1BNSA

Structural studies of barnase mutants
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYIAKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Contribution of buried hydrogen bonds to protein stability. The crystal structures of two barnase mutants.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Endonuclease
molecule keywords BARNASE
total genus 30
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 1994-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1bnsA00
8RNTA 2KF6A 1TRQA 1BSCA 1MGWA 1X1XA 2BU4A 1I0XA 1B2ZA 1RSNA 1BUJA 1C54A 1RMSA 1BRSA 1DETA 1RGHA 1TRPA 1LOVA 1MGRA 1AY7A 1BU4A 3RNTA 1RHLA 1X1WA 1B3SA 3D5IA 1BSEA 1T2IA 1GOVA 5RNTA 1RGGA 1YGWA 3AGNA 5GSPA 1TTOA 1YVSA 1PY3A 2RBIA 5BU4A 3URPA 4J5KA 2F5MA 1I0VA 5BIRA 1GOYA 3BIRA 1IYYA 1BNJA 1Q9EA 1LOWA 1RCKA 1FUTA 6RNTA 3AHWA 2HOHA 1BANA 1BRKA 1LOYA 3Q3FA 3GSPA 4RNTA 2C4BA 2KF5A 4GSPA 1RLSA 4HAAA 2ZA4A 1FZUA 3BU4A 1UCIA 2GSPA 1BGSA 1FUSA 7RNTA 1CH0A 1RGKA 1RGFA 1BRJA 1I8VA 1B21A 1R4YA 1T2HA 1BIRA 3WR2A 1I2FA 1RNTA 1AQZA 1SARA 1GOUA 4GHOA 2RNTA 1ZGXA 1BSDA 1LNIA 2AAEA 1B20A 1RGAA 1UCJA 1B2SA 2KF3A 2KAAA 1BRHA 3D4AA 1B27A 1B2UA 1I3IA 1RGCA 1RNBA 3AHSA 1B2XA 1BSBA 1I70A 1A2PA 1RN4A 1BVIA 4BIRA 3DGYA 3DH2A 9RNTA 1LRAA 1BNFA 1BOXA 4J5GA 1GMQA 1B2MA 1BRGA 6GSPA 4HOHA 3HOHA 1BNRA 1I2EA 1HYFA 1JBRA 1RCLA 1BSAA 1GSPA 2F5WA 1BRNL 1JBSA 3SYUA 2SARA 1BNIA 3A5EA 1BNEA 1BRIA 1HZ1A 1RGLA 3WHOA 2F4YA 2AADA 3KCHA 1BNSA 5HOHA 1I2GA 1X1UA 1FW7A 1BAOA 1GMPA 1I3FA 1UCLA 1X1YA 1YNVX 1RDSA 1RN1A 1UCKA 1DE3A 7GSPA 1BNGA 1RGEA 3AGOA 3D5GA 4BU4A 1FYSA 1RTUA 1GMRA 2KF4A 2BIRA 2F56A 1PYLA 1G02A 1JBTA
chains in the Genus database with same CATH superfamily
4HM4B 1YIJ3 2KF6A 3NBJA 3K5TA 1YJN3 3FH1A 2XF3A 3KSPA 2D42A 2IYJA 3DM8A 1O7HB 1N9JA 1N9EA 1I0XA 5KP3A 2HMOB 5G2GA 1VQK3 1DETA 4O2HA 2GBWB 1QAKA 1IQXA 1TRPA 4N3VA 1LOVA 3RNTA 3SVAA 5JPUA 3OX9A 3HZPA 3G16A 1O7WB 3K63A 4FCJA 1TIJA 1HU9A 1T2IA 3MYTA 5IG5A 5RNTA 3G4S3 3X3YA 3F8XA 1LOXA 1N5HA 2M7OA 4XDWA 1YVSA 3EB8A 4N6TA 1TU5A 3FG4A 5BU4A 4J9AA 4J5KA 2F5MA 5IG0A 1GOYA 1DVCA 2ZHXB 4LMIA 3WA3A 3CCS3 3GZYB 3DY5A 3SX1A 4HM5B 5AIGA 1VQ53 1T5YA 3PCRA 1QVF2 6RNTA 2K0MA 3T0UA 1TUHA 1WMPA 3WMDA 4K90B 1FGRA 1OGXA 2LQVA 3F14A 4RNTA 2C4BA 1IVUA 4GSPA 2LYXA 3DGNA 4NHFA 3F9SA 2CFDA 3VGNA 5AI1A 4NREA 5IG4A 1NB5I 1NWWA 1WTHA 3LTBA 1OF5A 4N6MA 4HM0B 2GSPA 7STDA 3B4OA 2KRTA 5AYSC 2E2TA 4L8OA 1W00A 2CK3H 4XBXA 1FUWA 4HM3B 5KP4A 3S67A 1BIRA 3UL6A 3K0ZA 5IG3A 1M1XB 1GYBA 1EA2A 3ECFA 2RFRA 5FGOA 1GS3A 1JN5A 5I97A 2GBXB 2QA43 3J7Yd 4ORLA 1ZGXA 3DXOA 2AAEA 1Q40B 3OWSA 1D6ZA 1B20A 3MG2A 1EEJA 4KT3B 1B2SA 1US1A 2KAAA 2SBLA 4HBRA 4CPKA 5AEUB 1B27A 3F8HA 1VQ63 1A2VA 2GU3A 3EBYA 4TX4A 4HYZA 1V74A 1RN7A 2BNGA 3PCSA 1A2PA 3V99A 1BVIA 2F98A 2IUKA 3DGYA 2OTL3 9RNTA 1RRHA 3LOYA 3CCQ3 3D79A 2W0QA 4HM7B 1IK3A 5D81A 3PZWA 4LGQA 5CK6A 4EV5A 3MHEA 3Q90A 3WODG 3CCE3 5AIIA 2CWUA 1HYFA 1KWIA 1TJDA 1IVVA 3NQZA 3HX8A 3ZG0A 5IERA 2W56B 2XEPA 3N9HA 1DMQA 2CFWA 3LZAA 4KFDA 2UGIA 3STDA 1BNIA 1CQSA 3CC23 1RRLA 1BRIA 1IU7A 1HZ1A 3Q1CA 3OWYA 5LC7A 1O7NB 3KCHA 1G96A 4R9KA 3WOEB 1GY6A 1QJGA 1I2GA 3NM7A 4J8TA 4L7KA 1FW7A 2CW9A 2MF7A 1OCVA 1JN5B 1YNVX 1RDSA 1RN1A 2GXFA 5AIHA 1RGEA 3LH4A 3AGOA 1JJ22 4LYLB 1LQMB 3KIIA 4MMXB 1FYSA 4BL2A 1VQ73 2HMNB 1JB5A 5EEOA 1GMRA 5JBSA 1DMMA 1IDPA 1SIIA 2BIRA 2CX0A 5CXOA 1JBTA 4GL6A 2O9UX 3CCM3 1FGMA 3X42A 2KCDA 4EBGA 1YJW3 1UUWB 3FF0A 1TRQA 3X3ZA 4H3UA 4HM8B 3FCSB 5AIFA 2W2CA 1SQWA 1K734 2BU4A 4XDVA 1FA3A 1RSNA 1B2ZA 2UUGC 5M1AA 1BUJA 1BRSA 2CG0A 3D9RA 1L5GB 3ZFZA 1TP6A 1UGIA 1JV2B 1Q814 2D1WA 1IT7A 3QK9A 5EQLA 1D6UA 1MGRA 1AY7A 3CD63 4X2OA 1N8QA 1RHLA 2Y73A 4QWTA 1B3SA 1JRQA 1GOVA 1JKGA 1STFI 2HMJB 3CPOA 1YGWA 2IUJA 3T8UA 1JZDA 4XBTA 4XB5A 1W6CA 3URPA 3N8BA 3LT9A 4XM4A 1NU3A 3GRDA 1I0VA 1LNHA 2XH9A 2Z77A 2Z6BA 3RGAA 3RGRA 4ZM8A 2XR8B 1IYYA 1VQ93 3ROBA 1BNJA 3JUNA 1VQN3 2IA7A 3FF2A 3MPHA 1RCKA 1FUTA 2PNCA 4HKVB 1PFPA 1ROAA 2Y74A 3AHWA 1BRKA 3EE1A 2W9PA 2W6JH 4O02B 2YFIB 3EN8A 3X41A 2B24B 4HAAA 4JF8A 5BVBA 3LYGA 1NB3I 1SPUA 1T3BA 3SOYA 2WO0A 4HVNA 4LZIA 1YIT3 4RNYA 1A67A 2GU1A 5IEPA 1FZUA 3FG1A 3PXMA 4DKIA 4U13A 3G6E3 1W7CA 1UI7A 1BGSA 1JZOA 2BO9B 1CH0A 1RGKA 3CU3A 3S5CA 5EVHA 1R4YA 3KN4A 1IVXA 2RCDA 1VQ43 3SOAA 1MOLA 4HM1B 1OGZA 3CME3 3AMOA 3FLJA 3VSYA 4FMAA 3WA2X 3BNDA 2L1SA 1EQKA 3MKIA 1DYUA 1UDII 2ZDJA 1U5OA 4GHOA 2CIUA 3KZTA 1BSDA 1MWTA 5G1LA 1MWSA 4H61A 3UB1A 2C11A 1LXEA 2OQEC 2KF3A 3D4AA 3NX0A 2Q07A 1B2UA 4BTWA 2H0IA 3OV4A 3OXAA 1I70A 1K9M4 1M904 5LC6A 1RNBA 1MWUA 1RN4A 5HGRA 2MC8A 3I553 1IV9A 2BT3A 3DH2A 1JKGB 3BNBA 5CF1A 3S27A 1U8CB 3CC43 2V1LA 1BNFA 4HZBB 5IW9A 1RKYA 4J5GA 3NQYA 3X3XA 2IMJA 6GSPA 1GD3A 2WGOA 2INXA 5ELJA 2XGLA 3S29A 2CFLA 3BNEA 1DMNA 4HZ9B 1FGQA 3O8YA 4K1UA 1IQ8A 2XSHB 4FCZA 3M8CA 5IEOA 4I5QA 3MG3A 2GEXA 2F99A 2AADA 4KVHA 3N54B 4IIAA 1STDA 4WHAA 2Z76A 1S723 1BNSA 1WNHA 5HOHA 1OUNA 1UCLA 1I3FA 2E2VA 3NM2A 4R4KA 4WWUC 1HKXA 3E99A 2RSXA 1DE3A 1TFKA 7GSPA 2P05A 1Q864 2P0XA 2W9QA 1W6YA 2ML6A 3KKGA 5A0OB 1KSIA 3HIIA 1C7HA 1YJ93 2JDIH 2F56A 1VQL3 2OTJ3 3EC9A 1Q42A 3JUPA 3UNLA 2Z7AA 4BL3A 8RNTA 1GY5A 1RJOA 1W2ZA 3X40A 5ELUA 3F40A 1QVG2 3EHCA 5M18A 2QEX3 1MGWA 1JB2A 1X1XA 4O3VA 4OUQA 4EW5A 3DGLA 1IQYA 2WOFA 4FMCA 5DRVA 3JVCA 3HIGA 3FKAA 3V92A 2P38A 3NV0A 3K9MC 1MWRA 2HMKB 4RBNA 3U97A 4K1VA 3D5IA 1OACA 3JUQA 1A2KA 4X2HA 3GAXA 4FR9A 3DGMA 3WOFB 3ALAA 2QIYA 3AGNA 5GSPA 1W2B2 2XGNA 3PS8A 2BMOB 1V57A 5FW5A 2CFKA 2FGTA 2B1XB 3BIRA 1OHPA 5AYRB 3K7CA 1CYUA 1LOWA 3CCR3 2I9WA 3LXUX 4AKZA 3FZWA 3HK4A 3QRDA 1BANA 3Q3FA 4JRFA 1WQLB 3OWUA 2KF5A 4EYCA 1W02A 3NBBA 1RLSA 3KE7A 5CF2A 1IT8A 1A90A 4MEIA 2YX9A 3DUKA 1NDOB 1VQQA 2HMLB 2XSOB 4HM2B 3V98A 1VQP3 4N6NB 1KD14 2W04A 2FNQA 3SEDA 7RNTA 1ZS7A 1RGFA 1BRJA 1ASKA 3PGBA 2CG1A 1B21A 1ZO2A 4LEHA 1QAFA 5DREA 2YFJB 1NO3A 1RNTA 1W01A 1O7GB 2BHMA 1AQZA 1V58A 1SARA 1GOUA 1Q40A 1ISKA 3TDGA 1WMNA 2RNTA 5CLKA 3G8ZA 3DGOA 1IV7A 2XRXB 1KQS2 1W4NA 2OOVA 1BRHA 4N6LA 1JB4A 4HM6B 5TGNA 3PYJA 1Q7HA 1I3IA 2IY2A 2A15A 3AHSA 1B2XA 1BSBA 3SLUA 1BUQA 1E3RA 4I4KA 4WYKA 4WP5A 4K61A 4WYKB 3MWZA 1OPYA 1Z1SA 3NXJA 3CNMA 2BMQB 1BOXA 1F8NA 3DZLA 3G0KA 3H51A 3B7CA 1BRGA 1LVNA 1M9GA 2ZL8A 1YGEA 3EBTA 4OK0A 4OVMA 5KP1A 1YHQ3 3HOHA 3F7SA 5AEWB 5JPPA 1NJI4 3MG1A 1IVWA 4MMZB 1O7MB 2F5WA 1GSPA 4MMYB 2K3DA 1BRNL 4FMDA 1EKMA 5D83A 2SARA 3LTDA 3A5EA 4KFEA 1RGLA 4R1KA 4BTXA 3FG3A 3WHOA 2J8XB 3EN1B 4N6V0 1FGTA 3LTAA 1AVLA 1OHOA 2OQEA 4EV2A 2OCTA 5G1KA 3CNXA 3H3HA 3UJMA 3D3LA 4FMBA 1KC84 4Q53A 1UW1A 5D82A 1VQ83 1UCKA 1BNGA 1PU4A 4MJDA 1RTUA 2RGQA 1UI8A 2KF4A 1K41A 1W6GA 6STDA 1PYLA 3VF1A 1EUIC 4EXRA 1JBRA 1MNLA 1UUGB 1VZZA 3G713 2F86B 4WFOA 3NHXA 1J2BA 1BSCA 1EG9B 1SIHA 4CDLA 2CWVA 2H0GA 1VQO3 4PEJA 4AKYA 1Q824 2P09A 2CH9A 1CYVA 1TFOA 3AMOB 1C54A 2OWPA 1RMSA 3I563 1N8R4 1QALA 1ULJB 3FGYA 2WOHA 1RGHA 1O7PB 1BU4A 1X1WA 1UGHI 4KFFA 4NPBA 4R80A 1D6YA 1BSEA 3DMCA 1AR0A 1RGGA 1OH0A 1TTOA 3RDEA 4IT7A 1PY3A 1FGOA 2RBIA 4RZMA 3B4PA 3CPW2 2CWTA 2P0MA 5STDA 5BIRA 2YFLB 1Y4KA 3CXC2 1Q9EA 2R41A 3GZBA 3B8LA 2HOHA 3NUVA 2GEYA 3U1WA 1LOYA 3LT8A 1YI23 2W03A 3GSPA 1ROVA 2H0HA 3CCV3 1AVKA 2ZA4A 2CX1A 3GWRA 2KXGA 4KZ1A 3T8NA 3UL5A 2BMRB 3IMAB 4AEQA 1VQM3 4CCVA 3WDGB 1OHSA 3BU4A 3BLZA 4HJLB 1ZX2A 1K8A4 1UCIA 4XBYA 2K54A 1FUSA 1OF5B 4IPBA 4ILFA 3JUOA 3BNCA 1I8VA 2XFTA 4EC6A 4G1MB 1T2HA 3CCL3 1GY7A 3EJVA 3WR2A 4N6OB 1I2FA 3I0YA 2WGQA 4BTYA 1YVBI 2UX0A 2CFGA 3GZXB 1S5AA 1LNIA 3HI7A 3SXXA 4O8SA 1RGAA 1UCJA 1AV4A 3KSED 8CHOA 1LQGC 5M19A 1R4CA 3IJEB 1RGCA 2XFSA 1Q7Y4 4BIRA 2FXTA 3MSOA 3NV0B 1LRAA 1E3VA 2CKFB 3CMA3 4L8PA 3CCU3 1UUVB 1B2MA 1GMQA 2JQ5A 3EQQB 1WMOA 1GD4A 1E97A 3EF8A 1W5ZA 1CEWI 3EX9A 4HOHA 3CC73 5IENA 1M1K4 1I2EA 1BNRA 4RNZA 3JUMA 5BXQA 1RCLA 3NBRA 3Q2PA 4FCMA 3ER7A 1BSAA 1NNVA 2QGUA 3FSDA 1JBSA 3SYUA 2PZVA 4R9LA 1G0TA 3L0RA 1QMAA 1BNEA 1SJWA 2F4YA 4CJNA 2R4IA 3OW22 1ULIB 3GZRA 2OOVC 4N6UA 3LMLA 2HMMB 2ML5A 1X1UA 4GB5A 1BAOA 2C10A 2E2UA 2W56A 1GMPA 2O3OA 2CC3A 3F7XA 1X1YA 3ZG5A 3BB9A 2L4VA 3LTCA 3D5GA 4STDA 2CHCA 3A76A 4BU4A 3IPTA 5IF6A 3KFQC 3CCJ3 1N5PA 2STDA 1JNQA 4LSOA 1DVDA 3S28A 1G02A 1K28A
chains in the Genus database with same CATH topology
8RNTA 2KF6A 1TRQA 1BSCA 1MGWA 1X1XA 2BU4A 1I0XA 1B2ZA 1RSNA 1BUJA 1C54A 1RMSA 1BRSA 1DETA 1RGHA 1TRPA 1LOVA 1MGRA 1AY7A 1BU4A 3RNTA 1RHLA 1X1WA 1B3SA 3D5IA 1BSEA 1T2IA 1GOVA 5RNTA 1RGGA 1YGWA 3AGNA 5GSPA 1TTOA 1YVSA 1PY3A 2RBIA 5BU4A 3URPA 4J5KA 2F5MA 1I0VA 5BIRA 1GOYA 3BIRA 1IYYA 1BNJA 1Q9EA 1LOWA 1RCKA 1FUTA 6RNTA 3AHWA 2HOHA 1BANA 1BRKA 1LOYA 3Q3FA 3GSPA 4RNTA 2C4BA 2KF5A 4GSPA 1RLSA 4HAAA 2ZA4A 1FZUA 3BU4A 1UCIA 2GSPA 1BGSA 1FUSA 7RNTA 1CH0A 1RGKA 1RGFA 1BRJA 1I8VA 1B21A 1R4YA 1T2HA 1BIRA 3WR2A 1I2FA 1RNTA 1AQZA 1SARA 1GOUA 4GHOA 2RNTA 1ZGXA 1BSDA 1LNIA 2AAEA 1B20A 1RGAA 1UCJA 1B2SA 2KF3A 2KAAA 1BRHA 3D4AA 1B27A 1B2UA 1I3IA 1RGCA 1RNBA 3AHSA 1B2XA 1BSBA 1I70A 1A2PA 1RN4A 1BVIA 4BIRA 3DGYA 3DH2A 9RNTA 1LRAA 1BNFA 1BOXA 4J5GA 1GMQA 1B2MA 1BRGA 6GSPA 4HOHA 3HOHA 1BNRA 1I2EA 1HYFA 1JBRA 1RCLA 1BSAA 1GSPA 2F5WA 1BRNL 1JBSA 3SYUA 2SARA 1BNIA 3A5EA 1BNEA 1BRIA 1HZ1A 1RGLA 3WHOA 2F4YA 2AADA 3KCHA 1BNSA 5HOHA 1I2GA 1X1UA 1FW7A 1BAOA 1GMPA 1I3FA 1UCLA 1X1YA 1YNVX 1RDSA 1RN1A 1UCKA 1DE3A 7GSPA 1BNGA 1RGEA 3AGOA 3D5GA 4BU4A 1FYSA 1RTUA 1GMRA 2KF4A 2BIRA 2F56A 1PYLA 1G02A 1JBTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 8RNT A;  2KF6 A;  1TRQ A;  1BSC A;  1MGW A;  1X1X A;  2BU4 A;  1I0X A;  1B2Z A;  1RSN A;  1BUJ A;  1C54 A;  1RMS A;  1BRS A;  1DET A;  1RGH A;  1TRP A;  1LOV A;  1MGR A;  1AY7 A;  1BU4 A;  3RNT A;  1RHL A;  1X1W A;  1B3S A;  3D5I A;  1BSE A;  1T2I A;  1GOV A;  5RNT A;  1RGG A;  1YGW A;  3AGN A;  5GSP A;  1TTO A;  1YVS A;  1PY3 A;  2RBI A;  5BU4 A;  3URP A;  4J5K A;  2F5M A;  1I0V A;  5BIR A;  1GOY A;  3BIR A;  1IYY A;  1BNJ A;  1Q9E A;  1LOW A;  1RCK A;  1FUT A;  6RNT A;  3AHW A;  2HOH A;  1BAN A;  1BRK A;  1LOY A;  3Q3F A;  3GSP A;  4RNT A;  2C4B A;  2KF5 A;  4GSP A;  1RLS A;  4HAA A;  2ZA4 A;  1FZU A;  3BU4 A;  1UCI A;  2GSP A;  1BGS A;  1FUS A;  7RNT A;  1CH0 A;  1RGK A;  1RGF A;  1BRJ A;  1I8V A;  1B21 A;  1R4Y A;  1T2H A;  1BIR A;  3WR2 A;  1I2F A;  1RNT A;  1AQZ A;  1SAR A;  1GOU A;  4GHO A;  2RNT A;  1ZGX A;  1BSD A;  1LNI A;  2AAE A;  1B20 A;  1RGA A;  1UCJ A;  1B2S A;  2KF3 A;  2KAA A;  1BRH A;  3D4A A;  1B27 A;  1B2U A;  1I3I A;  1RGC A;  1RNB A;  3AHS A;  1B2X A;  1BSB A;  1I70 A;  1A2P A;  1RN4 A;  1BVI A;  4BIR A;  3DGY A;  3DH2 A;  9RNT A;  1LRA A;  1BNF A;  1BOX A;  4J5G A;  1GMQ A;  1B2M A;  1BRG A;  6GSP A;  4HOH A;  3HOH A;  1BNR A;  1I2E A;  1HYF A;  1JBR A;  1RCL A;  1BSA A;  1GSP A;  2F5W A;  1BRN L;  1JBS A;  3SYU A;  2SAR A;  1BNI A;  3A5E A;  1BNE A;  1BRI A;  1HZ1 A;  1RGL A;  3WHO A;  2F4Y A;  2AAD A;  3KCH A;  1BNS A;  5HOH A;  1I2G A;  1X1U A;  1FW7 A;  1BAO A;  1GMP A;  1I3F A;  1UCL A;  1X1Y A;  1YNV X;  1RDS A;  1RN1 A;  1UCK A;  1DE3 A;  7GSP A;  1BNG A;  1RGE A;  3AGO A;  3D5G A;  4BU4 A;  1FYS A;  1RTU A;  1GMR A;  2KF4 A;  2BIR A;  2F56 A;  1PYL A;  1G02 A;  1JBT A; 
#chains in the Genus database with same CATH topology
 4HM4 B;  1YIJ 3;  2KF6 A;  3NBJ A;  3K5T A;  1YJN 3;  3FH1 A;  2XF3 A;  3KSP A;  2D42 A;  2IYJ A;  3DM8 A;  1O7H B;  1N9J A;  1N9E A;  1I0X A;  5KP3 A;  2HMO B;  5G2G A;  1VQK 3;  1DET A;  4O2H A;  2GBW B;  1QAK A;  1IQX A;  1TRP A;  4N3V A;  1LOV A;  3RNT A;  3SVA A;  5JPU A;  3OX9 A;  3HZP A;  3G16 A;  1O7W B;  3K63 A;  4FCJ A;  1TIJ A;  1HU9 A;  1T2I A;  3MYT A;  5IG5 A;  5RNT A;  3G4S 3;  3X3Y A;  3F8X A;  1LOX A;  1N5H A;  2M7O A;  4XDW A;  1YVS A;  3EB8 A;  4N6T A;  1TU5 A;  3FG4 A;  5BU4 A;  4J9A A;  4J5K A;  2F5M A;  5IG0 A;  1GOY A;  1DVC A;  2ZHX B;  4LMI A;  3WA3 A;  3CCS 3;  3GZY B;  3DY5 A;  3SX1 A;  4HM5 B;  5AIG A;  1VQ5 3;  1T5Y A;  3PCR A;  1QVF 2;  6RNT A;  2K0M A;  3T0U A;  1TUH A;  1WMP A;  3WMD A;  4K90 B;  1FGR A;  1OGX A;  2LQV A;  3F14 A;  4RNT A;  2C4B A;  1IVU A;  4GSP A;  2LYX A;  3DGN A;  4NHF A;  3F9S A;  2CFD A;  3VGN A;  5AI1 A;  4NRE A;  5IG4 A;  1NB5 I;  1NWW A;  1WTH A;  3LTB A;  1OF5 A;  4N6M A;  4HM0 B;  2GSP A;  7STD A;  3B4O A;  2KRT A;  5AYS C;  2E2T A;  4L8O A;  1W00 A;  2CK3 H;  4XBX A;  1FUW A;  4HM3 B;  5KP4 A;  3S67 A;  1BIR A;  3UL6 A;  3K0Z A;  5IG3 A;  1M1X B;  1GYB A;  1EA2 A;  3ECF A;  2RFR A;  5FGO A;  1GS3 A;  1JN5 A;  5I97 A;  2GBX B;  2QA4 3;  3J7Y d;  4ORL A;  1ZGX A;  3DXO A;  2AAE A;  1Q40 B;  3OWS A;  1D6Z A;  1B20 A;  3MG2 A;  1EEJ A;  4KT3 B;  1B2S A;  1US1 A;  2KAA A;  2SBL A;  4HBR A;  4CPK A;  5AEU B;  1B27 A;  3F8H A;  1VQ6 3;  1A2V A;  2GU3 A;  3EBY A;  4TX4 A;  4HYZ A;  1V74 A;  1RN7 A;  2BNG A;  3PCS A;  1A2P A;  3V99 A;  1BVI A;  2F98 A;  2IUK A;  3DGY A;  2OTL 3;  9RNT A;  1RRH A;  3LOY A;  3CCQ 3;  3D79 A;  2W0Q A;  4HM7 B;  1IK3 A;  5D81 A;  3PZW A;  4LGQ A;  5CK6 A;  4EV5 A;  3MHE A;  3Q90 A;  3WOD G;  3CCE 3;  5AII A;  2CWU A;  1HYF A;  1KWI A;  1TJD A;  1IVV A;  3NQZ A;  3HX8 A;  3ZG0 A;  5IER A;  2W56 B;  2XEP A;  3N9H A;  1DMQ A;  2CFW A;  3LZA A;  4KFD A;  2UGI A;  3STD A;  1BNI A;  1CQS A;  3CC2 3;  1RRL A;  1BRI A;  1IU7 A;  1HZ1 A;  3Q1C A;  3OWY A;  5LC7 A;  1O7N B;  3KCH A;  1G96 A;  4R9K A;  3WOE B;  1GY6 A;  1QJG A;  1I2G A;  3NM7 A;  4J8T A;  4L7K A;  1FW7 A;  2CW9 A;  2MF7 A;  1OCV A;  1JN5 B;  1YNV X;  1RDS A;  1RN1 A;  2GXF A;  5AIH A;  1RGE A;  3LH4 A;  3AGO A;  1JJ2 2;  4LYL B;  1LQM B;  3KII A;  4MMX B;  1FYS A;  4BL2 A;  1VQ7 3;  2HMN B;  1JB5 A;  5EEO A;  1GMR A;  5JBS A;  1DMM A;  1IDP A;  1SII A;  2BIR A;  2CX0 A;  5CXO A;  1JBT A;  4GL6 A;  2O9U X;  3CCM 3;  1FGM A;  3X42 A;  2KCD A;  4EBG A;  1YJW 3;  1UUW B;  3FF0 A;  1TRQ A;  3X3Z A;  4H3U A;  4HM8 B;  3FCS B;  5AIF A;  2W2C A;  1SQW A;  1K73 4;  2BU4 A;  4XDV A;  1FA3 A;  1RSN A;  1B2Z A;  2UUG C;  5M1A A;  1BUJ A;  1BRS A;  2CG0 A;  3D9R A;  1L5G B;  3ZFZ A;  1TP6 A;  1UGI A;  1JV2 B;  1Q81 4;  2D1W A;  1IT7 A;  3QK9 A;  5EQL A;  1D6U A;  1MGR A;  1AY7 A;  3CD6 3;  4X2O A;  1N8Q A;  1RHL A;  2Y73 A;  4QWT A;  1B3S A;  1JRQ A;  1GOV A;  1JKG A;  1STF I;  2HMJ B;  3CPO A;  1YGW A;  2IUJ A;  3T8U A;  1JZD A;  4XBT A;  4XB5 A;  1W6C A;  3URP A;  3N8B A;  3LT9 A;  4XM4 A;  1NU3 A;  3GRD A;  1I0V A;  1LNH A;  2XH9 A;  2Z77 A;  2Z6B A;  3RGA A;  3RGR A;  4ZM8 A;  2XR8 B;  1IYY A;  1VQ9 3;  3ROB A;  1BNJ A;  3JUN A;  1VQN 3;  2IA7 A;  3FF2 A;  3MPH A;  1RCK A;  1FUT A;  2PNC A;  4HKV B;  1PFP A;  1ROA A;  2Y74 A;  3AHW A;  1BRK A;  3EE1 A;  2W9P A;  2W6J H;  4O02 B;  2YFI B;  3EN8 A;  3X41 A;  2B24 B;  4HAA A;  4JF8 A;  5BVB A;  3LYG A;  1NB3 I;  1SPU A;  1T3B A;  3SOY A;  2WO0 A;  4HVN A;  4LZI A;  1YIT 3;  4RNY A;  1A67 A;  2GU1 A;  5IEP A;  1FZU A;  3FG1 A;  3PXM A;  4DKI A;  4U13 A;  3G6E 3;  1W7C A;  1UI7 A;  1BGS A;  1JZO A;  2BO9 B;  1CH0 A;  1RGK A;  3CU3 A;  3S5C A;  5EVH A;  1R4Y A;  3KN4 A;  1IVX A;  2RCD A;  1VQ4 3;  3SOA A;  1MOL A;  4HM1 B;  1OGZ A;  3CME 3;  3AMO A;  3FLJ A;  3VSY A;  4FMA A;  3WA2 X;  3BND A;  2L1S A;  1EQK A;  3MKI A;  1DYU A;  1UDI I;  2ZDJ A;  1U5O A;  4GHO A;  2CIU A;  3KZT A;  1BSD A;  1MWT A;  5G1L A;  1MWS A;  4H61 A;  3UB1 A;  2C11 A;  1LXE A;  2OQE C;  2KF3 A;  3D4A A;  3NX0 A;  2Q07 A;  1B2U A;  4BTW A;  2H0I A;  3OV4 A;  3OXA A;  1I70 A;  1K9M 4;  1M90 4;  5LC6 A;  1RNB A;  1MWU A;  1RN4 A;  5HGR A;  2MC8 A;  3I55 3;  1IV9 A;  2BT3 A;  3DH2 A;  1JKG B;  3BNB A;  5CF1 A;  3S27 A;  1U8C B;  3CC4 3;  2V1L A;  1BNF A;  4HZB B;  5IW9 A;  1RKY A;  4J5G A;  3NQY A;  3X3X A;  2IMJ A;  6GSP A;  1GD3 A;  2WGO A;  2INX A;  5ELJ A;  2XGL A;  3S29 A;  2CFL A;  3BNE A;  1DMN A;  4HZ9 B;  1FGQ A;  3O8Y A;  4K1U A;  1IQ8 A;  2XSH B;  4FCZ A;  3M8C A;  5IEO A;  4I5Q A;  3MG3 A;  2GEX A;  2F99 A;  2AAD A;  4KVH A;  3N54 B;  4IIA A;  1STD A;  4WHA A;  2Z76 A;  1S72 3;  1BNS A;  1WNH A;  5HOH A;  1OUN A;  1UCL A;  1I3F A;  2E2V A;  3NM2 A;  4R4K A;  4WWU C;  1HKX A;  3E99 A;  2RSX A;  1DE3 A;  1TFK A;  7GSP A;  2P05 A;  1Q86 4;  2P0X A;  2W9Q A;  1W6Y A;  2ML6 A;  3KKG A;  5A0O B;  1KSI A;  3HII A;  1C7H A;  1YJ9 3;  2JDI H;  2F56 A;  1VQL 3;  2OTJ 3;  3EC9 A;  1Q42 A;  3JUP A;  3UNL A;  2Z7A A;  4BL3 A;  8RNT A;  1GY5 A;  1RJO A;  1W2Z A;  3X40 A;  5ELU A;  3F40 A;  1QVG 2;  3EHC A;  5M18 A;  2QEX 3;  1MGW A;  1JB2 A;  1X1X A;  4O3V A;  4OUQ A;  4EW5 A;  3DGL A;  1IQY A;  2WOF A;  4FMC A;  5DRV A;  3JVC A;  3HIG A;  3FKA A;  3V92 A;  2P38 A;  3NV0 A;  3K9M C;  1MWR A;  2HMK B;  4RBN A;  3U97 A;  4K1V A;  3D5I A;  1OAC A;  3JUQ A;  1A2K A;  4X2H A;  3GAX A;  4FR9 A;  3DGM A;  3WOF B;  3ALA A;  2QIY A;  3AGN A;  5GSP A;  1W2B 2;  2XGN A;  3PS8 A;  2BMO B;  1V57 A;  5FW5 A;  2CFK A;  2FGT A;  2B1X B;  3BIR A;  1OHP A;  5AYR B;  3K7C A;  1CYU A;  1LOW A;  3CCR 3;  2I9W A;  3LXU X;  4AKZ A;  3FZW A;  3HK4 A;  3QRD A;  1BAN A;  3Q3F A;  4JRF A;  1WQL B;  3OWU A;  2KF5 A;  4EYC A;  1W02 A;  3NBB A;  1RLS A;  3KE7 A;  5CF2 A;  1IT8 A;  1A90 A;  4MEI A;  2YX9 A;  3DUK A;  1NDO B;  1VQQ A;  2HML B;  2XSO B;  4HM2 B;  3V98 A;  1VQP 3;  4N6N B;  1KD1 4;  2W04 A;  2FNQ A;  3SED A;  7RNT A;  1ZS7 A;  1RGF A;  1BRJ A;  1ASK A;  3PGB A;  2CG1 A;  1B21 A;  1ZO2 A;  4LEH A;  1QAF A;  5DRE A;  2YFJ B;  1NO3 A;  1RNT A;  1W01 A;  1O7G B;  2BHM A;  1AQZ A;  1V58 A;  1SAR A;  1GOU A;  1Q40 A;  1ISK A;  3TDG A;  1WMN A;  2RNT A;  5CLK A;  3G8Z A;  3DGO A;  1IV7 A;  2XRX B;  1KQS 2;  1W4N A;  2OOV A;  1BRH A;  4N6L A;  1JB4 A;  4HM6 B;  5TGN A;  3PYJ A;  1Q7H A;  1I3I A;  2IY2 A;  2A15 A;  3AHS A;  1B2X A;  1BSB A;  3SLU A;  1BUQ A;  1E3R A;  4I4K A;  4WYK A;  4WP5 A;  4K61 A;  4WYK B;  3MWZ A;  1OPY A;  1Z1S A;  3NXJ A;  3CNM A;  2BMQ B;  1BOX A;  1F8N A;  3DZL A;  3G0K A;  3H51 A;  3B7C A;  1BRG A;  1LVN A;  1M9G A;  2ZL8 A;  1YGE A;  3EBT A;  4OK0 A;  4OVM A;  5KP1 A;  1YHQ 3;  3HOH A;  3F7S A;  5AEW B;  5JPP A;  1NJI 4;  3MG1 A;  1IVW A;  4MMZ B;  1O7M B;  2F5W A;  1GSP A;  4MMY B;  2K3D A;  1BRN L;  4FMD A;  1EKM A;  5D83 A;  2SAR A;  3LTD A;  3A5E A;  4KFE A;  1RGL A;  4R1K A;  4BTX A;  3FG3 A;  3WHO A;  2J8X B;  3EN1 B;  4N6V 0;  1FGT A;  3LTA A;  1AVL A;  1OHO A;  2OQE A;  4EV2 A;  2OCT A;  5G1K A;  3CNX A;  3H3H A;  3UJM A;  3D3L A;  4FMB A;  1KC8 4;  4Q53 A;  1UW1 A;  5D82 A;  1VQ8 3;  1UCK A;  1BNG A;  1PU4 A;  4MJD A;  1RTU A;  2RGQ A;  1UI8 A;  2KF4 A;  1K41 A;  1W6G A;  6STD A;  1PYL A;  3VF1 A;  1EUI C;  4EXR A;  1JBR A;  1MNL A;  1UUG B;  1VZZ A;  3G71 3;  2F86 B;  4WFO A;  3NHX A;  1J2B A;  1BSC A;  1EG9 B;  1SIH A;  4CDL A;  2CWV A;  2H0G A;  1VQO 3;  4PEJ A;  4AKY A;  1Q82 4;  2P09 A;  2CH9 A;  1CYV A;  1TFO A;  3AMO B;  1C54 A;  2OWP A;  1RMS A;  3I56 3;  1N8R 4;  1QAL A;  1ULJ B;  3FGY A;  2WOH A;  1RGH A;  1O7P B;  1BU4 A;  1X1W A;  1UGH I;  4KFF A;  4NPB A;  4R80 A;  1D6Y A;  1BSE A;  3DMC A;  1AR0 A;  1RGG A;  1OH0 A;  1TTO A;  3RDE A;  4IT7 A;  1PY3 A;  1FGO A;  2RBI A;  4RZM A;  3B4P A;  3CPW 2;  2CWT A;  2P0M A;  5STD A;  5BIR A;  2YFL B;  1Y4K A;  3CXC 2;  1Q9E A;  2R41 A;  3GZB A;  3B8L A;  2HOH A;  3NUV A;  2GEY A;  3U1W A;  1LOY A;  3LT8 A;  1YI2 3;  2W03 A;  3GSP A;  1ROV A;  2H0H A;  3CCV 3;  1AVK A;  2ZA4 A;  2CX1 A;  3GWR A;  2KXG A;  4KZ1 A;  3T8N A;  3UL5 A;  2BMR B;  3IMA B;  4AEQ A;  1VQM 3;  4CCV A;  3WDG B;  1OHS A;  3BU4 A;  3BLZ A;  4HJL B;  1ZX2 A;  1K8A 4;  1UCI A;  4XBY A;  2K54 A;  1FUS A;  1OF5 B;  4IPB A;  4ILF A;  3JUO A;  3BNC A;  1I8V A;  2XFT A;  4EC6 A;  4G1M B;  1T2H A;  3CCL 3;  1GY7 A;  3EJV A;  3WR2 A;  4N6O B;  1I2F A;  3I0Y A;  2WGQ A;  4BTY A;  1YVB I;  2UX0 A;  2CFG A;  3GZX B;  1S5A A;  1LNI A;  3HI7 A;  3SXX A;  4O8S A;  1RGA A;  1UCJ A;  1AV4 A;  3KSE D;  8CHO A;  1LQG C;  5M19 A;  1R4C A;  3IJE B;  1RGC A;  2XFS A;  1Q7Y 4;  4BIR A;  2FXT A;  3MSO A;  3NV0 B;  1LRA A;  1E3V A;  2CKF B;  3CMA 3;  4L8P A;  3CCU 3;  1UUV B;  1B2M A;  1GMQ A;  2JQ5 A;  3EQQ B;  1WMO A;  1GD4 A;  1E97 A;  3EF8 A;  1W5Z A;  1CEW I;  3EX9 A;  4HOH A;  3CC7 3;  5IEN A;  1M1K 4;  1I2E A;  1BNR A;  4RNZ A;  3JUM A;  5BXQ A;  1RCL A;  3NBR A;  3Q2P A;  4FCM A;  3ER7 A;  1BSA A;  1NNV A;  2QGU A;  3FSD A;  1JBS A;  3SYU A;  2PZV A;  4R9L A;  1G0T A;  3L0R A;  1QMA A;  1BNE A;  1SJW A;  2F4Y A;  4CJN A;  2R4I A;  3OW2 2;  1ULI B;  3GZR A;  2OOV C;  4N6U A;  3LML A;  2HMM B;  2ML5 A;  1X1U A;  4GB5 A;  1BAO A;  2C10 A;  2E2U A;  2W56 A;  1GMP A;  2O3O A;  2CC3 A;  3F7X A;  1X1Y A;  3ZG5 A;  3BB9 A;  2L4V A;  3LTC A;  3D5G A;  4STD A;  2CHC A;  3A76 A;  4BU4 A;  3IPT A;  5IF6 A;  3KFQ C;  3CCJ 3;  1N5P A;  2STD A;  1JNQ A;  4LSO A;  1DVD A;  3S28 A;  1G02 A;  1K28 A; 
#chains in the Genus database with same CATH homology
 8RNT A;  2KF6 A;  1TRQ A;  1BSC A;  1MGW A;  1X1X A;  2BU4 A;  1I0X A;  1B2Z A;  1RSN A;  1BUJ A;  1C54 A;  1RMS A;  1BRS A;  1DET A;  1RGH A;  1TRP A;  1LOV A;  1MGR A;  1AY7 A;  1BU4 A;  3RNT A;  1RHL A;  1X1W A;  1B3S A;  3D5I A;  1BSE A;  1T2I A;  1GOV A;  5RNT A;  1RGG A;  1YGW A;  3AGN A;  5GSP A;  1TTO A;  1YVS A;  1PY3 A;  2RBI A;  5BU4 A;  3URP A;  4J5K A;  2F5M A;  1I0V A;  5BIR A;  1GOY A;  3BIR A;  1IYY A;  1BNJ A;  1Q9E A;  1LOW A;  1RCK A;  1FUT A;  6RNT A;  3AHW A;  2HOH A;  1BAN A;  1BRK A;  1LOY A;  3Q3F A;  3GSP A;  4RNT A;  2C4B A;  2KF5 A;  4GSP A;  1RLS A;  4HAA A;  2ZA4 A;  1FZU A;  3BU4 A;  1UCI A;  2GSP A;  1BGS A;  1FUS A;  7RNT A;  1CH0 A;  1RGK A;  1RGF A;  1BRJ A;  1I8V A;  1B21 A;  1R4Y A;  1T2H A;  1BIR A;  3WR2 A;  1I2F A;  1RNT A;  1AQZ A;  1SAR A;  1GOU A;  4GHO A;  2RNT A;  1ZGX A;  1BSD A;  1LNI A;  2AAE A;  1B20 A;  1RGA A;  1UCJ A;  1B2S A;  2KF3 A;  2KAA A;  1BRH A;  3D4A A;  1B27 A;  1B2U A;  1I3I A;  1RGC A;  1RNB A;  3AHS A;  1B2X A;  1BSB A;  1I70 A;  1A2P A;  1RN4 A;  1BVI A;  4BIR A;  3DGY A;  3DH2 A;  9RNT A;  1LRA A;  1BNF A;  1BOX A;  4J5G A;  1GMQ A;  1B2M A;  1BRG A;  6GSP A;  4HOH A;  3HOH A;  1BNR A;  1I2E A;  1HYF A;  1JBR A;  1RCL A;  1BSA A;  1GSP A;  2F5W A;  1BRN L;  1JBS A;  3SYU A;  2SAR A;  1BNI A;  3A5E A;  1BNE A;  1BRI A;  1HZ1 A;  1RGL A;  3WHO A;  2F4Y A;  2AAD A;  3KCH A;  1BNS A;  5HOH A;  1I2G A;  1X1U A;  1FW7 A;  1BAO A;  1GMP A;  1I3F A;  1UCL A;  1X1Y A;  1YNV X;  1RDS A;  1RN1 A;  1UCK A;  1DE3 A;  7GSP A;  1BNG A;  1RGE A;  3AGO A;  3D5G A;  4BU4 A;  1FYS A;  1RTU A;  1GMR A;  2KF4 A;  2BIR A;  2F56 A;  1PYL A;  1G02 A;  1JBT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...