1BSEA

Crystal structural analysis of mutations in the hydrophobic cores of barnase
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRIVYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BARNASE
publication title Crystal structural analysis of mutations in the hydrophobic cores of barnase.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Endonuclease
total genus 32
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 1993-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1bseA00
1RGKA 1A2PA 2BU4A 4GSPA 7GSPA 1FUSA 1I2EA 1DETA 1BOXA 2KF6A 1I3FA 2HOHA 1G02A 1YVSA 1RN4A 2GSPA 3WHOA 1RNBA 2KF4A 2KF3A 1BNFA 1RCLA 3SYUA 1GOUA 1BU4A 4J5GA 1BRNL 1GMRA 1BANA 2KF5A 1BNEA 1JBSA 3D5GA 1BNRA 1BGSA 1BRSA 1GOYA 2F4YA 3AHWA 1RCKA 8RNTA 1X1UA 2ZA4A 3D4AA 1DE3A 1I2GA 1BNSA 1I0VA 2KAAA 1LOYA 1B2XA 3A5EA 9RNTA 1RGCA 3BU4A 1BSDA 1LOWA 1HZ1A 1RGLA 1FW7A 2F5MA 3WR2A 3D5IA 2BIRA 1SARA 1RGGA 1X1WA 1GOVA 1PY3A 1BRKA 1TRPA 1BRJA 1GMPA 1BRIA 1C54A 1MGWA 1Q9EA 1MGRA 4BU4A 1LRAA 4GHOA 1JBRA 2RNTA 3KCHA 2AAEA 4BIRA 1RGFA 1UCIA 3HOHA 3BIRA 1IYYA 5GSPA 1B27A 1RLSA 2C4BA 1BRGA 1RMSA 1CH0A 2F5WA 1BNIA 1GSPA 1UCLA 1RDSA 3URPA 1PYLA 1FZUA 3RNTA 5BIRA 1T2HA 1TTOA 3GSPA 2F56A 1HYFA 3DH2A 1RN1A 1BNJA 4HAAA 1RSNA 1BSCA 1BNGA 1RGEA 3AHSA 7RNTA 3AGNA 1BSAA 4J5KA 1BSEA 1LOVA 1FYSA 4RNTA 1B2MA 1B21A 1B20A 1UCKA 1BSBA 1BVIA 1AQZA 1B2ZA 1X1YA 2AADA 1B3SA 1I3IA 3DGYA 1BIRA 1UCJA 1RNTA 1RGAA 1YGWA 6RNTA 4HOHA 1I2FA 1RTUA 1BUJA 1B2UA 5RNTA 2RBIA 2SARA 1JBTA 5HOHA 1BAOA 1I8VA 1I0XA 3AGOA 1AY7A 1R4YA 1T2IA 1LNIA 1FUTA 1GMQA 1RHLA 1X1XA 1YNVX 1BRHA 5BU4A 1TRQA 1B2SA 1I70A 6GSPA 1ZGXA 3Q3FA 1RGHA
chains in the Genus database with same CATH superfamily
4LMIA 3FGYA 1N8R4 5EEOA 3OWUA 1RGKA 1A2PA 3I553 7GSPA 1N5PA 3DZLA 1I2EA 2XGLA 4K90B 3X42A 3KSPA 4CDLA 3UL5A 1IV7A 1D6UA 2L4VA 2GEYA 1IQYA 4WWUC 2HMMB 4XBXA 3S29A 4KZ1A 1QVG2 1KQS2 4HKVB 3KE7A 4MJDA 1SIIA 1YVSA 1DMQA 1UDII 1UUVB 3CCQ3 1VQ93 1ZS7A 1GOUA 1BU4A 1FGRA 4K1UA 4WFOA 5M18A 1OF5A 1W01A 3X3XA 1OH0A 3PGBA 3LT8A 1JB4A 2HMOB 3EF8A 2ZL8A 1BRSA 1NWWA 2F4YA 1RCKA 4I4KA 3VSYA 2JDIH 2Z77A 1DVCA 1E3RA 1WQLB 3BNEA 1I0VA 4BTXA 4HM0B 1TP6A 4LYLB 1B2XA 3F8XA 3NM2A 1ZO2A 2RSXA 3A5EA 2P0XA 3UB1A 1ASKA 2GU1A 2XH9A 1RGCA 3G6E3 1LOWA 4FCJA 3LZAA 1A2VA 3NV0A 2CHCA 2OOVC 2P38A 1RGGA 3PS8A 1OGZA 2XFTA 3V92A 3CC73 1WMNA 2WO0A 3TDGA 5BVBA 1G96A 2W56B 4BL2A 3CCL3 1W2ZA 1GY5A 1Q9EA 4K61A 2W2CA 3FCSB 2LYXA 1YVBI 1MWRA 3IPTA 4GHOA 4IIAA 4NHFA 1Q864 3MG2A 1Q824 3DGLA 3EE1A 3KCHA 3SLUA 5I97A 5IERA 1MWSA 1WMPA 1FGMA 2IUJA 3FG4A 1V58A 1NB3I 3LH4A 1IVVA 3MPHA 1RRHA 3EBYA 3F14A 1YI23 1B27A 3M8CA 1RLSA 3DXOA 3MG3A 1RKYA 3CCE3 2Z7AA 4G1MB 4ORLA 5D81A 1M1K4 4AKZA 1V74A 2W0QA 3JVCA 4TX4A 3WOFB 2B24B 1JRQA 4OK0A 4WYKA 5M1AA 5LC7A 1NJI4 2XRXB 3CPOA 1LNHA 2HMNB 1US1A 1VZZA 1BNJA 2O9UX 1QVF2 1D6ZA 1QMAA 1W5ZA 3AHSA 7RNTA 3CCM3 2LQVA 5DRVA 3T8NA 1PFPA 3LOYA 1QAFA 3PCSA 4RZMA 2IA7A 3F40A 4IPBA 3JUPA 4N6NB 2BMOB 1BSBA 2KXGA 3ZG5A 4O8SA 2BMQB 3U97A 2CH9A 2GU3A 1NB5I 5CLKA 2XR8B 3F7XA 4Q53A 1JZDA 1UCJA 2OCTA 1RNTA 4FMAA 3WODG 4HOHA 1VQN3 1VQ53 1YIT3 1VQ43 5EQLA 1BUJA 2E2TA 1UI8A 3FH1A 5CF2A 4L7KA 1JKGA 1S5AA 2D42A 5HOHA 2HMLB 3AGOA 1AY7A 4CPKA 2Q07A 3F7SA 3DY5A 1LQGC 3FG1A 1AVLA 1BRHA 4AKYA 1TRQA 5BU4A 1OHPA 6GSPA 4STDA 1VQL3 5AIHA 3UNLA 3DGMA 4L8OA 5A0OB 1JNQA 4DKIA 3SOAA 4GSPA 5AIIA 4NPBA 3Q1CA 2ML6A 4K1VA 2Z6BA 3CMA3 1DETA 4OUQA 1BOXA 2W9PA 1W6YA 3CC43 3NQYA 1VQ63 2SBLA 4R4KA 1RNBA 2KF4A 4XBYA 5TGNA 3I563 1BNFA 3CCV3 5AYSC 2UUGC 1N5HA 4N3VA 2P09A 3X3ZA 3WDGB 1JZOA 3Q90A 3S5CA 4U13A 2OOVA 3LXUX 1BANA 2KF5A 1BNRA 1Q7Y4 2OTJ3 1VQQA 3K9MC 1GOYA 1QALA 1LVNA 3AHWA 8RNTA 1X1UA 2ZA4A 3SXXA 1BNSA 2BNGA 4N6MA 3GRDA 2KAAA 3KKGA 3V98A 1O7NB 5FW5A 2CK3H 1TIJA 1BSDA 2D1WA 1YHQ3 3H51A 3ECFA 1S723 2F5MA 3CCU3 3RGRA 5IEPA 1SARA 1UUWB 1X1WA 1TRPA 1K41A 1PY3A 4HBRA 2B1XB 1BRIA 3FF0A 1Y4KA 1C54A 3BNBA 1NDOB 5KP3A 1LRAA 5KP1A 1FGQA 4I5QA 3WA3A 4FMCA 2AAEA 2KRTA 3N8BA 3NXJA 2J8XB 3EJVA 4HZ9B 3HOHA 5G1LA 3BIRA 5AEWB 1IT7A 1O7HB 2XEPA 3PCRA 2OQEC 3LTDA 1N8QA 3LMLA 3WMDA 8CHOA 2C4BA 1CYVA 4FCMA 3MHEA 2V1LA 4XM4A 2PNCA 1E3VA 1FGTA 4X2OA 3KN4A 4GL6A 3URPA 2QGUA 3GZBA 1PYLA 2XSHB 2OWPA 3RNTA 3OXAA 4CCVA 1K734 2RCDA 4KVHA 4R1KA 1VQK3 1T2HA 1DMNA 3K63A 3N54B 3PXMA 1JJ22 3SX1A 5KP4A 1RN1A 4HAAA 5IF6A 5JPUA 1RGEA 3EX9A 2H0HA 1STDA 3EN8A 4J5KA 3D3LA 6STDA 4NREA 3B4PA 1STFI 3EQQB 1WMOA 1LOVA 1ROAA 2I9WA 4RNTA 2O3OA 2RGQA 1B21A 4HZBB 1CEWI 1D6YA 1TJDA 2FGTA 2W56A 3SVAA 1AQZA 4OVMA 4RBNA 1PU4A 1K8A4 3WA2X 2W04A 2OTL3 1AV4A 4ILFA 2BO9B 1BUQA 1UI7A 2CKFB 2IMJA 5IENA 1RGAA 3NHXA 1Q40B 4FCZA 1TUHA 2STDA 5D82A 2WGOA 5IEOA 1W4NA 1IQ8A 5AIGA 1RTUA 1L5GB 3PZWA 4N6TA 2YFJB 3B7CA 2HMKB 3S27A 2K54A 4FMDA 2CX0A 4MMXB 4R9LA 5M19A 3NQZA 1VQ73 1JBTA 1BAOA 1IVWA 1VQ83 1YIJ3 1OACA 5HGRA 1RHLA 1FUTA 1GMQA 3K0ZA 3CCR3 3OV4A 1KC84 1JB5A 3Q3FA 5IG3A 1UGIA 7STDA 1DMMA 4O02B 2CW9A 3G16A 2IUKA 2BU4A 1FGOA 1WNHA 5ELUA 5JBSA 1ROVA 3FLJA 1UUGB 4KFFA 3WOEB 1VQP3 1I3FA 4FR9A 2GEXA 4RNYA 2BMRB 2INXA 1TFOA 4R80A 4ZM8A 1RN4A 1HKXA 3Q2PA 3FF2A 3T0UA 2YFLB 2Y73A 1V57A 2K0MA 1RCLA 5AI1A 4J5GA 3CXC2 3CD63 1GD3A 1LXEA 3JUNA 4H3UA 1E97A 1W00A 2UX0A 3MSOA 1BNEA 2ML5A 3D5GA 1JBSA 3KFQC 1IU7A 1GY7A 2H0GA 5CK6A 5IG4A 2L1SA 2CWTA 1DE3A 1I2GA 4LSOA 4FMBA 1AR0A 2ZHXB 2M7OA 1JB2A 3AMOB 1T3BA 3HK4A 4JF8A 3B8LA 1K9M4 2R4IA 1RRLA 3FG3A 5ELJA 1R4CA 3BU4A 3JUMA 2PZVA 3A76A 3CC23 3D5IA 3AMOA 3CME3 1EUIC 2XSOB 3DGNA 1FA3A 1GOVA 3D79A 4IT7A 1ULJB 1G0TA 3PYJA 4N6UA 5STDA 2FNQA 4N6LA 3EC9A 1IK3A 1MGWA 2GBWB 3E99A 1MGRA 4XDVA 5CXOA 4MEIA 3STDA 1YGEA 5AEUB 3CCJ3 4WHAA 1AVKA 3CCS3 4BIRA 1IV9A 1YJW3 3G713 1UCIA 3QK9A 4EV5A 2WOFA 3FZWA 4EXRA 1M904 3UL6A 2RFRA 1IYYA 2KCDA 1JN5B 5GSPA 3DUKA 1LQMB 3ZFZA 3I0YA 1UW1A 4HM1B 5AYRB 3GWRA 1RMSA 1CH0A 1EA2A 2F5WA 1BNIA 3K7CA 4HVNA 3BB9A 4JRFA 1C7HA 1FZUA 3MWZA 3T8UA 2BHMA 1W2B2 1JN5A 2IY2A 3GZRA 3SOYA 1Q7HA 3ZG0A 1TTOA 3GSPA 2F56A 1HYFA 3IJEB 4O3VA 4BTYA 3VGNA 3K5TA 3QRDA 1O7WB 3J7Yd 1RSNA 1BSCA 1RN7A 3UJMA 1RJOA 3CU3A 3FSDA 3U1WA 3BLZA 1BSEA 1K28A 2R41A 2F86B 1KD14 1OGXA 1B2MA 4HYZA 5G2GA 3GZYB 2CFLA 2AADA 1B3SA 4J8TA 1VQO3 2ZDJA 1I3IA 3DGYA 3LYGA 1BIRA 3ROBA 1OF5B 1YGWA 4HM8B 2A15A 1LOXA 3HIGA 4HM7B 3DM8A 1T5YA 3EN1B 3KZTA 5FGOA 3BNCA 3G4S3 1MNLA 1B2UA 1EQKA 1KSIA 5RNTA 4AEQA 1IVUA 1TFKA 2RBIA 2SARA 3NX0A 1F8NA 3KSED 1T2IA 1X1XA 3CNXA 1LNIA 3HI7A 4X2HA 1SIHA 3GAXA 3NV0B 1B2SA 1I70A 3DMCA 5AIFA 2CIUA 4XDWA 2MC8A 3CPW2 2XGNA 1IT8A 2CWUA 4N6OB 2C11A 4GB5A 4KFDA 1W6GA 1TU5A 1FUSA 3KIIA 2C10A 4HM4B 1VQM3 1O7MB 3MYTA 1FUWA 1Z1SA 1IQXA 1OPYA 2F99A 2KF6A 3B4OA 3H3HA 3MG1A 4EV2A 2HOHA 3EB8A 2CX1A 1G02A 3F8HA 5JPPA 2WGQA 1W6CA 2GSPA 1GS3A 4XB5A 3WHOA 1GYBA 1UGHI 2KF3A 1DYUA 3DGOA 2W03A 1BRNL 3SYUA 4J9AA 4QWTA 1IDPA 2CC3A 1MWTA 1Q40A 1GMRA 3NM7A 1W02A 4LGQA 3X40A 1NO3A 1JV2B 4MMYB 3N9HA 4MMZB 1BGSA 2WOHA 1DVDA 1J2BA 1SJWA 2F98A 3V99A 4CJNA 4WYKB 3D4AA 3F9SA 2GBXB 4XBTA 4EC6A 5CF1A 1ISKA 2P05A 3MKIA 4BL3A 2H0IA 1LOYA 2CWVA 3SEDA 1MWUA 3S67A 1ULIB 9RNTA 2K3DA 3HIIA 4O2HA 3JUQA 3HZPA 1HZ1A 1RGLA 3FKAA 3L0RA 1CYUA 1KWIA 1O7GB 2Z76A 3G0KA 1A2KA 3WR2A 1FW7A 2BIRA 2W9QA 3LTAA 2CG0A 3O8YA 3HX8A 3OWYA 1BRKA 3RDEA 1BRJA 1M9GA 3ALAA 1GMPA 2IYJA 3LT9A 4HM2B 1OHOA 4EBGA 4BU4A 4EYCA 2UGIA 3VF1A 1Q42A 3X41A 1SPUA 1CQSA 1NU3A 2CG1A 2RNTA 4HJLB 1JBRA 1EKMA 2XF3A 5IG5A 1GD4A 1RGFA 1NNVA 1O7PB 3EBTA 1OCVA 2QIYA 3GZXB 1BRGA 2JQ5A 3OWSA 4KT3B 3RGAA 5IW9A 1Q814 3ER7A 1A67A 4HM6B 2YFIB 1JKGB 3NBBA 2GXFA 1GSPA 1UCLA 1RDSA 5EVHA 5BIRA 5LC6A 1W7CA 2MF7A 1M1XB 2OQEA 2BT3A 1IVXA 2YX9A 1SQWA 3DH2A 1N9EA 2P0MA 2FXTA 3LTCA 1BNGA 4LZIA 1GY6A 5IG0A 2E2VA 1OUNA 1QJGA 3AGNA 4HM5B 1BSAA 4H61A 4HM3B 4BTWA 1EEJA 2XFSA 5BXQA 1MOLA 1QAKA 4N6V0 1YJN3 1YJ93 4PEJA 4WP5A 1FYSA 3G8ZA 3NBRA 3IMAB 1WTHA 1B20A 1UCKA 3JUOA 1BVIA 1B2ZA 2QA43 1U8CB 1X1YA 2E2UA 1ZX2A 1A90A 3NUVA 2CFGA 2CFDA 5G1KA 3LTBA 4LEHA 6RNTA 1I2FA 2QEX3 4EW5A 1U5OA 1HU9A 4R9KA 4KFEA 5D83A 3CNMA 4RNZA 3S28A 5DREA 1N9JA 2Y74A 1I8VA 1I0XA 2HMJB 1R4YA 4L8PA 1OHSA 1YNVX 3EHCA 3NBJA 3D9RA 3OW22 2CFKA 2CFWA 3OX9A 3X3YA 3BNDA 1EG9B 1ZGXA 2W6JH 1RGHA
chains in the Genus database with same CATH topology
1RGKA 1A2PA 2BU4A 4GSPA 7GSPA 1FUSA 1I2EA 1DETA 1BOXA 2KF6A 1I3FA 2HOHA 1G02A 1YVSA 1RN4A 2GSPA 3WHOA 1RNBA 2KF4A 2KF3A 1BNFA 1RCLA 3SYUA 1GOUA 1BU4A 4J5GA 1BRNL 1GMRA 1BANA 2KF5A 1BNEA 1JBSA 3D5GA 1BNRA 1BGSA 1BRSA 1GOYA 2F4YA 3AHWA 1RCKA 8RNTA 1X1UA 2ZA4A 3D4AA 1DE3A 1I2GA 1BNSA 1I0VA 2KAAA 1LOYA 1B2XA 3A5EA 9RNTA 1RGCA 3BU4A 1BSDA 1LOWA 1HZ1A 1RGLA 1FW7A 2F5MA 3WR2A 3D5IA 2BIRA 1SARA 1RGGA 1X1WA 1GOVA 1PY3A 1BRKA 1TRPA 1BRJA 1GMPA 1BRIA 1C54A 1MGWA 1Q9EA 1MGRA 4BU4A 1LRAA 4GHOA 1JBRA 2RNTA 3KCHA 2AAEA 4BIRA 1RGFA 1UCIA 3HOHA 3BIRA 1IYYA 5GSPA 1B27A 1RLSA 2C4BA 1BRGA 1RMSA 1CH0A 2F5WA 1BNIA 1GSPA 1UCLA 1RDSA 3URPA 1PYLA 1FZUA 3RNTA 5BIRA 1T2HA 1TTOA 3GSPA 2F56A 1HYFA 3DH2A 1RN1A 1BNJA 4HAAA 1RSNA 1BSCA 1BNGA 1RGEA 3AHSA 7RNTA 3AGNA 1BSAA 4J5KA 1BSEA 1LOVA 1FYSA 4RNTA 1B2MA 1B21A 1B20A 1UCKA 1BSBA 1BVIA 1AQZA 1B2ZA 1X1YA 2AADA 1B3SA 1I3IA 3DGYA 1BIRA 1UCJA 1RNTA 1RGAA 1YGWA 6RNTA 4HOHA 1I2FA 1RTUA 1BUJA 1B2UA 5RNTA 2RBIA 2SARA 1JBTA 5HOHA 1BAOA 1I8VA 1I0XA 3AGOA 1AY7A 1R4YA 1T2IA 1LNIA 1FUTA 1GMQA 1RHLA 1X1XA 1YNVX 1BRHA 5BU4A 1TRQA 1B2SA 1I70A 6GSPA 1ZGXA 3Q3FA 1RGHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RGK A;  1A2P A;  2BU4 A;  4GSP A;  7GSP A;  1FUS A;  1I2E A;  1DET A;  1BOX A;  2KF6 A;  1I3F A;  2HOH A;  1G02 A;  1YVS A;  1RN4 A;  2GSP A;  3WHO A;  1RNB A;  2KF4 A;  2KF3 A;  1BNF A;  1RCL A;  3SYU A;  1GOU A;  1BU4 A;  4J5G A;  1BRN L;  1GMR A;  1BAN A;  2KF5 A;  1BNE A;  1JBS A;  3D5G A;  1BNR A;  1BGS A;  1BRS A;  1GOY A;  2F4Y A;  3AHW A;  1RCK A;  8RNT A;  1X1U A;  2ZA4 A;  3D4A A;  1DE3 A;  1I2G A;  1BNS A;  1I0V A;  2KAA A;  1LOY A;  1B2X A;  3A5E A;  9RNT A;  1RGC A;  3BU4 A;  1BSD A;  1LOW A;  1HZ1 A;  1RGL A;  1FW7 A;  2F5M A;  3WR2 A;  3D5I A;  2BIR A;  1SAR A;  1RGG A;  1X1W A;  1GOV A;  1PY3 A;  1BRK A;  1TRP A;  1BRJ A;  1GMP A;  1BRI A;  1C54 A;  1MGW A;  1Q9E A;  1MGR A;  4BU4 A;  1LRA A;  4GHO A;  1JBR A;  2RNT A;  3KCH A;  2AAE A;  4BIR A;  1RGF A;  1UCI A;  3HOH A;  3BIR A;  1IYY A;  5GSP A;  1B27 A;  1RLS A;  2C4B A;  1BRG A;  1RMS A;  1CH0 A;  2F5W A;  1BNI A;  1GSP A;  1UCL A;  1RDS A;  3URP A;  1PYL A;  1FZU A;  3RNT A;  5BIR A;  1T2H A;  1TTO A;  3GSP A;  2F56 A;  1HYF A;  3DH2 A;  1RN1 A;  1BNJ A;  4HAA A;  1RSN A;  1BSC A;  1BNG A;  1RGE A;  3AHS A;  7RNT A;  3AGN A;  1BSA A;  4J5K A;  1BSE A;  1LOV A;  1FYS A;  4RNT A;  1B2M A;  1B21 A;  1B20 A;  1UCK A;  1BSB A;  1BVI A;  1AQZ A;  1B2Z A;  1X1Y A;  2AAD A;  1B3S A;  1I3I A;  3DGY A;  1BIR A;  1UCJ A;  1RNT A;  1RGA A;  1YGW A;  6RNT A;  4HOH A;  1I2F A;  1RTU A;  1BUJ A;  1B2U A;  5RNT A;  2RBI A;  2SAR A;  1JBT A;  5HOH A;  1BAO A;  1I8V A;  1I0X A;  3AGO A;  1AY7 A;  1R4Y A;  1T2I A;  1LNI A;  1FUT A;  1GMQ A;  1RHL A;  1X1X A;  1YNV X;  1BRH A;  5BU4 A;  1TRQ A;  1B2S A;  1I70 A;  6GSP A;  1ZGX A;  3Q3F A;  1RGH A; 
#chains in the Genus database with same CATH topology
 4LMI A;  3FGY A;  1N8R 4;  5EEO A;  3OWU A;  1RGK A;  1A2P A;  3I55 3;  7GSP A;  1N5P A;  3DZL A;  1I2E A;  2XGL A;  4K90 B;  3X42 A;  3KSP A;  4CDL A;  3UL5 A;  1IV7 A;  1D6U A;  2L4V A;  2GEY A;  1IQY A;  4WWU C;  2HMM B;  4XBX A;  3S29 A;  4KZ1 A;  1QVG 2;  1KQS 2;  4HKV B;  3KE7 A;  4MJD A;  1SII A;  1YVS A;  1DMQ A;  1UDI I;  1UUV B;  3CCQ 3;  1VQ9 3;  1ZS7 A;  1GOU A;  1BU4 A;  1FGR A;  4K1U A;  4WFO A;  5M18 A;  1OF5 A;  1W01 A;  3X3X A;  1OH0 A;  3PGB A;  3LT8 A;  1JB4 A;  2HMO B;  3EF8 A;  2ZL8 A;  1BRS A;  1NWW A;  2F4Y A;  1RCK A;  4I4K A;  3VSY A;  2JDI H;  2Z77 A;  1DVC A;  1E3R A;  1WQL B;  3BNE A;  1I0V A;  4BTX A;  4HM0 B;  1TP6 A;  4LYL B;  1B2X A;  3F8X A;  3NM2 A;  1ZO2 A;  2RSX A;  3A5E A;  2P0X A;  3UB1 A;  1ASK A;  2GU1 A;  2XH9 A;  1RGC A;  3G6E 3;  1LOW A;  4FCJ A;  3LZA A;  1A2V A;  3NV0 A;  2CHC A;  2OOV C;  2P38 A;  1RGG A;  3PS8 A;  1OGZ A;  2XFT A;  3V92 A;  3CC7 3;  1WMN A;  2WO0 A;  3TDG A;  5BVB A;  1G96 A;  2W56 B;  4BL2 A;  3CCL 3;  1W2Z A;  1GY5 A;  1Q9E A;  4K61 A;  2W2C A;  3FCS B;  2LYX A;  1YVB I;  1MWR A;  3IPT A;  4GHO A;  4IIA A;  4NHF A;  1Q86 4;  3MG2 A;  1Q82 4;  3DGL A;  3EE1 A;  3KCH A;  3SLU A;  5I97 A;  5IER A;  1MWS A;  1WMP A;  1FGM A;  2IUJ A;  3FG4 A;  1V58 A;  1NB3 I;  3LH4 A;  1IVV A;  3MPH A;  1RRH A;  3EBY A;  3F14 A;  1YI2 3;  1B27 A;  3M8C A;  1RLS A;  3DXO A;  3MG3 A;  1RKY A;  3CCE 3;  2Z7A A;  4G1M B;  4ORL A;  5D81 A;  1M1K 4;  4AKZ A;  1V74 A;  2W0Q A;  3JVC A;  4TX4 A;  3WOF B;  2B24 B;  1JRQ A;  4OK0 A;  4WYK A;  5M1A A;  5LC7 A;  1NJI 4;  2XRX B;  3CPO A;  1LNH A;  2HMN B;  1US1 A;  1VZZ A;  1BNJ A;  2O9U X;  1QVF 2;  1D6Z A;  1QMA A;  1W5Z A;  3AHS A;  7RNT A;  3CCM 3;  2LQV A;  5DRV A;  3T8N A;  1PFP A;  3LOY A;  1QAF A;  3PCS A;  4RZM A;  2IA7 A;  3F40 A;  4IPB A;  3JUP A;  4N6N B;  2BMO B;  1BSB A;  2KXG A;  3ZG5 A;  4O8S A;  2BMQ B;  3U97 A;  2CH9 A;  2GU3 A;  1NB5 I;  5CLK A;  2XR8 B;  3F7X A;  4Q53 A;  1JZD A;  1UCJ A;  2OCT A;  1RNT A;  4FMA A;  3WOD G;  4HOH A;  1VQN 3;  1VQ5 3;  1YIT 3;  1VQ4 3;  5EQL A;  1BUJ A;  2E2T A;  1UI8 A;  3FH1 A;  5CF2 A;  4L7K A;  1JKG A;  1S5A A;  2D42 A;  5HOH A;  2HML B;  3AGO A;  1AY7 A;  4CPK A;  2Q07 A;  3F7S A;  3DY5 A;  1LQG C;  3FG1 A;  1AVL A;  1BRH A;  4AKY A;  1TRQ A;  5BU4 A;  1OHP A;  6GSP A;  4STD A;  1VQL 3;  5AIH A;  3UNL A;  3DGM A;  4L8O A;  5A0O B;  1JNQ A;  4DKI A;  3SOA A;  4GSP A;  5AII A;  4NPB A;  3Q1C A;  2ML6 A;  4K1V A;  2Z6B A;  3CMA 3;  1DET A;  4OUQ A;  1BOX A;  2W9P A;  1W6Y A;  3CC4 3;  3NQY A;  1VQ6 3;  2SBL A;  4R4K A;  1RNB A;  2KF4 A;  4XBY A;  5TGN A;  3I56 3;  1BNF A;  3CCV 3;  5AYS C;  2UUG C;  1N5H A;  4N3V A;  2P09 A;  3X3Z A;  3WDG B;  1JZO A;  3Q90 A;  3S5C A;  4U13 A;  2OOV A;  3LXU X;  1BAN A;  2KF5 A;  1BNR A;  1Q7Y 4;  2OTJ 3;  1VQQ A;  3K9M C;  1GOY A;  1QAL A;  1LVN A;  3AHW A;  8RNT A;  1X1U A;  2ZA4 A;  3SXX A;  1BNS A;  2BNG A;  4N6M A;  3GRD A;  2KAA A;  3KKG A;  3V98 A;  1O7N B;  5FW5 A;  2CK3 H;  1TIJ A;  1BSD A;  2D1W A;  1YHQ 3;  3H51 A;  3ECF A;  1S72 3;  2F5M A;  3CCU 3;  3RGR A;  5IEP A;  1SAR A;  1UUW B;  1X1W A;  1TRP A;  1K41 A;  1PY3 A;  4HBR A;  2B1X B;  1BRI A;  3FF0 A;  1Y4K A;  1C54 A;  3BNB A;  1NDO B;  5KP3 A;  1LRA A;  5KP1 A;  1FGQ A;  4I5Q A;  3WA3 A;  4FMC A;  2AAE A;  2KRT A;  3N8B A;  3NXJ A;  2J8X B;  3EJV A;  4HZ9 B;  3HOH A;  5G1L A;  3BIR A;  5AEW B;  1IT7 A;  1O7H B;  2XEP A;  3PCR A;  2OQE C;  3LTD A;  1N8Q A;  3LML A;  3WMD A;  8CHO A;  2C4B A;  1CYV A;  4FCM A;  3MHE A;  2V1L A;  4XM4 A;  2PNC A;  1E3V A;  1FGT A;  4X2O A;  3KN4 A;  4GL6 A;  3URP A;  2QGU A;  3GZB A;  1PYL A;  2XSH B;  2OWP A;  3RNT A;  3OXA A;  4CCV A;  1K73 4;  2RCD A;  4KVH A;  4R1K A;  1VQK 3;  1T2H A;  1DMN A;  3K63 A;  3N54 B;  3PXM A;  1JJ2 2;  3SX1 A;  5KP4 A;  1RN1 A;  4HAA A;  5IF6 A;  5JPU A;  1RGE A;  3EX9 A;  2H0H A;  1STD A;  3EN8 A;  4J5K A;  3D3L A;  6STD A;  4NRE A;  3B4P A;  1STF I;  3EQQ B;  1WMO A;  1LOV A;  1ROA A;  2I9W A;  4RNT A;  2O3O A;  2RGQ A;  1B21 A;  4HZB B;  1CEW I;  1D6Y A;  1TJD A;  2FGT A;  2W56 A;  3SVA A;  1AQZ A;  4OVM A;  4RBN A;  1PU4 A;  1K8A 4;  3WA2 X;  2W04 A;  2OTL 3;  1AV4 A;  4ILF A;  2BO9 B;  1BUQ A;  1UI7 A;  2CKF B;  2IMJ A;  5IEN A;  1RGA A;  3NHX A;  1Q40 B;  4FCZ A;  1TUH A;  2STD A;  5D82 A;  2WGO A;  5IEO A;  1W4N A;  1IQ8 A;  5AIG A;  1RTU A;  1L5G B;  3PZW A;  4N6T A;  2YFJ B;  3B7C A;  2HMK B;  3S27 A;  2K54 A;  4FMD A;  2CX0 A;  4MMX B;  4R9L A;  5M19 A;  3NQZ A;  1VQ7 3;  1JBT A;  1BAO A;  1IVW A;  1VQ8 3;  1YIJ 3;  1OAC A;  5HGR A;  1RHL A;  1FUT A;  1GMQ A;  3K0Z A;  3CCR 3;  3OV4 A;  1KC8 4;  1JB5 A;  3Q3F A;  5IG3 A;  1UGI A;  7STD A;  1DMM A;  4O02 B;  2CW9 A;  3G16 A;  2IUK A;  2BU4 A;  1FGO A;  1WNH A;  5ELU A;  5JBS A;  1ROV A;  3FLJ A;  1UUG B;  4KFF A;  3WOE B;  1VQP 3;  1I3F A;  4FR9 A;  2GEX A;  4RNY A;  2BMR B;  2INX A;  1TFO A;  4R80 A;  4ZM8 A;  1RN4 A;  1HKX A;  3Q2P A;  3FF2 A;  3T0U A;  2YFL B;  2Y73 A;  1V57 A;  2K0M A;  1RCL A;  5AI1 A;  4J5G A;  3CXC 2;  3CD6 3;  1GD3 A;  1LXE A;  3JUN A;  4H3U A;  1E97 A;  1W00 A;  2UX0 A;  3MSO A;  1BNE A;  2ML5 A;  3D5G A;  1JBS A;  3KFQ C;  1IU7 A;  1GY7 A;  2H0G A;  5CK6 A;  5IG4 A;  2L1S A;  2CWT A;  1DE3 A;  1I2G A;  4LSO A;  4FMB A;  1AR0 A;  2ZHX B;  2M7O A;  1JB2 A;  3AMO B;  1T3B A;  3HK4 A;  4JF8 A;  3B8L A;  1K9M 4;  2R4I A;  1RRL A;  3FG3 A;  5ELJ A;  1R4C A;  3BU4 A;  3JUM A;  2PZV A;  3A76 A;  3CC2 3;  3D5I A;  3AMO A;  3CME 3;  1EUI C;  2XSO B;  3DGN A;  1FA3 A;  1GOV A;  3D79 A;  4IT7 A;  1ULJ B;  1G0T A;  3PYJ A;  4N6U A;  5STD A;  2FNQ A;  4N6L A;  3EC9 A;  1IK3 A;  1MGW A;  2GBW B;  3E99 A;  1MGR A;  4XDV A;  5CXO A;  4MEI A;  3STD A;  1YGE A;  5AEU B;  3CCJ 3;  4WHA A;  1AVK A;  3CCS 3;  4BIR A;  1IV9 A;  1YJW 3;  3G71 3;  1UCI A;  3QK9 A;  4EV5 A;  2WOF A;  3FZW A;  4EXR A;  1M90 4;  3UL6 A;  2RFR A;  1IYY A;  2KCD A;  1JN5 B;  5GSP A;  3DUK A;  1LQM B;  3ZFZ A;  3I0Y A;  1UW1 A;  4HM1 B;  5AYR B;  3GWR A;  1RMS A;  1CH0 A;  1EA2 A;  2F5W A;  1BNI A;  3K7C A;  4HVN A;  3BB9 A;  4JRF A;  1C7H A;  1FZU A;  3MWZ A;  3T8U A;  2BHM A;  1W2B 2;  1JN5 A;  2IY2 A;  3GZR A;  3SOY A;  1Q7H A;  3ZG0 A;  1TTO A;  3GSP A;  2F56 A;  1HYF A;  3IJE B;  4O3V A;  4BTY A;  3VGN A;  3K5T A;  3QRD A;  1O7W B;  3J7Y d;  1RSN A;  1BSC A;  1RN7 A;  3UJM A;  1RJO A;  3CU3 A;  3FSD A;  3U1W A;  3BLZ A;  1BSE A;  1K28 A;  2R41 A;  2F86 B;  1KD1 4;  1OGX A;  1B2M A;  4HYZ A;  5G2G A;  3GZY B;  2CFL A;  2AAD A;  1B3S A;  4J8T A;  1VQO 3;  2ZDJ A;  1I3I A;  3DGY A;  3LYG A;  1BIR A;  3ROB A;  1OF5 B;  1YGW A;  4HM8 B;  2A15 A;  1LOX A;  3HIG A;  4HM7 B;  3DM8 A;  1T5Y A;  3EN1 B;  3KZT A;  5FGO A;  3BNC A;  3G4S 3;  1MNL A;  1B2U A;  1EQK A;  1KSI A;  5RNT A;  4AEQ A;  1IVU A;  1TFK A;  2RBI A;  2SAR A;  3NX0 A;  1F8N A;  3KSE D;  1T2I A;  1X1X A;  3CNX A;  1LNI A;  3HI7 A;  4X2H A;  1SIH A;  3GAX A;  3NV0 B;  1B2S A;  1I70 A;  3DMC A;  5AIF A;  2CIU A;  4XDW A;  2MC8 A;  3CPW 2;  2XGN A;  1IT8 A;  2CWU A;  4N6O B;  2C11 A;  4GB5 A;  4KFD A;  1W6G A;  1TU5 A;  1FUS A;  3KII A;  2C10 A;  4HM4 B;  1VQM 3;  1O7M B;  3MYT A;  1FUW A;  1Z1S A;  1IQX A;  1OPY A;  2F99 A;  2KF6 A;  3B4O A;  3H3H A;  3MG1 A;  4EV2 A;  2HOH A;  3EB8 A;  2CX1 A;  1G02 A;  3F8H A;  5JPP A;  2WGQ A;  1W6C A;  2GSP A;  1GS3 A;  4XB5 A;  3WHO A;  1GYB A;  1UGH I;  2KF3 A;  1DYU A;  3DGO A;  2W03 A;  1BRN L;  3SYU A;  4J9A A;  4QWT A;  1IDP A;  2CC3 A;  1MWT A;  1Q40 A;  1GMR A;  3NM7 A;  1W02 A;  4LGQ A;  3X40 A;  1NO3 A;  1JV2 B;  4MMY B;  3N9H A;  4MMZ B;  1BGS A;  2WOH A;  1DVD A;  1J2B A;  1SJW A;  2F98 A;  3V99 A;  4CJN A;  4WYK B;  3D4A A;  3F9S A;  2GBX B;  4XBT A;  4EC6 A;  5CF1 A;  1ISK A;  2P05 A;  3MKI A;  4BL3 A;  2H0I A;  1LOY A;  2CWV A;  3SED A;  1MWU A;  3S67 A;  1ULI B;  9RNT A;  2K3D A;  3HII A;  4O2H A;  3JUQ A;  3HZP A;  1HZ1 A;  1RGL A;  3FKA A;  3L0R A;  1CYU A;  1KWI A;  1O7G B;  2Z76 A;  3G0K A;  1A2K A;  3WR2 A;  1FW7 A;  2BIR A;  2W9Q A;  3LTA A;  2CG0 A;  3O8Y A;  3HX8 A;  3OWY A;  1BRK A;  3RDE A;  1BRJ A;  1M9G A;  3ALA A;  1GMP A;  2IYJ A;  3LT9 A;  4HM2 B;  1OHO A;  4EBG A;  4BU4 A;  4EYC A;  2UGI A;  3VF1 A;  1Q42 A;  3X41 A;  1SPU A;  1CQS A;  1NU3 A;  2CG1 A;  2RNT A;  4HJL B;  1JBR A;  1EKM A;  2XF3 A;  5IG5 A;  1GD4 A;  1RGF A;  1NNV A;  1O7P B;  3EBT A;  1OCV A;  2QIY A;  3GZX B;  1BRG A;  2JQ5 A;  3OWS A;  4KT3 B;  3RGA A;  5IW9 A;  1Q81 4;  3ER7 A;  1A67 A;  4HM6 B;  2YFI B;  1JKG B;  3NBB A;  2GXF A;  1GSP A;  1UCL A;  1RDS A;  5EVH A;  5BIR A;  5LC6 A;  1W7C A;  2MF7 A;  1M1X B;  2OQE A;  2BT3 A;  1IVX A;  2YX9 A;  1SQW A;  3DH2 A;  1N9E A;  2P0M A;  2FXT A;  3LTC A;  1BNG A;  4LZI A;  1GY6 A;  5IG0 A;  2E2V A;  1OUN A;  1QJG A;  3AGN A;  4HM5 B;  1BSA A;  4H61 A;  4HM3 B;  4BTW A;  1EEJ A;  2XFS A;  5BXQ A;  1MOL A;  1QAK A;  4N6V 0;  1YJN 3;  1YJ9 3;  4PEJ A;  4WP5 A;  1FYS A;  3G8Z A;  3NBR A;  3IMA B;  1WTH A;  1B20 A;  1UCK A;  3JUO A;  1BVI A;  1B2Z A;  2QA4 3;  1U8C B;  1X1Y A;  2E2U A;  1ZX2 A;  1A90 A;  3NUV A;  2CFG A;  2CFD A;  5G1K A;  3LTB A;  4LEH A;  6RNT A;  1I2F A;  2QEX 3;  4EW5 A;  1U5O A;  1HU9 A;  4R9K A;  4KFE A;  5D83 A;  3CNM A;  4RNZ A;  3S28 A;  5DRE A;  1N9J A;  2Y74 A;  1I8V A;  1I0X A;  2HMJ B;  1R4Y A;  4L8P A;  1OHS A;  1YNV X;  3EHC A;  3NBJ A;  3D9R A;  3OW2 2;  2CFK A;  2CFW A;  3OX9 A;  3X3Y A;  3BND A;  1EG9 B;  1ZGX A;  2W6J H;  1RGH A; 
#chains in the Genus database with same CATH homology
 1RGK A;  1A2P A;  2BU4 A;  4GSP A;  7GSP A;  1FUS A;  1I2E A;  1DET A;  1BOX A;  2KF6 A;  1I3F A;  2HOH A;  1G02 A;  1YVS A;  1RN4 A;  2GSP A;  3WHO A;  1RNB A;  2KF4 A;  2KF3 A;  1BNF A;  1RCL A;  3SYU A;  1GOU A;  1BU4 A;  4J5G A;  1BRN L;  1GMR A;  1BAN A;  2KF5 A;  1BNE A;  1JBS A;  3D5G A;  1BNR A;  1BGS A;  1BRS A;  1GOY A;  2F4Y A;  3AHW A;  1RCK A;  8RNT A;  1X1U A;  2ZA4 A;  3D4A A;  1DE3 A;  1I2G A;  1BNS A;  1I0V A;  2KAA A;  1LOY A;  1B2X A;  3A5E A;  9RNT A;  1RGC A;  3BU4 A;  1BSD A;  1LOW A;  1HZ1 A;  1RGL A;  1FW7 A;  2F5M A;  3WR2 A;  3D5I A;  2BIR A;  1SAR A;  1RGG A;  1X1W A;  1GOV A;  1PY3 A;  1BRK A;  1TRP A;  1BRJ A;  1GMP A;  1BRI A;  1C54 A;  1MGW A;  1Q9E A;  1MGR A;  4BU4 A;  1LRA A;  4GHO A;  1JBR A;  2RNT A;  3KCH A;  2AAE A;  4BIR A;  1RGF A;  1UCI A;  3HOH A;  3BIR A;  1IYY A;  5GSP A;  1B27 A;  1RLS A;  2C4B A;  1BRG A;  1RMS A;  1CH0 A;  2F5W A;  1BNI A;  1GSP A;  1UCL A;  1RDS A;  3URP A;  1PYL A;  1FZU A;  3RNT A;  5BIR A;  1T2H A;  1TTO A;  3GSP A;  2F56 A;  1HYF A;  3DH2 A;  1RN1 A;  1BNJ A;  4HAA A;  1RSN A;  1BSC A;  1BNG A;  1RGE A;  3AHS A;  7RNT A;  3AGN A;  1BSA A;  4J5K A;  1BSE A;  1LOV A;  1FYS A;  4RNT A;  1B2M A;  1B21 A;  1B20 A;  1UCK A;  1BSB A;  1BVI A;  1AQZ A;  1B2Z A;  1X1Y A;  2AAD A;  1B3S A;  1I3I A;  3DGY A;  1BIR A;  1UCJ A;  1RNT A;  1RGA A;  1YGW A;  6RNT A;  4HOH A;  1I2F A;  1RTU A;  1BUJ A;  1B2U A;  5RNT A;  2RBI A;  2SAR A;  1JBT A;  5HOH A;  1BAO A;  1I8V A;  1I0X A;  3AGO A;  1AY7 A;  1R4Y A;  1T2I A;  1LNI A;  1FUT A;  1GMQ A;  1RHL A;  1X1X A;  1YNV X;  1BRH A;  5BU4 A;  1TRQ A;  1B2S A;  1I70 A;  6GSP A;  1ZGX A;  3Q3F A;  1RGH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...