LTAA 4Q53A 4RBNA 1AR0A 1LNIA 3FLJA 1UW1A 3N9HA 2ML5A 3URPA 5IERA 4GB5A 4CJNA 1IV7A 2QIYA 3FH1A 1FUWA 4HM8B 1JN5B 3KE7A 3K5TA 4R4KA 1OGZA 1V74A 4HM3B 3FZWA 3M8CA 1RJOA 2AADA 5G1LA 1TU5A 2L4VA 3WMDA 4GL6A 1MWSA 1GY5A 1NU3A 3CU3A 5KP1A 3JUOA 1JBRA 2LYXA 1M904 3AMOA 1LOWA 4OUQA 4EYCA 3CME3 3PZWA 2SARA 1RN7A 3PGBA 1HYFA 1Q864 2D1WA 4ORLA 1TP6A 3BNBA 2IUJA 2IYJA 2RCDA 3S28A 1CH0A 1T3BA 4CPKA 4LMIA 2UUGC 1BNFA 2K54A 1JB4A 3B4PA 3RNTA 1LNHA 1SIHA 3L0RA 1RHLA 1QALA 1OACA 3SLUA 1W02A 1Q42A 5AEUB 2M7OA 2D42A 2RBIA 5FW5A 1YJ93 1C54A 3FGYA 1WMOA 3IJEB 1RDSA 3G4S3 5AIGA 4R9LA 3WOEB 3KN4A 3CCE3 1DVDA 2F99A 3EE1A 3WA3A 1IVVA 5TGNA 3CCV3 3D4AA 1YGEA 3MKIA 1A67A 1J2BA 1O7WB 2XGLA 3GSPA 4I5QA 9RNTA 1O7HB 1JV2B 1UI7A 1BSBA 1Q40B 1A2VA 3JUMA 1MGWA 1EEJA 2ML6A 3D79A 4I4KA 2O9UX 4AKZA 2QGUA 3SOAA 3GAXA 2BMRB 1YVBI 3KZTA 1I70A 4QWTA 6STDA 3FG1A 3RGRA 3K9MC 1YIJ3 2WOHA 3FG4A 2XR8B 3VGNA 4EC6A 5DREA 4HAAA 5AYRB 2BHMA 1B2SA 3CCJ3 2CWTA 4BTYA 2CFKA 4FMBA 2W03A 5G2GA 3LH4A 1FW7A 4HM2B 1D6UA 2P09A 1YJN3 3EBTA 1HZ1A 3H3HA 5KP3A 3NXJA 1BRJA 2HMMB 1BIRA 4HM5B 3I553 1OF5A 2GEXA 2Q07A 2Y73A 4LGQA 5AIIA 1Q9EA 5AI1A 2PNCA 1I2EA 1STFI 5CF1A 5IF6A 2E2VA 1K734 2C4BA 1JRQA 1SIIA 1W6CA 1LOYA 1Y4KA 3LTDA 4O02B 3DGMA 1IVXA 2QEX3 3LXUX 3NV0A 3EF8A 4XDWA 1GOYA 3NHXA 4WFOA 1ASKA 1W6YA 4FMCA 1CYUA 3BB9A 1B27A 1RGLA 4MMYB 3EN1B 2YX9A 2Z76A 3HZPA 3D9RA 1EG9B 3PYJA 1O7MB 4LSOA 3UL5A 1UUGB 1DYUA 3K7CA 1K28A 1VQP3 2OWPA 2F98A 2Z77A 3BIRA 4O8SA 3T0UA 1SPUA 1N9EA 1NWWA 2K3DA 2WOFA 3V98A 4KFFA 1B2XA 3Q1CA 4XB5A 1BUJA 3LT8A 2F4YA 1WTHA 1OPYA 1BRNL 1GOUA 1LQGC 3S27A 3PXMA 1M1XB 1SJWA 1RGCA 3O8YA 4U13A 7RNTA 4FCZA 2XSOB 1FUSA 3EBYA 3F8XA 1I0VA 3MPHA 8RNTA 3CXC2 2CX0A 1FA3A 2WGQA 2R41A 2XSHB 4HM7B 2WGOA 3D3LA 3CD63 1O7PB 2F56A 2E2UA 2OQEA 5M18A 1M1K4 1DE3A 3PCSA 1AY7A 3EQQB 4FCJA 3CCS3 4TX4A 5AYSC 2F86B 2W2CA 1RGHA 1AQZA 3CMA3 5BIRA 1U8CB 1UCLA 3MSOA 1B2MA 3CCR3 1C7HA 2XEPA 4L8PA 1BNGA 5CLKA 3A76A 3FKAA 2YFIB 3CNXA 1BUQA 1PFPA 4HZBB 2W56B 3NQYA 2E2TA 1UCKA 1GS3A 2GBWB 3Q90A 1X1UA 1T5YA 2IA7A 1BSAA 1HU9A 2CIUA 4EBGA 2CFLA 1LVNA 1N5PA 3B7CA 2BO9B 2P0MA 2INXA 4H61A 3FF0A 2A15A 2F5WA 5BXQA 1VQ83 2CG0A 1VQL3 3CCL3 1PY3A 3G6E3 4HM1B 3T8NA 5JPPA 3X3YA 1VQ53 1E97A 4WHAA 1E3VA 3D5IA 1JN5A 2XGNA 1BRIA 5JBSA 3SX1A 4MMZB 3MG2A 1I2GA 3OXAA 2O3OA 1BNJA 3NBJA 2YFLB 1Z1SA 4HBRA 3NBRA 4J8TA 3HIIA 3MYTA 5D81A 5KP4A 3GZBA 1MWUA 2J8XB 1TTOA 2KRTA 3MHEA 1X1WA 3AGOA 1AV4A 1FGRA 1TIJA 1G96A 1GMPA 1O7GB 3ALAA 1IT7A 3X41A 4N6OB 4J9AA 3GZRA 3ROBA 2GBXB 1PU4A 3UB1A 3WA2X 3WHOA 1YI23 2UX0A 2IY2A 1RCKA 1ZGXA 2CC3A 4J5KA 4KVHA 3VF1A 1OH0A 5IG4A 3CCM3 2W9PA 1VQ43 4HM0B 1OHPA 1MGRA 1EQKA 1YNVX 3BLZA 1W01A 3UJMA 4BL3A 6RNTA 3MG3A 2ZL8A 1YHQ3 1R4CA 3AHSA 2CW9A 4LEHA 2Y74A 3F8HA 1N8QA 2GEYA 4L7KA 2H0HA 3HIGA 4K61A 1Q40A 2WO0A 3LZAA 2RGQA 3AHWA 1D6ZA 1O7NB 1I0XA 1NDOB 4DKIA 7STDA 3DM8A 1MWTA 2XFTA 3FCSB 3STDA 1KD14 3G16A 1ISKA 1BNIA 8CHOA 3V92A 1UGHI 1FGOA 1IV9A 1WMPA 3G713 1ZX2A 2JDIH 3G0KA 2XF3A 4KFDA 1RTUA 1W6GA 3CCQ3 4NHFA 1K41A 3E99A 2V1LA 2W0QA 5GSPA 1CEWI 1RRLA 1ROAA 3X42A 1YIT3 1BSDA 1U5OA 3G8ZA 4R1KA 4CDLA 1F8NA 2K0MA 3DUKA 3Q3FA 2MC8A 2I9WA 2AAEA 1TFKA 2BMOB 1LXEA 1IQ8A 1CYVA 2XFSA 1Q7Y4 1AVLA 3IMAB 5HGRA 3I0YA 2YFJB 5LC7A 1UGIA 4RNTA 3T8UA 3DGYA 3GZYB 4HOHA 2B1XB 2BU4A 2H0GA 1VQO3 1NB5I 3DGNA 1RGFA 2GU3A 5A0OB 3J7Yd 3EHCA 3D5GA 1Q7HA 5RNTA 1RGKA 1JJ22 3DMCA 1FYSA 2XRXB 3DZLA 4IPBA 1NO3A 2F5MA 3ER7A 4X2HA 5D83A 1RLSA 3FSDA 2UGIA 1MOLA 1RGEA 2HMOB 3DH2A 3KFQC 3SEDA 5CF2A 1DMQA 1NB3I 1KSIA 4N3VA 1KC84 1RNTA 1GD4A 1DMNA 3MWZA 4KT3B 1RSNA 4H3UA 5ELUA 3LOYA 3PS8A 3EN8A 4RNZA 3RDEA 1IQYA 1YVSA 3BNCA 1UCIA 2CWUA 3OV4A 3SXXA 1DMMA 3JUPA 3LT9A 4L8OA 1RMSA 2RNTA 1RKYA 2BNGA 2CFGA 3H51A 3OWYA 4RNYA 2CK3H 3KSPA 3UL6A 1RGAA 3F9SA 1VQK3 5ELJA 1X1XA 3LYGA 2ZDJA 4NREA 1IYYA 4BL2A 1DVCA 1IT8A 1FGQA 5AIFA 2KF6A 1NJI4 3F7XA 1QJGA 1OGXA 3NBBA 5IEPA 1GMQA 2FGTA 4N6TA 4O2HA 2FXTA 4MMXB 1QAKA 2W9QA 4N6UA 4KZ1A 4J5GA 3K63A 3OWSA 4X2OA 4AKYA 1IVWA 1GYBA 4HZ9B 2KCDA 5LC6A 1JKGB 4IIAA 4EV5A 1QMAA 2SBLA 2Z6BA 4WYKB 5G1KA 1GSPA 2HMNB 1US1A 2B24B 3FF2A 5CK6A 2KAAA 1FGMA 3S67A 1UUVB 2HMLB 2W56A 5M19A 1WNHA 1BNEA 5EVHA 3V99A 3HOHA 1W7CA 3ECFA 2IMJA 1V57A 3Q2PA 4STDA 2P38A 4OVMA 5HOHA 1VQ93 4EXRA 3A5EA 1TFOA 4K1UA 1LQMB 1GY7A 2OTL3 2QA43 1VQM3 1JBTA 1S5AA 3EC9A 1LOVA 1STDA 2CX1A 2CFWA 4PEJA 1JNQA 1E3RA 1T2HA 3WODG 3I563 2C11A 3DXOA 2W04A 5EEOA 1X1YA 1LRAA 3BU4A 1ULIB 3JUQA 5IW9A 3CC23 1RRHA 1FGTA 1RCLA 3EB8A 1OCVA 1IVUA 3EJVA 3NUVA 4NPBA 4WP5A 2CH9A 1OUNA 3N8BA 4XDVA 4XBXA 2OQEC 4K1VA 1UUWB 5IG0A 5IG3A 2HMKB 1JZOA 2MF7A 3KIIA 2P05A 2Z7AA 1A2KA 3CPOA 3SOYA 3OW22 1KQS2 1B20A 1I8VA 1WQLB 2ZHXB 2R4IA 1Q824 3AMOB 1GY6A 5AEWB 5EQLA 3CC73 3CNMA 1JB2A 4N6NB 4OK0A 1M9GA 1BNRA 1D6YA 1BRGA 1OHSA 1KWIA 2CKFB 4FR9A 1GMRA 4R9KA 3RGAA 4BIRA 1VQ63 3CCU3 4HJLB 4ZM8A 3N54B 3FG3A 4R80A 3KKGA 2KXGA 3B8LA 1W5ZA 1BSCA 4FCMA 3JVCA 1BRHA 5AIHA 3GRDA 3X3ZA 2C10A 4O3VA 4JF8A 4GHOA 4IT7A 5STDA 3S29A 3VSYA 4KFEA 3HX8A 3F7SA 3K0ZA 1BU4A 5IG5A 1G0TA 5BU4A 3F40A 1BOXA 2BMQB 2BT3A 3B4OA 3WR2A 3ZFZA 1BVIA 1IK3A 2RFRA 1RN4A 2HOHA 3EX9A 4MJDA 2STDA 1V58A 1TRQA
chains in the Genus database with same CATH topology
5CXOA 2W6JH 3WDGB 1L5GB 3LMLA 5FGOA 4BTWA 3WOFB 1VQ73 5DRVA 1TUHA 4XBYA 2JQ5A 1K8A4 1IDPA 2RSXA 5IEOA 3OX9A 1VQN3 4HYZA 2XH9A 4BTXA 4HM6B 2OOVA 3X3XA 3IPTA 1MNLA 3U97A 3DGLA 3QK9A 1OF5B 1EKMA 3HI7A 4FMAA 1ROVA 4AEQA 3NX0A 3DY5A 3HK4A 5BVBA 4G1MB 2PZVA 5JPUA 3NV0B 1AVKA 3LTCA 4FMDA 4CCVA 4LZIA 5D82A 1WMNA 1A90A 2P0XA 2CG1A 4WWUC 1IU7A 4JRFA 2GU1A 3CC43 1VZZA 3LTBA 3PCRA 1N8R4 4K90B 4HKVB 1N5HA 1QAFA 1CQSA 3NM7A 1EA2A 2OTJ3 3BNDA 1YJW3 2CFDA 3JUNA 1OHOA 4HVNA 3DGOA 4RZMA 3U1WA 1HKXA 1QVF2 3KSED 3UNLA 1Q814 5IENA 2OCTA 3NQZA 1K9M4 2HMJB 3OWUA 3S5CA 2IUKA 3GZXB 1S723 4N6MA 3GWRA 1LOXA 1JKGA 2FNQA 4WYKA 2OOVC 1IQXA 1JB5A 1ULJB 4XM4A 3CPW2 1GD3A 1UI8A 4N6V0 1W2B2 2CWVA 1SQWA 3X40A 3BNEA 3MG1A 3TDGA 3NM2A 1QVG2 2LQVA 2CHCA 5I97A 1ZO2A 1N9JA 4EV2A 1W2ZA 4XBTA 3SVAA 1W00A 3QRDA 1W4NA 4HM4B 2GXFA 3F14A 4N6LA 4MEIA 3LTAA 4Q53A 4RBNA 1AR0A 3FLJA 1UW1A 3N9HA 2ML5A 5IERA 4GB5A 1IV7A 2QIYA 3FH1A 1FUWA 4HM8B 1JN5B 3KE7A 3K5TA 4R4KA 1OGZA 1V74A 4HM3B 3FZWA 3M8CA 1RJOA 1TU5A 2L4VA 3WMDA 4GL6A 1GY5A 1NU3A 3CU3A 5KP1A 3JUOA 2LYXA 1M904 3AMOA 4OUQA 4EYCA 3CME3 3PZWA 1RN7A 3PGBA 1Q864 2D1WA 4ORLA 1TP6A 3BNBA 2IUJA 2RCDA 3S28A 4LMIA 3B4PA 2K54A 1JB4A 1LNHA 1SIHA 3L0RA 1QALA 1OACA 3SLUA 1W02A 1Q42A 5AEUB 2M7OA 2D42A 5FW5A 1YJ93 3FGYA 1WMOA 3IJEB 3G4S3 5AIGA 4R9LA 3WOEB 3KN4A 3CCE3 1DVDA 2F99A 3EE1A 3WA3A 1IVVA 5TGNA 3CCV3 1YGEA 3MKIA 1A67A 1J2BA 1O7WB 2XGLA 1O7HB 1JV2B 1UI7A 1Q40B 1A2VA 3JUMA 2ML6A 4I4KA 2O9UX 4AKZA 2QGUA 3SOAA 3GAXA 2BMRB 1YVBI 3KZTA 6STDA 4QWTA 3FG1A 3RGRA 3K9MC 1YIJ3 2WOHA 3FG4A 2XR8B 3VGNA 4EC6A 5DREA 5AYRB 2BHMA 3CCJ3 2CWTA 4BTYA 2CFKA 4FMBA 2W03A 5G2GA 3LH4A 4HM2B 1D6UA 2P09A 1YJN3 3EBTA 5KP3A 3H3HA 3NXJA 2HMMB 4HM5B 3I553 1OF5A 2GEXA 2Q07A 2Y73A 4LGQA 5AIIA 5AI1A 2PNCA 1STFI 5CF1A 5IF6A 2E2VA 1K734 1JRQA 1SIIA 1W6CA 1Y4KA 3LTDA 4O02B 3DGMA 1IVXA 2QEX3 3LXUX 3NV0A 3EF8A 4XDWA 3NHXA 4WFOA 1ASKA 1W6YA 4FMCA 1CYUA 3BB9A 4MMYB 3EN1B 2YX9A 2Z76A 3HZPA 3D9RA 1EG9B 3PYJA 1O7MB 4LSOA 3UL5A 1DYUA 3K7CA 1K28A 1VQP3 2OWPA 2F98A 2Z77A 4O8SA 3T0UA 1SPUA 1N9EA 1NWWA 2WOFA 3V98A 4KFFA 3Q1CA 4XB5A 3LT8A 1WTHA 1OPYA 3S27A 3PXMA 1M1XB 1SJWA 4U13A 3O8YA 4FCZA 2XSOB 3CXC2 3EBYA 3F8XA 3MPHA 1FA3A 2WGQA 2XSHB 4HM7B 2WGOA 3D3LA 3CD63 1O7PB 2E2UA 2OQEA 1M1K4 3PCSA 3EQQB 4FCJA 3CCS3 4TX4A 5AYSC 2F86B 2W2CA 3CMA3 1U8CB 3MSOA 3CCR3 1C7HA 2XEPA 4L8PA 5CLKA 3A76A 3FKAA 2YFIB 3CNXA 1BUQA 1PFPA 4HZBB 2W56B 3NQYA 2E2TA 1GS3A 2GBWB 3Q90A 2IA7A 1T5YA 1HU9A 2CIUA 4EBGA 2CFLA 1LVNA 1N5PA 3B7CA 2BO9B 2P0MA 2INXA 4H61A 3FF0A 2A15A 1VQ83 5BXQA 2CG0A 3CCL3 3G6E3 4HM1B 3T8NA 5JPPA 3X3YA 1VQ53 1E97A 4WHAA 1E3VA 1JN5A 2XGNA 5JBSA 3SX1A 4MMZB 3MG2A 3OXAA 2O3OA 3NBJA 2YFLB 1Z1SA 4HBRA 3NBRA 4J8TA 3HIIA 3MYTA 5D81A 3GZBA 2KRTA 3MHEA 1AV4A 1FGRA 1TIJA 1G96A 1O7GB 3ALAA 1IT7A 3X41A 4N6OB 4J9AA 3GZRA 3ROBA 2GBXB 1PU4A 3UB1A 3WA2X 1YI23 2UX0A 2CC3A 4KVHA 3VF1A 1OH0A 5IG4A 3CCM3 2W9PA 1VQ43 4HM0B 1OHPA 1EQKA 3BLZA 3UJMA 1W01A 3MG3A 2ZL8A 1YHQ3 1R4CA 2CW9A 4LEHA 2Y74A 3F8HA 1N8QA 2GEYA 4L7KA 3HIGA 4K61A 1Q40A 2WO0A 3LZAA 2RGQA 1D6ZA 1O7NB 1NDOB 7STDA 3DM8A 3FCSB 2XFTA 3STDA 1KD14 3G16A 1ISKA 8CHOA 3V92A 1FGOA 1IV9A 1WMPA 3G713 1ZX2A 2JDIH 3G0KA 2XF3A 4KFDA 1W6GA 3CCQ3 4NHFA 1K41A 3E99A 2V1LA 2W0QA 1YIT3 1CEWI 1RRLA 1ROAA 3X42A 1U5OA 4R1KA 3G8ZA 4CDLA 1F8NA 2K0MA 3DUKA 2MC8A 2I9WA 1TFKA 2BMOB 1LXEA 1IQ8A 1CYVA 2XFSA 1Q7Y4 1AVLA 3IMAB 5HGRA 3I0YA 2YFJB 5LC7A 3T8UA 3GZYB 1VQO3 2B1XB 1NB5I 3DGNA 2GU3A 5A0OB 3J7Yd 3EHCA 1JJ22 3DMCA 2XRXB 3DZLA 4IPBA 1NO3A 3ER7A 4X2HA 5D83A 3FSDA 5KP4A 1MOLA 2HMOB 3KFQC 3SEDA 5CF2A 1DMQA 1NB3I 1KSIA 4N3VA 1KC84 1GD4A 1DMNA 3MWZA 4H3UA 5ELUA 3LOYA 3PS8A 3EN8A 4RNZA 3RDEA 1IQYA 3BNCA 3OV4A 3SXXA 2CWUA 1DMMA 3JUPA 3LT9A 4L8OA 1RKYA 2BNGA 2CFGA 3H51A 3OWYA 4RNYA 2CK3H 3KSPA 3UL6A 3F9SA 1VQK3 5ELJA 3LYGA 4NREA 2ZDJA 1DVCA 1IT8A 1FGQA 5AIFA 1NJI4 3F7XA 1QJGA 1OGXA 3NBBA 5IEPA 2FGTA 4N6TA 4O2HA 2FXTA 4MMXB 1QAKA 2W9QA 4N6UA 4KZ1A 3K63A 3OWSA 4X2OA 4AKYA 1IVWA 1GYBA 4HZ9B 2KCDA 5LC6A 1JKGB 4IIAA 4EV5A 1QMAA 2SBLA 2Z6BA 4WYKB 2HMNB 1US1A 2B24B 3FF2A 5CK6A 1FGMA 3S67A 1UUVB 2HMLB 2W56A 1WNHA 5EVHA 3V99A 1W7CA 3ECFA 2IMJA 3Q2PA 4STDA 2P38A 4OVMA 1VQ93 4EXRA 1TFOA 4K1UA 1GY7A 2OTL3 2QA43 1VQM3 1S5AA 3EC9A 1STDA 3WODG 2CFWA 4PEJA 1JNQA 1E3RA 3I563 2C11A 3DXOA 2W04A 5EEOA 3JUQA 1ULIB 5IW9A 1VQL3 3CC23 1FGTA 1RRHA 3EB8A 3EJVA 1OCVA 1IVUA 3NUVA 4WP5A 2CH9A 1OUNA 3N8BA 4XDVA 4XBXA 2OQEC 4K1VA 1UUWB 5IG0A 5IG3A 2HMKB 2MF7A 3KIIA 2P05A 2Z7AA 1A2KA 3CPOA 3SOYA 3OW22 1KQS2 1WQLB 2R4IA 1Q824 3AMOB 1GY6A 5AEWB 5EQLA 3CC73 3CNMA 1JB2A 4N6NB 4OK0A 1M9GA 1D6YA 1OHSA 2CKFB 1KWIA 4FR9A 4R9KA 3RGAA 1VQ63 3CCU3 4HJLB 4ZM8A 3N54B 3FG3A 4R80A 3KKGA 2KXGA 3B8LA 1W5ZA 4FCMA 3JVCA 5AIHA 3GRDA 3X3ZA 2C10A 4O3VA 4JF8A 4IT7A 5STDA 3S29A 3VSYA 4KFEA 3HX8A 3F7SA 3K0ZA 5IG5A 3F40A 2BMQB 2BT3A 3B4OA 1IK3A 2RFRA 3EX9A 4MJDA 2STDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ6 3;  1K9M 4;  1VQL 3;  3CC2 3;  3CCU 3;  1K73 4;  1Q86 4;  1Q7Y 4;  1VQ7 3;  1S72 3;  2QEX 3;  3CXC 2;  1VQO 3;  1K8A 4;  3CC4 3;  3CD6 3;  1YIJ 3;  1VQN 3;  3CPW 2;  1N8R 4;  1KD1 4;  1M1K 4;  1VQK 3;  1JJ2 2;  1VQ8 3;  1YJ9 3;  1VQ9 3;  3CCS 3;  3CCL 3;  3G71 3;  3CCJ 3;  3G4S 3;  3G6E 3;  3OW2 2;  1YI2 3;  1W2B 2;  1KQS 2;  1VQ5 3;  1VQP 3;  2OTL 3;  2QA4 3;  1VQM 3;  1NJI 4;  3CCM 3;  3CCQ 3;  3CCE 3;  1Q82 4;  3CMA 3;  1VQ4 3;  1YJW 3;  1YJN 3;  1YIT 3;  2OTJ 3;  3CC7 3;  1QVF 2;  1QVG 2;  3I56 3;  3CCV 3;  1KC8 4;  3CCR 3;  3I55 3;  1Q81 4;  1M90 4;  1YHQ 3;  3CME 3; 
#chains in the Genus database with same CATH topology
 5CXO A;  2W6J H;  3WDG B;  1L5G B;  3LML A;  6GSP A;  1UCJ A;  1BAN A;  5FGO A;  1B2Z A;  4BTW A;  3WOF B;  1VQ7 3;  5DRV A;  1TJD A;  1TUH A;  4ILF A;  4XBY A;  2KF3 A;  2JQ5 A;  1K8A 4;  4GSP A;  1IDP A;  1UDI I;  2RSX A;  3OX9 A;  1BNS A;  4LYL B;  5IEO A;  3S5C A;  1VQN 3;  4HYZ A;  2XH9 A;  4BTX A;  4HM6 B;  2OOV A;  3X3X A;  1SAR A;  1BAO A;  1MNL A;  3IPT A;  3U97 A;  1I3I A;  3DGL A;  3QK9 A;  3KCH A;  1OF5 B;  1EKM A;  3HI7 A;  4BU4 A;  4FMA A;  1ROV A;  4AEQ A;  3NX0 A;  3DY5 A;  3HK4 A;  5BVB A;  1RGG A;  1BGS A;  1T2I A;  1VQQ A;  2PZV A;  4G1M B;  3NV0 B;  3SYU A;  7GSP A;  2GSP A;  5JPU A;  1ZS7 A;  1AVK A;  3LTC A;  4FMD A;  1B3S A;  4CCV A;  1JZD A;  4LZI A;  5D82 A;  1WMN A;  1EUI C;  2P0X A;  1A90 A;  2CG1 A;  4WWU C;  1IU7 A;  1PYL A;  1G02 A;  2GU1 A;  1VZZ A;  4JRF A;  3CC4 3;  1TRP A;  3LTB A;  3PCR A;  1B21 A;  1N8R 4;  1GOV A;  4K90 B;  4HKV B;  1FUT A;  1N5H A;  1QAF A;  1CQS A;  3NM7 A;  1EA2 A;  1BSE A;  2H0I A;  2OTJ 3;  3BND A;  1YJW 3;  1MWR A;  2CFD A;  1OHO A;  3JUN A;  4HVN A;  3DGO A;  4RZM A;  3U1W A;  1HKX A;  1QVF 2;  3KSE D;  3UNL A;  1Q81 4;  5IEN A;  2OCT A;  2L1S A;  3NQZ A;  1K9M 4;  2HMJ B;  3OWU A;  1DET A;  1R4Y A;  1FZU A;  1I2F A;  2IUK A;  1I3F A;  1BRS A;  2ZA4 A;  1BRK A;  1NNV A;  3GZX B;  1S72 3;  1JBS A;  4N6M A;  2KF5 A;  3GWR A;  1LOX A;  1JKG A;  2FNQ A;  4WYK A;  2OOV C;  1IQX A;  1JB5 A;  1ULJ B;  4XM4 A;  1RNB A;  3ZG5 A;  1YGW A;  3CPW 2;  1GD3 A;  1UI8 A;  3ZG0 A;  4N6V 0;  1W2B 2;  2CWV A;  1A2P A;  1SQW A;  3X40 A;  3BNE A;  2KF4 A;  3MG1 A;  3TDG A;  3NM2 A;  1QVG 2;  2LQV A;  2CHC A;  3AGN A;  5I97 A;  1ZO2 A;  1N9J A;  4EV2 A;  1B2U A;  1W2Z A;  4XBT A;  3SVA A;  1W00 A;  2BIR A;  3QRD A;  1RN1 A;  5M1A A;  1W4N A;  4HM4 B;  4EW5 A;  2GXF A;  3F14 A;  4N6L A;  4MEI A;  3LTA A;  4Q53 A;  4RBN A;  1AR0 A;  1LNI A;  3FLJ A;  1UW1 A;  3N9H A;  2ML5 A;  3URP A;  5IER A;  4GB5 A;  4CJN A;  1IV7 A;  2QIY A;  3FH1 A;  1FUW A;  4HM8 B;  1JN5 B;  3KE7 A;  3K5T A;  4R4K A;  1OGZ A;  1V74 A;  4HM3 B;  3FZW A;  3M8C A;  1RJO A;  2AAD A;  5G1L A;  1TU5 A;  2L4V A;  3WMD A;  4GL6 A;  1MWS A;  1GY5 A;  1NU3 A;  3CU3 A;  5KP1 A;  3JUO A;  1JBR A;  2LYX A;  1M90 4;  3AMO A;  1LOW A;  4OUQ A;  4EYC A;  3CME 3;  3PZW A;  2SAR A;  1RN7 A;  3PGB A;  1HYF A;  1Q86 4;  2D1W A;  4ORL A;  1TP6 A;  3BNB A;  2IUJ A;  2IYJ A;  2RCD A;  3S28 A;  1CH0 A;  1T3B A;  4CPK A;  4LMI A;  2UUG C;  1BNF A;  2K54 A;  1JB4 A;  3B4P A;  3RNT A;  1LNH A;  1SIH A;  3L0R A;  1RHL A;  1QAL A;  1OAC A;  3SLU A;  1W02 A;  1Q42 A;  5AEU B;  2M7O A;  2D42 A;  2RBI A;  5FW5 A;  1YJ9 3;  1C54 A;  3FGY A;  1WMO A;  3IJE B;  1RDS A;  3G4S 3;  5AIG A;  4R9L A;  3WOE B;  3KN4 A;  3CCE 3;  1DVD A;  2F99 A;  3EE1 A;  3WA3 A;  1IVV A;  5TGN A;  3CCV 3;  3D4A A;  1YGE A;  3MKI A;  1A67 A;  1J2B A;  1O7W B;  2XGL A;  3GSP A;  4I5Q A;  9RNT A;  1O7H B;  1JV2 B;  1UI7 A;  1BSB A;  1Q40 B;  1A2V A;  3JUM A;  1MGW A;  1EEJ A;  2ML6 A;  3D79 A;  4I4K A;  2O9U X;  4AKZ A;  2QGU A;  3SOA A;  3GAX A;  2BMR B;  1YVB I;  3KZT A;  1I70 A;  4QWT A;  6STD A;  3FG1 A;  3RGR A;  3K9M C;  1YIJ 3;  2WOH A;  3FG4 A;  2XR8 B;  3VGN A;  4EC6 A;  5DRE A;  4HAA A;  5AYR B;  2BHM A;  1B2S A;  3CCJ 3;  2CWT A;  4BTY A;  2CFK A;  4FMB A;  2W03 A;  5G2G A;  3LH4 A;  1FW7 A;  4HM2 B;  1D6U A;  2P09 A;  1YJN 3;  3EBT A;  1HZ1 A;  3H3H A;  5KP3 A;  3NXJ A;  1BRJ A;  2HMM B;  1BIR A;  4HM5 B;  3I55 3;  1OF5 A;  2GEX A;  2Q07 A;  2Y73 A;  4LGQ A;  5AII A;  1Q9E A;  5AI1 A;  2PNC A;  1I2E A;  1STF I;  5CF1 A;  5IF6 A;  2E2V A;  1K73 4;  2C4B A;  1JRQ A;  1SII A;  1W6C A;  1LOY A;  1Y4K A;  3LTD A;  4O02 B;  3DGM A;  1IVX A;  2QEX 3;  3LXU X;  3NV0 A;  3EF8 A;  4XDW A;  1GOY A;  3NHX A;  4WFO A;  1ASK A;  1W6Y A;  4FMC A;  1CYU A;  3BB9 A;  1B27 A;  1RGL A;  4MMY B;  3EN1 B;  2YX9 A;  2Z76 A;  3HZP A;  3D9R A;  1EG9 B;  3PYJ A;  1O7M B;  4LSO A;  3UL5 A;  1UUG B;  1DYU A;  3K7C A;  1K28 A;  1VQP 3;  2OWP A;  2F98 A;  2Z77 A;  3BIR A;  4O8S A;  3T0U A;  1SPU A;  1N9E A;  1NWW A;  2K3D A;  2WOF A;  3V98 A;  4KFF A;  1B2X A;  3Q1C A;  4XB5 A;  1BUJ A;  3LT8 A;  2F4Y A;  1WTH A;  1OPY A;  1BRN L;  1GOU A;  1LQG C;  3S27 A;  3PXM A;  1M1X B;  1SJW A;  1RGC A;  3O8Y A;  4U13 A;  7RNT A;  4FCZ A;  2XSO B;  1FUS A;  3EBY A;  3F8X A;  1I0V A;  3MPH A;  8RNT A;  3CXC 2;  2CX0 A;  1FA3 A;  2WGQ A;  2R41 A;  2XSH B;  4HM7 B;  2WGO A;  3D3L A;  3CD6 3;  1O7P B;  2F56 A;  2E2U A;  2OQE A;  5M18 A;  1M1K 4;  1DE3 A;  3PCS A;  1AY7 A;  3EQQ B;  4FCJ A;  3CCS 3;  4TX4 A;  5AYS C;  2F86 B;  2W2C A;  1RGH A;  1AQZ A;  3CMA 3;  5BIR A;  1U8C B;  1UCL A;  3MSO A;  1B2M A;  3CCR 3;  1C7H A;  2XEP A;  4L8P A;  1BNG A;  5CLK A;  3A76 A;  3FKA A;  2YFI B;  3CNX A;  1BUQ A;  1PFP A;  4HZB B;  2W56 B;  3NQY A;  2E2T A;  1UCK A;  1GS3 A;  2GBW B;  3Q90 A;  1X1U A;  1T5Y A;  2IA7 A;  1BSA A;  1HU9 A;  2CIU A;  4EBG A;  2CFL A;  1LVN A;  1N5P A;  3B7C A;  2BO9 B;  2P0M A;  2INX A;  4H61 A;  3FF0 A;  2A15 A;  2F5W A;  5BXQ A;  1VQ8 3;  2CG0 A;  1VQL 3;  3CCL 3;  1PY3 A;  3G6E 3;  4HM1 B;  3T8N A;  5JPP A;  3X3Y A;  1VQ5 3;  1E97 A;  4WHA A;  1E3V A;  3D5I A;  1JN5 A;  2XGN A;  1BRI A;  5JBS A;  3SX1 A;  4MMZ B;  3MG2 A;  1I2G A;  3OXA A;  2O3O A;  1BNJ A;  3NBJ A;  2YFL B;  1Z1S A;  4HBR A;  3NBR A;  4J8T A;  3HII A;  3MYT A;  5D81 A;  5KP4 A;  3GZB A;  1MWU A;  2J8X B;  1TTO A;  2KRT A;  3MHE A;  1X1W A;  3AGO A;  1AV4 A;  1FGR A;  1TIJ A;  1G96 A;  1GMP A;  1O7G B;  3ALA A;  1IT7 A;  3X41 A;  4N6O B;  4J9A A;  3GZR A;  3ROB A;  2GBX B;  1PU4 A;  3UB1 A;  3WA2 X;  3WHO A;  1YI2 3;  2UX0 A;  2IY2 A;  1RCK A;  1ZGX A;  2CC3 A;  4J5K A;  4KVH A;  3VF1 A;  1OH0 A;  5IG4 A;  3CCM 3;  2W9P A;  1VQ4 3;  4HM0 B;  1OHP A;  1MGR A;  1EQK A;  1YNV X;  3BLZ A;  1W01 A;  3UJM A;  4BL3 A;  6RNT A;  3MG3 A;  2ZL8 A;  1YHQ 3;  1R4C A;  3AHS A;  2CW9 A;  4LEH A;  2Y74 A;  3F8H A;  1N8Q A;  2GEY A;  4L7K A;  2H0H A;  3HIG A;  4K61 A;  1Q40 A;  2WO0 A;  3LZA A;  2RGQ A;  3AHW A;  1D6Z A;  1O7N B;  1I0X A;  1NDO B;  4DKI A;  7STD A;  3DM8 A;  1MWT A;  2XFT A;  3FCS B;  3STD A;  1KD1 4;  3G16 A;  1ISK A;  1BNI A;  8CHO A;  3V92 A;  1UGH I;  1FGO A;  1IV9 A;  1WMP A;  3G71 3;  1ZX2 A;  2JDI H;  3G0K A;  2XF3 A;  4KFD A;  1RTU A;  1W6G A;  3CCQ 3;  4NHF A;  1K41 A;  3E99 A;  2V1L A;  2W0Q A;  5GSP A;  1CEW I;  1RRL A;  1ROA A;  3X42 A;  1YIT 3;  1BSD A;  1U5O A;  3G8Z A;  4R1K A;  4CDL A;  1F8N A;  2K0M A;  3DUK A;  3Q3F A;  2MC8 A;  2I9W A;  2AAE A;  1TFK A;  2BMO B;  1LXE A;  1IQ8 A;  1CYV A;  2XFS A;  1Q7Y 4;  1AVL A;  3IMA B;  5HGR A;  3I0Y A;  2YFJ B;  5LC7 A;  1UGI A;  4RNT A;  3T8U A;  3DGY A;  3GZY B;  4HOH A;  2B1X B;  2BU4 A;  2H0G A;  1VQO 3;  1NB5 I;  3DGN A;  1RGF A;  2GU3 A;  5A0O B;  3J7Y d;  3EHC A;  3D5G A;  1Q7H A;  5RNT A;  1RGK A;  1JJ2 2;  3DMC A;  1FYS A;  2XRX B;  3DZL A;  4IPB A;  1NO3 A;  2F5M A;  3ER7 A;  4X2H A;  5D83 A;  1RLS A;  3FSD A;  2UGI A;  1MOL A;  1RGE A;  2HMO B;  3DH2 A;  3KFQ C;  3SED A;  5CF2 A;  1DMQ A;  1NB3 I;  1KSI A;  4N3V A;  1KC8 4;  1RNT A;  1GD4 A;  1DMN A;  3MWZ A;  4KT3 B;  1RSN A;  4H3U A;  5ELU A;  3LOY A;  3PS8 A;  3EN8 A;  4RNZ A;  3RDE A;  1IQY A;  1YVS A;  3BNC A;  1UCI A;  2CWU A;  3OV4 A;  3SXX A;  1DMM A;  3JUP A;  3LT9 A;  4L8O A;  1RMS A;  2RNT A;  1RKY A;  2BNG A;  2CFG A;  3H51 A;  3OWY A;  4RNY A;  2CK3 H;  3KSP A;  3UL6 A;  1RGA A;  3F9S A;  1VQK 3;  5ELJ A;  1X1X A;  3LYG A;  2ZDJ A;  4NRE A;  1IYY A;  4BL2 A;  1DVC A;  1IT8 A;  1FGQ A;  5AIF A;  2KF6 A;  1NJI 4;  3F7X A;  1QJG A;  1OGX A;  3NBB A;  5IEP A;  1GMQ A;  2FGT A;  4N6T A;  4O2H A;  2FXT A;  4MMX B;  1QAK A;  2W9Q A;  4N6U A;  4KZ1 A;  4J5G A;  3K63 A;  3OWS A;  4X2O A;  4AKY A;  1IVW A;  1GYB A;  4HZ9 B;  2KCD A;  5LC6 A;  1JKG B;  4IIA A;  4EV5 A;  1QMA A;  2SBL A;  2Z6B A;  4WYK B;  5G1K A;  1GSP A;  2HMN B;  1US1 A;  2B24 B;  3FF2 A;  5CK6 A;  2KAA A;  1FGM A;  3S67 A;  1UUV B;  2HML B;  2W56 A;  5M19 A;  1WNH A;  1BNE A;  5EVH A;  3V99 A;  3HOH A;  1W7C A;  3ECF A;  2IMJ A;  1V57 A;  3Q2P A;  4STD A;  2P38 A;  4OVM A;  5HOH A;  1VQ9 3;  4EXR A;  3A5E A;  1TFO A;  4K1U A;  1LQM B;  1GY7 A;  2OTL 3;  2QA4 3;  1VQM 3;  1JBT A;  1S5A A;  3EC9 A;  1LOV A;  1STD A;  2CX1 A;  2CFW A;  4PEJ A;  1JNQ A;  1E3R A;  1T2H A;  3WOD G;  3I56 3;  2C11 A;  3DXO A;  2W04 A;  5EEO A;  1X1Y A;  1LRA A;  3BU4 A;  1ULI B;  3JUQ A;  5IW9 A;  3CC2 3;  1RRH A;  1FGT A;  1RCL A;  3EB8 A;  1OCV A;  1IVU A;  3EJV A;  3NUV A;  4NPB A;  4WP5 A;  2CH9 A;  1OUN A;  3N8B A;  4XDV A;  4XBX A;  2OQE C;  4K1V A;  1UUW B;  5IG0 A;  5IG3 A;  2HMK B;  1JZO A;  2MF7 A;  3KII A;  2P05 A;  2Z7A A;  1A2K A;  3CPO A;  3SOY A;  3OW2 2;  1KQS 2;  1B20 A;  1I8V A;  1WQL B;  2ZHX B;  2R4I A;  1Q82 4;  3AMO B;  1GY6 A;  5AEW B;  5EQL A;  3CC7 3;  3CNM A;  1JB2 A;  4N6N B;  4OK0 A;  1M9G A;  1BNR A;  1D6Y A;  1BRG A;  1OHS A;  1KWI A;  2CKF B;  4FR9 A;  1GMR A;  4R9K A;  3RGA A;  4BIR A;  1VQ6 3;  3CCU 3;  4HJL B;  4ZM8 A;  3N54 B;  3FG3 A;  4R80 A;  3KKG A;  2KXG A;  3B8L A;  1W5Z A;  1BSC A;  4FCM A;  3JVC A;  1BRH A;  5AIH A;  3GRD A;  3X3Z A;  2C10 A;  4O3V A;  4JF8 A;  4GHO A;  4IT7 A;  5STD A;  3S29 A;  3VSY A;  4KFE A;  3HX8 A;  3F7S A;  3K0Z A;  1BU4 A;  5IG5 A;  1G0T A;  5BU4 A;  3F40 A;  1BOX A;  2BMQ B;  2BT3 A;  3B4O A;  3WR2 A;  3ZFZ A;  1BVI A;  1IK3 A;  2RFR A;  1RN4 A;  2HOH A;  3EX9 A;  4MJD A;  2STD A;  1V58 A;  1TRQ A; 
#chains in the Genus database with same CATH homology
 5CXO A;  2W6J H;  3WDG B;  1L5G B;  3LML A;  5FGO A;  4BTW A;  3WOF B;  1VQ7 3;  5DRV A;  1TUH A;  4XBY A;  2JQ5 A;  1K8A 4;  1IDP A;  2RSX A;  5IEO A;  3OX9 A;  1VQN 3;  4HYZ A;  2XH9 A;  4BTX A;  4HM6 B;  2OOV A;  3X3X A;  3IPT A;  1MNL A;  3U97 A;  3DGL A;  3QK9 A;  1OF5 B;  1EKM A;  3HI7 A;  4FMA A;  1ROV A;  4AEQ A;  3NX0 A;  3DY5 A;  3HK4 A;  5BVB A;  4G1M B;  2PZV A;  5JPU A;  3NV0 B;  1AVK A;  3LTC A;  4FMD A;  4CCV A;  4LZI A;  5D82 A;  1WMN A;  1A90 A;  2P0X A;  2CG1 A;  4WWU C;  1IU7 A;  4JRF A;  2GU1 A;  3CC4 3;  1VZZ A;  3LTB A;  3PCR A;  1N8R 4;  4K90 B;  4HKV B;  1N5H A;  1QAF A;  1CQS A;  3NM7 A;  1EA2 A;  2OTJ 3;  3BND A;  1YJW 3;  2CFD A;  3JUN A;  1OHO A;  4HVN A;  3DGO A;  4RZM A;  3U1W A;  1HKX A;  1QVF 2;  3KSE D;  3UNL A;  1Q81 4;  5IEN A;  2OCT A;  3NQZ A;  1K9M 4;  2HMJ B;  3OWU A;  3S5C A;  2IUK A;  3GZX B;  1S72 3;  4N6M A;  3GWR A;  1LOX A;  1JKG A;  2FNQ A;  4WYK A;  2OOV C;  1IQX A;  1JB5 A;  1ULJ B;  4XM4 A;  3CPW 2;  1GD3 A;  1UI8 A;  4N6V 0;  1W2B 2;  2CWV A;  1SQW A;  3X40 A;  3BNE A;  3MG1 A;  3TDG A;  3NM2 A;  1QVG 2;  2LQV A;  2CHC A;  5I97 A;  1ZO2 A;  1N9J A;  4EV2 A;  1W2Z A;  4XBT A;  3SVA A;  1W00 A;  3QRD A;  1W4N A;  4HM4 B;  2GXF A;  3F14 A;  4N6L A;  4MEI A;  3LTA A;  4Q53 A;  4RBN A;  1AR0 A;  3FLJ A;  1UW1 A;  3N9H A;  2ML5 A;  5IER A;  4GB5 A;  1IV7 A;  2QIY A;  3FH1 A;  1FUW A;  4HM8 B;  1JN5 B;  3KE7 A;  3K5T A;  4R4K A;  1OGZ A;  1V74 A;  4HM3 B;  3FZW A;  3M8C A;  1RJO A;  1TU5 A;  2L4V A;  3WMD A;  4GL6 A;  1GY5 A;  1NU3 A;  3CU3 A;  5KP1 A;  3JUO A;  2LYX A;  1M90 4;  3AMO A;  4OUQ A;  4EYC A;  3CME 3;  3PZW A;  1RN7 A;  3PGB A;  1Q86 4;  2D1W A;  4ORL A;  1TP6 A;  3BNB A;  2IUJ A;  2RCD A;  3S28 A;  4LMI A;  3B4P A;  2K54 A;  1JB4 A;  1LNH A;  1SIH A;  3L0R A;  1QAL A;  1OAC A;  3SLU A;  1W02 A;  1Q42 A;  5AEU B;  2M7O A;  2D42 A;  5FW5 A;  1YJ9 3;  3FGY A;  1WMO A;  3IJE B;  3G4S 3;  5AIG A;  4R9L A;  3WOE B;  3KN4 A;  3CCE 3;  1DVD A;  2F99 A;  3EE1 A;  3WA3 A;  1IVV A;  5TGN A;  3CCV 3;  1YGE A;  3MKI A;  1A67 A;  1J2B A;  1O7W B;  2XGL A;  1O7H B;  1JV2 B;  1UI7 A;  1Q40 B;  1A2V A;  3JUM A;  2ML6 A;  4I4K A;  2O9U X;  4AKZ A;  2QGU A;  3SOA A;  3GAX A;  2BMR B;  1YVB I;  3KZT A;  6STD A;  4QWT A;  3FG1 A;  3RGR A;  3K9M C;  1YIJ 3;  2WOH A;  3FG4 A;  2XR8 B;  3VGN A;  4EC6 A;  5DRE A;  5AYR B;  2BHM A;  3CCJ 3;  2CWT A;  4BTY A;  2CFK A;  4FMB A;  2W03 A;  5G2G A;  3LH4 A;  4HM2 B;  1D6U A;  2P09 A;  1YJN 3;  3EBT A;  5KP3 A;  3H3H A;  3NXJ A;  2HMM B;  4HM5 B;  3I55 3;  1OF5 A;  2GEX A;  2Q07 A;  2Y73 A;  4LGQ A;  5AII A;  5AI1 A;  2PNC A;  1STF I;  5CF1 A;  5IF6 A;  2E2V A;  1K73 4;  1JRQ A;  1SII A;  1W6C A;  1Y4K A;  3LTD A;  4O02 B;  3DGM A;  1IVX A;  2QEX 3;  3LXU X;  3NV0 A;  3EF8 A;  4XDW A;  3NHX A;  4WFO A;  1ASK A;  1W6Y A;  4FMC A;  1CYU A;  3BB9 A;  4MMY B;  3EN1 B;  2YX9 A;  2Z76 A;  3HZP A;  3D9R A;  1EG9 B;  3PYJ A;  1O7M B;  4LSO A;  3UL5 A;  1DYU A;  3K7C A;  1K28 A;  1VQP 3;  2OWP A;  2F98 A;  2Z77 A;  4O8S A;  3T0U A;  1SPU A;  1N9E A;  1NWW A;  2WOF A;  3V98 A;  4KFF A;  3Q1C A;  4XB5 A;  3LT8 A;  1WTH A;  1OPY A;  3S27 A;  3PXM A;  1M1X B;  1SJW A;  4U13 A;  3O8Y A;  4FCZ A;  2XSO B;  3CXC 2;  3EBY A;  3F8X A;  3MPH A;  1FA3 A;  2WGQ A;  2XSH B;  4HM7 B;  2WGO A;  3D3L A;  3CD6 3;  1O7P B;  2E2U A;  2OQE A;  1M1K 4;  3PCS A;  3EQQ B;  4FCJ A;  3CCS 3;  4TX4 A;  5AYS C;  2F86 B;  2W2C A;  3CMA 3;  1U8C B;  3MSO A;  3CCR 3;  1C7H A;  2XEP A;  4L8P A;  5CLK A;  3A76 A;  3FKA A;  2YFI B;  3CNX A;  1BUQ A;  1PFP A;  4HZB B;  2W56 B;  3NQY A;  2E2T A;  1GS3 A;  2GBW B;  3Q90 A;  2IA7 A;  1T5Y A;  1HU9 A;  2CIU A;  4EBG A;  2CFL A;  1LVN A;  1N5P A;  3B7C A;  2BO9 B;  2P0M A;  2INX A;  4H61 A;  3FF0 A;  2A15 A;  1VQ8 3;  5BXQ A;  2CG0 A;  3CCL 3;  3G6E 3;  4HM1 B;  3T8N A;  5JPP A;  3X3Y A;  1VQ5 3;  1E97 A;  4WHA A;  1E3V A;  1JN5 A;  2XGN A;  5JBS A;  3SX1 A;  4MMZ B;  3MG2 A;  3OXA A;  2O3O A;  3NBJ A;  2YFL B;  1Z1S A;  4HBR A;  3NBR A;  4J8T A;  3HII A;  3MYT A;  5D81 A;  3GZB A;  2KRT A;  3MHE A;  1AV4 A;  1FGR A;  1TIJ A;  1G96 A;  1O7G B;  3ALA A;  1IT7 A;  3X41 A;  4N6O B;  4J9A A;  3GZR A;  3ROB A;  2GBX B;  1PU4 A;  3UB1 A;  3WA2 X;  1YI2 3;  2UX0 A;  2CC3 A;  4KVH A;  3VF1 A;  1OH0 A;  5IG4 A;  3CCM 3;  2W9P A;  1VQ4 3;  4HM0 B;  1OHP A;  1EQK A;  3BLZ A;  3UJM A;  1W01 A;  3MG3 A;  2ZL8 A;  1YHQ 3;  1R4C A;  2CW9 A;  4LEH A;  2Y74 A;  3F8H A;  1N8Q A;  2GEY A;  4L7K A;  3HIG A;  4K61 A;  1Q40 A;  2WO0 A;  3LZA A;  2RGQ A;  1D6Z A;  1O7N B;  1NDO B;  7STD A;  3DM8 A;  3FCS B;  2XFT A;  3STD A;  1KD1 4;  3G16 A;  1ISK A;  8CHO A;  3V92 A;  1FGO A;  1IV9 A;  1WMP A;  3G71 3;  1ZX2 A;  2JDI H;  3G0K A;  2XF3 A;  4KFD A;  1W6G A;  3CCQ 3;  4NHF A;  1K41 A;  3E99 A;  2V1L A;  2W0Q A;  1YIT 3;  1CEW I;  1RRL A;  1ROA A;  3X42 A;  1U5O A;  4R1K A;  3G8Z A;  4CDL A;  1F8N A;  2K0M A;  3DUK A;  2MC8 A;  2I9W A;  1TFK A;  2BMO B;  1LXE A;  1IQ8 A;  1CYV A;  2XFS A;  1Q7Y 4;  1AVL A;  3IMA B;  5HGR A;  3I0Y A;  2YFJ B;  5LC7 A;  3T8U A;  3GZY B;  1VQO 3;  2B1X B;  1NB5 I;  3DGN A;  2GU3 A;  5A0O B;  3J7Y d;  3EHC A;  1JJ2 2;  3DMC A;  2XRX B;  3DZL A;  4IPB A;  1NO3 A;  3ER7 A;  4X2H A;  5D83 A;  3FSD A;  5KP4 A;  1MOL A;  2HMO B;  3KFQ C;  3SED A;  5CF2 A;  1DMQ A;  1NB3 I;  1KSI A;  4N3V A;  1KC8 4;  1GD4 A;  1DMN A;  3MWZ A;  4H3U A;  5ELU A;  3LOY A;  3PS8 A;  3EN8 A;  4RNZ A;  3RDE A;  1IQY A;  3BNC A;  3OV4 A;  3SXX A;  2CWU A;  1DMM A;  3JUP A;  3LT9 A;  4L8O A;  1RKY A;  2BNG A;  2CFG A;  3H51 A;  3OWY A;  4RNY A;  2CK3 H;  3KSP A;  3UL6 A;  3F9S A;  1VQK 3;  5ELJ A;  3LYG A;  4NRE A;  2ZDJ A;  1DVC A;  1IT8 A;  1FGQ A;  5AIF A;  1NJI 4;  3F7X A;  1QJG A;  1OGX A;  3NBB A;  5IEP A;  2FGT A;  4N6T A;  4O2H A;  2FXT A;  4MMX B;  1QAK A;  2W9Q A;  4N6U A;  4KZ1 A;  3K63 A;  3OWS A;  4X2O A;  4AKY A;  1IVW A;  1GYB A;  4HZ9 B;  2KCD A;  5LC6 A;  1JKG B;  4IIA A;  4EV5 A;  1QMA A;  2SBL A;  2Z6B A;  4WYK B;  2HMN B;  1US1 A;  2B24 B;  3FF2 A;  5CK6 A;  1FGM A;  3S67 A;  1UUV B;  2HML B;  2W56 A;  1WNH A;  5EVH A;  3V99 A;  1W7C A;  3ECF A;  2IMJ A;  3Q2P A;  4STD A;  2P38 A;  4OVM A;  1VQ9 3;  4EXR A;  1TFO A;  4K1U A;  1GY7 A;  2OTL 3;  2QA4 3;  1VQM 3;  1S5A A;  3EC9 A;  1STD A;  3WOD G;  2CFW A;  4PEJ A;  1JNQ A;  1E3R A;  3I56 3;  2C11 A;  3DXO A;  2W04 A;  5EEO A;  3JUQ A;  1ULI B;  5IW9 A;  1VQL 3;  3CC2 3;  1FGT A;  1RRH A;  3EB8 A;  3EJV A;  1OCV A;  1IVU A;  3NUV A;  4WP5 A;  2CH9 A;  1OUN A;  3N8B A;  4XDV A;  4XBX A;  2OQE C;  4K1V A;  1UUW B;  5IG0 A;  5IG3 A;  2HMK B;  2MF7 A;  3KII A;  2P05 A;  2Z7A A;  1A2K A;  3CPO A;  3SOY A;  3OW2 2;  1KQS 2;  1WQL B;  2R4I A;  1Q82 4;  3AMO B;  1GY6 A;  5AEW B;  5EQL A;  3CC7 3;  3CNM A;  1JB2 A;  4N6N B;  4OK0 A;  1M9G A;  1D6Y A;  1OHS A;  2CKF B;  1KWI A;  4FR9 A;  4R9K A;  3RGA A;  1VQ6 3;  3CCU 3;  4HJL B;  4ZM8 A;  3N54 B;  3FG3 A;  4R80 A;  3KKG A;  2KXG A;  3B8L A;  1W5Z A;  4FCM A;  3JVC A;  5AIH A;  3GRD A;  3X3Z A;  2C10 A;  4O3V A;  4JF8 A;  4IT7 A;  5STD A;  3S29 A;  3VSY A;  4KFE A;  3HX8 A;  3F7S A;  3K0Z A;  5IG5 A;  3F40 A;  2BMQ B;  2BT3 A;  3B4O A;  1IK3 A;  2RFR A;  3EX9 A;  4MJD A;  2STD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...