1R4YA

Solution structure of the deletion mutant delta(7-22) of the cytotoxic ribonuclease alpha-sarcin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
136
structure length
136
Chain Sequence
AVTWTCGGLLYNQNKAESNSHHAPLSDGKTGSSYPHWFTNGYDGDGKLPKGRTPIKFGKSDCDRPPKHSKDGNGKTDHYLLEFPTFPDGHDYKFDSKKPKENPGPARVIYTYPNKVFCGIIAHTKENQGELKLCSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ribonuclease alpha-sarcin
publication title NMR structure of the noncytotoxic {alpha}-sarcin mutant {Delta}(7-22): The importance of the native conformation of peripheral loops for activity.
pubmed doi rcsb
source organism Aspergillus giganteus
total genus 17
structure length 136
sequence length 136
ec nomenclature ec 3.1.27.10: rRNA endonuclease.
pdb deposition date 2003-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1r4yA00
3Q3FA 1FW7A 3BU4A 5BIRA 3KCHA 1BRHA 3AHSA 1FUSA 1T2IA 1BRKA 1I0VA 1AQZA 1UCIA 2SARA 3WHOA 1BGSA 3AHWA 6GSPA 1B3SA 1GOVA 1RNTA 5HOHA 1JBTA 1RNBA 1B20A 1X1WA 1AY7A 1HZ1A 1B2UA 6RNTA 3BIRA 3WR2A 1YGWA 1B21A 4BU4A 1RGEA 1RGKA 1RN4A 7GSPA 1GMRA 1HYFA 4HOHA 1UCLA 4HAAA 1I3IA 1RN1A 1BAOA 1BRIA 2BU4A 1RLSA 1CH0A 1I70A 1RHLA 1RTUA 4BIRA 5RNTA 1SARA 3GSPA 1RGAA 3D4AA 2KAAA 1I2EA 1BVIA 4GHOA 1B2MA 1A2PA 1UCKA 1RMSA 2AAEA 1MGWA 1DE3A 1PYLA 3D5IA 3SYUA 2KF6A 2RNTA 1BSDA 1FZUA 3A5EA 1JBSA 1BSCA 1BRNL 3D5GA 2C4BA 1RCKA 2KF3A 1LNIA 1FUTA 1GMQA 1UCJA 3URPA 1ZGXA 1RDSA 5GSPA 1RGLA 1X1XA 2KF5A 1BNJA 1BSAA 2GSPA 1B2XA 1I2GA 1RGFA 1BSEA 1LOYA 3AGNA 1BNSA 2KF4A 1GMPA 2AADA 1B2ZA 3HOHA 1RGCA 9RNTA 1TRPA 1TRQA 1BNEA 3DH2A 1I2FA 1X1YA 4J5GA 3RNTA 1I3FA 1BRSA 1BOXA 1RGHA 4GSPA 1BNRA 1BSBA 2F4YA 1BANA 1LRAA 1LOVA 4RNTA 1IYYA 1GOUA 1BUJA 2ZA4A 1B2SA 1BIRA 1RSNA 2RBIA 3DGYA 1C54A 1BNGA 1T2HA 1LOWA 2F5MA 1BNIA 1R4YA 1YNVX 2BIRA 3AGOA 1GSPA 1BNFA 7RNTA 1PY3A 1G02A 1RCLA 2F5WA 1YVSA 1I0XA 1B27A 1JBRA 2HOHA 1I8VA 1RGGA 5BU4A 8RNTA 1BRJA 1BRGA 1FYSA 4J5KA 2F56A 1DETA 1BU4A 1TTOA 1X1UA 1Q9EA 1GOYA 1MGRA
chains in the Genus database with same CATH superfamily
1IT8A 1IVVA 1D6ZA 3PCSA 3UL5A 3Q1CA 3D9RA 2CFKA 2OOVC 3LH4A 1J2BA 1OF5A 3KCHA 3AHSA 1OPYA 1O7PB 2IY2A 3CCQ3 3NXJA 3CMA3 3JUPA 4LMIA 1K28A 6GSPA 1CEWI 3EJVA 3NM2A 5M1AA 5HOHA 2CFDA 1PFPA 4XDVA 5AEUB 1RNBA 1YI23 1AY7A 2GU3A 4PEJA 3NQYA 4AEQA 1HZ1A 1B2UA 1Q864 1QVG2 3EX9A 3SX1A 2WOHA 2Q07A 3PXMA 2RFRA 3K5TA 4N6TA 1RGEA 1RGKA 2CWTA 7GSPA 2GBWB 3SVAA 1HYFA 5CLKA 2HMLB 1CYVA 2ZL8A 1EUIC 1TP6A 1M1XB 1YIT3 1UCLA 3N8BA 1I3IA 1RN1A 1N9EA 2ML5A 2BU4A 1QMAA 2HMOB 1Q40A 3FLJA 1VQ73 1TUHA 2LQVA 1CH0A 1RHLA 1NNVA 1S723 3NUVA 4R4KA 1RGAA 4BL3A 1ZO2A 1BVIA 2K54A 4GHOA 2F86B 4GB5A 3EN1B 4EW5A 2F99A 1TFOA 1UCKA 1YGEA 3F7SA 5G1LA 2OQEA 3RDEA 1Q824 2A15A 3F14A 3LMLA 1RJOA 3SYUA 4EBGA 3CC23 2R4IA 1GY7A 2YFLB 1STFI 1FZUA 3NX0A 2W56B 4IT7A 4HM3B 1BSCA 5AEWB 4HM7B 3PYJA 3D5GA 1RCKA 3NM7A 1DVDA 3CC43 1FGRA 1R4CA 3T0UA 3DM8A 1NJI4 5GSPA 4HJLB 4HZBB 1BNJA 1BSAA 1GYBA 2GSPA 1SQWA 3U97A 1N9JA 3FG1A 1YJW3 3DUKA 1IV9A 1LOYA 1OUNA 3OXAA 5AYSC 3O8YA 1DMQA 2BMQB 2HMJB 3X40A 1BNSA 1Z1SA 3B7CA 2KF4A 2W9PA 5KP1A 2XRXB 2CFLA 1KD14 2CFWA 2IYJA 1TRPA 4ILFA 4BL2A 4L8PA 2ZDJA 1BNEA 4FCJA 3IJEB 1ROVA 4FMCA 1X1YA 3FSDA 3RNTA 1NU3A 1I3FA 3BB9A 4HM2B 1ULJB 1BRSA 1RGHA 2CK3H 1VQN3 1BSBA 2F4YA 2INXA 3MG1A 5DRVA 3VSYA 1W6CA 2J8XB 2UUGC 3Q90A 1W2B2 4HM0B 4RNTA 2BMRB 1IYYA 1N5HA 2MF7A 8CHOA 2HMNB 2W9QA 1RSNA 2RBIA 2V1LA 2W03A 2XGNA 2CX1A 3HZPA 2D42A 3WOFB 3FF2A 3OV4A 1LOWA 4G1MB 5AI1A 3VF1A 5IG0A 4N3VA 4N6LA 1UI7A 5EEOA 1GSPA 3N54B 7RNTA 4RZMA 2L1SA 4OUQA 1DVCA 1YIJ3 1G02A 1RCLA 3OWYA 1G0TA 1LXEA 3HX8A 3G0KA 1JBRA 3NV0B 1Y4KA 3A76A 3V98A 4J5KA 2P38A 1FGQA 2Z76A 1U5OA 5HGRA 1X1UA 2P09A 5FGOA 1GOYA 2SBLA 1C7HA 3LTBA 3Q3FA 4J8TA 3BU4A 3EC9A 2CIUA 2XF3A 5LC7A 1IT7A 4LSOA 1ZX2A 5BIRA 3DZLA 1JB5A 3G8ZA 3IPTA 3STDA 1F8NA 4FMBA 1M9GA 1UCIA 3LT8A 3I563 4KFFA 5FW5A 1B3SA 1GOVA 4LEHA 1YHQ3 3M8CA 4J9AA 1RNTA 2Z6BA 3ZG0A 4JF8A 2CWVA 2WGQA 1X1WA 3H3HA 6STDA 1Q814 2BO9B 2O3OA 4MJDA 2IUJA 3MG3A 4R80A 3BIRA 3FGYA 1JB2A 1W01A 3KKGA 1B21A 5DREA 2FGTA 2RCDA 1GMRA 1W00A 2H0GA 1NDOB 4ORLA 3G16A 2CW9A 3F8XA 5IW9A 3DXOA 2I9WA 2E2VA 2Y74A 3AMOA 1RLSA 5AIGA 1VQ93 5RNTA 4BIRA 1W4NA 1SJWA 3FKAA 3GSPA 5D81A 3K7CA 3ALAA 1VQL3 1N5PA 1MWUA 1AVKA 1B2MA 3CCV3 1RMSA 1Q7Y4 4R9LA 2B24B 1IU7A 3MPHA 5LC6A 4MMYB 1UI8A 1V57A 3L0RA 4X2OA 3DGNA 3LTDA 1MNLA 4XBXA 3KN4A 1TFKA 2KF6A 1O7NB 2XGLA 3WA2X 1BSDA 2KXGA 1WMPA 2Z7AA 4XB5A 2OQEC 4R9KA 3GZBA 3AMOB 4GL6A 4HM6B 2HMMB 2RGQA 2H0IA 1BRNL 3PGBA 1QAFA 4NHFA 3SLUA 1LNIA 2CG0A 2PZVA 1JNQA 1FUTA 3OWUA 4O3VA 1UUWB 1DYUA 1RDSA 2W56A 2W0QA 2PNCA 2Z77A 1M1K4 1RGLA 1VQQA 1X1XA 2KF5A 5BVBA 1FUWA 4H3UA 4XM4A 1B2XA 3WOEB 1KWIA 4WYKB 1QVF2 1BSEA 1WQLB 2XFTA 2QIYA 1NB3I 3GRDA 1WTHA 2B1XB 3G6E3 3X3ZA 1UGHI 4NPBA 1V58A 3EBTA 3HOHA 3I553 2D1WA 3CCL3 4K1VA 2GU1A 3QRDA 2P0MA 4FMAA 1VQ53 1TRQA 3F7XA 2H0HA 1IVXA 3DH2A 4BTXA 1OHOA 2OWPA 1L5GB 3FCSB 4J5GA 4EXRA 1V74A 1GY5A 3BNBA 1VZZA 5D83A 1BOXA 1BNRA 3J7Yd 4HM5B 5G2GA 2CH9A 2GBXB 1BANA 1EKMA 1QAKA 3K9MC 2GEYA 2ZA4A 5EVHA 4EV2A 2CHCA 2BNGA 3HIIA 1T2HA 1UUVB 4L8OA 4U13A 1R4YA 2BIRA 1HKXA 1MWSA 1UUGB 1PY3A 1LQMB 4IIAA 2W2CA 5JPPA 2F5WA 4LYLB 1YVSA 1I0XA 1MOLA 3FH1A 1FA3A 2XSHB 1A2KA 3HK4A 5EQLA 4WWUC 3HIGA 4FR9A 2XSOB 1BRGA 1PU4A 3CNMA 1YJN3 2F56A 3T8UA 3DY5A 3EB8A 3CCR3 3LTAA 1JKGB 4XBYA 1JV2B 4MMXB 5D82A 3NQZA 4FMDA 4XBTA 3NV0A 1AV4A 3UB1A 1FW7A 3ZFZA 1EEJA 2P0XA 1GY6A 3JVCA 4TX4A 1IQXA 3KE7A 1OHSA 1FUSA 2E2TA 1T2IA 1BRKA 2GEXA 1M904 3AHWA 1WMNA 4KZ1A 5G1KA 1VQP3 2YX9A 3TDGA 3KFQC 4NREA 2KRTA 5CF1A 2OTL3 2CC3A 3LZAA 4O2HA 3WR2A 1VQO3 3KSPA 1A2VA 1RN4A 3UNLA 1OGZA 1EG9B 3OW22 3ZG5A 4HOHA 2C11A 2STDA 3LOYA 1OCVA 1S5AA 1FGMA 2IUKA 4XDWA 1EQKA 2QGUA 1BAOA 3Q2PA 1UDII 1NO3A 4HYZA 3RGRA 4N6V0 1RTUA 1JN5A 4K1UA 5CXOA 3EBYA 2W6JH 1I2EA 1RKYA 3LT9A 3B4PA 3K63A 1Q42A 1A2PA 3D3LA 2K3DA 5I97A 2XR8B 2YFJB 4IPBA 4Q53A 4I5QA 5AIHA 4EYCA 2WO0A 1PYLA 4O8SA 3V99A 2RNTA 1ZS7A 3CNXA 1IQ8A 1O7WB 3A5EA 3E99A 3X3XA 3SEDA 1E97A 5JPUA 1LVNA 1U8CB 4N6MA 2XEPA 4AKZA 5M19A 2C4BA 2KF3A 1JN5B 3F8HA 5IENA 2XFSA 1GMQA 3URPA 3SXXA 1ZGXA 3BNDA 2BT3A 4WP5A 1IDPA 2CFGA 1N8QA 2CG1A 1YJ93 2CX0A 1E3VA 2JDIH 3DMCA 4OVMA 1I2GA 4QWTA 4CJNA 1T5YA 4LZIA 3MSOA 3CXC2 1ROAA 2UGIA 1UW1A 3AGNA 4H61A 4LGQA 4MEIA 2R41A 5JBSA 1O7GB 3EE1A 3PZWA 5IERA 1RGCA 1D6UA 4WYKA 2GXFA 5IEOA 3RGAA 3S5CA 3SOYA 5IG4A 1KQS2 1I2FA 3LYGA 3CU3A 3EQQB 3V92A 3WMDA 1JJ22 3S28A 1OHPA 3I0YA 5A0OB 2K0MA 1LOVA 3CCJ3 3FG3A 3EN8A 1TJDA 5IG5A 3X3YA 5IF6A 4WHAA 1BUJA 1B2SA 4N6NB 3CPOA 2QEX3 3K0ZA 3JUMA 3WDGB 1BNGA 1OACA 2F5MA 1BNIA 2WOFA 4CDLA 3CCS3 2RSXA 2BHMA 2L4VA 3JUOA 2KCDA 5TGNA 3GAXA 1IVWA 4JRFA 5ELJA 1SIHA 3LTCA 1DMNA 1TU5A 4HM8B 2O9UX 3GZRA 3MYTA 3WODG 3BLZA 1K734 5BXQA 1GS3A 2ML6A 1W5ZA 1VQ83 1I8VA 1NWWA 2C10A 5BU4A 2M7OA 1OGXA 1BRJA 4FCMA 1W7CA 1FYSA 5M18A 1OF5B 1BU4A 1TTOA 1LQGC 2OOVA 1Q9EA 1K8A4 3PCRA 1EA2A 1QALA 5KP4A 4HBRA 1US1A 1SIIA 4O02B 3F40A 1BUQA 4N6UA 4BTWA 2P05A 3MKIA 3U1WA 1BRHA 1JZOA 1JKGA 2SARA 1I0VA 1AQZA 1KSIA 2IA7A 3VGNA 1BGSA 3WHOA 3G713 2W04A 1K9M4 3MHEA 3BNEA 3OWSA 1MWRA 5ELUA 5STDA 5IEPA 1G96A 2FNQA 5AIIA 3EHCA 4HZ9B 5IG3A 2IMJA 5AYRB 1VQM3 3FZWA 3HI7A 1JBTA 1IVUA 4DKIA 1NB5I 1B20A 4KVHA 4K61A 1O7HB 1T3BA 6RNTA 3SOAA 3X42A 1YGWA 3ER7A 3F9SA 4R1KA 3ROBA 3S27A 4BU4A 3CC73 1Q40B 1AVLA 3JUNA 7STDA 3GWRA 3H51A 3FG4A 1JRQA 1GD3A 4HAAA 4HM4B 3DGOA 1BRIA 1A90A 3CME3 4ZM8A 1I70A 1HU9A 1SARA 1TIJA 3GZYB 3D4AA 2KAAA 3OX9A 2FXTA 3CCU3 3NBJA 4K90B 2LYXA 1FGOA 2CWUA 2AAEA 1K41A 4MMZB 3CCM3 1A67A 1W2ZA 1MGWA 1DE3A 1VQ43 3N9HA 3D5IA 3G4S3 3T8NA 3PS8A 1WNHA 4CPKA 3WA3A 1SPUA 4FCZA 4I4KA 1KC84 4HVNA 1VQ63 4KFEA 3S67A 4BTYA 1JBSA 2CKFB 2QA43 2Y73A 3KIIA 3MG2A 1LOXA 1CYUA 2HMKB 1UCJA 3KSED 3B8LA 4N6OB 4OK0A 1FGTA 1C54A 2YFIB 4WFOA 4KFDA 3NBBA 5KP3A 1AR0A 3UJMA 3D79A 2XH9A 1CQSA 5CK6A 3X41A 4HM1B 3UL6A 1LNHA 1RGFA 3FF0A 1D6YA 1GD4A 1YVBI 4RNYA 1IQYA 2ZHXB 1MWTA 1GMPA 2E2UA 1UGIA 2AADA 3JUQA 1B2ZA 3DGLA 4CCVA 1RRLA 9RNTA 3CCE3 1STDA 2OCTA 1JZDA 4HKVB 3CD63 4EC6A 4L7KA 1Q7HA 3IMAB 1ULIB 4X2HA 2WGOA 1IV7A 3NHXA 4GSPA 4EV5A 1WMOA 1N8R4 1W02A 1VQK3 1IK3A 1OH0A 3QK9A 1LRAA 2JQ5A 4KT3B 1W6GA 1O7MB 1DMMA 1GOUA 3ECFA 3GZXB 1BIRA 1RN7A 2BMOB 5AIFA 3DGYA 1ISKA 1QJGA 3EF8A 2F98A 2MC8A 3NBRA 4STDA 1YNVX 3AGOA 1JB4A 3KZTA 3S29A 3MWZA 1BNFA 3DGMA 1E3RA 2OTJ3 1B27A 2UX0A 2HOHA 5CF2A 1RGGA 3BNCA 3LXUX 8RNTA 3CPW2 1DETA 4RBNA 1W6YA 4AKYA 1ASKA 3B4OA 4RNZA 1RRHA 1MGRA
chains in the Genus database with same CATH topology
3Q3FA 1FW7A 3BU4A 5BIRA 3KCHA 1BRHA 3AHSA 1FUSA 1T2IA 1BRKA 1I0VA 1AQZA 1UCIA 2SARA 3WHOA 1BGSA 3AHWA 6GSPA 1B3SA 1GOVA 1RNTA 5HOHA 1JBTA 1RNBA 1B20A 1X1WA 1AY7A 1HZ1A 1B2UA 6RNTA 3BIRA 3WR2A 1YGWA 1B21A 4BU4A 1RGEA 1RGKA 1RN4A 7GSPA 1GMRA 1HYFA 4HOHA 1UCLA 4HAAA 1I3IA 1RN1A 1BAOA 1BRIA 2BU4A 1RLSA 1CH0A 1I70A 1RHLA 1RTUA 4BIRA 5RNTA 1SARA 3GSPA 1RGAA 3D4AA 2KAAA 1I2EA 1BVIA 4GHOA 1B2MA 1A2PA 1UCKA 1RMSA 2AAEA 1MGWA 1DE3A 1PYLA 3D5IA 3SYUA 2KF6A 2RNTA 1BSDA 1FZUA 3A5EA 1JBSA 1BSCA 1BRNL 3D5GA 2C4BA 1RCKA 2KF3A 1LNIA 1FUTA 1GMQA 1UCJA 3URPA 1ZGXA 1RDSA 5GSPA 1RGLA 1X1XA 2KF5A 1BNJA 1BSAA 2GSPA 1B2XA 1I2GA 1RGFA 1BSEA 1LOYA 3AGNA 1BNSA 2KF4A 1GMPA 2AADA 1B2ZA 3HOHA 1RGCA 9RNTA 1TRPA 1TRQA 1BNEA 3DH2A 1I2FA 1X1YA 4J5GA 3RNTA 1I3FA 1BRSA 1BOXA 1RGHA 4GSPA 1BNRA 1BSBA 2F4YA 1BANA 1LRAA 1LOVA 4RNTA 1IYYA 1GOUA 1BUJA 2ZA4A 1B2SA 1BIRA 1RSNA 2RBIA 3DGYA 1C54A 1BNGA 1T2HA 1LOWA 2F5MA 1BNIA 1R4YA 1YNVX 2BIRA 3AGOA 1GSPA 1BNFA 7RNTA 1PY3A 1G02A 1RCLA 2F5WA 1YVSA 1I0XA 1B27A 1JBRA 2HOHA 1I8VA 1RGGA 5BU4A 8RNTA 1BRJA 1BRGA 1FYSA 4J5KA 2F56A 1DETA 1BU4A 1TTOA 1X1UA 1Q9EA 1GOYA 1MGRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q3F A;  1FW7 A;  3BU4 A;  5BIR A;  3KCH A;  1BRH A;  3AHS A;  1FUS A;  1T2I A;  1BRK A;  1I0V A;  1AQZ A;  1UCI A;  2SAR A;  3WHO A;  1BGS A;  3AHW A;  6GSP A;  1B3S A;  1GOV A;  1RNT A;  5HOH A;  1JBT A;  1RNB A;  1B20 A;  1X1W A;  1AY7 A;  1HZ1 A;  1B2U A;  6RNT A;  3BIR A;  3WR2 A;  1YGW A;  1B21 A;  4BU4 A;  1RGE A;  1RGK A;  1RN4 A;  7GSP A;  1GMR A;  1HYF A;  4HOH A;  1UCL A;  4HAA A;  1I3I A;  1RN1 A;  1BAO A;  1BRI A;  2BU4 A;  1RLS A;  1CH0 A;  1I70 A;  1RHL A;  1RTU A;  4BIR A;  5RNT A;  1SAR A;  3GSP A;  1RGA A;  3D4A A;  2KAA A;  1I2E A;  1BVI A;  4GHO A;  1B2M A;  1A2P A;  1UCK A;  1RMS A;  2AAE A;  1MGW A;  1DE3 A;  1PYL A;  3D5I A;  3SYU A;  2KF6 A;  2RNT A;  1BSD A;  1FZU A;  3A5E A;  1JBS A;  1BSC A;  1BRN L;  3D5G A;  2C4B A;  1RCK A;  2KF3 A;  1LNI A;  1FUT A;  1GMQ A;  1UCJ A;  3URP A;  1ZGX A;  1RDS A;  5GSP A;  1RGL A;  1X1X A;  2KF5 A;  1BNJ A;  1BSA A;  2GSP A;  1B2X A;  1I2G A;  1RGF A;  1BSE A;  1LOY A;  3AGN A;  1BNS A;  2KF4 A;  1GMP A;  2AAD A;  1B2Z A;  3HOH A;  1RGC A;  9RNT A;  1TRP A;  1TRQ A;  1BNE A;  3DH2 A;  1I2F A;  1X1Y A;  4J5G A;  3RNT A;  1I3F A;  1BRS A;  1BOX A;  1RGH A;  4GSP A;  1BNR A;  1BSB A;  2F4Y A;  1BAN A;  1LRA A;  1LOV A;  4RNT A;  1IYY A;  1GOU A;  1BUJ A;  2ZA4 A;  1B2S A;  1BIR A;  1RSN A;  2RBI A;  3DGY A;  1C54 A;  1BNG A;  1T2H A;  1LOW A;  2F5M A;  1BNI A;  1R4Y A;  1YNV X;  2BIR A;  3AGO A;  1GSP A;  1BNF A;  7RNT A;  1PY3 A;  1G02 A;  1RCL A;  2F5W A;  1YVS A;  1I0X A;  1B27 A;  1JBR A;  2HOH A;  1I8V A;  1RGG A;  5BU4 A;  8RNT A;  1BRJ A;  1BRG A;  1FYS A;  4J5K A;  2F56 A;  1DET A;  1BU4 A;  1TTO A;  1X1U A;  1Q9E A;  1GOY A;  1MGR A; 
#chains in the Genus database with same CATH topology
 1IT8 A;  1IVV A;  1D6Z A;  3PCS A;  3UL5 A;  3Q1C A;  3D9R A;  2CFK A;  2OOV C;  3LH4 A;  1J2B A;  1OF5 A;  3KCH A;  3AHS A;  1OPY A;  1O7P B;  2IY2 A;  3CCQ 3;  3NXJ A;  3CMA 3;  3JUP A;  4LMI A;  1K28 A;  6GSP A;  1CEW I;  3EJV A;  3NM2 A;  5M1A A;  5HOH A;  2CFD A;  1PFP A;  4XDV A;  5AEU B;  1RNB A;  1YI2 3;  1AY7 A;  2GU3 A;  4PEJ A;  3NQY A;  4AEQ A;  1HZ1 A;  1B2U A;  1Q86 4;  1QVG 2;  3EX9 A;  3SX1 A;  2WOH A;  2Q07 A;  3PXM A;  2RFR A;  3K5T A;  4N6T A;  1RGE A;  1RGK A;  2CWT A;  7GSP A;  2GBW B;  3SVA A;  1HYF A;  5CLK A;  2HML B;  1CYV A;  2ZL8 A;  1EUI C;  1TP6 A;  1M1X B;  1YIT 3;  1UCL A;  3N8B A;  1I3I A;  1RN1 A;  1N9E A;  2ML5 A;  2BU4 A;  1QMA A;  2HMO B;  1Q40 A;  3FLJ A;  1VQ7 3;  1TUH A;  2LQV A;  1CH0 A;  1RHL A;  1NNV A;  1S72 3;  3NUV A;  4R4K A;  1RGA A;  4BL3 A;  1ZO2 A;  1BVI A;  2K54 A;  4GHO A;  2F86 B;  4GB5 A;  3EN1 B;  4EW5 A;  2F99 A;  1TFO A;  1UCK A;  1YGE A;  3F7S A;  5G1L A;  2OQE A;  3RDE A;  1Q82 4;  2A15 A;  3F14 A;  3LML A;  1RJO A;  3SYU A;  4EBG A;  3CC2 3;  2R4I A;  1GY7 A;  2YFL B;  1STF I;  1FZU A;  3NX0 A;  2W56 B;  4IT7 A;  4HM3 B;  1BSC A;  5AEW B;  4HM7 B;  3PYJ A;  3D5G A;  1RCK A;  3NM7 A;  1DVD A;  3CC4 3;  1FGR A;  1R4C A;  3T0U A;  3DM8 A;  1NJI 4;  5GSP A;  4HJL B;  4HZB B;  1BNJ A;  1BSA A;  1GYB A;  2GSP A;  1SQW A;  3U97 A;  1N9J A;  3FG1 A;  1YJW 3;  3DUK A;  1IV9 A;  1LOY A;  1OUN A;  3OXA A;  5AYS C;  3O8Y A;  1DMQ A;  2BMQ B;  2HMJ B;  3X40 A;  1BNS A;  1Z1S A;  3B7C A;  2KF4 A;  2W9P A;  5KP1 A;  2XRX B;  2CFL A;  1KD1 4;  2CFW A;  2IYJ A;  1TRP A;  4ILF A;  4BL2 A;  4L8P A;  2ZDJ A;  1BNE A;  4FCJ A;  3IJE B;  1ROV A;  4FMC A;  1X1Y A;  3FSD A;  3RNT A;  1NU3 A;  1I3F A;  3BB9 A;  4HM2 B;  1ULJ B;  1BRS A;  1RGH A;  2CK3 H;  1VQN 3;  1BSB A;  2F4Y A;  2INX A;  3MG1 A;  5DRV A;  3VSY A;  1W6C A;  2J8X B;  2UUG C;  3Q90 A;  1W2B 2;  4HM0 B;  4RNT A;  2BMR B;  1IYY A;  1N5H A;  2MF7 A;  8CHO A;  2HMN B;  2W9Q A;  1RSN A;  2RBI A;  2V1L A;  2W03 A;  2XGN A;  2CX1 A;  3HZP A;  2D42 A;  3WOF B;  3FF2 A;  3OV4 A;  1LOW A;  4G1M B;  5AI1 A;  3VF1 A;  5IG0 A;  4N3V A;  4N6L A;  1UI7 A;  5EEO A;  1GSP A;  3N54 B;  7RNT A;  4RZM A;  2L1S A;  4OUQ A;  1DVC A;  1YIJ 3;  1G02 A;  1RCL A;  3OWY A;  1G0T A;  1LXE A;  3HX8 A;  3G0K A;  1JBR A;  3NV0 B;  1Y4K A;  3A76 A;  3V98 A;  4J5K A;  2P38 A;  1FGQ A;  2Z76 A;  1U5O A;  5HGR A;  1X1U A;  2P09 A;  5FGO A;  1GOY A;  2SBL A;  1C7H A;  3LTB A;  3Q3F A;  4J8T A;  3BU4 A;  3EC9 A;  2CIU A;  2XF3 A;  5LC7 A;  1IT7 A;  4LSO A;  1ZX2 A;  5BIR A;  3DZL A;  1JB5 A;  3G8Z A;  3IPT A;  3STD A;  1F8N A;  4FMB A;  1M9G A;  1UCI A;  3LT8 A;  3I56 3;  4KFF A;  5FW5 A;  1B3S A;  1GOV A;  4LEH A;  1YHQ 3;  3M8C A;  4J9A A;  1RNT A;  2Z6B A;  3ZG0 A;  4JF8 A;  2CWV A;  2WGQ A;  1X1W A;  3H3H A;  6STD A;  1Q81 4;  2BO9 B;  2O3O A;  4MJD A;  2IUJ A;  3MG3 A;  4R80 A;  3BIR A;  3FGY A;  1JB2 A;  1W01 A;  3KKG A;  1B21 A;  5DRE A;  2FGT A;  2RCD A;  1GMR A;  1W00 A;  2H0G A;  1NDO B;  4ORL A;  3G16 A;  2CW9 A;  3F8X A;  5IW9 A;  3DXO A;  2I9W A;  2E2V A;  2Y74 A;  3AMO A;  1RLS A;  5AIG A;  1VQ9 3;  5RNT A;  4BIR A;  1W4N A;  1SJW A;  3FKA A;  3GSP A;  5D81 A;  3K7C A;  3ALA A;  1VQL 3;  1N5P A;  1MWU A;  1AVK A;  1B2M A;  3CCV 3;  1RMS A;  1Q7Y 4;  4R9L A;  2B24 B;  1IU7 A;  3MPH A;  5LC6 A;  4MMY B;  1UI8 A;  1V57 A;  3L0R A;  4X2O A;  3DGN A;  3LTD A;  1MNL A;  4XBX A;  3KN4 A;  1TFK A;  2KF6 A;  1O7N B;  2XGL A;  3WA2 X;  1BSD A;  2KXG A;  1WMP A;  2Z7A A;  4XB5 A;  2OQE C;  4R9K A;  3GZB A;  3AMO B;  4GL6 A;  4HM6 B;  2HMM B;  2RGQ A;  2H0I A;  1BRN L;  3PGB A;  1QAF A;  4NHF A;  3SLU A;  1LNI A;  2CG0 A;  2PZV A;  1JNQ A;  1FUT A;  3OWU A;  4O3V A;  1UUW B;  1DYU A;  1RDS A;  2W56 A;  2W0Q A;  2PNC A;  2Z77 A;  1M1K 4;  1RGL A;  1VQQ A;  1X1X A;  2KF5 A;  5BVB A;  1FUW A;  4H3U A;  4XM4 A;  1B2X A;  3WOE B;  1KWI A;  4WYK B;  1QVF 2;  1BSE A;  1WQL B;  2XFT A;  2QIY A;  1NB3 I;  3GRD A;  1WTH A;  2B1X B;  3G6E 3;  3X3Z A;  1UGH I;  4NPB A;  1V58 A;  3EBT A;  3HOH A;  3I55 3;  2D1W A;  3CCL 3;  4K1V A;  2GU1 A;  3QRD A;  2P0M A;  4FMA A;  1VQ5 3;  1TRQ A;  3F7X A;  2H0H A;  1IVX A;  3DH2 A;  4BTX A;  1OHO A;  2OWP A;  1L5G B;  3FCS B;  4J5G A;  4EXR A;  1V74 A;  1GY5 A;  3BNB A;  1VZZ A;  5D83 A;  1BOX A;  1BNR A;  3J7Y d;  4HM5 B;  5G2G A;  2CH9 A;  2GBX B;  1BAN A;  1EKM A;  1QAK A;  3K9M C;  2GEY A;  2ZA4 A;  5EVH A;  4EV2 A;  2CHC A;  2BNG A;  3HII A;  1T2H A;  1UUV B;  4L8O A;  4U13 A;  1R4Y A;  2BIR A;  1HKX A;  1MWS A;  1UUG B;  1PY3 A;  1LQM B;  4IIA A;  2W2C A;  5JPP A;  2F5W A;  4LYL B;  1YVS A;  1I0X A;  1MOL A;  3FH1 A;  1FA3 A;  2XSH B;  1A2K A;  3HK4 A;  5EQL A;  4WWU C;  3HIG A;  4FR9 A;  2XSO B;  1BRG A;  1PU4 A;  3CNM A;  1YJN 3;  2F56 A;  3T8U A;  3DY5 A;  3EB8 A;  3CCR 3;  3LTA A;  1JKG B;  4XBY A;  1JV2 B;  4MMX B;  5D82 A;  3NQZ A;  4FMD A;  4XBT A;  3NV0 A;  1AV4 A;  3UB1 A;  1FW7 A;  3ZFZ A;  1EEJ A;  2P0X A;  1GY6 A;  3JVC A;  4TX4 A;  1IQX A;  3KE7 A;  1OHS A;  1FUS A;  2E2T A;  1T2I A;  1BRK A;  2GEX A;  1M90 4;  3AHW A;  1WMN A;  4KZ1 A;  5G1K A;  1VQP 3;  2YX9 A;  3TDG A;  3KFQ C;  4NRE A;  2KRT A;  5CF1 A;  2OTL 3;  2CC3 A;  3LZA A;  4O2H A;  3WR2 A;  1VQO 3;  3KSP A;  1A2V A;  1RN4 A;  3UNL A;  1OGZ A;  1EG9 B;  3OW2 2;  3ZG5 A;  4HOH A;  2C11 A;  2STD A;  3LOY A;  1OCV A;  1S5A A;  1FGM A;  2IUK A;  4XDW A;  1EQK A;  2QGU A;  1BAO A;  3Q2P A;  1UDI I;  1NO3 A;  4HYZ A;  3RGR A;  4N6V 0;  1RTU A;  1JN5 A;  4K1U A;  5CXO A;  3EBY A;  2W6J H;  1I2E A;  1RKY A;  3LT9 A;  3B4P A;  3K63 A;  1Q42 A;  1A2P A;  3D3L A;  2K3D A;  5I97 A;  2XR8 B;  2YFJ B;  4IPB A;  4Q53 A;  4I5Q A;  5AIH A;  4EYC A;  2WO0 A;  1PYL A;  4O8S A;  3V99 A;  2RNT A;  1ZS7 A;  3CNX A;  1IQ8 A;  1O7W B;  3A5E A;  3E99 A;  3X3X A;  3SED A;  1E97 A;  5JPU A;  1LVN A;  1U8C B;  4N6M A;  2XEP A;  4AKZ A;  5M19 A;  2C4B A;  2KF3 A;  1JN5 B;  3F8H A;  5IEN A;  2XFS A;  1GMQ A;  3URP A;  3SXX A;  1ZGX A;  3BND A;  2BT3 A;  4WP5 A;  1IDP A;  2CFG A;  1N8Q A;  2CG1 A;  1YJ9 3;  2CX0 A;  1E3V A;  2JDI H;  3DMC A;  4OVM A;  1I2G A;  4QWT A;  4CJN A;  1T5Y A;  4LZI A;  3MSO A;  3CXC 2;  1ROA A;  2UGI A;  1UW1 A;  3AGN A;  4H61 A;  4LGQ A;  4MEI A;  2R41 A;  5JBS A;  1O7G B;  3EE1 A;  3PZW A;  5IER A;  1RGC A;  1D6U A;  4WYK A;  2GXF A;  5IEO A;  3RGA A;  3S5C A;  3SOY A;  5IG4 A;  1KQS 2;  1I2F A;  3LYG A;  3CU3 A;  3EQQ B;  3V92 A;  3WMD A;  1JJ2 2;  3S28 A;  1OHP A;  3I0Y A;  5A0O B;  2K0M A;  1LOV A;  3CCJ 3;  3FG3 A;  3EN8 A;  1TJD A;  5IG5 A;  3X3Y A;  5IF6 A;  4WHA A;  1BUJ A;  1B2S A;  4N6N B;  3CPO A;  2QEX 3;  3K0Z A;  3JUM A;  3WDG B;  1BNG A;  1OAC A;  2F5M A;  1BNI A;  2WOF A;  4CDL A;  3CCS 3;  2RSX A;  2BHM A;  2L4V A;  3JUO A;  2KCD A;  5TGN A;  3GAX A;  1IVW A;  4JRF A;  5ELJ A;  1SIH A;  3LTC A;  1DMN A;  1TU5 A;  4HM8 B;  2O9U X;  3GZR A;  3MYT A;  3WOD G;  3BLZ A;  1K73 4;  5BXQ A;  1GS3 A;  2ML6 A;  1W5Z A;  1VQ8 3;  1I8V A;  1NWW A;  2C10 A;  5BU4 A;  2M7O A;  1OGX A;  1BRJ A;  4FCM A;  1W7C A;  1FYS A;  5M18 A;  1OF5 B;  1BU4 A;  1TTO A;  1LQG C;  2OOV A;  1Q9E A;  1K8A 4;  3PCR A;  1EA2 A;  1QAL A;  5KP4 A;  4HBR A;  1US1 A;  1SII A;  4O02 B;  3F40 A;  1BUQ A;  4N6U A;  4BTW A;  2P05 A;  3MKI A;  3U1W A;  1BRH A;  1JZO A;  1JKG A;  2SAR A;  1I0V A;  1AQZ A;  1KSI A;  2IA7 A;  3VGN A;  1BGS A;  3WHO A;  3G71 3;  2W04 A;  1K9M 4;  3MHE A;  3BNE A;  3OWS A;  1MWR A;  5ELU A;  5STD A;  5IEP A;  1G96 A;  2FNQ A;  5AII A;  3EHC A;  4HZ9 B;  5IG3 A;  2IMJ A;  5AYR B;  1VQM 3;  3FZW A;  3HI7 A;  1JBT A;  1IVU A;  4DKI A;  1NB5 I;  1B20 A;  4KVH A;  4K61 A;  1O7H B;  1T3B A;  6RNT A;  3SOA A;  3X42 A;  1YGW A;  3ER7 A;  3F9S A;  4R1K A;  3ROB A;  3S27 A;  4BU4 A;  3CC7 3;  1Q40 B;  1AVL A;  3JUN A;  7STD A;  3GWR A;  3H51 A;  3FG4 A;  1JRQ A;  1GD3 A;  4HAA A;  4HM4 B;  3DGO A;  1BRI A;  1A90 A;  3CME 3;  4ZM8 A;  1I70 A;  1HU9 A;  1SAR A;  1TIJ A;  3GZY B;  3D4A A;  2KAA A;  3OX9 A;  2FXT A;  3CCU 3;  3NBJ A;  4K90 B;  2LYX A;  1FGO A;  2CWU A;  2AAE A;  1K41 A;  4MMZ B;  3CCM 3;  1A67 A;  1W2Z A;  1MGW A;  1DE3 A;  1VQ4 3;  3N9H A;  3D5I A;  3G4S 3;  3T8N A;  3PS8 A;  1WNH A;  4CPK A;  3WA3 A;  1SPU A;  4FCZ A;  4I4K A;  1KC8 4;  4HVN A;  1VQ6 3;  4KFE A;  3S67 A;  4BTY A;  1JBS A;  2CKF B;  2QA4 3;  2Y73 A;  3KII A;  3MG2 A;  1LOX A;  1CYU A;  2HMK B;  1UCJ A;  3KSE D;  3B8L A;  4N6O B;  4OK0 A;  1FGT A;  1C54 A;  2YFI B;  4WFO A;  4KFD A;  3NBB A;  5KP3 A;  1AR0 A;  3UJM A;  3D79 A;  2XH9 A;  1CQS A;  5CK6 A;  3X41 A;  4HM1 B;  3UL6 A;  1LNH A;  1RGF A;  3FF0 A;  1D6Y A;  1GD4 A;  1YVB I;  4RNY A;  1IQY A;  2ZHX B;  1MWT A;  1GMP A;  2E2U A;  1UGI A;  2AAD A;  3JUQ A;  1B2Z A;  3DGL A;  4CCV A;  1RRL A;  9RNT A;  3CCE 3;  1STD A;  2OCT A;  1JZD A;  4HKV B;  3CD6 3;  4EC6 A;  4L7K A;  1Q7H A;  3IMA B;  1ULI B;  4X2H A;  2WGO A;  1IV7 A;  3NHX A;  4GSP A;  4EV5 A;  1WMO A;  1N8R 4;  1W02 A;  1VQK 3;  1IK3 A;  1OH0 A;  3QK9 A;  1LRA A;  2JQ5 A;  4KT3 B;  1W6G A;  1O7M B;  1DMM A;  1GOU A;  3ECF A;  3GZX B;  1BIR A;  1RN7 A;  2BMO B;  5AIF A;  3DGY A;  1ISK A;  1QJG A;  3EF8 A;  2F98 A;  2MC8 A;  3NBR A;  4STD A;  1YNV X;  3AGO A;  1JB4 A;  3KZT A;  3S29 A;  3MWZ A;  1BNF A;  3DGM A;  1E3R A;  2OTJ 3;  1B27 A;  2UX0 A;  2HOH A;  5CF2 A;  1RGG A;  3BNC A;  3LXU X;  8RNT A;  3CPW 2;  1DET A;  4RBN A;  1W6Y A;  4AKY A;  1ASK A;  3B4O A;  4RNZ A;  1RRH A;  1MGR A; 
#chains in the Genus database with same CATH homology
 3Q3F A;  1FW7 A;  3BU4 A;  5BIR A;  3KCH A;  1BRH A;  3AHS A;  1FUS A;  1T2I A;  1BRK A;  1I0V A;  1AQZ A;  1UCI A;  2SAR A;  3WHO A;  1BGS A;  3AHW A;  6GSP A;  1B3S A;  1GOV A;  1RNT A;  5HOH A;  1JBT A;  1RNB A;  1B20 A;  1X1W A;  1AY7 A;  1HZ1 A;  1B2U A;  6RNT A;  3BIR A;  3WR2 A;  1YGW A;  1B21 A;  4BU4 A;  1RGE A;  1RGK A;  1RN4 A;  7GSP A;  1GMR A;  1HYF A;  4HOH A;  1UCL A;  4HAA A;  1I3I A;  1RN1 A;  1BAO A;  1BRI A;  2BU4 A;  1RLS A;  1CH0 A;  1I70 A;  1RHL A;  1RTU A;  4BIR A;  5RNT A;  1SAR A;  3GSP A;  1RGA A;  3D4A A;  2KAA A;  1I2E A;  1BVI A;  4GHO A;  1B2M A;  1A2P A;  1UCK A;  1RMS A;  2AAE A;  1MGW A;  1DE3 A;  1PYL A;  3D5I A;  3SYU A;  2KF6 A;  2RNT A;  1BSD A;  1FZU A;  3A5E A;  1JBS A;  1BSC A;  1BRN L;  3D5G A;  2C4B A;  1RCK A;  2KF3 A;  1LNI A;  1FUT A;  1GMQ A;  1UCJ A;  3URP A;  1ZGX A;  1RDS A;  5GSP A;  1RGL A;  1X1X A;  2KF5 A;  1BNJ A;  1BSA A;  2GSP A;  1B2X A;  1I2G A;  1RGF A;  1BSE A;  1LOY A;  3AGN A;  1BNS A;  2KF4 A;  1GMP A;  2AAD A;  1B2Z A;  3HOH A;  1RGC A;  9RNT A;  1TRP A;  1TRQ A;  1BNE A;  3DH2 A;  1I2F A;  1X1Y A;  4J5G A;  3RNT A;  1I3F A;  1BRS A;  1BOX A;  1RGH A;  4GSP A;  1BNR A;  1BSB A;  2F4Y A;  1BAN A;  1LRA A;  1LOV A;  4RNT A;  1IYY A;  1GOU A;  1BUJ A;  2ZA4 A;  1B2S A;  1BIR A;  1RSN A;  2RBI A;  3DGY A;  1C54 A;  1BNG A;  1T2H A;  1LOW A;  2F5M A;  1BNI A;  1R4Y A;  1YNV X;  2BIR A;  3AGO A;  1GSP A;  1BNF A;  7RNT A;  1PY3 A;  1G02 A;  1RCL A;  2F5W A;  1YVS A;  1I0X A;  1B27 A;  1JBR A;  2HOH A;  1I8V A;  1RGG A;  5BU4 A;  8RNT A;  1BRJ A;  1BRG A;  1FYS A;  4J5K A;  2F56 A;  1DET A;  1BU4 A;  1TTO A;  1X1U A;  1Q9E A;  1GOY A;  1MGR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...