1Q814

Crystal structure of minihelix with 3' puromycin bound to a-site of the 50s ribosomal subunit.
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into Peptide Bond Formation
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 16
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1q81400
1K8A4 1S723 1YHQ3 1QVG2 3CCQ3 1M904 1YJW3 1VQ93 1Q7Y4 1YI23 3CC73 1VQ53 1N8R4 3G713 3CCR3 1KD14 1VQ73 3CXC2 1KQS2 1VQM3 1KC84 1YIJ3 1VQO3 1YJN3 3I563 3CCJ3 1VQK3 1VQ83 3CCS3 3I553 2OTJ3 1Q824 1W2B2 1Q814 2QEX3 1Q864 3CMA3 1YJ93 1M1K4 3OW22 3CC43 1K9M4 2QA43 1JJ22 1VQ43 1NJI4 3CCE3 3CPW2 1VQ63 1VQL3 3CME3 3CCL3 1VQP3 3CCU3 3CC23 1YIT3 1QVF2 3CCV3 1VQN3 3CD63 2OTL3 3G4S3 3G6E3 1K734 3CCM3
chains in the Genus database with same CATH superfamily
1A2VA 1I2EA 1IVVA 2M7OA 2CW9A 3F40A 3DGOA 1RCLA 4N6NB 1Q40A 2LYXA 4O3VA 4OK0A 5IG5A 3WHOA 4EW5A 1O7GB 1N8R4 1RMSA 1BRGA 3D3LA 3JUPA 2CK3H 1WMPA 5IG0A 1O7HB 5TGNA 1BNGA 1RHLA 3QK9A 3HIIA 5AIGA 5JPUA 3EN1B 3BB9A 2BHMA 1WMOA 3STDA 1N5PA 1ZS7A 1JNQA 3EC9A 2IUKA 3RDEA 1Q9EA 2INXA 1VQP3 3MSOA 1T2IA 3CCU3 3N54B 4I4KA 1US1A 2R4IA 4XDVA 1B20A 2L4VA 4X2HA 1DVCA 5AYRB 2E2VA 2KRTA 1OHSA 4HZ9B 5M19A 2ZHXB 3SEDA 1K8A4 3JUNA 3LTCA 3SYUA 1OCVA 1QAFA 2XSHB 4N3VA 4LGQA 5RNTA 2KF5A 4MJDA 2OQEA 2YFJB 1KQS2 5G1KA 4FMAA 1J2BA 3Q2PA 2FXTA 3G16A 1JRQA 1GSPA 4RNYA 1I0VA 3NV0A 1NB3I 1B2MA 2E2UA 3EE1A 2CX0A 1UCKA 4U13A 3ZFZA 5BXQA 3EX9A 3CC43 3OW22 1BAOA 3FG3A 4WHAA 1QJGA 4HM1B 2HMNB 2GU3A 1E3RA 1N8QA 3O8YA 3ZG5A 2YFLB 2BO9B 2W56B 5HOHA 1I0XA 1O7NB 3HK4A 4IT7A 2F99A 5ELJA 5CF2A 2W0QA 3Q90A 1W00A 3MG3A 1D6UA 1MWTA 1GD3A 4CPKA 1FA3A 1RGAA 1LOXA 1O7PB 1Q7HA 3EQQB 2F5WA 4JRFA 2UUGC 1TU5A 1BANA 3MG2A 4L8PA 1BRIA 1FGMA 5JBSA 3CCR3 1X1YA 4GB5A 2KF3A 1JV2B 1B2XA 5EVHA 1YIJ3 3UNLA 6STDA 1IU7A 2BNGA 3ALAA 4XM4A 1Q824 4K1UA 3Q3FA 4XBTA 2K0MA 1ROAA 3WDGB 1UI8A 1UUVB 1IV7A 2AAEA 1DETA 1RGHA 1SPUA 3ZG0A 3BNBA 5A0OB 1O7WB 1GOYA 2HMJB 4HM6B 4WFOA 3KN4A 3OWSA 1RN4A 1KSIA 1K734 4X2OA 4CCVA 1C54A 1OHOA 2AADA 2SARA 2R41A 4NPBA 1RCKA 1WNHA 3AGOA 3LYGA 3JUOA 1BSCA 3PS8A 2Q07A 4XBXA 3FH1A 4J8TA 5D83A 3DM8A 2CWTA 2F86B 3DGNA 4MMZB 2CHCA 1SQWA 2XGLA 4K1VA 3FKAA 3WMDA 1QMAA 3NBJA 1W02A 4H61A 2W56A 3AHWA 3HIGA 3SX1A 1T2HA 2QEX3 1BSBA 2OOVC 2W04A 3IMAB 1SIIA 1B27A 1W7CA 2ZA4A 3D9RA 4NHFA 7GSPA 1BRKA 1JBTA 3CME3 3FZWA 4R80A 1IV9A 5I97A 1JB5A 2RBIA 3FGYA 4J9AA 4MMYB 1PY3A 1FUSA 1B2ZA 2IY2A 3FG1A 3FG4A 1MWUA 4WYKB 1STFI 1DMMA 5AEWB 1X1XA 2Z6BA 5M1AA 1JBRA 4I5QA 2QIYA 1EG9B 1MGRA 3EF8A 3URPA 1IVUA 1JKGA 3DH2A 4HM4B 2WGQA 3SVAA 1EEJA 2OOVA 1OHPA 1SJWA 1IQXA 5BVBA 5KP4A 3K0ZA 4HM2B 3CCJ3 2F98A 1JN5B 1NDOB 4O2HA 3LTBA 1TRQA 1RNTA 5BU4A 1W6GA 2CX1A 1LRAA 4FMDA 2K54A 3L0RA 3UL5A 1V74A 2FNQA 4LSOA 5GSPA 1BUJA 4ILFA 3LZAA 2Z7AA 3PGBA 1I2GA 2C4BA 5D82A 3D5IA 1HU9A 1JKGB 1YGWA 1BRJA 2L1SA 1BVIA 1BU4A 3SXXA 2CFGA 4EYCA 3GAXA 1GMRA 1YI23 1IT8A 2E2TA 1YHQ3 1JB2A 1E97A 2IYJA 6GSPA 1JN5A 3PXMA 1A2KA 1TTOA 3FF2A 3X42A 1RSNA 2HOHA 2Z77A 1RTUA 1YJN3 1IYYA 1VQ83 2BMOB 3CCS3 2W03A 4KT3B 2HMKB 4LEHA 1UDII 4FCZA 3PCSA 4NREA 3UL6A 2YX9A 1YVBI 1BIRA 1VZZA 3E99A 4Q53A 1ULJB 2XF3A 1NNVA 3Q1CA 5AI1A 1DE3A 2PZVA 4K90B 3ROBA 3HOHA 2P09A 2V1LA 2CKFB 4HAAA 1DVDA 3EBTA 4BTXA 1M1XB 1V58A 3F8XA 3CCM3 1FGQA 4STDA 1QVG2 1TFKA 1GY5A 1TRPA 1LNHA 5G1LA 2KF6A 2F5MA 3X3YA 1SIHA 3CNMA 1ZO2A 2RNTA 4R1KA 3VSYA 1GMPA 1B21A 2A15A 1IQ8A 1V57A 1AY7A 5D81A 1MWSA 2STDA 1UGIA 4OUQA 1W2B2 4BU4A 2BT3A 3LT8A 1FGOA 3DGMA 2UGIA 1BSDA 3DY5A 2HMMB 3FCSB 3NQZA 4QWTA 5EEOA 1K9M4 4RBNA 4MMXB 1CH0A 4XBYA 5CF1A 2W2CA 1BNJA 5EQLA 3EN8A 2ZDJA 5LC7A 5IW9A 3MYTA 3RGAA 3BNCA 1EQKA 3LMLA 4HOHA 7RNTA 4GSPA 4OVMA 3QRDA 4O8SA 1S723 3JUMA 4HKVB 1YVSA 4H3UA 5IERA 2KAAA 1YJW3 3D4AA 1T3BA 2W9PA 5KP3A 3MHEA 1RGLA 1UW1A 1Q42A 1AQZA 3S29A 2CFLA 2OCTA 3X3XA 3PCRA 1QAKA 3DUKA 3T0UA 1BRSA 3K63A 3MPHA 1TFOA 3GZXB 1TIJA 4XDWA 3SLUA 2KXGA 1YJ93 1TUHA 3B8LA 4N6LA 3CPW2 5CK6A 4EV5A 1B3SA 3OWYA 2OQEC 2BIRA 2P0XA 1YIT3 1NO3A 1BNSA 2CFDA 4KFEA 1Q40B 3MWZA 4RZMA 3CPOA 3V98A 3F7SA 1OPYA 1RN7A 3LTDA 1HZ1A 2GSPA 2ML5A 3T8UA 3OWUA 1UI7A 4ZM8A 2P38A 3HI7A 4FCMA 2RSXA 4GL6A 3FLJA 5IENA 1GY7A 3X41A 1OF5B 1LOWA 2RGQA 1I2FA 5KP1A 2O3OA 3OX9A 2XEPA 3G0KA 1EUIC 4HVNA 1VQO3 3DXOA 2KF4A 3I553 1N5HA 1FGTA 3EB8A 1JZOA 3BIRA 5DRVA 5JPPA 3WODG 3GSPA 2QA43 2C10A 1ASKA 1NB5I 3LOYA 4AKYA 2Y73A 3X40A 1QVF2 3CD63 1UUWB 1IQYA 5CLKA 1IVWA 1ISKA 1UCJA 4AKZA 1IVXA 3IPTA 3OXAA 1OH0A 1FW7A 2J8XB 2XRXB 1KWIA 4JF8A 1LNIA 4J5GA 3S28A 1DMQA 4WYKA 5AYSC 1Q7Y4 1D6YA 1RRLA 3K9MC 3CXC2 2ML6A 1M9GA 1R4CA 3EHCA 2F56A 5AIFA 3TDGA 4L7KA 1GYBA 1RN1A 9RNTA 5LC6A 2P0MA 3I0YA 1M1K4 3KSPA 4K61A 3S27A 1K41A 1MGWA 4LMIA 1CEWI 1A67A 3AMOB 1ZGXA 5AIHA 2FGTA 4N6OB 1W2ZA 4EV2A 5M18A 2IA7A 6RNTA 3ER7A 1QALA 3KCHA 1CQSA 3GZYB 3JUQA 1UGHI 2D1WA 3MG1A 2MF7A 3ECFA 1RLSA 1TP6A 3JVCA 1Y4KA 3S5CA 2SBLA 1IDPA 2B24B 2GU1A 1GOUA 2XGNA 1FUTA 2CFKA 4RNTA 4LZIA 1IK3A 3IJEB 3AHSA 2IUJA 1PFPA 1F8NA 3DMCA 3BU4A 1MOLA 2XSOB 1NU3A 4O02B 5IEOA 5STDA 1JZDA 3D79A 3G8ZA 3V99A 3AMOA 8CHOA 1CYUA 2BMQB 1RGCA 3BLZA 5BIRA 2KCDA 3F7XA 4BL2A 5IF6A 3G4S3 1LQMB 1PU4A 3WOFB 1YNVX 3KKGA 7STDA 3SOAA 1E3VA 3N8BA 5IEPA 2W6JH 1C7HA 1RGGA 3D5GA 4R9LA 1PYLA 2PNCA 2Z76A 2WOHA 3FF0A 2XR8B 1W01A 3M8CA 3G713 1BRHA 1S5AA 4BL3A 1UCIA 2C11A 2K3DA 1OUNA 1Z1SA 1KC84 3S67A 4FMCA 3I563 2W9QA 4CDLA 2CWVA 3WOEB 2YFIB 1MWRA 2OTJ3 4R9KA 1X1UA 3HZPA 1Q864 1IT7A 3DZLA 1BNRA 1RRHA 2CFWA 5FGOA 2MC8A 1AVLA 2BU4A 3F9SA 1W6CA 3NM7A 1FYSA 4N6V0 3NM2A 3CCV3 1CYVA 2H0IA 3GZRA 3UB1A 5IG3A 3G6E3 1KD14 2OWPA 1UCLA 1W5ZA 5HGRA 1DMNA 3CNXA 1L5GB 3A5EA 5FW5A 1D6ZA 3HX8A 3T8NA 3U1WA 3CCQ3 1VQ93 1GMQA 1U5OA 2IMJA 1N9JA 1BNFA 2RCDA 3B4OA 1WTHA 2UX0A 4HM3B 5G2GA 1B2UA 1BSAA 1K28A 1VQM3 1OACA 4HYZA 1SARA 1FGRA 3NX0A 1N9EA 1WQLB 3SOYA 2ZL8A 2RFRA 5IG4A 4AEQA 3NBBA 3H51A 2XH9A 3NUVA 2WO0A 4EXRA 1NJI4 1VQ63 3WA3A 3J7Yd 1VQL3 2QGUA 2JDIH 4ORLA 4GHOA 3CC23 1W6YA 3K7CA 4IIAA 3MKIA 3V92A 1OGZA 1R4YA 1FZUA 1I3FA 2GEYA 3GRDA 1RGFA 4WWUC 5ELUA 1X1WA 1AV4A 2XFSA 1HKXA 1LOVA 4FR9A 2WGOA 3CC73 1RJOA 3CU3A 3PZWA 1VQ73 1YGEA 3OV4A 1LOYA 1OF5A 2B1XB 4BIRA 5AEUB 4N6UA 1GS3A 4G1MB 4KFDA 5CXOA 3H3HA 5AIIA 2CG1A 4L8OA 1RNBA 3GWRA 1LQGC 1Q814 3CMA3 3B4PA 2BMRB 1ULIB 3UJMA 1ZX2A 3F14A 1JJ22 4MEIA 3RNTA 4EC6A 3CCL3 1G96A 3AGNA 4J5KA 4DKIA 4HM8B 4WP5A 3X3ZA 2GEXA 1STDA 3EBYA 3LT9A 2GXFA 4BTWA 3DGLA 3VGNA 4HZBB 1A90A 1M904 3KFQC 4N6MA 3NXJA 2XFTA 2Y74A 1LXEA 1I70A 1EA2A 1ROVA 3LH4A 1FUWA 1RGKA 1BGSA 2HMLB 1I8VA 1MNLA 2LQVA 2H0HA 1U8CB 3DGYA 1JBSA 3N9HA 1VQK3 1RKYA 2GBWB 1TJDA 1NWWA 3EJVA 3BNEA 3B7CA 4IPBA 3NBRA 3U97A 1AVKA 5DREA 4RNZA 3WA2X 1B2SA 4FMBA 3FSDA 2CC3A 4KFFA 4BTYA 3KE7A 3A76A 3CCE3 2F4YA 3F8HA 4PEJA 2GBXB 2H0GA 2CH9A 4HM7B 2CWUA 4EBGA 1JB4A 2CG0A 2JQ5A 3KSED 1OGXA 1I3IA 1BRNL 1LVNA 3LXUX 1BOXA 2O9UX 1EKMA 1GOVA 1A2PA 4TX4A 3NHXA 2P05A 1DYUA 1WMNA 3VF1A 1VQ53 2I9WA 8RNTA 4CJNA 2HMOB 4LYLB 1BNEA 1O7MB 1W4NA 3GZBA 3NV0B 4R4KA 3PYJA 2CIUA 4HJLB 4KVHA 3WR2A 3LTAA 4HM0B 4N6TA 4XB5A 3KIIA 1BSEA 3BNDA 4KZ1A 1VQQA 3K5TA 1GY6A 1RDSA 1GD4A 3KZTA 1BNIA 1VQ43 2D42A 4HBRA 3NQYA 1UUGB 1G0TA 1BUQA 1HYFA 4HM5B 1T5YA 1VQN3 1G02A 2WOFA 2OTL3 1AR0A 1RGEA 3RGRA 4FCJA
chains in the Genus database with same CATH topology
1A2VA 1IVVA 2M7OA 2CW9A 3F40A 3DGOA 4N6NB 1Q40A 2LYXA 4O3VA 4OK0A 5IG5A 1N8R4 1O7GB 3D3LA 3JUPA 2CK3H 1WMPA 5IG0A 1O7HB 5TGNA 3QK9A 3HIIA 5AIGA 5JPUA 3EN1B 3BB9A 2BHMA 1WMOA 3STDA 1N5PA 1JNQA 3EC9A 2IUKA 3RDEA 2INXA 1VQP3 3MSOA 3CCU3 3N54B 4I4KA 1US1A 2R4IA 4XDVA 2L4VA 4X2HA 1DVCA 5AYRB 2E2VA 2KRTA 1OHSA 4HZ9B 3SEDA 1K8A4 3JUNA 3LTCA 1OCVA 1QAFA 2XSHB 4N3VA 4LGQA 4MJDA 2OQEA 2YFJB 1KQS2 4FMAA 1J2BA 3Q2PA 2FXTA 3G16A 1JRQA 4RNYA 3NV0A 1NB3I 2E2UA 3EE1A 5BXQA 4U13A 3EX9A 3CC43 3OW22 3FG3A 4WHAA 1QJGA 4HM1B 2HMNB 2GU3A 1E3RA 1N8QA 3O8YA 2YFLB 2BO9B 2W56B 1O7NB 3HK4A 4IT7A 2F99A 5ELJA 5CF2A 2W0QA 3Q90A 1W00A 3MG3A 1D6UA 1GD3A 1FA3A 1LOXA 1O7PB 3EQQB 4JRFA 1TU5A 3MG2A 4L8PA 1FGMA 5JBSA 3CCR3 4GB5A 1YIJ3 1JV2B 5EVHA 3UNLA 6STDA 1IU7A 2BNGA 3ALAA 4XM4A 1Q824 4K1UA 4XBTA 2K0MA 1ROAA 3WDGB 1UI8A 1UUVB 1IV7A 1SPUA 3BNBA 5A0OB 1O7WB 2HMJB 4HM6B 4WFOA 3KN4A 3OWSA 1KSIA 1K734 4X2OA 4CCVA 1OHOA 1WNHA 3LYGA 3JUOA 3PS8A 2Q07A 4XBXA 3FH1A 4J8TA 5D83A 3DM8A 2CWTA 2F86B 3DGNA 4MMZB 2CHCA 1SQWA 2XGLA 4K1VA 3FKAA 3WMDA 1QMAA 3NBJA 1W02A 4H61A 2W56A 3HIGA 3SX1A 2QEX3 2W04A 2OOVC 3IMAB 1SIIA 1W7CA 3D9RA 4NHFA 3CME3 3FZWA 4R80A 1IV9A 5I97A 1JB5A 3FGYA 4J9AA 4MMYB 3FG1A 3FG4A 4WYKB 1STFI 1DMMA 5AEWB 2Z6BA 2QIYA 1EG9B 3EF8A 1IVUA 1JKGA 4HM4B 2WGQA 3SVAA 2OOVA 1OHPA 1SJWA 1IQXA 5BVBA 5KP4A 3K0ZA 4HM2B 3CCJ3 2F98A 1JN5B 1NDOB 4O2HA 3LTBA 1W6GA 4FMDA 2K54A 3L0RA 3UL5A 1V74A 2FNQA 4LSOA 3LZAA 2Z7AA 3PGBA 5D82A 1HU9A 1JKGB 3SXXA 2CFGA 4EYCA 3GAXA 1YI23 1IT8A 2E2TA 1YHQ3 1JB2A 1E97A 1JN5A 3PXMA 1A2KA 3FF2A 3X42A 2Z77A 1YJN3 1VQ83 2BMOB 3CCS3 2W03A 2HMKB 4LEHA 4FCZA 3PCSA 4NREA 3UL6A 2YX9A 1YVBI 1VZZA 4Q53A 3E99A 1ULJB 2XF3A 3Q1CA 5AI1A 2PZVA 4K90B 3ROBA 2P09A 2V1LA 2CKFB 1DVDA 3EBTA 4BTXA 1M1XB 3F8XA 3CCM3 1FGQA 4STDA 1QVG2 1TFKA 1GY5A 1LNHA 3X3YA 1SIHA 3CNMA 1ZO2A 4R1KA 3VSYA 2A15A 1IQ8A 5D81A 2STDA 1W2B2 4OUQA 2BT3A 3LT8A 1FGOA 3DGMA 3DY5A 4QWTA 5EEOA 2HMMB 3FCSB 3NQZA 1K9M4 4RBNA 4MMXB 4XBYA 5CF1A 2W2CA 5EQLA 3EN8A 2ZDJA 5LC7A 5IW9A 3MYTA 3RGAA 3BNCA 1EQKA 3LMLA 4OVMA 3QRDA 4O8SA 1S723 3JUMA 4HKVB 5IERA 4H3UA 1YJW3 2W9PA 5KP3A 3MHEA 1UW1A 1Q42A 3S29A 2CFLA 2OCTA 3X3XA 3PCRA 1QAKA 3DUKA 3T0UA 3MPHA 3K63A 1TFOA 3GZXB 1TIJA 4XDWA 3SLUA 2KXGA 1YJ93 1TUHA 3B8LA 4N6LA 3CPW2 5CK6A 4EV5A 3OWYA 2OQEC 2P0XA 1YIT3 1NO3A 2CFDA 4KFEA 1Q40B 3MWZA 4RZMA 3CPOA 3V98A 3F7SA 1OPYA 1RN7A 3LTDA 2ML5A 3T8UA 3OWUA 1UI7A 4ZM8A 2P38A 3HI7A 4FCMA 2RSXA 4GL6A 3FLJA 5IENA 1GY7A 3X41A 1OF5B 2RGQA 5KP1A 2O3OA 3OX9A 2XEPA 3G0KA 4HVNA 1VQO3 3DXOA 3I553 1N5HA 1FGTA 3EB8A 5DRVA 5JPPA 3WODG 2QA43 2C10A 1ASKA 1NB5I 3LOYA 4AKYA 2Y73A 3X40A 1QVF2 3CD63 1UUWB 1IQYA 5CLKA 1IVWA 1ISKA 4AKZA 1IVXA 3IPTA 3OXAA 1OH0A 2XRXB 1KWIA 4JF8A 3S28A 1DMQA 4WYKA 5AYSC 1Q7Y4 1D6YA 1RRLA 3K9MC 3CXC2 2ML6A 1M9GA 1R4CA 3EHCA 3TDGA 5AIFA 4L7KA 1GYBA 5LC6A 2P0MA 3I0YA 1M1K4 3KSPA 4K61A 3S27A 1K41A 4LMIA 1CEWI 1A67A 3AMOB 5AIHA 2FGTA 4N6OB 1W2ZA 4EV2A 2IA7A 3ER7A 1QALA 1CQSA 3GZYB 3JUQA 2D1WA 3MG1A 2MF7A 3ECFA 1TP6A 3JVCA 1Y4KA 3S5CA 2SBLA 1IDPA 2B24B 2GU1A 2XGNA 2CFKA 1IK3A 4LZIA 3IJEB 2IUJA 1PFPA 1F8NA 3DMCA 5IEOA 1MOLA 2XSOB 1NU3A 4O02B 5STDA 3G8ZA 3V99A 3AMOA 8CHOA 1CYUA 2BMQB 3BLZA 2KCDA 3F7XA 5IF6A 3G4S3 1PU4A 3WOFB 7STDA 3KKGA 3SOAA 1E3VA 3N8BA 5IEPA 2W6JH 1C7HA 4R9LA 2PNCA 2Z76A 2WOHA 3FF0A 2XR8B 1W01A 3M8CA 3G713 1S5AA 2C11A 1OUNA 1Z1SA 1KC84 3S67A 4FMCA 3I563 2W9QA 4CDLA 2CWVA 3WOEB 2YFIB 2OTJ3 4R9KA 3HZPA 1Q864 1IT7A 3DZLA 1RRHA 2CFWA 5FGOA 2MC8A 1AVLA 3F9SA 1W6CA 3NM7A 4N6V0 3NM2A 3CCV3 1CYVA 3G6E3 3GZRA 3UB1A 5IG3A 1KD14 2OWPA 1W5ZA 5HGRA 1DMNA 3CNXA 1L5GB 3U1WA 5FW5A 1D6ZA 3HX8A 3T8NA 3CCQ3 1VQ93 2RCDA 1U5OA 2IMJA 1N9JA 3B4OA 5G2GA 4HM3B 1WTHA 2UX0A 1K28A 1VQM3 1OACA 4HYZA 1FGRA 3NX0A 1N9EA 1WQLB 3SOYA 2ZL8A 2RFRA 5IG4A 4AEQA 3NBBA 3H51A 2XH9A 3NUVA 2WO0A 4EXRA 1NJI4 1VQ63 3WA3A 3J7Yd 1VQL3 2QGUA 2JDIH 4ORLA 3CC23 1W6YA 3K7CA 4IIAA 3MKIA 3V92A 1OGZA 2GEYA 3GRDA 4WWUC 5ELUA 1AV4A 2XFSA 1HKXA 4FR9A 2WGOA 3CC73 1RJOA 3CU3A 3PZWA 1VQ73 1YGEA 3OV4A 1OF5A 2B1XB 5AEUB 4N6UA 1GS3A 4G1MB 4KFDA 5CXOA 3H3HA 5AIIA 2CG1A 4L8OA 3GWRA 1Q814 3CMA3 3B4PA 2BMRB 1ULIB 3UJMA 1ZX2A 3F14A 1JJ22 4MEIA 4EC6A 3CCL3 1G96A 4HM8B 4WP5A 3X3ZA 2GEXA 1STDA 3EBYA 3LT9A 2GXFA 4BTWA 3DGLA 3VGNA 4HZBB 1A90A 1M904 3KFQC 4N6MA 3NXJA 2XFTA 2Y74A 1LXEA 3LH4A 1EA2A 1ROVA 1FUWA 2HMLB 1MNLA 2LQVA 1U8CB 3N9HA 1VQK3 1RKYA 2GBWB 3EJVA 1NWWA 3BNEA 3B7CA 4IPBA 3NBRA 3U97A 1AVKA 5DREA 4RNZA 3WA2X 4FMBA 3FSDA 2CC3A 4KFFA 4BTYA 3KE7A 3A76A 3CCE3 3F8HA 4PEJA 2GBXB 2CH9A 4HM7B 2CWUA 4EBGA 1JB4A 2CG0A 2JQ5A 3KSED 1OGXA 1LVNA 3LXUX 2O9UX 1EKMA 4TX4A 3NHXA 2P05A 1DYUA 1WMNA 3VF1A 1VQ53 2I9WA 2HMOB 1O7MB 1W4NA 3GZBA 3NV0B 4R4KA 3PYJA 2CIUA 4HJLB 4KVHA 3LTAA 4HM0B 4N6TA 4XB5A 3KIIA 3BNDA 4KZ1A 3K5TA 1GY6A 1GD4A 3KZTA 1VQ43 2D42A 4HBRA 3NQYA 1BUQA 4HM5B 1T5YA 1VQN3 2WOFA 2OTL3 1AR0A 3RGRA 4FCJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K8A 4;  1S72 3;  1YHQ 3;  1QVG 2;  3CCQ 3;  1M90 4;  1YJW 3;  1VQ9 3;  1Q7Y 4;  1YI2 3;  3CC7 3;  1VQ5 3;  1N8R 4;  3G71 3;  3CCR 3;  1KD1 4;  1VQ7 3;  3CXC 2;  1KQS 2;  1VQM 3;  1KC8 4;  1YIJ 3;  1VQO 3;  1YJN 3;  3I56 3;  3CCJ 3;  1VQK 3;  1VQ8 3;  3CCS 3;  3I55 3;  2OTJ 3;  1Q82 4;  1W2B 2;  1Q81 4;  2QEX 3;  1Q86 4;  3CMA 3;  1YJ9 3;  1M1K 4;  3OW2 2;  3CC4 3;  1K9M 4;  2QA4 3;  1JJ2 2;  1VQ4 3;  1NJI 4;  3CCE 3;  3CPW 2;  1VQ6 3;  1VQL 3;  3CME 3;  3CCL 3;  1VQP 3;  3CCU 3;  3CC2 3;  1YIT 3;  1QVF 2;  3CCV 3;  1VQN 3;  3CD6 3;  2OTL 3;  3G4S 3;  3G6E 3;  1K73 4;  3CCM 3; 
#chains in the Genus database with same CATH topology
 1A2V A;  1I2E A;  1IVV A;  2M7O A;  2CW9 A;  3F40 A;  3DGO A;  1RCL A;  4N6N B;  1Q40 A;  2LYX A;  4O3V A;  4OK0 A;  5IG5 A;  3WHO A;  4EW5 A;  1O7G B;  1N8R 4;  1RMS A;  1BRG A;  3D3L A;  3JUP A;  2CK3 H;  1WMP A;  5IG0 A;  1O7H B;  5TGN A;  1BNG A;  1RHL A;  3QK9 A;  3HII A;  5AIG A;  5JPU A;  3EN1 B;  3BB9 A;  2BHM A;  1WMO A;  3STD A;  1N5P A;  1ZS7 A;  1JNQ A;  3EC9 A;  2IUK A;  3RDE A;  1Q9E A;  2INX A;  1VQP 3;  3MSO A;  1T2I A;  3CCU 3;  3N54 B;  4I4K A;  1US1 A;  2R4I A;  4XDV A;  1B20 A;  2L4V A;  4X2H A;  1DVC A;  5AYR B;  2E2V A;  2KRT A;  1OHS A;  4HZ9 B;  5M19 A;  2ZHX B;  3SED A;  1K8A 4;  3JUN A;  3LTC A;  3SYU A;  1OCV A;  1QAF A;  2XSH B;  4N3V A;  4LGQ A;  5RNT A;  2KF5 A;  4MJD A;  2OQE A;  2YFJ B;  1KQS 2;  5G1K A;  4FMA A;  1J2B A;  3Q2P A;  2FXT A;  3G16 A;  1JRQ A;  1GSP A;  4RNY A;  1I0V A;  3NV0 A;  1NB3 I;  1B2M A;  2E2U A;  3EE1 A;  2CX0 A;  1UCK A;  4U13 A;  3ZFZ A;  5BXQ A;  3EX9 A;  3CC4 3;  3OW2 2;  1BAO A;  3FG3 A;  4WHA A;  1QJG A;  4HM1 B;  2HMN B;  2GU3 A;  1E3R A;  1N8Q A;  3O8Y A;  3ZG5 A;  2YFL B;  2BO9 B;  2W56 B;  5HOH A;  1I0X A;  1O7N B;  3HK4 A;  4IT7 A;  2F99 A;  5ELJ A;  5CF2 A;  2W0Q A;  3Q90 A;  1W00 A;  3MG3 A;  1D6U A;  1MWT A;  1GD3 A;  4CPK A;  1FA3 A;  1RGA A;  1LOX A;  1O7P B;  1Q7H A;  3EQQ B;  2F5W A;  4JRF A;  2UUG C;  1TU5 A;  1BAN A;  3MG2 A;  4L8P A;  1BRI A;  1FGM A;  5JBS A;  3CCR 3;  1X1Y A;  4GB5 A;  2KF3 A;  1JV2 B;  1B2X A;  5EVH A;  1YIJ 3;  3UNL A;  6STD A;  1IU7 A;  2BNG A;  3ALA A;  4XM4 A;  1Q82 4;  4K1U A;  3Q3F A;  4XBT A;  2K0M A;  1ROA A;  3WDG B;  1UI8 A;  1UUV B;  1IV7 A;  2AAE A;  1DET A;  1RGH A;  1SPU A;  3ZG0 A;  3BNB A;  5A0O B;  1O7W B;  1GOY A;  2HMJ B;  4HM6 B;  4WFO A;  3KN4 A;  3OWS A;  1RN4 A;  1KSI A;  1K73 4;  4X2O A;  4CCV A;  1C54 A;  1OHO A;  2AAD A;  2SAR A;  2R41 A;  4NPB A;  1RCK A;  1WNH A;  3AGO A;  3LYG A;  3JUO A;  1BSC A;  3PS8 A;  2Q07 A;  4XBX A;  3FH1 A;  4J8T A;  5D83 A;  3DM8 A;  2CWT A;  2F86 B;  3DGN A;  4MMZ B;  2CHC A;  1SQW A;  2XGL A;  4K1V A;  3FKA A;  3WMD A;  1QMA A;  3NBJ A;  1W02 A;  4H61 A;  2W56 A;  3AHW A;  3HIG A;  3SX1 A;  1T2H A;  2QEX 3;  1BSB A;  2OOV C;  2W04 A;  3IMA B;  1SII A;  1B27 A;  1W7C A;  2ZA4 A;  3D9R A;  4NHF A;  7GSP A;  1BRK A;  1JBT A;  3CME 3;  3FZW A;  4R80 A;  1IV9 A;  5I97 A;  1JB5 A;  2RBI A;  3FGY A;  4J9A A;  4MMY B;  1PY3 A;  1FUS A;  1B2Z A;  2IY2 A;  3FG1 A;  3FG4 A;  1MWU A;  4WYK B;  1STF I;  1DMM A;  5AEW B;  1X1X A;  2Z6B A;  5M1A A;  1JBR A;  4I5Q A;  2QIY A;  1EG9 B;  1MGR A;  3EF8 A;  3URP A;  1IVU A;  1JKG A;  3DH2 A;  4HM4 B;  2WGQ A;  3SVA A;  1EEJ A;  2OOV A;  1OHP A;  1SJW A;  1IQX A;  5BVB A;  5KP4 A;  3K0Z A;  4HM2 B;  3CCJ 3;  2F98 A;  1JN5 B;  1NDO B;  4O2H A;  3LTB A;  1TRQ A;  1RNT A;  5BU4 A;  1W6G A;  2CX1 A;  1LRA A;  4FMD A;  2K54 A;  3L0R A;  3UL5 A;  1V74 A;  2FNQ A;  4LSO A;  5GSP A;  1BUJ A;  4ILF A;  3LZA A;  2Z7A A;  3PGB A;  1I2G A;  2C4B A;  5D82 A;  3D5I A;  1HU9 A;  1JKG B;  1YGW A;  1BRJ A;  2L1S A;  1BVI A;  1BU4 A;  3SXX A;  2CFG A;  4EYC A;  3GAX A;  1GMR A;  1YI2 3;  1IT8 A;  2E2T A;  1YHQ 3;  1JB2 A;  1E97 A;  2IYJ A;  6GSP A;  1JN5 A;  3PXM A;  1A2K A;  1TTO A;  3FF2 A;  3X42 A;  1RSN A;  2HOH A;  2Z77 A;  1RTU A;  1YJN 3;  1IYY A;  1VQ8 3;  2BMO B;  3CCS 3;  2W03 A;  4KT3 B;  2HMK B;  4LEH A;  1UDI I;  4FCZ A;  3PCS A;  4NRE A;  3UL6 A;  2YX9 A;  1YVB I;  1BIR A;  1VZZ A;  3E99 A;  4Q53 A;  1ULJ B;  2XF3 A;  1NNV A;  3Q1C A;  5AI1 A;  1DE3 A;  2PZV A;  4K90 B;  3ROB A;  3HOH A;  2P09 A;  2V1L A;  2CKF B;  4HAA A;  1DVD A;  3EBT A;  4BTX A;  1M1X B;  1V58 A;  3F8X A;  3CCM 3;  1FGQ A;  4STD A;  1QVG 2;  1TFK A;  1GY5 A;  1TRP A;  1LNH A;  5G1L A;  2KF6 A;  2F5M A;  3X3Y A;  1SIH A;  3CNM A;  1ZO2 A;  2RNT A;  4R1K A;  3VSY A;  1GMP A;  1B21 A;  2A15 A;  1IQ8 A;  1V57 A;  1AY7 A;  5D81 A;  1MWS A;  2STD A;  1UGI A;  4OUQ A;  1W2B 2;  4BU4 A;  2BT3 A;  3LT8 A;  1FGO A;  3DGM A;  2UGI A;  1BSD A;  3DY5 A;  2HMM B;  3FCS B;  3NQZ A;  4QWT A;  5EEO A;  1K9M 4;  4RBN A;  4MMX B;  1CH0 A;  4XBY A;  5CF1 A;  2W2C A;  1BNJ A;  5EQL A;  3EN8 A;  2ZDJ A;  5LC7 A;  5IW9 A;  3MYT A;  3RGA A;  3BNC A;  1EQK A;  3LML A;  4HOH A;  7RNT A;  4GSP A;  4OVM A;  3QRD A;  4O8S A;  1S72 3;  3JUM A;  4HKV B;  1YVS A;  4H3U A;  5IER A;  2KAA A;  1YJW 3;  3D4A A;  1T3B A;  2W9P A;  5KP3 A;  3MHE A;  1RGL A;  1UW1 A;  1Q42 A;  1AQZ A;  3S29 A;  2CFL A;  2OCT A;  3X3X A;  3PCR A;  1QAK A;  3DUK A;  3T0U A;  1BRS A;  3K63 A;  3MPH A;  1TFO A;  3GZX B;  1TIJ A;  4XDW A;  3SLU A;  2KXG A;  1YJ9 3;  1TUH A;  3B8L A;  4N6L A;  3CPW 2;  5CK6 A;  4EV5 A;  1B3S A;  3OWY A;  2OQE C;  2BIR A;  2P0X A;  1YIT 3;  1NO3 A;  1BNS A;  2CFD A;  4KFE A;  1Q40 B;  3MWZ A;  4RZM A;  3CPO A;  3V98 A;  3F7S A;  1OPY A;  1RN7 A;  3LTD A;  1HZ1 A;  2GSP A;  2ML5 A;  3T8U A;  3OWU A;  1UI7 A;  4ZM8 A;  2P38 A;  3HI7 A;  4FCM A;  2RSX A;  4GL6 A;  3FLJ A;  5IEN A;  1GY7 A;  3X41 A;  1OF5 B;  1LOW A;  2RGQ A;  1I2F A;  5KP1 A;  2O3O A;  3OX9 A;  2XEP A;  3G0K A;  1EUI C;  4HVN A;  1VQO 3;  3DXO A;  2KF4 A;  3I55 3;  1N5H A;  1FGT A;  3EB8 A;  1JZO A;  3BIR A;  5DRV A;  5JPP A;  3WOD G;  3GSP A;  2QA4 3;  2C10 A;  1ASK A;  1NB5 I;  3LOY A;  4AKY A;  2Y73 A;  3X40 A;  1QVF 2;  3CD6 3;  1UUW B;  1IQY A;  5CLK A;  1IVW A;  1ISK A;  1UCJ A;  4AKZ A;  1IVX A;  3IPT A;  3OXA A;  1OH0 A;  1FW7 A;  2J8X B;  2XRX B;  1KWI A;  4JF8 A;  1LNI A;  4J5G A;  3S28 A;  1DMQ A;  4WYK A;  5AYS C;  1Q7Y 4;  1D6Y A;  1RRL A;  3K9M C;  3CXC 2;  2ML6 A;  1M9G A;  1R4C A;  3EHC A;  2F56 A;  5AIF A;  3TDG A;  4L7K A;  1GYB A;  1RN1 A;  9RNT A;  5LC6 A;  2P0M A;  3I0Y A;  1M1K 4;  3KSP A;  4K61 A;  3S27 A;  1K41 A;  1MGW A;  4LMI A;  1CEW I;  1A67 A;  3AMO B;  1ZGX A;  5AIH A;  2FGT A;  4N6O B;  1W2Z A;  4EV2 A;  5M18 A;  2IA7 A;  6RNT A;  3ER7 A;  1QAL A;  3KCH A;  1CQS A;  3GZY B;  3JUQ A;  1UGH I;  2D1W A;  3MG1 A;  2MF7 A;  3ECF A;  1RLS A;  1TP6 A;  3JVC A;  1Y4K A;  3S5C A;  2SBL A;  1IDP A;  2B24 B;  2GU1 A;  1GOU A;  2XGN A;  1FUT A;  2CFK A;  4RNT A;  4LZI A;  1IK3 A;  3IJE B;  3AHS A;  2IUJ A;  1PFP A;  1F8N A;  3DMC A;  3BU4 A;  1MOL A;  2XSO B;  1NU3 A;  4O02 B;  5IEO A;  5STD A;  1JZD A;  3D79 A;  3G8Z A;  3V99 A;  3AMO A;  8CHO A;  1CYU A;  2BMQ B;  1RGC A;  3BLZ A;  5BIR A;  2KCD A;  3F7X A;  4BL2 A;  5IF6 A;  3G4S 3;  1LQM B;  1PU4 A;  3WOF B;  1YNV X;  3KKG A;  7STD A;  3SOA A;  1E3V A;  3N8B A;  5IEP A;  2W6J H;  1C7H A;  1RGG A;  3D5G A;  4R9L A;  1PYL A;  2PNC A;  2Z76 A;  2WOH A;  3FF0 A;  2XR8 B;  1W01 A;  3M8C A;  3G71 3;  1BRH A;  1S5A A;  4BL3 A;  1UCI A;  2C11 A;  2K3D A;  1OUN A;  1Z1S A;  1KC8 4;  3S67 A;  4FMC A;  3I56 3;  2W9Q A;  4CDL A;  2CWV A;  3WOE B;  2YFI B;  1MWR A;  2OTJ 3;  4R9K A;  1X1U A;  3HZP A;  1Q86 4;  1IT7 A;  3DZL A;  1BNR A;  1RRH A;  2CFW A;  5FGO A;  2MC8 A;  1AVL A;  2BU4 A;  3F9S A;  1W6C A;  3NM7 A;  1FYS A;  4N6V 0;  3NM2 A;  3CCV 3;  1CYV A;  2H0I A;  3GZR A;  3UB1 A;  5IG3 A;  3G6E 3;  1KD1 4;  2OWP A;  1UCL A;  1W5Z A;  5HGR A;  1DMN A;  3CNX A;  1L5G B;  3A5E A;  5FW5 A;  1D6Z A;  3HX8 A;  3T8N A;  3U1W A;  3CCQ 3;  1VQ9 3;  1GMQ A;  1U5O A;  2IMJ A;  1N9J A;  1BNF A;  2RCD A;  3B4O A;  1WTH A;  2UX0 A;  4HM3 B;  5G2G A;  1B2U A;  1BSA A;  1K28 A;  1VQM 3;  1OAC A;  4HYZ A;  1SAR A;  1FGR A;  3NX0 A;  1N9E A;  1WQL B;  3SOY A;  2ZL8 A;  2RFR A;  5IG4 A;  4AEQ A;  3NBB A;  3H51 A;  2XH9 A;  3NUV A;  2WO0 A;  4EXR A;  1NJI 4;  1VQ6 3;  3WA3 A;  3J7Y d;  1VQL 3;  2QGU A;  2JDI H;  4ORL A;  4GHO A;  3CC2 3;  1W6Y A;  3K7C A;  4IIA A;  3MKI A;  3V92 A;  1OGZ A;  1R4Y A;  1FZU A;  1I3F A;  2GEY A;  3GRD A;  1RGF A;  4WWU C;  5ELU A;  1X1W A;  1AV4 A;  2XFS A;  1HKX A;  1LOV A;  4FR9 A;  2WGO A;  3CC7 3;  1RJO A;  3CU3 A;  3PZW A;  1VQ7 3;  1YGE A;  3OV4 A;  1LOY A;  1OF5 A;  2B1X B;  4BIR A;  5AEU B;  4N6U A;  1GS3 A;  4G1M B;  4KFD A;  5CXO A;  3H3H A;  5AII A;  2CG1 A;  4L8O A;  1RNB A;  3GWR A;  1LQG C;  1Q81 4;  3CMA 3;  3B4P A;  2BMR B;  1ULI B;  3UJM A;  1ZX2 A;  3F14 A;  1JJ2 2;  4MEI A;  3RNT A;  4EC6 A;  3CCL 3;  1G96 A;  3AGN A;  4J5K A;  4DKI A;  4HM8 B;  4WP5 A;  3X3Z A;  2GEX A;  1STD A;  3EBY A;  3LT9 A;  2GXF A;  4BTW A;  3DGL A;  3VGN A;  4HZB B;  1A90 A;  1M90 4;  3KFQ C;  4N6M A;  3NXJ A;  2XFT A;  2Y74 A;  1LXE A;  1I70 A;  1EA2 A;  1ROV A;  3LH4 A;  1FUW A;  1RGK A;  1BGS A;  2HML B;  1I8V A;  1MNL A;  2LQV A;  2H0H A;  1U8C B;  3DGY A;  1JBS A;  3N9H A;  1VQK 3;  1RKY A;  2GBW B;  1TJD A;  1NWW A;  3EJV A;  3BNE A;  3B7C A;  4IPB A;  3NBR A;  3U97 A;  1AVK A;  5DRE A;  4RNZ A;  3WA2 X;  1B2S A;  4FMB A;  3FSD A;  2CC3 A;  4KFF A;  4BTY A;  3KE7 A;  3A76 A;  3CCE 3;  2F4Y A;  3F8H A;  4PEJ A;  2GBX B;  2H0G A;  2CH9 A;  4HM7 B;  2CWU A;  4EBG A;  1JB4 A;  2CG0 A;  2JQ5 A;  3KSE D;  1OGX A;  1I3I A;  1BRN L;  1LVN A;  3LXU X;  1BOX A;  2O9U X;  1EKM A;  1GOV A;  1A2P A;  4TX4 A;  3NHX A;  2P05 A;  1DYU A;  1WMN A;  3VF1 A;  1VQ5 3;  2I9W A;  8RNT A;  4CJN A;  2HMO B;  4LYL B;  1BNE A;  1O7M B;  1W4N A;  3GZB A;  3NV0 B;  4R4K A;  3PYJ A;  2CIU A;  4HJL B;  4KVH A;  3WR2 A;  3LTA A;  4HM0 B;  4N6T A;  4XB5 A;  3KII A;  1BSE A;  3BND A;  4KZ1 A;  1VQQ A;  3K5T A;  1GY6 A;  1RDS A;  1GD4 A;  3KZT A;  1BNI A;  1VQ4 3;  2D42 A;  4HBR A;  3NQY A;  1UUG B;  1G0T A;  1BUQ A;  1HYF A;  4HM5 B;  1T5Y A;  1VQN 3;  1G02 A;  2WOF A;  2OTL 3;  1AR0 A;  1RGE A;  3RGR A;  4FCJ A; 
#chains in the Genus database with same CATH homology
 1A2V A;  1IVV A;  2M7O A;  2CW9 A;  3F40 A;  3DGO A;  4N6N B;  1Q40 A;  2LYX A;  4O3V A;  4OK0 A;  5IG5 A;  1N8R 4;  1O7G B;  3D3L A;  3JUP A;  2CK3 H;  1WMP A;  5IG0 A;  1O7H B;  5TGN A;  3QK9 A;  3HII A;  5AIG A;  5JPU A;  3EN1 B;  3BB9 A;  2BHM A;  1WMO A;  3STD A;  1N5P A;  1JNQ A;  3EC9 A;  2IUK A;  3RDE A;  2INX A;  1VQP 3;  3MSO A;  3CCU 3;  3N54 B;  4I4K A;  1US1 A;  2R4I A;  4XDV A;  2L4V A;  4X2H A;  1DVC A;  5AYR B;  2E2V A;  2KRT A;  1OHS A;  4HZ9 B;  3SED A;  1K8A 4;  3JUN A;  3LTC A;  1OCV A;  1QAF A;  2XSH B;  4N3V A;  4LGQ A;  4MJD A;  2OQE A;  2YFJ B;  1KQS 2;  4FMA A;  1J2B A;  3Q2P A;  2FXT A;  3G16 A;  1JRQ A;  4RNY A;  3NV0 A;  1NB3 I;  2E2U A;  3EE1 A;  5BXQ A;  4U13 A;  3EX9 A;  3CC4 3;  3OW2 2;  3FG3 A;  4WHA A;  1QJG A;  4HM1 B;  2HMN B;  2GU3 A;  1E3R A;  1N8Q A;  3O8Y A;  2YFL B;  2BO9 B;  2W56 B;  1O7N B;  3HK4 A;  4IT7 A;  2F99 A;  5ELJ A;  5CF2 A;  2W0Q A;  3Q90 A;  1W00 A;  3MG3 A;  1D6U A;  1GD3 A;  1FA3 A;  1LOX A;  1O7P B;  3EQQ B;  4JRF A;  1TU5 A;  3MG2 A;  4L8P A;  1FGM A;  5JBS A;  3CCR 3;  4GB5 A;  1YIJ 3;  1JV2 B;  5EVH A;  3UNL A;  6STD A;  1IU7 A;  2BNG A;  3ALA A;  4XM4 A;  1Q82 4;  4K1U A;  4XBT A;  2K0M A;  1ROA A;  3WDG B;  1UI8 A;  1UUV B;  1IV7 A;  1SPU A;  3BNB A;  5A0O B;  1O7W B;  2HMJ B;  4HM6 B;  4WFO A;  3KN4 A;  3OWS A;  1KSI A;  1K73 4;  4X2O A;  4CCV A;  1OHO A;  1WNH A;  3LYG A;  3JUO A;  3PS8 A;  2Q07 A;  4XBX A;  3FH1 A;  4J8T A;  5D83 A;  3DM8 A;  2CWT A;  2F86 B;  3DGN A;  4MMZ B;  2CHC A;  1SQW A;  2XGL A;  4K1V A;  3FKA A;  3WMD A;  1QMA A;  3NBJ A;  1W02 A;  4H61 A;  2W56 A;  3HIG A;  3SX1 A;  2QEX 3;  2W04 A;  2OOV C;  3IMA B;  1SII A;  1W7C A;  3D9R A;  4NHF A;  3CME 3;  3FZW A;  4R80 A;  1IV9 A;  5I97 A;  1JB5 A;  3FGY A;  4J9A A;  4MMY B;  3FG1 A;  3FG4 A;  4WYK B;  1STF I;  1DMM A;  5AEW B;  2Z6B A;  2QIY A;  1EG9 B;  3EF8 A;  1IVU A;  1JKG A;  4HM4 B;  2WGQ A;  3SVA A;  2OOV A;  1OHP A;  1SJW A;  1IQX A;  5BVB A;  5KP4 A;  3K0Z A;  4HM2 B;  3CCJ 3;  2F98 A;  1JN5 B;  1NDO B;  4O2H A;  3LTB A;  1W6G A;  4FMD A;  2K54 A;  3L0R A;  3UL5 A;  1V74 A;  2FNQ A;  4LSO A;  3LZA A;  2Z7A A;  3PGB A;  5D82 A;  1HU9 A;  1JKG B;  3SXX A;  2CFG A;  4EYC A;  3GAX A;  1YI2 3;  1IT8 A;  2E2T A;  1YHQ 3;  1JB2 A;  1E97 A;  1JN5 A;  3PXM A;  1A2K A;  3FF2 A;  3X42 A;  2Z77 A;  1YJN 3;  1VQ8 3;  2BMO B;  3CCS 3;  2W03 A;  2HMK B;  4LEH A;  4FCZ A;  3PCS A;  4NRE A;  3UL6 A;  2YX9 A;  1YVB I;  1VZZ A;  4Q53 A;  3E99 A;  1ULJ B;  2XF3 A;  3Q1C A;  5AI1 A;  2PZV A;  4K90 B;  3ROB A;  2P09 A;  2V1L A;  2CKF B;  1DVD A;  3EBT A;  4BTX A;  1M1X B;  3F8X A;  3CCM 3;  1FGQ A;  4STD A;  1QVG 2;  1TFK A;  1GY5 A;  1LNH A;  3X3Y A;  1SIH A;  3CNM A;  1ZO2 A;  4R1K A;  3VSY A;  2A15 A;  1IQ8 A;  5D81 A;  2STD A;  1W2B 2;  4OUQ A;  2BT3 A;  3LT8 A;  1FGO A;  3DGM A;  3DY5 A;  4QWT A;  5EEO A;  2HMM B;  3FCS B;  3NQZ A;  1K9M 4;  4RBN A;  4MMX B;  4XBY A;  5CF1 A;  2W2C A;  5EQL A;  3EN8 A;  2ZDJ A;  5LC7 A;  5IW9 A;  3MYT A;  3RGA A;  3BNC A;  1EQK A;  3LML A;  4OVM A;  3QRD A;  4O8S A;  1S72 3;  3JUM A;  4HKV B;  5IER A;  4H3U A;  1YJW 3;  2W9P A;  5KP3 A;  3MHE A;  1UW1 A;  1Q42 A;  3S29 A;  2CFL A;  2OCT A;  3X3X A;  3PCR A;  1QAK A;  3DUK A;  3T0U A;  3MPH A;  3K63 A;  1TFO A;  3GZX B;  1TIJ A;  4XDW A;  3SLU A;  2KXG A;  1YJ9 3;  1TUH A;  3B8L A;  4N6L A;  3CPW 2;  5CK6 A;  4EV5 A;  3OWY A;  2OQE C;  2P0X A;  1YIT 3;  1NO3 A;  2CFD A;  4KFE A;  1Q40 B;  3MWZ A;  4RZM A;  3CPO A;  3V98 A;  3F7S A;  1OPY A;  1RN7 A;  3LTD A;  2ML5 A;  3T8U A;  3OWU A;  1UI7 A;  4ZM8 A;  2P38 A;  3HI7 A;  4FCM A;  2RSX A;  4GL6 A;  3FLJ A;  5IEN A;  1GY7 A;  3X41 A;  1OF5 B;  2RGQ A;  5KP1 A;  2O3O A;  3OX9 A;  2XEP A;  3G0K A;  4HVN A;  1VQO 3;  3DXO A;  3I55 3;  1N5H A;  1FGT A;  3EB8 A;  5DRV A;  5JPP A;  3WOD G;  2QA4 3;  2C10 A;  1ASK A;  1NB5 I;  3LOY A;  4AKY A;  2Y73 A;  3X40 A;  1QVF 2;  3CD6 3;  1UUW B;  1IQY A;  5CLK A;  1IVW A;  1ISK A;  4AKZ A;  1IVX A;  3IPT A;  3OXA A;  1OH0 A;  2XRX B;  1KWI A;  4JF8 A;  3S28 A;  1DMQ A;  4WYK A;  5AYS C;  1Q7Y 4;  1D6Y A;  1RRL A;  3K9M C;  3CXC 2;  2ML6 A;  1M9G A;  1R4C A;  3EHC A;  3TDG A;  5AIF A;  4L7K A;  1GYB A;  5LC6 A;  2P0M A;  3I0Y A;  1M1K 4;  3KSP A;  4K61 A;  3S27 A;  1K41 A;  4LMI A;  1CEW I;  1A67 A;  3AMO B;  5AIH A;  2FGT A;  4N6O B;  1W2Z A;  4EV2 A;  2IA7 A;  3ER7 A;  1QAL A;  1CQS A;  3GZY B;  3JUQ A;  2D1W A;  3MG1 A;  2MF7 A;  3ECF A;  1TP6 A;  3JVC A;  1Y4K A;  3S5C A;  2SBL A;  1IDP A;  2B24 B;  2GU1 A;  2XGN A;  2CFK A;  1IK3 A;  4LZI A;  3IJE B;  2IUJ A;  1PFP A;  1F8N A;  3DMC A;  5IEO A;  1MOL A;  2XSO B;  1NU3 A;  4O02 B;  5STD A;  3G8Z A;  3V99 A;  3AMO A;  8CHO A;  1CYU A;  2BMQ B;  3BLZ A;  2KCD A;  3F7X A;  5IF6 A;  3G4S 3;  1PU4 A;  3WOF B;  7STD A;  3KKG A;  3SOA A;  1E3V A;  3N8B A;  5IEP A;  2W6J H;  1C7H A;  4R9L A;  2PNC A;  2Z76 A;  2WOH A;  3FF0 A;  2XR8 B;  1W01 A;  3M8C A;  3G71 3;  1S5A A;  2C11 A;  1OUN A;  1Z1S A;  1KC8 4;  3S67 A;  4FMC A;  3I56 3;  2W9Q A;  4CDL A;  2CWV A;  3WOE B;  2YFI B;  2OTJ 3;  4R9K A;  3HZP A;  1Q86 4;  1IT7 A;  3DZL A;  1RRH A;  2CFW A;  5FGO A;  2MC8 A;  1AVL A;  3F9S A;  1W6C A;  3NM7 A;  4N6V 0;  3NM2 A;  3CCV 3;  1CYV A;  3G6E 3;  3GZR A;  3UB1 A;  5IG3 A;  1KD1 4;  2OWP A;  1W5Z A;  5HGR A;  1DMN A;  3CNX A;  1L5G B;  3U1W A;  5FW5 A;  1D6Z A;  3HX8 A;  3T8N A;  3CCQ 3;  1VQ9 3;  2RCD A;  1U5O A;  2IMJ A;  1N9J A;  3B4O A;  5G2G A;  4HM3 B;  1WTH A;  2UX0 A;  1K28 A;  1VQM 3;  1OAC A;  4HYZ A;  1FGR A;  3NX0 A;  1N9E A;  1WQL B;  3SOY A;  2ZL8 A;  2RFR A;  5IG4 A;  4AEQ A;  3NBB A;  3H51 A;  2XH9 A;  3NUV A;  2WO0 A;  4EXR A;  1NJI 4;  1VQ6 3;  3WA3 A;  3J7Y d;  1VQL 3;  2QGU A;  2JDI H;  4ORL A;  3CC2 3;  1W6Y A;  3K7C A;  4IIA A;  3MKI A;  3V92 A;  1OGZ A;  2GEY A;  3GRD A;  4WWU C;  5ELU A;  1AV4 A;  2XFS A;  1HKX A;  4FR9 A;  2WGO A;  3CC7 3;  1RJO A;  3CU3 A;  3PZW A;  1VQ7 3;  1YGE A;  3OV4 A;  1OF5 A;  2B1X B;  5AEU B;  4N6U A;  1GS3 A;  4G1M B;  4KFD A;  5CXO A;  3H3H A;  5AII A;  2CG1 A;  4L8O A;  3GWR A;  1Q81 4;  3CMA 3;  3B4P A;  2BMR B;  1ULI B;  3UJM A;  1ZX2 A;  3F14 A;  1JJ2 2;  4MEI A;  4EC6 A;  3CCL 3;  1G96 A;  4HM8 B;  4WP5 A;  3X3Z A;  2GEX A;  1STD A;  3EBY A;  3LT9 A;  2GXF A;  4BTW A;  3DGL A;  3VGN A;  4HZB B;  1A90 A;  1M90 4;  3KFQ C;  4N6M A;  3NXJ A;  2XFT A;  2Y74 A;  1LXE A;  3LH4 A;  1EA2 A;  1ROV A;  1FUW A;  2HML B;  1MNL A;  2LQV A;  1U8C B;  3N9H A;  1VQK 3;  1RKY A;  2GBW B;  3EJV A;  1NWW A;  3BNE A;  3B7C A;  4IPB A;  3NBR A;  3U97 A;  1AVK A;  5DRE A;  4RNZ A;  3WA2 X;  4FMB A;  3FSD A;  2CC3 A;  4KFF A;  4BTY A;  3KE7 A;  3A76 A;  3CCE 3;  3F8H A;  4PEJ A;  2GBX B;  2CH9 A;  4HM7 B;  2CWU A;  4EBG A;  1JB4 A;  2CG0 A;  2JQ5 A;  3KSE D;  1OGX A;  1LVN A;  3LXU X;  2O9U X;  1EKM A;  4TX4 A;  3NHX A;  2P05 A;  1DYU A;  1WMN A;  3VF1 A;  1VQ5 3;  2I9W A;  2HMO B;  1O7M B;  1W4N A;  3GZB A;  3NV0 B;  4R4K A;  3PYJ A;  2CIU A;  4HJL B;  4KVH A;  3LTA A;  4HM0 B;  4N6T A;  4XB5 A;  3KII A;  3BND A;  4KZ1 A;  3K5T A;  1GY6 A;  1GD4 A;  3KZT A;  1VQ4 3;  2D42 A;  4HBR A;  3NQY A;  1BUQ A;  4HM5 B;  1T5Y A;  1VQN 3;  2WOF A;  2OTL 3;  1AR0 A;  3RGR A;  4FCJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...