1R4YA

Solution structure of the deletion mutant delta(7-22) of the cytotoxic ribonuclease alpha-sarcin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
136
structure length
136
Chain Sequence
b'AVTWTCGGLLYNQNKAESNSHHAPLSDGKTGSSYPHWFTNGYDGDGKLPKGRTPIKFGKSDCDRPPKHSKDGNGKTDHYLLEFPTFPDGHDYKFDSKKPKENPGPARVIYTYPNKVFCGIIAHTKENQGELKLCSH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease alpha-sarcin
publication title NMR structure of the noncytotoxic {alpha}-sarcin mutant {Delta}(7-22): The importance of the native conformation of peripheral loops for activity.
pubmed doi rcsb
source organism Aspergillus giganteus
molecule tags Hydrolase
total genus 17
structure length 136
sequence length 136
ec nomenclature ec 3.1.27.10: rRNA endonuclease.
pdb deposition date 2003-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1r4yA00
4J5KA 1BRHA 1BRSA 1JBRA 3D4AA 5RNTA 1BU4A 1B20A 1PY3A 1RGLA 5GSPA 1RGGA 3GSPA 1BNIA 1BANA 1B2UA 1BSDA 1HYFA 1I8VA 1PYLA 1LOYA 2F5MA 1GMRA 1IYYA 5HOHA 1TRQA 1LOWA 1RSNA 2HOHA 1BRJA 3BIRA 3DH2A 1AQZA 2AADA 3AHSA 2KF4A 1MGWA 1TRPA 1BNGA 1I3IA 1T2IA 2F56A 3A5EA 1RN1A 2KAAA 2GSPA 1BNJA 1RGAA 1I2EA 2BIRA 2BU4A 3D5IA 1C54A 1RGFA 1GOUA 1YNVX 1I70A 2C4BA 6GSPA 1BVIA 1BSAA 1FUSA 1BAOA 7GSPA 1X1UA 3AGOA 1BUJA 3URPA 1BSCA 1YVSA 1HZ1A 1RTUA 3WR2A 1BNFA 3AHWA 4BIRA 4BU4A 1RLSA 1T2HA 1BRNL 1B21A 1JBTA 4J5GA 1X1WA 1B2SA 1GSPA 1GMQA 3Q3FA 3BU4A 4GHOA 1BNEA 4RNTA 1LOVA 1RGEA 3KCHA 1FUTA 1FW7A 1RCKA 1A2PA 1UCLA 1RGCA 1BRGA 1Q9EA 1JBSA 1B2XA 1AY7A 2RBIA 6RNTA 1BOXA 1RGKA 1UCJA 1RN4A 3SYUA 1RGHA 2AAEA 3RNTA 1GOVA 1I3FA 5BIRA 1DE3A 1BSEA 1LRAA 1ZGXA 1UCIA 3DGYA 1B27A 3AGNA 1RNTA 2KF6A 7RNTA 2F4YA 3D5GA 2KF5A 8RNTA 1RDSA 1I2FA 2F5WA 1I0XA 1MGRA 1BNRA 1BRIA 1UCKA 1I2GA 1SARA 4GSPA 1GMPA 4HOHA 5BU4A 2SARA 2RNTA 1BNSA 1BIRA 1RNBA 1FZUA 1CH0A 1BSBA 4HAAA 1BRKA 1TTOA 1X1XA 1BGSA 1R4YA 1RMSA 1G02A 1B2ZA 2ZA4A 1DETA 1GOYA 1RCLA 1YGWA 1B3SA 1B2MA 1X1YA 2KF3A 1LNIA 1RHLA 9RNTA 1FYSA 1I0VA 3WHOA 3HOHA
chains in the Genus database with same CATH superfamily
7STDA 1VQ53 3EN1B 5ELJA 3KE7A 1JBRA 3D4AA 3DGLA 3DMCA 4LMIA 1OACA 2W9QA 2WGOA 4HVNA 2W56A 5GSPA 3OX9A 3GSPA 1IQ8A 1BNIA 4XBXA 2QIYA 1B2UA 3Q90A 3UL5A 1JJ22 1RN7A 3LTCA 1SIHA 1SJWA 3KZTA 2HOHA 4N6MA 3ZFZA 3NX0A 2O9UX 3BIRA 1JKGA 1O7GB 4BTYA 2AADA 1NB5I 3EF8A 3PCSA 1TRPA 1JB4A 1T2IA 2F56A 2FNQA 1RN1A 1W01A 1WMOA 2D42A 2F98A 2ZDJA 4FMDA 1OCVA 4HM1B 4PEJA 4ZM8A 1YIJ3 2GSPA 1BNJA 1RGAA 3VF1A 1MNLA 1C54A 2GEXA 1T3BA 1TP6A 1RGFA 2GBXB 2L4VA 3KIIA 4H3UA 4HM6B 1RKYA 1JNQA 1WMPA 1VQ93 1O7NB 2CFLA 4NPBA 1BSAA 3NM7A 1BAOA 5KP4A 4RNYA 1MOLA 3EC9A 3OWSA 1TIJA 4HYZA 1BNFA 2V1LA 1RLSA 4NHFA 1E3VA 2KXGA 2B24B 4DKIA 3X3YA 3CCL3 1A90A 1GMQA 1IQXA 2P09A 3D79A 4XDWA 1LXEA 2BNGA 1OF5A 3SEDA 5KP3A 2XRXB 1RGEA 3X40A 1OGXA 1Q40B 1W6GA 3KCHA 3X42A 4N6NB 5IEPA 1W2ZA 2I9WA 4HM4B 3WDGB 3H3HA 5IG5A 1VQ63 3HX8A 4HZ9B 4BTXA 1A2PA 3EX9A 3MHEA 3F14A 4BL3A 3B4OA 1BRGA 1Q9EA 4MMXB 2YFLB 4L8OA 5STDA 1B2XA 1YIT3 4KFEA 1L5GB 2C10A 3HI7A 1EQKA 2XSOB 3NBRA 4CPKA 1UCJA 2STDA 1RN4A 2OQEA 4OUQA 1YHQ3 2AAEA 3WOEB 2K0MA 2IUJA 1BSEA 1K28A 3CCE3 1W2B2 4WYKA 1DE3A 1UUWB 1RNTA 3EQQB 2CWUA 3CNMA 2RGQA 2UX0A 2WO0A 2CHCA 2KF5A 3D5GA 3K9MC 2CIUA 3JUNA 1RDSA 4G1MB 1M904 1I2FA 2GU1A 2PNCA 4MMYB 5DRVA 1Y4KA 1NO3A 1HU9A 2CX1A 1MGRA 1FA3A 2YX9A 5AI1A 3MSOA 1DMQA 1GMPA 4MMZB 4R9LA 2M7OA 1N8QA 1V74A 2GEYA 4KZ1A 1Z1SA 1LQGC 2Z76A 1CQSA 3LH4A 4EC6A 3LZAA 1SQWA 1RNBA 1FGQA 1FZUA 2LQVA 5BXQA 1J2BA 1OH0A 1RRHA 1UDII 1D6YA 1GD3A 4LGQA 2QEX3 2B1XB 3PYJA 2Q07A 1WMNA 3FGYA 1VQ43 1QJGA 2WOHA 3FSDA 4KVHA 4EV5A 1KC84 1G02A 3JUOA 1U8CB 5EVHA 1YGWA 3Q2PA 3SXXA 1B3SA 1QVG2 4HM3B 1MWUA 1RHLA 3DGOA 4O02B 3X3ZA 1FYSA 4XBTA 5AYRB 4J5KA 1BRSA 1T5YA 3WODG 1PY3A 4HJLB 1HKXA 1JZDA 3BNCA 3T8UA 4AKZA 3MWZA 5I97A 3RDEA 2CFWA 3F9SA 5ELUA 3K5TA 4L8PA 1BANA 1BSDA 1HYFA 1I8VA 4KFDA 1GY7A 2F5MA 2HMNB 3EJVA 2W04A 4ILFA 3NUVA 5HOHA 1IU7A 1DYUA 1TRQA 3WA3A 2P05A 1VQM3 5EEOA 3CCV3 3DH2A 2H0HA 1OHSA 3DUKA 3MG2A 2KF4A 1MGWA 1QMAA 1W6YA 1EKMA 1I3IA 3SX1A 3FH1A 3JUQA 4LYLB 3S29A 2W0QA 1Q824 2BU4A 1I2EA 4N3VA 1OGZA 4AKYA 1DMMA 1UUVB 1GOUA 4LEHA 1ISKA 1ASKA 3KFQC 1FUSA 3SOAA 1ZO2A 1LOXA 7GSPA 5G1LA 5IG3A 5AYSC 1O7PB 3CCR3 3LTBA 4WFOA 4EBGA 1BSCA 1WNHA 2FGTA 1IV9A 1HZ1A 2YFJB 3BB9A 1Q7HA 3FCSB 4FR9A 4HM0B 1IVVA 4I4KA 4LZIA 4O2HA 2IMJA 4N6V0 3CCM3 5AIIA 3E99A 4FCJA 1R4CA 1B2SA 3Q3FA 1D6ZA 2CFDA 3BNEA 4GHOA 4IPBA 4J5GA 5CLKA 3V92A 1YI23 1Q864 1W5ZA 1QAKA 1LOVA 3ZG5A 3IJEB 3CC43 3CNXA 3GZYB 4K61A 4I5QA 4IIAA 2CKFB 2E2TA 1YGEA 5IEOA 1FUWA 1FW7A 1RCKA 1GYBA 5DREA 3I0YA 5LC7A 3X41A 5IF6A 2OOVC 3CC73 4FCZA 1Q7Y4 1JBSA 3PXMA 3QK9A 1AY7A 1WTHA 2CWVA 5HGRA 2BMRB 3GZRA 3HZPA 3U1WA 6RNTA 2W2CA 2RSXA 1W00A 1RGKA 4CJNA 3KSPA 3SYUA 3S5CA 3HIGA 5TGNA 3G8ZA 4EW5A 3EBTA 4RNZA 1I3FA 4MJDA 5IG0A 5BIRA 1LRAA 4H61A 1UCIA 1N5PA 1IVUA 4J8TA 3K0ZA 3ECFA 4QWTA 8RNTA 3WOFB 1Q40A 1Q814 2UGIA 1JB5A 1I0XA 3IMAB 4FMCA 3T8NA 3O8YA 1M1K4 1QVF2 1A2VA 1PU4A 3N8BA 3N54B 2CG0A 3CCJ3 1PFPA 2W03A 4HOHA 3B4PA 1LNHA 2SARA 3K7CA 1S5AA 3B7CA 3EN8A 3NV0B 3F7SA 3GZXB 1DVDA 1BNSA 4X2HA 1BIRA 3FG1A 2XH9A 5AIFA 1CH0A 1IT8A 3GRDA 4HAAA 2H0GA 1BRKA 1TTOA 4R4KA 5KP1A 4ORLA 2QA43 4WHAA 2P38A 5IW9A 1QAFA 4OK0A 4BL2A 1FGTA 4K1VA 5AIGA 2KF3A 2C11A 3AMOB 3WHOA 3CCS3 1QALA 2J8XB 3HOHA 2XGNA 1NWWA 1BRHA 1O7HB 5RNTA 2R41A 3QRDA 3X3XA 1OHPA 1BUJA 2MF7A 3MG3A 4JF8A 3CCQ3 4XM4A 1UW1A 2P0MA 4GL6A 4GB5A 1PYLA 1LOYA 3HIIA 3SOYA 1IYYA 1E3RA 3J7Yd 1RSNA 1BRJA 1NB3I 2MC8A 1AQZA 2RFRA 3FG3A 3LT8A 5G2GA 4HBRA 2OTL3 4HZBB 1IVWA 4KT3B 3F40A 3PZWA 1UGHI 2XF3A 1V58A 3OXAA 3N9HA 1O7MB 3DM8A 1TFOA 1TJDA 3D5IA 2BIRA 2UUGC 1A2KA 1VQQA 3S28A 1STDA 3JUMA 4Q53A 3U97A 1I70A 3MPHA 2C4BA 1OHOA 4N6TA 4EXRA 6GSPA 2XEPA 1X1UA 3NQZA 2L1SA 3H51A 4MEIA 1YVSA 2HMKB 2ZHXB 1RTUA 2ML6A 3WR2A 3FKAA 5AIHA 4BIRA 1NDOB 3NXJA 3CC23 2OTJ3 5AEWB 3KN4A 2IA7A 2WGQA 1IDPA 1X1WA 1EA2A 2HMMB 3Q1CA 1BNEA 2PZVA 2R4IA 4TX4A 4CCVA 1A67A 4EYCA 3JUPA 1VQP3 3IPTA 1FUTA 3KKGA 1Q42A 1IV7A 1VQO3 3SVAA 1UCLA 4OVMA 3NBJA 1K8A4 5IG4A 5EQLA 1OPYA 4K1UA 2CH9A 3NM2A 4LSOA 5G1KA 4O8SA 1TFKA 1OUNA 2HMLB 3FG4A 1TU5A 3EB8A 5JPPA 2GU3A 1RGHA 1GY6A 3RNTA 1LVNA 1CEWI 2F99A 2K54A 1IK3A 3LXUX 1YJ93 5CXOA 1UUGB 1W6CA 1ZGXA 3DGYA 1B27A 2BMQB 3AGNA 3DXOA 3FLJA 2KF6A 1EG9B 1ROAA 1JN5A 3OWUA 4R1KA 5FW5A 4EV2A 3CD63 1JN5B 2Z6BA 5IENA 5AEUB 2F5WA 2W9PA 2CW9A 1BNRA 3FF2A 3CPOA 1BRIA 1UCKA 3A76A 1SARA 3OV4A 4GSPA 4BTWA 2JQ5A 2OQEC 4RZMA 2GBWB 2W56B 3G0KA 3JVCA 3F8HA 1RRLA 1UI8A 1YJW3 3LMLA 3I563 2XGLA 3LTDA 3PGBA 1JV2B 1MWRA 4HKVB 3CPW2 3UL6A 1BSBA 1N9JA 1X1XA 1JKGB 2IYJA 1EEJA 3PCRA 4N6UA 2XFSA 4FMAA 5BVBA 5IERA 3GZBA 1M9GA 1BGSA 1GD4A 1D6UA 1W02A 1F8NA 1W7CA 1ZS7A 1GS3A 2HMOB 1LQMB 1M1XB 1R4YA 3DY5A 3GAXA 3L0RA 5CK6A 3S67A 1SPUA 1RCLA 3S27A 3V99A 1NJI4 1KD14 1VQL3 1ULIB 1DMNA 1FGMA 3VSYA 1US1A 3D3LA 3B8LA 3WMDA 2FXTA 3M8CA 2XR8B 2P0XA 3T0UA 1BUQA 1VZZA 4NREA 1BU4A 1B20A 4R9KA 3ROBA 1RGLA 2OWPA 5A0OB 1KSIA 1RGGA 3NV0A 1UGIA 3LTAA 3EBYA 4K90B 3NHXA 3UJMA 1STFI 1IVXA 3LOYA 1GMRA 2QGUA 1WQLB 3CME3 1LOWA 4XB5A 3RGAA 1JZOA 1S723 1KWIA 1AR0A 2BHMA 3AHSA 5M18A 1OF5B 1AV4A 5M1AA 1JRQA 1E97A 5CF1A 1BNGA 3VGNA 2XFTA 2YFIB 3A5EA 4N6OB 2KAAA 5M19A 3AMOA 1FGRA 2W6JH 1BRNL 2ZL8A 1N8R4 5D81A 2Z77A 2K3DA 2XSHB 1YNVX 1YVBI 1UI7A 1BVIA 3MKIA 6STDA 3DGMA 3AGOA 3BNDA 3LT9A 4HM7B 4U13A 2GXFA 2CX0A 1C7HA 3MG1A 2F86B 5LC6A 4FCMA 2OOVA 3TDGA 3URPA 8CHOA 2IUKA 3AHWA 3K63A 4KFFA 4BU4A 3F8XA 1T2HA 3OWYA 1B21A 1U5OA 3WA2X 1MWSA 1GSPA 3BNBA 3G6E3 3PS8A 3BU4A 1JBTA 1AVKA 3GWRA 3NBBA 4WP5A 4JRFA 4RNTA 4WYKB 1V57A 3FZWA 5JPUA 3CMA3 1JB2A 2Y73A 3ALAA 1KQS2 5D82A 1IQYA 2D1WA 4R80A 2CFGA 1N5HA 1ULJB 1ROVA 1RGCA 4CDLA 2H0IA 1VQ73 1W4NA 1K734 2E2VA 1YJN3 3RGRA 3OW22 2HMJB 2RBIA 4O3VA 1BOXA 2INXA 3D9RA 5FGOA 4IT7A 3G4S3 2Y74A 1VQK3 1G0TA 1K41A 2KCDA 1AVLA 4WWUC 4FMBA 1GOVA 1CYUA 1N9EA 3DGNA 1GY5A 4HM8B 2E2UA 2CFKA 3KSED 4HM2B 4L7KA 4XDVA 2SBLA 2WOFA 7RNTA 3FF0A 5JBSA 1DVCA 2F4YA 1CYVA 2CC3A 3SLUA 3G713 1FGOA 3EE1A 3DZLA 2BMOB 3LYGA 1G96A 3ER7A 4J9AA 1SIIA 4RBNA 1TUHA 3CU3A 2Z7AA 4STDA 3UB1A 1K9M4 1I2GA 2CWTA 3I553 1NU3A 3F7XA 1NNVA 4XBYA 2LYXA 5BU4A 3ZG0A 4HM5B 2O3OA 2RNTA 3UNLA 4AEQA 1VQN3 2BO9B 1O7WB 2A15A 3V98A 4N6LA 2BT3A 3EHCA 1ZX2A 1EUIC 3BLZA 1MWTA 2KRTA 2IY2A 4X2OA 1IT7A 3CXC2 3CCU3 5CF2A 1RMSA 1VQ83 1B2ZA 3G16A 5D83A 2CG1A 2ZA4A 1DETA 1GOYA 1RJOA 2RCDA 3HK4A 2JDIH 3NQYA 2ML5A 3STDA 1X1YA 1B2MA 1LNIA 9RNTA 1I0VA 3MYTA 2OCTA 2CK3H
chains in the Genus database with same CATH topology
4J5KA 1BRHA 1BRSA 1JBRA 3D4AA 5RNTA 1BU4A 1B20A 1PY3A 1RGLA 5GSPA 1RGGA 3GSPA 1BNIA 1BANA 1B2UA 1BSDA 1HYFA 1I8VA 1PYLA 1LOYA 2F5MA 1GMRA 1IYYA 5HOHA 1TRQA 1LOWA 1RSNA 2HOHA 1BRJA 3BIRA 3DH2A 1AQZA 2AADA 3AHSA 2KF4A 1MGWA 1TRPA 1BNGA 1I3IA 1T2IA 2F56A 3A5EA 1RN1A 2KAAA 2GSPA 1BNJA 1RGAA 1I2EA 2BIRA 2BU4A 3D5IA 1C54A 1RGFA 1GOUA 1YNVX 1I70A 2C4BA 6GSPA 1BVIA 1BSAA 1FUSA 1BAOA 7GSPA 1X1UA 3AGOA 1BUJA 3URPA 1BSCA 1YVSA 1HZ1A 1RTUA 3WR2A 1BNFA 3AHWA 4BIRA 4BU4A 1RLSA 1T2HA 1BRNL 1B21A 1JBTA 4J5GA 1X1WA 1B2SA 1GSPA 1GMQA 3Q3FA 3BU4A 4GHOA 1BNEA 4RNTA 1LOVA 1RGEA 3KCHA 1FUTA 1FW7A 1RCKA 1A2PA 1UCLA 1RGCA 1BRGA 1Q9EA 1JBSA 1B2XA 1AY7A 2RBIA 6RNTA 1BOXA 1RGKA 1UCJA 1RN4A 3SYUA 1RGHA 2AAEA 3RNTA 1GOVA 1I3FA 5BIRA 1DE3A 1BSEA 1LRAA 1ZGXA 1UCIA 3DGYA 1B27A 3AGNA 1RNTA 2KF6A 7RNTA 2F4YA 3D5GA 2KF5A 8RNTA 1RDSA 1I2FA 2F5WA 1I0XA 1MGRA 1BNRA 1BRIA 1UCKA 1I2GA 1SARA 4GSPA 1GMPA 4HOHA 5BU4A 2SARA 2RNTA 1BNSA 1BIRA 1RNBA 1FZUA 1CH0A 1BSBA 4HAAA 1BRKA 1TTOA 1X1XA 1BGSA 1R4YA 1RMSA 1G02A 1B2ZA 2ZA4A 1DETA 1GOYA 1RCLA 1YGWA 1B3SA 1B2MA 1X1YA 2KF3A 1LNIA 1RHLA 9RNTA 1FYSA 1I0VA 3WHOA 3HOHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J5K A;  1BRH A;  1BRS A;  1JBR A;  3D4A A;  5RNT A;  1BU4 A;  1B20 A;  1PY3 A;  1RGL A;  5GSP A;  1RGG A;  3GSP A;  1BNI A;  1BAN A;  1B2U A;  1BSD A;  1HYF A;  1I8V A;  1PYL A;  1LOY A;  2F5M A;  1GMR A;  1IYY A;  5HOH A;  1TRQ A;  1LOW A;  1RSN A;  2HOH A;  1BRJ A;  3BIR A;  3DH2 A;  1AQZ A;  2AAD A;  3AHS A;  2KF4 A;  1MGW A;  1TRP A;  1BNG A;  1I3I A;  1T2I A;  2F56 A;  3A5E A;  1RN1 A;  2KAA A;  2GSP A;  1BNJ A;  1RGA A;  1I2E A;  2BIR A;  2BU4 A;  3D5I A;  1C54 A;  1RGF A;  1GOU A;  1YNV X;  1I70 A;  2C4B A;  6GSP A;  1BVI A;  1BSA A;  1FUS A;  1BAO A;  7GSP A;  1X1U A;  3AGO A;  1BUJ A;  3URP A;  1BSC A;  1YVS A;  1HZ1 A;  1RTU A;  3WR2 A;  1BNF A;  3AHW A;  4BIR A;  4BU4 A;  1RLS A;  1T2H A;  1BRN L;  1B21 A;  1JBT A;  4J5G A;  1X1W A;  1B2S A;  1GSP A;  1GMQ A;  3Q3F A;  3BU4 A;  4GHO A;  1BNE A;  4RNT A;  1LOV A;  1RGE A;  3KCH A;  1FUT A;  1FW7 A;  1RCK A;  1A2P A;  1UCL A;  1RGC A;  1BRG A;  1Q9E A;  1JBS A;  1B2X A;  1AY7 A;  2RBI A;  6RNT A;  1BOX A;  1RGK A;  1UCJ A;  1RN4 A;  3SYU A;  1RGH A;  2AAE A;  3RNT A;  1GOV A;  1I3F A;  5BIR A;  1DE3 A;  1BSE A;  1LRA A;  1ZGX A;  1UCI A;  3DGY A;  1B27 A;  3AGN A;  1RNT A;  2KF6 A;  7RNT A;  2F4Y A;  3D5G A;  2KF5 A;  8RNT A;  1RDS A;  1I2F A;  2F5W A;  1I0X A;  1MGR A;  1BNR A;  1BRI A;  1UCK A;  1I2G A;  1SAR A;  4GSP A;  1GMP A;  4HOH A;  5BU4 A;  2SAR A;  2RNT A;  1BNS A;  1BIR A;  1RNB A;  1FZU A;  1CH0 A;  1BSB A;  4HAA A;  1BRK A;  1TTO A;  1X1X A;  1BGS A;  1R4Y A;  1RMS A;  1G02 A;  1B2Z A;  2ZA4 A;  1DET A;  1GOY A;  1RCL A;  1YGW A;  1B3S A;  1B2M A;  1X1Y A;  2KF3 A;  1LNI A;  1RHL A;  9RNT A;  1FYS A;  1I0V A;  3WHO A;  3HOH A; 
#chains in the Genus database with same CATH topology
 7STD A;  1VQ5 3;  3EN1 B;  5ELJ A;  3KE7 A;  1JBR A;  3D4A A;  3DGL A;  3DMC A;  4LMI A;  1OAC A;  2W9Q A;  2WGO A;  4HVN A;  2W56 A;  5GSP A;  3OX9 A;  3GSP A;  1IQ8 A;  1BNI A;  4XBX A;  2QIY A;  1B2U A;  3Q90 A;  3UL5 A;  1JJ2 2;  1RN7 A;  3LTC A;  1SIH A;  1SJW A;  3KZT A;  2HOH A;  4N6M A;  3ZFZ A;  3NX0 A;  2O9U X;  3BIR A;  1JKG A;  1O7G B;  4BTY A;  2AAD A;  1NB5 I;  3EF8 A;  3PCS A;  1TRP A;  1JB4 A;  1T2I A;  2F56 A;  2FNQ A;  1RN1 A;  1W01 A;  1WMO A;  2D42 A;  2F98 A;  2ZDJ A;  4FMD A;  1OCV A;  4HM1 B;  4PEJ A;  4ZM8 A;  1YIJ 3;  2GSP A;  1BNJ A;  1RGA A;  3VF1 A;  1MNL A;  1C54 A;  2GEX A;  1T3B A;  1TP6 A;  1RGF A;  2GBX B;  2L4V A;  3KII A;  4H3U A;  4HM6 B;  1RKY A;  1JNQ A;  1WMP A;  1VQ9 3;  1O7N B;  2CFL A;  4NPB A;  1BSA A;  3NM7 A;  1BAO A;  5KP4 A;  4RNY A;  1MOL A;  3EC9 A;  3OWS A;  1TIJ A;  4HYZ A;  1BNF A;  2V1L A;  1RLS A;  4NHF A;  1E3V A;  2KXG A;  2B24 B;  4DKI A;  3X3Y A;  3CCL 3;  1A90 A;  1GMQ A;  1IQX A;  2P09 A;  3D79 A;  4XDW A;  1LXE A;  2BNG A;  1OF5 A;  3SED A;  5KP3 A;  2XRX B;  1RGE A;  3X40 A;  1OGX A;  1Q40 B;  1W6G A;  3KCH A;  3X42 A;  4N6N B;  5IEP A;  1W2Z A;  2I9W A;  4HM4 B;  3WDG B;  3H3H A;  5IG5 A;  1VQ6 3;  3HX8 A;  4HZ9 B;  4BTX A;  1A2P A;  3EX9 A;  3MHE A;  3F14 A;  4BL3 A;  3B4O A;  1BRG A;  1Q9E A;  4MMX B;  2YFL B;  4L8O A;  5STD A;  1B2X A;  1YIT 3;  4KFE A;  1L5G B;  2C10 A;  3HI7 A;  1EQK A;  2XSO B;  3NBR A;  4CPK A;  1UCJ A;  2STD A;  1RN4 A;  2OQE A;  4OUQ A;  1YHQ 3;  2AAE A;  3WOE B;  2K0M A;  2IUJ A;  1BSE A;  1K28 A;  3CCE 3;  1W2B 2;  4WYK A;  1DE3 A;  1UUW B;  1RNT A;  3EQQ B;  2CWU A;  3CNM A;  2RGQ A;  2UX0 A;  2WO0 A;  2CHC A;  2KF5 A;  3D5G A;  3K9M C;  2CIU A;  3JUN A;  1RDS A;  4G1M B;  1M90 4;  1I2F A;  2GU1 A;  2PNC A;  4MMY B;  5DRV A;  1Y4K A;  1NO3 A;  1HU9 A;  2CX1 A;  1MGR A;  1FA3 A;  2YX9 A;  5AI1 A;  3MSO A;  1DMQ A;  1GMP A;  4MMZ B;  4R9L A;  2M7O A;  1N8Q A;  1V74 A;  2GEY A;  4KZ1 A;  1Z1S A;  1LQG C;  2Z76 A;  1CQS A;  3LH4 A;  4EC6 A;  3LZA A;  1SQW A;  1RNB A;  1FGQ A;  1FZU A;  2LQV A;  5BXQ A;  1J2B A;  1OH0 A;  1RRH A;  1UDI I;  1D6Y A;  1GD3 A;  4LGQ A;  2QEX 3;  2B1X B;  3PYJ A;  2Q07 A;  1WMN A;  3FGY A;  1VQ4 3;  1QJG A;  2WOH A;  3FSD A;  4KVH A;  4EV5 A;  1KC8 4;  1G02 A;  3JUO A;  1U8C B;  5EVH A;  1YGW A;  3Q2P A;  3SXX A;  1B3S A;  1QVG 2;  4HM3 B;  1MWU A;  1RHL A;  3DGO A;  4O02 B;  3X3Z A;  1FYS A;  4XBT A;  5AYR B;  4J5K A;  1BRS A;  1T5Y A;  3WOD G;  1PY3 A;  4HJL B;  1HKX A;  1JZD A;  3BNC A;  3T8U A;  4AKZ A;  3MWZ A;  5I97 A;  3RDE A;  2CFW A;  3F9S A;  5ELU A;  3K5T A;  4L8P A;  1BAN A;  1BSD A;  1HYF A;  1I8V A;  4KFD A;  1GY7 A;  2F5M A;  2HMN B;  3EJV A;  2W04 A;  4ILF A;  3NUV A;  5HOH A;  1IU7 A;  1DYU A;  1TRQ A;  3WA3 A;  2P05 A;  1VQM 3;  5EEO A;  3CCV 3;  3DH2 A;  2H0H A;  1OHS A;  3DUK A;  3MG2 A;  2KF4 A;  1MGW A;  1QMA A;  1W6Y A;  1EKM A;  1I3I A;  3SX1 A;  3FH1 A;  3JUQ A;  4LYL B;  3S29 A;  2W0Q A;  1Q82 4;  2BU4 A;  1I2E A;  4N3V A;  1OGZ A;  4AKY A;  1DMM A;  1UUV B;  1GOU A;  4LEH A;  1ISK A;  1ASK A;  3KFQ C;  1FUS A;  3SOA A;  1ZO2 A;  1LOX A;  7GSP A;  5G1L A;  5IG3 A;  5AYS C;  1O7P B;  3CCR 3;  3LTB A;  4WFO A;  4EBG A;  1BSC A;  1WNH A;  2FGT A;  1IV9 A;  1HZ1 A;  2YFJ B;  3BB9 A;  1Q7H A;  3FCS B;  4FR9 A;  4HM0 B;  1IVV A;  4I4K A;  4LZI A;  4O2H A;  2IMJ A;  4N6V 0;  3CCM 3;  5AII A;  3E99 A;  4FCJ A;  1R4C A;  1B2S A;  3Q3F A;  1D6Z A;  2CFD A;  3BNE A;  4GHO A;  4IPB A;  4J5G A;  5CLK A;  3V92 A;  1YI2 3;  1Q86 4;  1W5Z A;  1QAK A;  1LOV A;  3ZG5 A;  3IJE B;  3CC4 3;  3CNX A;  3GZY B;  4K61 A;  4I5Q A;  4IIA A;  2CKF B;  2E2T A;  1YGE A;  5IEO A;  1FUW A;  1FW7 A;  1RCK A;  1GYB A;  5DRE A;  3I0Y A;  5LC7 A;  3X41 A;  5IF6 A;  2OOV C;  3CC7 3;  4FCZ A;  1Q7Y 4;  1JBS A;  3PXM A;  3QK9 A;  1AY7 A;  1WTH A;  2CWV A;  5HGR A;  2BMR B;  3GZR A;  3HZP A;  3U1W A;  6RNT A;  2W2C A;  2RSX A;  1W00 A;  1RGK A;  4CJN A;  3KSP A;  3SYU A;  3S5C A;  3HIG A;  5TGN A;  3G8Z A;  4EW5 A;  3EBT A;  4RNZ A;  1I3F A;  4MJD A;  5IG0 A;  5BIR A;  1LRA A;  4H61 A;  1UCI A;  1N5P A;  1IVU A;  4J8T A;  3K0Z A;  3ECF A;  4QWT A;  8RNT A;  3WOF B;  1Q40 A;  1Q81 4;  2UGI A;  1JB5 A;  1I0X A;  3IMA B;  4FMC A;  3T8N A;  3O8Y A;  1M1K 4;  1QVF 2;  1A2V A;  1PU4 A;  3N8B A;  3N54 B;  2CG0 A;  3CCJ 3;  1PFP A;  2W03 A;  4HOH A;  3B4P A;  1LNH A;  2SAR A;  3K7C A;  1S5A A;  3B7C A;  3EN8 A;  3NV0 B;  3F7S A;  3GZX B;  1DVD A;  1BNS A;  4X2H A;  1BIR A;  3FG1 A;  2XH9 A;  5AIF A;  1CH0 A;  1IT8 A;  3GRD A;  4HAA A;  2H0G A;  1BRK A;  1TTO A;  4R4K A;  5KP1 A;  4ORL A;  2QA4 3;  4WHA A;  2P38 A;  5IW9 A;  1QAF A;  4OK0 A;  4BL2 A;  1FGT A;  4K1V A;  5AIG A;  2KF3 A;  2C11 A;  3AMO B;  3WHO A;  3CCS 3;  1QAL A;  2J8X B;  3HOH A;  2XGN A;  1NWW A;  1BRH A;  1O7H B;  5RNT A;  2R41 A;  3QRD A;  3X3X A;  1OHP A;  1BUJ A;  2MF7 A;  3MG3 A;  4JF8 A;  3CCQ 3;  4XM4 A;  1UW1 A;  2P0M A;  4GL6 A;  4GB5 A;  1PYL A;  1LOY A;  3HII A;  3SOY A;  1IYY A;  1E3R A;  3J7Y d;  1RSN A;  1BRJ A;  1NB3 I;  2MC8 A;  1AQZ A;  2RFR A;  3FG3 A;  3LT8 A;  5G2G A;  4HBR A;  2OTL 3;  4HZB B;  1IVW A;  4KT3 B;  3F40 A;  3PZW A;  1UGH I;  2XF3 A;  1V58 A;  3OXA A;  3N9H A;  1O7M B;  3DM8 A;  1TFO A;  1TJD A;  3D5I A;  2BIR A;  2UUG C;  1A2K A;  1VQQ A;  3S28 A;  1STD A;  3JUM A;  4Q53 A;  3U97 A;  1I70 A;  3MPH A;  2C4B A;  1OHO A;  4N6T A;  4EXR A;  6GSP A;  2XEP A;  1X1U A;  3NQZ A;  2L1S A;  3H51 A;  4MEI A;  1YVS A;  2HMK B;  2ZHX B;  1RTU A;  2ML6 A;  3WR2 A;  3FKA A;  5AIH A;  4BIR A;  1NDO B;  3NXJ A;  3CC2 3;  2OTJ 3;  5AEW B;  3KN4 A;  2IA7 A;  2WGQ A;  1IDP A;  1X1W A;  1EA2 A;  2HMM B;  3Q1C A;  1BNE A;  2PZV A;  2R4I A;  4TX4 A;  4CCV A;  1A67 A;  4EYC A;  3JUP A;  1VQP 3;  3IPT A;  1FUT A;  3KKG A;  1Q42 A;  1IV7 A;  1VQO 3;  3SVA A;  1UCL A;  4OVM A;  3NBJ A;  1K8A 4;  5IG4 A;  5EQL A;  1OPY A;  4K1U A;  2CH9 A;  3NM2 A;  4LSO A;  5G1K A;  4O8S A;  1TFK A;  1OUN A;  2HML B;  3FG4 A;  1TU5 A;  3EB8 A;  5JPP A;  2GU3 A;  1RGH A;  1GY6 A;  3RNT A;  1LVN A;  1CEW I;  2F99 A;  2K54 A;  1IK3 A;  3LXU X;  1YJ9 3;  5CXO A;  1UUG B;  1W6C A;  1ZGX A;  3DGY A;  1B27 A;  2BMQ B;  3AGN A;  3DXO A;  3FLJ A;  2KF6 A;  1EG9 B;  1ROA A;  1JN5 A;  3OWU A;  4R1K A;  5FW5 A;  4EV2 A;  3CD6 3;  1JN5 B;  2Z6B A;  5IEN A;  5AEU B;  2F5W A;  2W9P A;  2CW9 A;  1BNR A;  3FF2 A;  3CPO A;  1BRI A;  1UCK A;  3A76 A;  1SAR A;  3OV4 A;  4GSP A;  4BTW A;  2JQ5 A;  2OQE C;  4RZM A;  2GBW B;  2W56 B;  3G0K A;  3JVC A;  3F8H A;  1RRL A;  1UI8 A;  1YJW 3;  3LML A;  3I56 3;  2XGL A;  3LTD A;  3PGB A;  1JV2 B;  1MWR A;  4HKV B;  3CPW 2;  3UL6 A;  1BSB A;  1N9J A;  1X1X A;  1JKG B;  2IYJ A;  1EEJ A;  3PCR A;  4N6U A;  2XFS A;  4FMA A;  5BVB A;  5IER A;  3GZB A;  1M9G A;  1BGS A;  1GD4 A;  1D6U A;  1W02 A;  1F8N A;  1W7C A;  1ZS7 A;  1GS3 A;  2HMO B;  1LQM B;  1M1X B;  1R4Y A;  3DY5 A;  3GAX A;  3L0R A;  5CK6 A;  3S67 A;  1SPU A;  1RCL A;  3S27 A;  3V99 A;  1NJI 4;  1KD1 4;  1VQL 3;  1ULI B;  1DMN A;  1FGM A;  3VSY A;  1US1 A;  3D3L A;  3B8L A;  3WMD A;  2FXT A;  3M8C A;  2XR8 B;  2P0X A;  3T0U A;  1BUQ A;  1VZZ A;  4NRE A;  1BU4 A;  1B20 A;  4R9K A;  3ROB A;  1RGL A;  2OWP A;  5A0O B;  1KSI A;  1RGG A;  3NV0 A;  1UGI A;  3LTA A;  3EBY A;  4K90 B;  3NHX A;  3UJM A;  1STF I;  1IVX A;  3LOY A;  1GMR A;  2QGU A;  1WQL B;  3CME 3;  1LOW A;  4XB5 A;  3RGA A;  1JZO A;  1S72 3;  1KWI A;  1AR0 A;  2BHM A;  3AHS A;  5M18 A;  1OF5 B;  1AV4 A;  5M1A A;  1JRQ A;  1E97 A;  5CF1 A;  1BNG A;  3VGN A;  2XFT A;  2YFI B;  3A5E A;  4N6O B;  2KAA A;  5M19 A;  3AMO A;  1FGR A;  2W6J H;  1BRN L;  2ZL8 A;  1N8R 4;  5D81 A;  2Z77 A;  2K3D A;  2XSH B;  1YNV X;  1YVB I;  1UI7 A;  1BVI A;  3MKI A;  6STD A;  3DGM A;  3AGO A;  3BND A;  3LT9 A;  4HM7 B;  4U13 A;  2GXF A;  2CX0 A;  1C7H A;  3MG1 A;  2F86 B;  5LC6 A;  4FCM A;  2OOV A;  3TDG A;  3URP A;  8CHO A;  2IUK A;  3AHW A;  3K63 A;  4KFF A;  4BU4 A;  3F8X A;  1T2H A;  3OWY A;  1B21 A;  1U5O A;  3WA2 X;  1MWS A;  1GSP A;  3BNB A;  3G6E 3;  3PS8 A;  3BU4 A;  1JBT A;  1AVK A;  3GWR A;  3NBB A;  4WP5 A;  4JRF A;  4RNT A;  4WYK B;  1V57 A;  3FZW A;  5JPU A;  3CMA 3;  1JB2 A;  2Y73 A;  3ALA A;  1KQS 2;  5D82 A;  1IQY A;  2D1W A;  4R80 A;  2CFG A;  1N5H A;  1ULJ B;  1ROV A;  1RGC A;  4CDL A;  2H0I A;  1VQ7 3;  1W4N A;  1K73 4;  2E2V A;  1YJN 3;  3RGR A;  3OW2 2;  2HMJ B;  2RBI A;  4O3V A;  1BOX A;  2INX A;  3D9R A;  5FGO A;  4IT7 A;  3G4S 3;  2Y74 A;  1VQK 3;  1G0T A;  1K41 A;  2KCD A;  1AVL A;  4WWU C;  4FMB A;  1GOV A;  1CYU A;  1N9E A;  3DGN A;  1GY5 A;  4HM8 B;  2E2U A;  2CFK A;  3KSE D;  4HM2 B;  4L7K A;  4XDV A;  2SBL A;  2WOF A;  7RNT A;  3FF0 A;  5JBS A;  1DVC A;  2F4Y A;  1CYV A;  2CC3 A;  3SLU A;  3G71 3;  1FGO A;  3EE1 A;  3DZL A;  2BMO B;  3LYG A;  1G96 A;  3ER7 A;  4J9A A;  1SII A;  4RBN A;  1TUH A;  3CU3 A;  2Z7A A;  4STD A;  3UB1 A;  1K9M 4;  1I2G A;  2CWT A;  3I55 3;  1NU3 A;  3F7X A;  1NNV A;  4XBY A;  2LYX A;  5BU4 A;  3ZG0 A;  4HM5 B;  2O3O A;  2RNT A;  3UNL A;  4AEQ A;  1VQN 3;  2BO9 B;  1O7W B;  2A15 A;  3V98 A;  4N6L A;  2BT3 A;  3EHC A;  1ZX2 A;  1EUI C;  3BLZ A;  1MWT A;  2KRT A;  2IY2 A;  4X2O A;  1IT7 A;  3CXC 2;  3CCU 3;  5CF2 A;  1RMS A;  1VQ8 3;  1B2Z A;  3G16 A;  5D83 A;  2CG1 A;  2ZA4 A;  1DET A;  1GOY A;  1RJO A;  2RCD A;  3HK4 A;  2JDI H;  3NQY A;  2ML5 A;  3STD A;  1X1Y A;  1B2M A;  1LNI A;  9RNT A;  1I0V A;  3MYT A;  2OCT A;  2CK3 H; 
#chains in the Genus database with same CATH homology
 4J5K A;  1BRH A;  1BRS A;  1JBR A;  3D4A A;  5RNT A;  1BU4 A;  1B20 A;  1PY3 A;  1RGL A;  5GSP A;  1RGG A;  3GSP A;  1BNI A;  1BAN A;  1B2U A;  1BSD A;  1HYF A;  1I8V A;  1PYL A;  1LOY A;  2F5M A;  1GMR A;  1IYY A;  5HOH A;  1TRQ A;  1LOW A;  1RSN A;  2HOH A;  1BRJ A;  3BIR A;  3DH2 A;  1AQZ A;  2AAD A;  3AHS A;  2KF4 A;  1MGW A;  1TRP A;  1BNG A;  1I3I A;  1T2I A;  2F56 A;  3A5E A;  1RN1 A;  2KAA A;  2GSP A;  1BNJ A;  1RGA A;  1I2E A;  2BIR A;  2BU4 A;  3D5I A;  1C54 A;  1RGF A;  1GOU A;  1YNV X;  1I70 A;  2C4B A;  6GSP A;  1BVI A;  1BSA A;  1FUS A;  1BAO A;  7GSP A;  1X1U A;  3AGO A;  1BUJ A;  3URP A;  1BSC A;  1YVS A;  1HZ1 A;  1RTU A;  3WR2 A;  1BNF A;  3AHW A;  4BIR A;  4BU4 A;  1RLS A;  1T2H A;  1BRN L;  1B21 A;  1JBT A;  4J5G A;  1X1W A;  1B2S A;  1GSP A;  1GMQ A;  3Q3F A;  3BU4 A;  4GHO A;  1BNE A;  4RNT A;  1LOV A;  1RGE A;  3KCH A;  1FUT A;  1FW7 A;  1RCK A;  1A2P A;  1UCL A;  1RGC A;  1BRG A;  1Q9E A;  1JBS A;  1B2X A;  1AY7 A;  2RBI A;  6RNT A;  1BOX A;  1RGK A;  1UCJ A;  1RN4 A;  3SYU A;  1RGH A;  2AAE A;  3RNT A;  1GOV A;  1I3F A;  5BIR A;  1DE3 A;  1BSE A;  1LRA A;  1ZGX A;  1UCI A;  3DGY A;  1B27 A;  3AGN A;  1RNT A;  2KF6 A;  7RNT A;  2F4Y A;  3D5G A;  2KF5 A;  8RNT A;  1RDS A;  1I2F A;  2F5W A;  1I0X A;  1MGR A;  1BNR A;  1BRI A;  1UCK A;  1I2G A;  1SAR A;  4GSP A;  1GMP A;  4HOH A;  5BU4 A;  2SAR A;  2RNT A;  1BNS A;  1BIR A;  1RNB A;  1FZU A;  1CH0 A;  1BSB A;  4HAA A;  1BRK A;  1TTO A;  1X1X A;  1BGS A;  1R4Y A;  1RMS A;  1G02 A;  1B2Z A;  2ZA4 A;  1DET A;  1GOY A;  1RCL A;  1YGW A;  1B3S A;  1B2M A;  1X1Y A;  2KF3 A;  1LNI A;  1RHL A;  9RNT A;  1FYS A;  1I0V A;  3WHO A;  3HOH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...