1BSEA

Crystal structural analysis of mutations in the hydrophobic cores of barnase
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRIVYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endonuclease
molecule keywords BARNASE
publication title Crystal structural analysis of mutations in the hydrophobic cores of barnase.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
total genus 32
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 1993-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1bseA00
3D5GA 3Q3FA 5BIRA 1BRKA 1ZGXA 3RNTA 1I0VA 1AQZA 2F4YA 1B3SA 4GHOA 1AY7A 1I3IA 1FZUA 1RNTA 3AGOA 1UCKA 1X1XA 2GSPA 3BU4A 5HOHA 1RMSA 1HYFA 1R4YA 3A5EA 3AGNA 1RGGA 1BU4A 1X1UA 1RGFA 2RNTA 1RGAA 3DH2A 1BUJA 1B2XA 3SYUA 1BNIA 1YGWA 1B20A 1YNVX 1MGWA 1BIRA 1FUTA 1DETA 1BRSA 4HOHA 1BRHA 1I70A 2F56A 1BRIA 2KF6A 3AHSA 3D5IA 1LOYA 3KCHA 2RBIA 4RNTA 1BNGA 1FYSA 6RNTA 3WHOA 1YVSA 1I0XA 1FW7A 1LNIA 1MGRA 2BU4A 3BIRA 1RN4A 3HOHA 1FUSA 2KF4A 1RGHA 4J5GA 1I3FA 5GSPA 7GSPA 1I2FA 2KF5A 2F5MA 1B2ZA 1BNJA 1GSPA 1BAOA 1I2EA 1TRQA 2KF3A 3WR2A 1RLSA 1GOUA 2BIRA 1BANA 1GMRA 1RN1A 1BSBA 1C54A 1T2HA 1LOVA 5RNTA 1JBTA 1BRNL 1UCLA 1B27A 3AHWA 4J5KA 1BSEA 8RNTA 1BSDA 4BIRA 4GSPA 2ZA4A 1TRPA 1BNSA 1PYLA 1DE3A 1IYYA 2KAAA 2F5WA 1GMPA 2AAEA 1BGSA 1BVIA 1RGKA 1G02A 1GOYA 1BSAA 1RCKA 5BU4A 9RNTA 1BNRA 1BOXA 1JBRA 1I2GA 1B2UA 1X1YA 1GOVA 2HOHA 2SARA 7RNTA 1PY3A 1T2IA 1BSCA 2C4BA 1RGEA 6GSPA 1RCLA 1B2SA 1RHLA 1RDSA 1B2MA 1LRAA 1RSNA 1UCIA 1HZ1A 1BRJA 1X1WA 1UCJA 3GSPA 3URPA 1I8VA 1LOWA 2AADA 1RGLA 1B21A 1CH0A 4BU4A 1Q9EA 1BNFA 1GMQA 1SARA 1TTOA 1BNEA 3DGYA 1JBSA 1RTUA 1A2PA 1RGCA 3D4AA 1RNBA 4HAAA 1BRGA
chains in the Genus database with same CATH superfamily
3ALAA 3D5GA 3Q3FA 1KQS2 4OVMA 3G0KA 1WMPA 1MWRA 3CCQ3 1JN5A 1JB4A 1NB5I 3EX9A 1SPUA 3PCRA 2WGQA 4R4KA 2HMKB 2OOVC 4JRFA 4N6UA 3CCU3 3AGOA 4FCMA 4WWUC 8CHOA 1VQN3 1RMSA 4HBRA 3MYTA 1FGQA 4FMBA 3S67A 1OCVA 3D9RA 1BU4A 1X1UA 2RGQA 2V1LA 3HI7A 3Q2PA 5TGNA 1IV7A 5LC7A 3FZWA 3SVAA 1VQM3 3SXXA 1B2XA 1W2B2 1YGWA 1G0TA 1YNVX 4NHFA 3G4S3 3HX8A 3CNMA 1DVCA 1DETA 1CEWI 1BRSA 1OF5A 4R80A 3G713 3X40A 3EN8A 1S5AA 1BRIA 4L7KA 1LOYA 3DGLA 4EBGA 3GRDA 1NJI4 5G2GA 2F99A 3T8UA 2KCDA 6STDA 3KSPA 1BNGA 7STDA 6RNTA 3PS8A 5KP1A 1N5PA 5AI1A 1I0XA 1FW7A 2ZHXB 5M19A 2YFIB 3CXC2 4BTYA 1MGRA 4JF8A 2GEYA 3F8HA 4WP5A 5I97A 1RN4A 2P0MA 2D1WA 2XFTA 3F7SA 3LT8A 3I563 3G6E3 1Q7HA 1TFOA 3GAXA 3GZXB 1O7PB 3TDGA 1JZOA 3LZAA 1AVLA 2PNCA 1IQXA 5AYRB 3GZYB 2OQEC 3GWRA 1JRQA 1OUNA 3M8CA 4WYKA 3IJEB 3NX0A 2STDA 1MWTA 3GZBA 2CIUA 3QRDA 1UDII 4KFFA 2CWTA 2QEX3 1DMMA 4XM4A 2A15A 4KFDA 3X3ZA 5IG5A 4LGQA 2BNGA 5HGRA 3K7CA 3NBRA 1C54A 3EBYA 4N3VA 4R9LA 4EYCA 1LOVA 5RNTA 3CCJ3 1JBTA 3B4OA 4RNYA 2P05A 1IT7A 5D82A 3CME3 3CMA3 2RFRA 3HIGA 8RNTA 1W5ZA 2C10A 3V99A 4AEQA 4GSPA 2D42A 1YGEA 2ZA4A 1TRPA 2KAAA 3MPHA 1K41A 1DMQA 1RGKA 3SLUA 3B8LA 4HZ9B 2BMOB 5AIFA 3MWZA 1A67A 1TJDA 1BSAA 2QA43 1VQO3 2LQVA 1SJWA 1B2UA 1WNHA 1GOVA 2IA7A 3BNDA 4K1VA 1OHPA 2GU3A 1BSCA 1Z1SA 1STDA 1E97A 1TFKA 1IVUA 1UUWB 3NUVA 1YIT3 1RCLA 1B2SA 1JB2A 1NNVA 3OWUA 5BXQA 1Q824 1FA3A 1GY5A 3SX1A 1R4CA 1ZX2A 1A90A 1VQ73 2CFDA 4N6V0 1IV9A 1M1XB 2YX9A 2XH9A 2P38A 3OWSA 1W6GA 3CCL3 1W00A 4IIAA 3FLJA 3VF1A 1NB3I 4ORLA 5IERA 1G96A 1TP6A 1US1A 2GBWB 4RNZA 1Q864 1ISKA 4HVNA 1U5OA 2CWUA 5LC6A 1JBSA 1E3RA 5G1LA 3QK9A 4L8PA 1IVXA 3UNLA 3HIIA 1A2PA 1WMOA 2CKFB 2FNQA 4I4KA 5M18A 1BRGA 4MMZB 3AMOB 3UL6A 2RSXA 1QJGA 3BB9A 1IQ8A 3X42A 1I0VA 1AR0A 2W9PA 4O8SA 3RGRA 4H61A 1YIJ3 2F4YA 5STDA 1NWWA 3BU4A 1HKXA 1S723 1MOLA 1UCKA 3U1WA 4I5QA 4HKVB 1HYFA 4MMXB 5FGOA 2MC8A 1RGGA 1UI7A 1JKGA 3KN4A 4LZIA 2Z7AA 2I9WA 1Q40A 2HMMB 4HYZA 1BUJA 1N9JA 1DMNA 1FGMA 3NHXA 4Q53A 2OQEA 1MGWA 4ILFA 3UL5A 3PXMA 1QVG2 4MMYB 1ULJB 2F56A 2KF6A 3FKAA 3U97A 3X3XA 1YJ93 3AHSA 3D5IA 2CWVA 5A0OB 1RRHA 3KCHA 5KP3A 3RGAA 1Y4KA 1DVDA 3S5CA 3EB8A 2RBIA 3LYGA 2M7OA 4MEIA 3RDEA 1Q42A 3S29A 3WMDA 2XF3A 1ZO2A 1PU4A 1RKYA 3BNCA 1T5YA 1V57A 2CX1A 1SQWA 1W6CA 2P09A 2Y73A 2OTL3 1Q7Y4 1K28A 2BU4A 1IVVA 3CC43 4EW5A 3CPOA 4CDLA 1RGHA 1YJN3 4XBYA 3JVCA 2RCDA 1I3FA 4N6NB 5GSPA 3OV4A 1HU9A 3CD63 2UX0A 1I2FA 2J8XB 2XSOB 2IUJA 5AYSC 2B1XB 3S27A 3MG1A 2E2UA 1TRQA 2KF3A 3WA2X 4CCVA 3HZPA 1ROVA 1RLSA 1GOUA 2BIRA 2K54A 1BANA 1VQK3 1RN1A 4HZBB 3CCR3 2OCTA 2Z76A 1CYVA 3K0ZA 1YVBI 3NV0B 2GU1A 1UCLA 3CC23 1BSEA 1K9M4 1M9GA 1BSDA 4CJNA 3WOEB 4X2OA 4STDA 3LT9A 5IEOA 2WGOA 3WOFB 1N8QA 4TX4A 1DYUA 4J9AA 2GEXA 1BVIA 2H0HA 1UUVB 3SOYA 1JB5A 3LTBA 1G02A 1V74A 2MF7A 1BNRA 1BOXA 2BO9B 2HMOB 2HOHA 2R41A 3DXOA 3LMLA 2W9QA 4N6OB 5EEOA 4O3VA 5CK6A 2Q07A 1WTHA 1RDSA 3K9MC 1JNQA 3NXJA 3CCM3 1UI8A 2UUGC 3OXAA 3CCS3 2W03A 1HZ1A 3LH4A 5IEPA 1M1K4 3F14A 3VGNA 4MJDA 1X1WA 4HM7B 5CLKA 3GSPA 3KFQC 3NBJA 1AVKA 1I8VA 4HM4B 1KD14 1ASKA 2CFGA 2JDIH 5M1AA 1CH0A 3LTCA 1Q9EA 1TTOA 1GMQA 2WOFA 3EF8A 3B7CA 3DGYA 3MKIA 3PZWA 4XDVA 5AIGA 3WODG 4RZMA 1RGCA 1AV4A 3D4AA 5D81A 3E99A 5JBSA 2XEPA 3OW22 4HAAA 2BHMA 3DM8A 3CU3A 1W2ZA 2Y74A 1BRKA 1ZGXA 2F98A 4WHAA 1AQZA 1T3BA 4FR9A 1OACA 1GD3A 3N54B 3EQQB 4GHOA 1AY7A 1I3IA 1FZUA 1RNTA 2GSPA 4XBTA 3CCE3 5HOHA 1F8NA 1R4YA 3AGNA 3A5EA 4FMAA 4PEJA 3J7Yd 3SOAA 2E2VA 3MG3A 1RGFA 2E2TA 1RGAA 2RNTA 4N6LA 2YFLB 2CH9A 3ZG0A 1QAKA 5BVBA 2K0MA 3SYUA 1BNIA 1B20A 1RN7A 1W7CA 2XR8B 1FUTA 1WMNA 3DZLA 1O7WB 3G8ZA 3V98A 4HOHA 5ELJA 1I70A 3T0UA 2ZL8A 4LSOA 3V92A 5DREA 2WO0A 4FCZA 4FMDA 3JUOA 2OWPA 2CK3H 2IUKA 2W56B 2KRTA 3AMOA 3UJMA 1FYSA 1ULIB 1LNHA 5IG4A 4EXRA 4HM0B 2ZDJA 3WHOA 2BMRB 3A76A 1LNIA 2ML6A 2C11A 3MSOA 3Q90A 2CFKA 4HM3B 4XBXA 1CYUA 3PCSA 2O3OA 4HM8B 1N5HA 3HOHA 1FUSA 1FGTA 4DKIA 2W0QA 2XSHB 3LTDA 1MWSA 4K61A 1VQL3 1LVNA 4FCJA 2XRXB 2IYJA 1L5GB 1E3VA 3CPW2 1B2ZA 1KSIA 3EN1B 4WFOA 1BNJA 1GSPA 4ZM8A 5FW5A 2HMLB 2INXA 3FSDA 4LYLB 1NU3A 1GMRA 1NO3A 3H51A 3LOYA 1EKMA 1T2HA 4LMIA 1IU7A 1QMAA 3MHEA 3AHWA 3LTAA 1K734 3F8XA 3FG4A 1FGRA 3EJVA 2IMJA 3JUMA 2H0GA 1DE3A 1PYLA 1TU5A 2F5WA 1GMPA 2ML5A 1BGSA 3DY5A 3IPTA 4GB5A 1GY7A 2JQ5A 2QIYA 4HM1B 1GOYA 1RCKA 3FH1A 5BU4A 9RNTA 5IG3A 1IDPA 1I2GA 2SARA 1PY3A 1T2IA 2C4BA 4NREA 2OTJ3 3PYJA 1UUGB 4KZ1A 2OOVA 4O2HA 5EQLA 1W01A 1TIJA 2F86B 1FGOA 1GYBA 3X3YA 4BL2A 2GBXB 1UCIA 3KKGA 1LXEA 3DGOA 1M904 3KSED 1EQKA 1VQP3 3NM7A 2O9UX 1UCJA 1RRLA 4HM6B 3URPA 3WA3A 2R4IA 2BMQB 2GXFA 4L8OA 2PZVA 4HM5B 3ZG5A 1OF5B 2Z77A 3BNBA 2AADA 1LQMB 1RGLA 3FF2A 3L0RA 3NV0A 1BNFA 1MWUA 1N9EA 1SARA 3FF0A 3JUQA 4O02B 3KIIA 1RTUA 2Z6BA 3JUNA 4BL3A 3I553 1YHQ3 2CC3A 1D6YA 3UB1A 3I0YA 4HJLB 1RNBA 2B24B 1ZS7A 3K63A 1RJOA 4X2HA 1A2VA 1MNLA 5BIRA 3RNTA 1VQQA 3VSYA 4R9KA 5IG0A 1O7HB 1UGHI 2CHCA 3OX9A 2XGLA 4U13A 1OH0A 4XB5A 1O7MB 3F9SA 3IMAB 2BT3A 1B3SA 1WQLB 2H0IA 5D83A 3CCV3 1Q814 1X1XA 3NM2A 1FUWA 3DMCA 2P0XA 2YFJB 1QALA 1SIIA 3BLZA 5CF2A 3LXUX 3Q1CA 4OUQA 4N6TA 3H3HA 3PGBA 1J2BA 3DH2A 1EUIC 3DGNA 4H3UA 3ECFA 1VZZA 1OHOA 1BIRA 2CG0A 4WYKB 3S28A 1UW1A 4EV5A 3CNXA 3EE1A 2CX0A 1OHSA 1VQ83 1BRHA 3NQYA 1UGIA 2W2CA 4XDWA 2HMJB 1VQ43 1GS3A 3FG3A 3CC73 1EG9B 3D3LA 4CPKA 1PFPA 1W4NA 4RNTA 5G1KA 1LQGC 1IVWA 1NDOB 2FGTA 4IT7A 5EVHA 4EV2A 1YVSA 2CW9A 2L1SA 3O8YA 4NPBA 5CXOA 1EA2A 4FMCA 4GL6A 3BIRA 1YI23 1U8CB 3G16A 3NQZA 2CFLA 2KF4A 1LOXA 1V58A 2XGNA 5JPUA 2XFSA 3FG1A 5JPPA 3NBBA 4J5GA 5AIIA 2WOHA 3X41A 2W04A 7GSPA 1JJ22 2KF5A 1KWIA 3DUKA 1BUQA 2F5MA 1STFI 2LYXA 2FXTA 3STDA 2SBLA 2W6JH 5DRVA 1VQ53 1BAOA 1I2EA 1CQSA 1TUHA 4RBNA 1D6UA 3WR2A 2QGUA 4G1MB 1BSBA 3F7XA 1KC84 1IK3A 4LEHA 1A2KA 3N8BA 1BRNL 4K1UA 4HM2B 4J5KA 1B27A 1ROAA 2W56A 1VQ93 1IQYA 3ER7A 5ELUA 4BIRA 3KZTA 5KP4A 4J8TA 4BTXA 1BNSA 1IYYA 5AEWB 3ROBA 5CF1A 1D6ZA 2AAEA 4AKYA 1OGZA 2CFWA 1SIHA 3N9HA 3DGMA 3GZRA 4N6MA 3WDGB 5IENA 2HMNB 1VQ63 4R1KA 1JBRA 1X1YA 4EC6A 1IT8A 7RNTA 1QVF2 1RGEA 6GSPA 3B4PA 3EC9A 4KFEA 1RHLA 1JZDA 1O7GB 1OPYA 4KVHA 3EBTA 1B2MA 1LRAA 1JKGB 1RSNA 3OWYA 4KT3B 2L4VA 4AKZA 1BRJA 4BTWA 1Q40B 3D79A 2KXGA 2K3DA 3K5TA 4OK0A 3SEDA 5AIHA 3F40A 3T8NA 5IW9A 3HK4A 1YJW3 1N8R4 2IY2A 1GY6A 1GD4A 3ZFZA 1JV2B 3BNEA 2CG1A 3FGYA 1LOWA 1O7NB 3EHCA 2UGIA 1EEJA 1B21A 3JUPA 4BU4A 1OGXA 4K90B 1C7HA 4QWTA 5AEUB 1BNEA 1K8A4 1W02A 5IF6A 1QAFA 3FCSB 4IPBA 1JN5B 1W6YA 3MG2A 3KE7A
chains in the Genus database with same CATH topology
3D5GA 3Q3FA 5BIRA 1BRKA 1ZGXA 3RNTA 1I0VA 1AQZA 2F4YA 1B3SA 4GHOA 1AY7A 1I3IA 1FZUA 1RNTA 3AGOA 1UCKA 1X1XA 2GSPA 3BU4A 5HOHA 1RMSA 1HYFA 1R4YA 3A5EA 3AGNA 1RGGA 1BU4A 1X1UA 1RGFA 2RNTA 1RGAA 3DH2A 1BUJA 1B2XA 3SYUA 1BNIA 1YGWA 1B20A 1YNVX 1MGWA 1BIRA 1FUTA 1DETA 1BRSA 4HOHA 1BRHA 1I70A 2F56A 1BRIA 2KF6A 3AHSA 3D5IA 1LOYA 3KCHA 2RBIA 4RNTA 1BNGA 1FYSA 6RNTA 3WHOA 1YVSA 1I0XA 1FW7A 1LNIA 1MGRA 2BU4A 3BIRA 1RN4A 3HOHA 1FUSA 2KF4A 1RGHA 4J5GA 1I3FA 5GSPA 7GSPA 1I2FA 2KF5A 2F5MA 1B2ZA 1BNJA 1GSPA 1BAOA 1I2EA 1TRQA 2KF3A 3WR2A 1RLSA 1GOUA 2BIRA 1BANA 1GMRA 1RN1A 1BSBA 1C54A 1T2HA 1LOVA 5RNTA 1JBTA 1BRNL 1UCLA 1B27A 3AHWA 4J5KA 1BSEA 8RNTA 1BSDA 4BIRA 4GSPA 2ZA4A 1TRPA 1BNSA 1PYLA 1DE3A 1IYYA 2KAAA 2F5WA 1GMPA 2AAEA 1BGSA 1BVIA 1RGKA 1G02A 1GOYA 1BSAA 1RCKA 5BU4A 9RNTA 1BNRA 1BOXA 1JBRA 1I2GA 1B2UA 1X1YA 1GOVA 2HOHA 2SARA 7RNTA 1PY3A 1T2IA 1BSCA 2C4BA 1RGEA 6GSPA 1RCLA 1B2SA 1RHLA 1RDSA 1B2MA 1LRAA 1RSNA 1UCIA 1HZ1A 1BRJA 1X1WA 1UCJA 3GSPA 3URPA 1I8VA 1LOWA 2AADA 1RGLA 1B21A 1CH0A 4BU4A 1Q9EA 1BNFA 1GMQA 1SARA 1TTOA 1BNEA 3DGYA 1JBSA 1RTUA 1A2PA 1RGCA 3D4AA 1RNBA 4HAAA 1BRGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D5G A;  3Q3F A;  5BIR A;  1BRK A;  1ZGX A;  3RNT A;  1I0V A;  1AQZ A;  2F4Y A;  1B3S A;  4GHO A;  1AY7 A;  1I3I A;  1FZU A;  1RNT A;  3AGO A;  1UCK A;  1X1X A;  2GSP A;  3BU4 A;  5HOH A;  1RMS A;  1HYF A;  1R4Y A;  3A5E A;  3AGN A;  1RGG A;  1BU4 A;  1X1U A;  1RGF A;  2RNT A;  1RGA A;  3DH2 A;  1BUJ A;  1B2X A;  3SYU A;  1BNI A;  1YGW A;  1B20 A;  1YNV X;  1MGW A;  1BIR A;  1FUT A;  1DET A;  1BRS A;  4HOH A;  1BRH A;  1I70 A;  2F56 A;  1BRI A;  2KF6 A;  3AHS A;  3D5I A;  1LOY A;  3KCH A;  2RBI A;  4RNT A;  1BNG A;  1FYS A;  6RNT A;  3WHO A;  1YVS A;  1I0X A;  1FW7 A;  1LNI A;  1MGR A;  2BU4 A;  3BIR A;  1RN4 A;  3HOH A;  1FUS A;  2KF4 A;  1RGH A;  4J5G A;  1I3F A;  5GSP A;  7GSP A;  1I2F A;  2KF5 A;  2F5M A;  1B2Z A;  1BNJ A;  1GSP A;  1BAO A;  1I2E A;  1TRQ A;  2KF3 A;  3WR2 A;  1RLS A;  1GOU A;  2BIR A;  1BAN A;  1GMR A;  1RN1 A;  1BSB A;  1C54 A;  1T2H A;  1LOV A;  5RNT A;  1JBT A;  1BRN L;  1UCL A;  1B27 A;  3AHW A;  4J5K A;  1BSE A;  8RNT A;  1BSD A;  4BIR A;  4GSP A;  2ZA4 A;  1TRP A;  1BNS A;  1PYL A;  1DE3 A;  1IYY A;  2KAA A;  2F5W A;  1GMP A;  2AAE A;  1BGS A;  1BVI A;  1RGK A;  1G02 A;  1GOY A;  1BSA A;  1RCK A;  5BU4 A;  9RNT A;  1BNR A;  1BOX A;  1JBR A;  1I2G A;  1B2U A;  1X1Y A;  1GOV A;  2HOH A;  2SAR A;  7RNT A;  1PY3 A;  1T2I A;  1BSC A;  2C4B A;  1RGE A;  6GSP A;  1RCL A;  1B2S A;  1RHL A;  1RDS A;  1B2M A;  1LRA A;  1RSN A;  1UCI A;  1HZ1 A;  1BRJ A;  1X1W A;  1UCJ A;  3GSP A;  3URP A;  1I8V A;  1LOW A;  2AAD A;  1RGL A;  1B21 A;  1CH0 A;  4BU4 A;  1Q9E A;  1BNF A;  1GMQ A;  1SAR A;  1TTO A;  1BNE A;  3DGY A;  1JBS A;  1RTU A;  1A2P A;  1RGC A;  3D4A A;  1RNB A;  4HAA A;  1BRG A; 
#chains in the Genus database with same CATH topology
 3ALA A;  3D5G A;  3Q3F A;  1KQS 2;  4OVM A;  3G0K A;  1WMP A;  1MWR A;  3CCQ 3;  1JN5 A;  1JB4 A;  1NB5 I;  3EX9 A;  1SPU A;  3PCR A;  2WGQ A;  4R4K A;  2HMK B;  2OOV C;  4JRF A;  4N6U A;  3CCU 3;  3AGO A;  4FCM A;  4WWU C;  8CHO A;  1VQN 3;  1RMS A;  4HBR A;  3MYT A;  1FGQ A;  4FMB A;  3S67 A;  1OCV A;  3D9R A;  1BU4 A;  1X1U A;  2RGQ A;  2V1L A;  3HI7 A;  3Q2P A;  5TGN A;  1IV7 A;  5LC7 A;  3FZW A;  3SVA A;  1VQM 3;  3SXX A;  1B2X A;  1W2B 2;  1YGW A;  1G0T A;  1YNV X;  4NHF A;  3G4S 3;  3HX8 A;  3CNM A;  1DVC A;  1DET A;  1CEW I;  1BRS A;  1OF5 A;  4R80 A;  3G71 3;  3X40 A;  3EN8 A;  1S5A A;  1BRI A;  4L7K A;  1LOY A;  3DGL A;  4EBG A;  3GRD A;  1NJI 4;  5G2G A;  2F99 A;  3T8U A;  2KCD A;  6STD A;  3KSP A;  1BNG A;  7STD A;  6RNT A;  3PS8 A;  5KP1 A;  1N5P A;  5AI1 A;  1I0X A;  1FW7 A;  2ZHX B;  5M19 A;  2YFI B;  3CXC 2;  4BTY A;  1MGR A;  4JF8 A;  2GEY A;  3F8H A;  4WP5 A;  5I97 A;  1RN4 A;  2P0M A;  2D1W A;  2XFT A;  3F7S A;  3LT8 A;  3I56 3;  3G6E 3;  1Q7H A;  1TFO A;  3GAX A;  3GZX B;  1O7P B;  3TDG A;  1JZO A;  3LZA A;  1AVL A;  2PNC A;  1IQX A;  5AYR B;  3GZY B;  2OQE C;  3GWR A;  1JRQ A;  1OUN A;  3M8C A;  4WYK A;  3IJE B;  3NX0 A;  2STD A;  1MWT A;  3GZB A;  2CIU A;  3QRD A;  1UDI I;  4KFF A;  2CWT A;  2QEX 3;  1DMM A;  4XM4 A;  2A15 A;  4KFD A;  3X3Z A;  5IG5 A;  4LGQ A;  2BNG A;  5HGR A;  3K7C A;  3NBR A;  1C54 A;  3EBY A;  4N3V A;  4R9L A;  4EYC A;  1LOV A;  5RNT A;  3CCJ 3;  1JBT A;  3B4O A;  4RNY A;  2P05 A;  1IT7 A;  5D82 A;  3CME 3;  3CMA 3;  2RFR A;  3HIG A;  8RNT A;  1W5Z A;  2C10 A;  3V99 A;  4AEQ A;  4GSP A;  2D42 A;  1YGE A;  2ZA4 A;  1TRP A;  2KAA A;  3MPH A;  1K41 A;  1DMQ A;  1RGK A;  3SLU A;  3B8L A;  4HZ9 B;  2BMO B;  5AIF A;  3MWZ A;  1A67 A;  1TJD A;  1BSA A;  2QA4 3;  1VQO 3;  2LQV A;  1SJW A;  1B2U A;  1WNH A;  1GOV A;  2IA7 A;  3BND A;  4K1V A;  1OHP A;  2GU3 A;  1BSC A;  1Z1S A;  1STD A;  1E97 A;  1TFK A;  1IVU A;  1UUW B;  3NUV A;  1YIT 3;  1RCL A;  1B2S A;  1JB2 A;  1NNV A;  3OWU A;  5BXQ A;  1Q82 4;  1FA3 A;  1GY5 A;  3SX1 A;  1R4C A;  1ZX2 A;  1A90 A;  1VQ7 3;  2CFD A;  4N6V 0;  1IV9 A;  1M1X B;  2YX9 A;  2XH9 A;  2P38 A;  3OWS A;  1W6G A;  3CCL 3;  1W00 A;  4IIA A;  3FLJ A;  3VF1 A;  1NB3 I;  4ORL A;  5IER A;  1G96 A;  1TP6 A;  1US1 A;  2GBW B;  4RNZ A;  1Q86 4;  1ISK A;  4HVN A;  1U5O A;  2CWU A;  5LC6 A;  1JBS A;  1E3R A;  5G1L A;  3QK9 A;  4L8P A;  1IVX A;  3UNL A;  3HII A;  1A2P A;  1WMO A;  2CKF B;  2FNQ A;  4I4K A;  5M18 A;  1BRG A;  4MMZ B;  3AMO B;  3UL6 A;  2RSX A;  1QJG A;  3BB9 A;  1IQ8 A;  3X42 A;  1I0V A;  1AR0 A;  2W9P A;  4O8S A;  3RGR A;  4H61 A;  1YIJ 3;  2F4Y A;  5STD A;  1NWW A;  3BU4 A;  1HKX A;  1S72 3;  1MOL A;  1UCK A;  3U1W A;  4I5Q A;  4HKV B;  1HYF A;  4MMX B;  5FGO A;  2MC8 A;  1RGG A;  1UI7 A;  1JKG A;  3KN4 A;  4LZI A;  2Z7A A;  2I9W A;  1Q40 A;  2HMM B;  4HYZ A;  1BUJ A;  1N9J A;  1DMN A;  1FGM A;  3NHX A;  4Q53 A;  2OQE A;  1MGW A;  4ILF A;  3UL5 A;  3PXM A;  1QVG 2;  4MMY B;  1ULJ B;  2F56 A;  2KF6 A;  3FKA A;  3U97 A;  3X3X A;  1YJ9 3;  3AHS A;  3D5I A;  2CWV A;  5A0O B;  1RRH A;  3KCH A;  5KP3 A;  3RGA A;  1Y4K A;  1DVD A;  3S5C A;  3EB8 A;  2RBI A;  3LYG A;  2M7O A;  4MEI A;  3RDE A;  1Q42 A;  3S29 A;  3WMD A;  2XF3 A;  1ZO2 A;  1PU4 A;  1RKY A;  3BNC A;  1T5Y A;  1V57 A;  2CX1 A;  1SQW A;  1W6C A;  2P09 A;  2Y73 A;  2OTL 3;  1Q7Y 4;  1K28 A;  2BU4 A;  1IVV A;  3CC4 3;  4EW5 A;  3CPO A;  4CDL A;  1RGH A;  1YJN 3;  4XBY A;  3JVC A;  2RCD A;  1I3F A;  4N6N B;  5GSP A;  3OV4 A;  1HU9 A;  3CD6 3;  2UX0 A;  1I2F A;  2J8X B;  2XSO B;  2IUJ A;  5AYS C;  2B1X B;  3S27 A;  3MG1 A;  2E2U A;  1TRQ A;  2KF3 A;  3WA2 X;  4CCV A;  3HZP A;  1ROV A;  1RLS A;  1GOU A;  2BIR A;  2K54 A;  1BAN A;  1VQK 3;  1RN1 A;  4HZB B;  3CCR 3;  2OCT A;  2Z76 A;  1CYV A;  3K0Z A;  1YVB I;  3NV0 B;  2GU1 A;  1UCL A;  3CC2 3;  1BSE A;  1K9M 4;  1M9G A;  1BSD A;  4CJN A;  3WOE B;  4X2O A;  4STD A;  3LT9 A;  5IEO A;  2WGO A;  3WOF B;  1N8Q A;  4TX4 A;  1DYU A;  4J9A A;  2GEX A;  1BVI A;  2H0H A;  1UUV B;  3SOY A;  1JB5 A;  3LTB A;  1G02 A;  1V74 A;  2MF7 A;  1BNR A;  1BOX A;  2BO9 B;  2HMO B;  2HOH A;  2R41 A;  3DXO A;  3LML A;  2W9Q A;  4N6O B;  5EEO A;  4O3V A;  5CK6 A;  2Q07 A;  1WTH A;  1RDS A;  3K9M C;  1JNQ A;  3NXJ A;  3CCM 3;  1UI8 A;  2UUG C;  3OXA A;  3CCS 3;  2W03 A;  1HZ1 A;  3LH4 A;  5IEP A;  1M1K 4;  3F14 A;  3VGN A;  4MJD A;  1X1W A;  4HM7 B;  5CLK A;  3GSP A;  3KFQ C;  3NBJ A;  1AVK A;  1I8V A;  4HM4 B;  1KD1 4;  1ASK A;  2CFG A;  2JDI H;  5M1A A;  1CH0 A;  3LTC A;  1Q9E A;  1TTO A;  1GMQ A;  2WOF A;  3EF8 A;  3B7C A;  3DGY A;  3MKI A;  3PZW A;  4XDV A;  5AIG A;  3WOD G;  4RZM A;  1RGC A;  1AV4 A;  3D4A A;  5D81 A;  3E99 A;  5JBS A;  2XEP A;  3OW2 2;  4HAA A;  2BHM A;  3DM8 A;  3CU3 A;  1W2Z A;  2Y74 A;  1BRK A;  1ZGX A;  2F98 A;  4WHA A;  1AQZ A;  1T3B A;  4FR9 A;  1OAC A;  1GD3 A;  3N54 B;  3EQQ B;  4GHO A;  1AY7 A;  1I3I A;  1FZU A;  1RNT A;  2GSP A;  4XBT A;  3CCE 3;  5HOH A;  1F8N A;  1R4Y A;  3AGN A;  3A5E A;  4FMA A;  4PEJ A;  3J7Y d;  3SOA A;  2E2V A;  3MG3 A;  1RGF A;  2E2T A;  1RGA A;  2RNT A;  4N6L A;  2YFL B;  2CH9 A;  3ZG0 A;  1QAK A;  5BVB A;  2K0M A;  3SYU A;  1BNI A;  1B20 A;  1RN7 A;  1W7C A;  2XR8 B;  1FUT A;  1WMN A;  3DZL A;  1O7W B;  3G8Z A;  3V98 A;  4HOH A;  5ELJ A;  1I70 A;  3T0U A;  2ZL8 A;  4LSO A;  3V92 A;  5DRE A;  2WO0 A;  4FCZ A;  4FMD A;  3JUO A;  2OWP A;  2CK3 H;  2IUK A;  2W56 B;  2KRT A;  3AMO A;  3UJM A;  1FYS A;  1ULI B;  1LNH A;  5IG4 A;  4EXR A;  4HM0 B;  2ZDJ A;  3WHO A;  2BMR B;  3A76 A;  1LNI A;  2ML6 A;  2C11 A;  3MSO A;  3Q90 A;  2CFK A;  4HM3 B;  4XBX A;  1CYU A;  3PCS A;  2O3O A;  4HM8 B;  1N5H A;  3HOH A;  1FUS A;  1FGT A;  4DKI A;  2W0Q A;  2XSH B;  3LTD A;  1MWS A;  4K61 A;  1VQL 3;  1LVN A;  4FCJ A;  2XRX B;  2IYJ A;  1L5G B;  1E3V A;  3CPW 2;  1B2Z A;  1KSI A;  3EN1 B;  4WFO A;  1BNJ A;  1GSP A;  4ZM8 A;  5FW5 A;  2HML B;  2INX A;  3FSD A;  4LYL B;  1NU3 A;  1GMR A;  1NO3 A;  3H51 A;  3LOY A;  1EKM A;  1T2H A;  4LMI A;  1IU7 A;  1QMA A;  3MHE A;  3AHW A;  3LTA A;  1K73 4;  3F8X A;  3FG4 A;  1FGR A;  3EJV A;  2IMJ A;  3JUM A;  2H0G A;  1DE3 A;  1PYL A;  1TU5 A;  2F5W A;  1GMP A;  2ML5 A;  1BGS A;  3DY5 A;  3IPT A;  4GB5 A;  1GY7 A;  2JQ5 A;  2QIY A;  4HM1 B;  1GOY A;  1RCK A;  3FH1 A;  5BU4 A;  9RNT A;  5IG3 A;  1IDP A;  1I2G A;  2SAR A;  1PY3 A;  1T2I A;  2C4B A;  4NRE A;  2OTJ 3;  3PYJ A;  1UUG B;  4KZ1 A;  2OOV A;  4O2H A;  5EQL A;  1W01 A;  1TIJ A;  2F86 B;  1FGO A;  1GYB A;  3X3Y A;  4BL2 A;  2GBX B;  1UCI A;  3KKG A;  1LXE A;  3DGO A;  1M90 4;  3KSE D;  1EQK A;  1VQP 3;  3NM7 A;  2O9U X;  1UCJ A;  1RRL A;  4HM6 B;  3URP A;  3WA3 A;  2R4I A;  2BMQ B;  2GXF A;  4L8O A;  2PZV A;  4HM5 B;  3ZG5 A;  1OF5 B;  2Z77 A;  3BNB A;  2AAD A;  1LQM B;  1RGL A;  3FF2 A;  3L0R A;  3NV0 A;  1BNF A;  1MWU A;  1N9E A;  1SAR A;  3FF0 A;  3JUQ A;  4O02 B;  3KII A;  1RTU A;  2Z6B A;  3JUN A;  4BL3 A;  3I55 3;  1YHQ 3;  2CC3 A;  1D6Y A;  3UB1 A;  3I0Y A;  4HJL B;  1RNB A;  2B24 B;  1ZS7 A;  3K63 A;  1RJO A;  4X2H A;  1A2V A;  1MNL A;  5BIR A;  3RNT A;  1VQQ A;  3VSY A;  4R9K A;  5IG0 A;  1O7H B;  1UGH I;  2CHC A;  3OX9 A;  2XGL A;  4U13 A;  1OH0 A;  4XB5 A;  1O7M B;  3F9S A;  3IMA B;  2BT3 A;  1B3S A;  1WQL B;  2H0I A;  5D83 A;  3CCV 3;  1Q81 4;  1X1X A;  3NM2 A;  1FUW A;  3DMC A;  2P0X A;  2YFJ B;  1QAL A;  1SII A;  3BLZ A;  5CF2 A;  3LXU X;  3Q1C A;  4OUQ A;  4N6T A;  3H3H A;  3PGB A;  1J2B A;  3DH2 A;  1EUI C;  3DGN A;  4H3U A;  3ECF A;  1VZZ A;  1OHO A;  1BIR A;  2CG0 A;  4WYK B;  3S28 A;  1UW1 A;  4EV5 A;  3CNX A;  3EE1 A;  2CX0 A;  1OHS A;  1VQ8 3;  1BRH A;  3NQY A;  1UGI A;  2W2C A;  4XDW A;  2HMJ B;  1VQ4 3;  1GS3 A;  3FG3 A;  3CC7 3;  1EG9 B;  3D3L A;  4CPK A;  1PFP A;  1W4N A;  4RNT A;  5G1K A;  1LQG C;  1IVW A;  1NDO B;  2FGT A;  4IT7 A;  5EVH A;  4EV2 A;  1YVS A;  2CW9 A;  2L1S A;  3O8Y A;  4NPB A;  5CXO A;  1EA2 A;  4FMC A;  4GL6 A;  3BIR A;  1YI2 3;  1U8C B;  3G16 A;  3NQZ A;  2CFL A;  2KF4 A;  1LOX A;  1V58 A;  2XGN A;  5JPU A;  2XFS A;  3FG1 A;  5JPP A;  3NBB A;  4J5G A;  5AII A;  2WOH A;  3X41 A;  2W04 A;  7GSP A;  1JJ2 2;  2KF5 A;  1KWI A;  3DUK A;  1BUQ A;  2F5M A;  1STF I;  2LYX A;  2FXT A;  3STD A;  2SBL A;  2W6J H;  5DRV A;  1VQ5 3;  1BAO A;  1I2E A;  1CQS A;  1TUH A;  4RBN A;  1D6U A;  3WR2 A;  2QGU A;  4G1M B;  1BSB A;  3F7X A;  1KC8 4;  1IK3 A;  4LEH A;  1A2K A;  3N8B A;  1BRN L;  4K1U A;  4HM2 B;  4J5K A;  1B27 A;  1ROA A;  2W56 A;  1VQ9 3;  1IQY A;  3ER7 A;  5ELU A;  4BIR A;  3KZT A;  5KP4 A;  4J8T A;  4BTX A;  1BNS A;  1IYY A;  5AEW B;  3ROB A;  5CF1 A;  1D6Z A;  2AAE A;  4AKY A;  1OGZ A;  2CFW A;  1SIH A;  3N9H A;  3DGM A;  3GZR A;  4N6M A;  3WDG B;  5IEN A;  2HMN B;  1VQ6 3;  4R1K A;  1JBR A;  1X1Y A;  4EC6 A;  1IT8 A;  7RNT A;  1QVF 2;  1RGE A;  6GSP A;  3B4P A;  3EC9 A;  4KFE A;  1RHL A;  1JZD A;  1O7G B;  1OPY A;  4KVH A;  3EBT A;  1B2M A;  1LRA A;  1JKG B;  1RSN A;  3OWY A;  4KT3 B;  2L4V A;  4AKZ A;  1BRJ A;  4BTW A;  1Q40 B;  3D79 A;  2KXG A;  2K3D A;  3K5T A;  4OK0 A;  3SED A;  5AIH A;  3F40 A;  3T8N A;  5IW9 A;  3HK4 A;  1YJW 3;  1N8R 4;  2IY2 A;  1GY6 A;  1GD4 A;  3ZFZ A;  1JV2 B;  3BNE A;  2CG1 A;  3FGY A;  1LOW A;  1O7N B;  3EHC A;  2UGI A;  1EEJ A;  1B21 A;  3JUP A;  4BU4 A;  1OGX A;  4K90 B;  1C7H A;  4QWT A;  5AEU B;  1BNE A;  1K8A 4;  1W02 A;  5IF6 A;  1QAF A;  3FCS B;  4IPB A;  1JN5 B;  1W6Y A;  3MG2 A;  3KE7 A; 
#chains in the Genus database with same CATH homology
 3D5G A;  3Q3F A;  5BIR A;  1BRK A;  1ZGX A;  3RNT A;  1I0V A;  1AQZ A;  2F4Y A;  1B3S A;  4GHO A;  1AY7 A;  1I3I A;  1FZU A;  1RNT A;  3AGO A;  1UCK A;  1X1X A;  2GSP A;  3BU4 A;  5HOH A;  1RMS A;  1HYF A;  1R4Y A;  3A5E A;  3AGN A;  1RGG A;  1BU4 A;  1X1U A;  1RGF A;  2RNT A;  1RGA A;  3DH2 A;  1BUJ A;  1B2X A;  3SYU A;  1BNI A;  1YGW A;  1B20 A;  1YNV X;  1MGW A;  1BIR A;  1FUT A;  1DET A;  1BRS A;  4HOH A;  1BRH A;  1I70 A;  2F56 A;  1BRI A;  2KF6 A;  3AHS A;  3D5I A;  1LOY A;  3KCH A;  2RBI A;  4RNT A;  1BNG A;  1FYS A;  6RNT A;  3WHO A;  1YVS A;  1I0X A;  1FW7 A;  1LNI A;  1MGR A;  2BU4 A;  3BIR A;  1RN4 A;  3HOH A;  1FUS A;  2KF4 A;  1RGH A;  4J5G A;  1I3F A;  5GSP A;  7GSP A;  1I2F A;  2KF5 A;  2F5M A;  1B2Z A;  1BNJ A;  1GSP A;  1BAO A;  1I2E A;  1TRQ A;  2KF3 A;  3WR2 A;  1RLS A;  1GOU A;  2BIR A;  1BAN A;  1GMR A;  1RN1 A;  1BSB A;  1C54 A;  1T2H A;  1LOV A;  5RNT A;  1JBT A;  1BRN L;  1UCL A;  1B27 A;  3AHW A;  4J5K A;  1BSE A;  8RNT A;  1BSD A;  4BIR A;  4GSP A;  2ZA4 A;  1TRP A;  1BNS A;  1PYL A;  1DE3 A;  1IYY A;  2KAA A;  2F5W A;  1GMP A;  2AAE A;  1BGS A;  1BVI A;  1RGK A;  1G02 A;  1GOY A;  1BSA A;  1RCK A;  5BU4 A;  9RNT A;  1BNR A;  1BOX A;  1JBR A;  1I2G A;  1B2U A;  1X1Y A;  1GOV A;  2HOH A;  2SAR A;  7RNT A;  1PY3 A;  1T2I A;  1BSC A;  2C4B A;  1RGE A;  6GSP A;  1RCL A;  1B2S A;  1RHL A;  1RDS A;  1B2M A;  1LRA A;  1RSN A;  1UCI A;  1HZ1 A;  1BRJ A;  1X1W A;  1UCJ A;  3GSP A;  3URP A;  1I8V A;  1LOW A;  2AAD A;  1RGL A;  1B21 A;  1CH0 A;  4BU4 A;  1Q9E A;  1BNF A;  1GMQ A;  1SAR A;  1TTO A;  1BNE A;  3DGY A;  1JBS A;  1RTU A;  1A2P A;  1RGC A;  3D4A A;  1RNB A;  4HAA A;  1BRG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...