1BNSA

Structural studies of barnase mutants
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYIAKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BARNASE
publication title Contribution of buried hydrogen bonds to protein stability. The crystal structures of two barnase mutants.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Endonuclease
total genus 30
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 1994-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1bnsA00
5HOHA 4HAAA 1B27A 8RNTA 3D5IA 1B2MA 2KAAA 4BIRA 1T2IA 2AAEA 3DGYA 1B3SA 1BRHA 1BU4A 1I2GA 4RNTA 1BVIA 2F4YA 3HOHA 1FYSA 1RGKA 2ZA4A 3URPA 1RGHA 1BRJA 1X1WA 2BU4A 1I2EA 3AHWA 2RBIA 1I3IA 1GOUA 1BGSA 9RNTA 1GMRA 1PYLA 1BANA 1RHLA 1YNVX 3GSPA 1RMSA 1BRGA 1BRIA 2HOHA 2AADA 5BIRA 1BNSA 1B2XA 1FUTA 1UCIA 1TTOA 5RNTA 2KF3A 1I0XA 1RDSA 1RGAA 3RNTA 1FUSA 1ZGXA 1RN4A 1BNRA 3D5GA 3KCHA 1I2FA 2F5WA 3WR2A 2SARA 1B20A 1BNFA 1BSBA 1GSPA 1LRAA 1LOWA 1RTUA 1B2SA 1MGRA 1T2HA 3BU4A 4J5GA 1BRSA 1LOYA 4BU4A 1A2PA 1CH0A 1X1UA 2GSPA 1BIRA 1JBTA 2BIRA 1FZUA 1I0VA 1RGCA 3AHSA 4GHOA 1RLSA 1RCLA 1RSNA 1UCJA 3BIRA 2KF5A 1MGWA 1B2ZA 1I8VA 1BSAA 3SYUA 1RGEA 1UCKA 1SARA 1X1XA 1C54A 1BRKA 1GOVA 1RGGA 1LOVA 7RNTA 1DE3A 1BNGA 1GMPA 2KF6A 1RNTA 2RNTA 1GOYA 1YGWA 2KF4A 1X1YA 3DH2A 1BSCA 1B2UA 4GSPA 1BNJA 1HZ1A 1BAOA 3AGOA 1RN1A 3D4AA 1AY7A 4J5KA 6RNTA 1BOXA 5BU4A 2F56A 3AGNA 6GSPA 1R4YA 1RGFA 1TRQA 1Q9EA 1RCKA 1AQZA 1I3FA 1BNIA 1FW7A 1IYYA 2F5MA 1B21A 1BRNL 1TRPA 3A5EA 1BNEA 1BUJA 1GMQA 3WHOA 1LNIA 1BSEA 1PY3A 1JBRA 1YVSA 1RNBA 1BSDA 1DETA 4HOHA 7GSPA 1UCLA 3Q3FA 1RGLA 1HYFA 1I70A 1JBSA 2C4BA 1G02A 5GSPA
chains in the Genus database with same CATH superfamily
4HAAA 3H3HA 1L5GB 3D5IA 3EF8A 2P0XA 1MNLA 1W7CA 1LQMB 4RBNA 1JKGB 1U8CB 4MJDA 4BIRA 2YFIB 2YFJB 1B3SA 3CCL3 3LYGA 1BU4A 1N8QA 2F4YA 2FGTA 1A67A 3Q90A 2ZA4A 1N5PA 2IUKA 2CC3A 1ISKA 2KCDA 2C10A 2IYJA 2W56A 1ROAA 2XFSA 1Q7Y4 1VQ93 1AVKA 5KP3A 1D6YA 3CME3 1I3IA 3GZRA 1BGSA 1GMRA 4EW5A 1D6UA 1O7HB 1BANA 3GWRA 3NBJA 3GSPA 4EV5A 1UUWB 1BRGA 2BNGA 1BRIA 4XBYA 2GEYA 2FXTA 1YVBI 1UCIA 1RDSA 4HM5B 1FUSA 3MG2A 2M7OA 3D5GA 1OF5A 1KQS2 4ORLA 3MKIA 3WOEB 4BL3A 4WFOA 3I553 5CF1A 1BNFA 1TUHA 4R4KA 1LRAA 1V74A 5JPUA 4BTXA 5KP4A 1RTUA 1B2SA 1TFOA 2LQVA 3AMOB 4KFEA 2CG0A 2R41A 1Q40A 3MPHA 3FG4A 3KFQC 4J5GA 5I97A 3ROBA 2XRXB 2Z76A 1U5OA 4MEIA 1BRSA 3F14A 3S5CA 1VQ63 1OGXA 1A2PA 4AKYA 1CH0A 3BNEA 1X1UA 3DY5A 3LTBA 3GZXB 1AVLA 1Q7HA 1CYUA 1RKYA 3RGAA 3OW22 1YJW3 4L8PA 1QAFA 4EC6A 4R9LA 3ECFA 4GHOA 3H51A 1MWRA 3X3XA 1UCJA 4MMZB 4ILFA 4WWUC 5DRVA 1JZDA 4IPBA 5CK6A 1M904 3FG1A 4GL6A 1QAKA 3LOYA 1W00A 4LYLB 4KFFA 5TGNA 2L1SA 1M1K4 2W6JH 1RGGA 1E3RA 1JB2A 3Q1CA 2KF6A 1FGOA 2QA43 1RNTA 2SBLA 1OGZA 3OWSA 2KF4A 5A0OB 4LSOA 3F8HA 1HZ1A 4I4KA 1EEJA 1MWTA 3BB9A 1VQ83 1GY5A 3X40A 1W01A 3GAXA 1N5HA 3PCSA 5EVHA 6RNTA 1BOXA 3D79A 2F56A 2RFRA 2Z6BA 3K7CA 4L8OA 4Q53A 6GSPA 4J8TA 2HMOB 2CHCA 5G1KA 2XSHB 1BNIA 1N9JA 1TRPA 2OQEA 2R4IA 1BNEA 3SXXA 1YJN3 1UI8A 3U97A 5M18A 1UW1A 3KSED 2J8XB 1YIJ3 3SOAA 1OACA 4GB5A 2I9WA 1YVSA 2XGLA 1DETA 4R80A 3BLZA 3K9MC 3VSYA 1KWIA 4O8SA 3Q3FA 2B24B 3G6E3 3VF1A 3JUMA 1WMOA 2W04A 5GSPA 5HOHA 3CCM3 5LC6A 8RNTA 1STDA 3EJVA 5HGRA 3DZLA 2UGIA 3UJMA 1FA3A 3DGOA 3EBYA 2O9UX 3WA2X 1VQQA 3FZWA 2ZDJA 2AAEA 4ZM8A 1UGIA 3DUKA 1AR0A 1DMQA 4I5QA 2YX9A 3LT8A 2W0QA 1TIJA 4HKVB 1BVIA 3FCSB 3CD63 3HOHA 1FYSA 2F99A 5IERA 4CJNA 2QEX3 4BL2A 1T5YA 3URPA 2W56B 1E97A 4LZIA 1BRJA 1AV4A 1K41A 3CPW2 3SVAA 2JDIH 4FCMA 5EEOA 3CCU3 3PS8A 4FMCA 9RNTA 1PYLA 3F7SA 3EN8A 1IDPA 1IK3A 3DMCA 3PCRA 5IW9A 5CXOA 3EN1B 2HOHA 5IG4A 3LXUX 4O3VA 1IU7A 3B4PA 3V98A 2UX0A 4H61A 1OH0A 2GEXA 5AEUB 5RNTA 3BNCA 3RNTA 5ELJA 1IVUA 1OF5B 4HBRA 2K3DA 1I2FA 2L4VA 3LMLA 2OOVA 1B20A 4LMIA 1K9M4 1UGHI 2CW9A 2ZHXB 3MYTA 4MMXB 2HMNB 3WOFB 4STDA 1ULIB 1Q40B 4H3UA 3CCV3 1T2HA 2GXFA 1STFI 5STDA 1F8NA 1OHOA 2XEPA 4G1MB 2CFDA 1M9GA 3FF2A 4L7KA 1Q864 3NM7A 4N6MA 1EG9B 1MOLA 4WHAA 4R9KA 1JBTA 3QRDA 3PXMA 5AIFA 3K5TA 4OVMA 4FMDA 1GYBA 1QMAA 2BIRA 3MHEA 3MWZA 4AEQA 1I0VA 1RGCA 2RCDA 3E99A 3IMAB 2MC8A 2F98A 3D9RA 1RLSA 3N54B 5AIIA 1RCLA 1K28A 2GBWB 3BIRA 1GD4A 3IPTA 4WYKA 3LTCA 2CWVA 2V1LA 1TP6A 3NBBA 5EQLA 3GZYB 3T0UA 3CCS3 1VQ43 4HM7B 3SYUA 3LH4A 5AIHA 1UDII 4XM4A 1UCKA 1EUIC 1SQWA 1FUWA 1X1XA 1O7NB 1R4CA 1BRKA 1ZS7A 3SEDA 7RNTA 2RNTA 2IY2A 4NHFA 1KC84 1YGWA 1X1YA 2P38A 3S29A 1ZX2A 2W2CA 3V99A 1JJ22 3BNBA 1BAOA 3AGOA 4IIAA 1W6CA 2HMLB 4IT7A 3PGBA 1J2BA 2H0IA 3AGNA 3EBTA 3B7CA 4EXRA 1RGFA 3NX0A 2E2TA 4HZ9B 1CEWI 1DYUA 1RCKA 1I3FA 2XR8B 2QGUA 5D83A 4NPBA 1IYYA 2B1XB 4N6NB 2WGOA 1B21A 2W9PA 1QVG2 1MWSA 2P09A 3FH1A 1GMQA 1BUJA 2STDA 2P0MA 3DM8A 1LNIA 1VQN3 1W5ZA 1BSEA 2E2VA 4HM6B 3NUVA 1HU9A 2PNCA 2CG1A 4JF8A 3F8XA 5D82A 1BSDA 3NV0A 3HK4A 4HOHA 3RDEA 5AYSC 4OUQA 1RNBA 1Q42A 1LVNA 4N6OB 1RGLA 2CK3H 4CDLA 3N9HA 3G16A 2C4BA 1VQ73 1VQ53 1DMMA 1G02A 3GZBA 1B27A 1YJ93 5CLKA 1WMNA 1NB5I 3LTAA 3KSPA 1D6ZA 4N6UA 1NJI4 3UNLA 1T2IA 4RZMA 1IT7A 3B4OA 4KT3B 3DGNA 1I2GA 4RNTA 3QK9A 4DKIA 4RNZA 2CFGA 1RGKA 1EKMA 1RGHA 1ROVA 1WQLB 4X2HA 1WTHA 2H0HA 4O02B 1E3VA 1SIHA 1US1A 2JQ5A 4OK0A 3AHWA 4K1UA 1VQK3 3CCR3 2CH9A 5IG3A 3ALAA 4EBGA 1G96A 4CPKA 1RMSA 1UI7A 5D81A 5BIRA 4RNYA 1B2XA 1FUTA 2WOHA 1TTOA 1O7PB 5IENA 4FMBA 4CCVA 2KF3A 2WOFA 1I0XA 3JUOA 3ER7A 4XB5A 3EB8A 1ZGXA 3EHCA 1VQL3 1RN4A 2C11A 5JPPA 2K54A 3KCHA 3KN4A 2CFWA 3CCJ3 1BNRA 1FGRA 3NQZA 2F5WA 3WR2A 2SARA 4BTWA 2BMRB 1N9EA 2KXGA 3I0YA 3EE1A 1BSBA 1EQKA 1YI23 2Q07A 3PYJA 5AIGA 2OWPA 4XDVA 4J9AA 2XH9A 3WDGB 3U1WA 2OTJ3 1SPUA 3BU4A 1C7HA 3UB1A 2Z7AA 1UUVB 3PZWA 1IQXA 1W6GA 1VQP3 1LOYA 4BU4A 3FKAA 1GY7A 2D42A 5FW5A 4HM2B 2GSPA 3T8UA 3G0KA 2YFLB 1FZUA 3T8NA 1JB5A 3JUPA 1RRLA 1PU4A 3AHSA 3EX9A 3JUNA 2OQEC 1LNHA 1RSNA 2XSOB 5LC7A 1FGMA 2PZVA 2HMKB 3OWUA 3SLUA 1WNHA 4WYKB 2BMOB 1KSIA 1MGWA 1B2ZA 4MMYB 1BSAA 3LZAA 4TX4A 1QALA 2ZL8A 1SARA 3CNXA 1GOVA 1A2VA 2BO9B 1IQYA 1LOVA 4KZ1A 1BNGA 1GMPA 2F86B 2RSXA 2Y74A 3FSDA 3G713 3MSOA 4GSPA 2RGQA 3DH2A 8CHOA 1BSCA 1B2UA 1QVF2 1BNJA 1EA2A 3CU3A 1NNVA 5G2GA 1TU5A 1RN1A 3DGMA 3HI7A 1NU3A 4HZBB 3K63A 3D4AA 6STDA 1OUNA 3ZG0A 4FCZA 1AY7A 3WA3A 1IT8A 2MF7A 4HYZA 5AI1A 1K734 1TRQA 5DREA 3K0ZA 5M1AA 1Q9EA 3TDGA 2WO0A 1AQZA 4R1KA 1OPYA 4KFDA 5AEWB 1FW7A 3EQQB 1IV9A 3NXJA 4PEJA 1PFPA 2CFLA 3HIGA 1CQSA 3L0RA 3NBRA 3A5EA 2K0MA 1NB3I 1S723 4N6V0 1A90A 2CWUA 3KKGA 1CYVA 3CCQ3 2GU1A 1DVDA 1W2ZA 1N8R4 2KRTA 2D1WA 4HM0B 2GBXB 1Z1SA 3HZPA 3NV0B 1JNQA 1YGEA 2ML5A 3STDA 1UCLA 7GSPA 1I70A 5IEOA 4O2HA 1YHQ3 1JN5A 2OCTA 3V92A 3EC9A 1LQGC 3G4S3 3D3LA 1KD14 4N6LA 4N3VA 3UL5A 3X41A 3LTDA 5ELUA 3FF0A 3HIIA 2CX1A 3B8LA 3FGYA 3GRDA 1VQO3 1B2MA 2KAAA 1JKGA 1NO3A 2O3OA 1IV7A 1SIIA 2XF3A 3DGLA 3DGYA 2OOVC 3KIIA 3NHXA 1GD3A 1BRHA 1W6YA 2XGNA 1JV2B 1NDOB 4JRFA 1X1WA 2BU4A 1ASKA 1IVVA 3BNDA 1S5AA 4FMAA 1I2EA 5AYRB 4BTYA 3CC43 1JB4A 1IVXA 2RBIA 2A15A 2LYXA 4NREA 1GOUA 1JZOA 1ZO2A 3O8YA 3I563 1RHLA 3X3YA 3CMA3 1YNVX 3FG3A 4HJLB 2AADA 5JBSA 3OX9A 1BUQA 1BNSA 3S28A 1O7WB 2GU3A 4HM3B 3JUQA 2WGQA 3KZTA 1RGAA 5BXQA 1Q824 1TFKA 1FGTA 1V58A 1O7GB 4FR9A 3ZFZA 3NQYA 1LOXA 3Q2PA 3WMDA 1VQM3 1GY6A 1GSPA 3S67A 1WMPA 4XBXA 7STDA 1LOWA 3F7XA 3LT9A 1Q814 4QWTA 2ML6A 4HM8B 1FGQA 1W02A 3AMOA 1MGRA 2FNQA 1V57A 3S27A 1SJWA 1RRHA 1K8A4 1OHPA 3CNMA 5KP1A 3ZG5A 3WODG 4EV2A 3G8ZA 3J7Yd 1BIRA 5BVBA 3F40A 4FCJA 2CIUA 4K90B 5CF2A 1IQ8A 1NWWA 5IEPA 1OCVA 4AKZA 2IA7A 2XFTA 2BT3A 2KF5A 5G1LA 5M19A 3CCE3 1QJGA 1UUGB 3FLJA 2HMJB 1YIT3 1I8VA 1DMNA 3F9SA 2UUGC 4LGQA 1RGEA 2P05A 3MG3A 3RGRA 1C54A 1ULJB 1DVCA 1TJDA 4K1VA 1DE3A 4HVNA 3NM2A 5FGOA 4LEHA 3VGNA 3CC23 1GOYA 2CWTA 4U13A 3X42A 3KE7A 2E2UA 1O7MB 3SOYA 1JRQA 2BMQB 3OWYA 4HM1B 3IJEB 4XDWA 2H0GA 2CFKA 3OV4A 4X2OA 4XBTA 4J5KA 3CXC2 1LXEA 3X3ZA 5BU4A 1IVWA 1R4YA 1W4NA 1RN7A 2BHMA 2IMJA 4K61A 2OTL3 2QIYA 4WP5A 1A2KA 5IG0A 3N8BA 4N6TA 1MWUA 2F5MA 1G0TA 2INXA 1M1XB 3M8CA 1BRNL 1OHSA 2CX0A 2HMMB 3WHOA 1Y4KA 3OXAA 3CC73 2W03A 3SX1A 1PY3A 5IG5A 1JBRA 1W2B2 3DXOA 2Z77A 4EYCA 1T3BA 2CKFB 1HKXA 3MG1A 2Y73A 4KVHA 3JVCA 3A76A 1GS3A 1HYFA 1JN5B 1JBSA 4HM4B 3UL6A 3CPOA 1RJOA 2IUJA 1VZZA 5IF6A 3HX8A 2W9QA
chains in the Genus database with same CATH topology
5HOHA 4HAAA 1B27A 8RNTA 3D5IA 1B2MA 2KAAA 4BIRA 1T2IA 2AAEA 3DGYA 1B3SA 1BRHA 1BU4A 1I2GA 4RNTA 1BVIA 2F4YA 3HOHA 1FYSA 1RGKA 2ZA4A 3URPA 1RGHA 1BRJA 1X1WA 2BU4A 1I2EA 3AHWA 2RBIA 1I3IA 1GOUA 1BGSA 9RNTA 1GMRA 1PYLA 1BANA 1RHLA 1YNVX 3GSPA 1RMSA 1BRGA 1BRIA 2HOHA 2AADA 5BIRA 1BNSA 1B2XA 1FUTA 1UCIA 1TTOA 5RNTA 2KF3A 1I0XA 1RDSA 1RGAA 3RNTA 1FUSA 1ZGXA 1RN4A 1BNRA 3D5GA 3KCHA 1I2FA 2F5WA 3WR2A 2SARA 1B20A 1BNFA 1BSBA 1GSPA 1LRAA 1LOWA 1RTUA 1B2SA 1MGRA 1T2HA 3BU4A 4J5GA 1BRSA 1LOYA 4BU4A 1A2PA 1CH0A 1X1UA 2GSPA 1BIRA 1JBTA 2BIRA 1FZUA 1I0VA 1RGCA 3AHSA 4GHOA 1RLSA 1RCLA 1RSNA 1UCJA 3BIRA 2KF5A 1MGWA 1B2ZA 1I8VA 1BSAA 3SYUA 1RGEA 1UCKA 1SARA 1X1XA 1C54A 1BRKA 1GOVA 1RGGA 1LOVA 7RNTA 1DE3A 1BNGA 1GMPA 2KF6A 1RNTA 2RNTA 1GOYA 1YGWA 2KF4A 1X1YA 3DH2A 1BSCA 1B2UA 4GSPA 1BNJA 1HZ1A 1BAOA 3AGOA 1RN1A 3D4AA 1AY7A 4J5KA 6RNTA 1BOXA 5BU4A 2F56A 3AGNA 6GSPA 1R4YA 1RGFA 1TRQA 1Q9EA 1RCKA 1AQZA 1I3FA 1BNIA 1FW7A 1IYYA 2F5MA 1B21A 1BRNL 1TRPA 3A5EA 1BNEA 1BUJA 1GMQA 3WHOA 1LNIA 1BSEA 1PY3A 1JBRA 1YVSA 1RNBA 1BSDA 1DETA 4HOHA 7GSPA 1UCLA 3Q3FA 1RGLA 1HYFA 1I70A 1JBSA 2C4BA 1G02A 5GSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HOH A;  4HAA A;  1B27 A;  8RNT A;  3D5I A;  1B2M A;  2KAA A;  4BIR A;  1T2I A;  2AAE A;  3DGY A;  1B3S A;  1BRH A;  1BU4 A;  1I2G A;  4RNT A;  1BVI A;  2F4Y A;  3HOH A;  1FYS A;  1RGK A;  2ZA4 A;  3URP A;  1RGH A;  1BRJ A;  1X1W A;  2BU4 A;  1I2E A;  3AHW A;  2RBI A;  1I3I A;  1GOU A;  1BGS A;  9RNT A;  1GMR A;  1PYL A;  1BAN A;  1RHL A;  1YNV X;  3GSP A;  1RMS A;  1BRG A;  1BRI A;  2HOH A;  2AAD A;  5BIR A;  1BNS A;  1B2X A;  1FUT A;  1UCI A;  1TTO A;  5RNT A;  2KF3 A;  1I0X A;  1RDS A;  1RGA A;  3RNT A;  1FUS A;  1ZGX A;  1RN4 A;  1BNR A;  3D5G A;  3KCH A;  1I2F A;  2F5W A;  3WR2 A;  2SAR A;  1B20 A;  1BNF A;  1BSB A;  1GSP A;  1LRA A;  1LOW A;  1RTU A;  1B2S A;  1MGR A;  1T2H A;  3BU4 A;  4J5G A;  1BRS A;  1LOY A;  4BU4 A;  1A2P A;  1CH0 A;  1X1U A;  2GSP A;  1BIR A;  1JBT A;  2BIR A;  1FZU A;  1I0V A;  1RGC A;  3AHS A;  4GHO A;  1RLS A;  1RCL A;  1RSN A;  1UCJ A;  3BIR A;  2KF5 A;  1MGW A;  1B2Z A;  1I8V A;  1BSA A;  3SYU A;  1RGE A;  1UCK A;  1SAR A;  1X1X A;  1C54 A;  1BRK A;  1GOV A;  1RGG A;  1LOV A;  7RNT A;  1DE3 A;  1BNG A;  1GMP A;  2KF6 A;  1RNT A;  2RNT A;  1GOY A;  1YGW A;  2KF4 A;  1X1Y A;  3DH2 A;  1BSC A;  1B2U A;  4GSP A;  1BNJ A;  1HZ1 A;  1BAO A;  3AGO A;  1RN1 A;  3D4A A;  1AY7 A;  4J5K A;  6RNT A;  1BOX A;  5BU4 A;  2F56 A;  3AGN A;  6GSP A;  1R4Y A;  1RGF A;  1TRQ A;  1Q9E A;  1RCK A;  1AQZ A;  1I3F A;  1BNI A;  1FW7 A;  1IYY A;  2F5M A;  1B21 A;  1BRN L;  1TRP A;  3A5E A;  1BNE A;  1BUJ A;  1GMQ A;  3WHO A;  1LNI A;  1BSE A;  1PY3 A;  1JBR A;  1YVS A;  1RNB A;  1BSD A;  1DET A;  4HOH A;  7GSP A;  1UCL A;  3Q3F A;  1RGL A;  1HYF A;  1I70 A;  1JBS A;  2C4B A;  1G02 A;  5GSP A; 
#chains in the Genus database with same CATH topology
 4HAA A;  3H3H A;  1L5G B;  3D5I A;  3EF8 A;  2P0X A;  1MNL A;  1W7C A;  1LQM B;  4RBN A;  1JKG B;  1U8C B;  4MJD A;  4BIR A;  2YFI B;  2YFJ B;  1B3S A;  3CCL 3;  3LYG A;  1BU4 A;  1N8Q A;  2F4Y A;  2FGT A;  1A67 A;  3Q90 A;  2ZA4 A;  1N5P A;  2IUK A;  2CC3 A;  1ISK A;  2KCD A;  2C10 A;  2IYJ A;  2W56 A;  1ROA A;  2XFS A;  1Q7Y 4;  1VQ9 3;  1AVK A;  5KP3 A;  1D6Y A;  3CME 3;  1I3I A;  3GZR A;  1BGS A;  1GMR A;  4EW5 A;  1D6U A;  1O7H B;  1BAN A;  3GWR A;  3NBJ A;  3GSP A;  4EV5 A;  1UUW B;  1BRG A;  2BNG A;  1BRI A;  4XBY A;  2GEY A;  2FXT A;  1YVB I;  1UCI A;  1RDS A;  4HM5 B;  1FUS A;  3MG2 A;  2M7O A;  3D5G A;  1OF5 A;  1KQS 2;  4ORL A;  3MKI A;  3WOE B;  4BL3 A;  4WFO A;  3I55 3;  5CF1 A;  1BNF A;  1TUH A;  4R4K A;  1LRA A;  1V74 A;  5JPU A;  4BTX A;  5KP4 A;  1RTU A;  1B2S A;  1TFO A;  2LQV A;  3AMO B;  4KFE A;  2CG0 A;  2R41 A;  1Q40 A;  3MPH A;  3FG4 A;  3KFQ C;  4J5G A;  5I97 A;  3ROB A;  2XRX B;  2Z76 A;  1U5O A;  4MEI A;  1BRS A;  3F14 A;  3S5C A;  1VQ6 3;  1OGX A;  1A2P A;  4AKY A;  1CH0 A;  3BNE A;  1X1U A;  3DY5 A;  3LTB A;  3GZX B;  1AVL A;  1Q7H A;  1CYU A;  1RKY A;  3RGA A;  3OW2 2;  1YJW 3;  4L8P A;  1QAF A;  4EC6 A;  4R9L A;  3ECF A;  4GHO A;  3H51 A;  1MWR A;  3X3X A;  1UCJ A;  4MMZ B;  4ILF A;  4WWU C;  5DRV A;  1JZD A;  4IPB A;  5CK6 A;  1M90 4;  3FG1 A;  4GL6 A;  1QAK A;  3LOY A;  1W00 A;  4LYL B;  4KFF A;  5TGN A;  2L1S A;  1M1K 4;  2W6J H;  1RGG A;  1E3R A;  1JB2 A;  3Q1C A;  2KF6 A;  1FGO A;  2QA4 3;  1RNT A;  2SBL A;  1OGZ A;  3OWS A;  2KF4 A;  5A0O B;  4LSO A;  3F8H A;  1HZ1 A;  4I4K A;  1EEJ A;  1MWT A;  3BB9 A;  1VQ8 3;  1GY5 A;  3X40 A;  1W01 A;  3GAX A;  1N5H A;  3PCS A;  5EVH A;  6RNT A;  1BOX A;  3D79 A;  2F56 A;  2RFR A;  2Z6B A;  3K7C A;  4L8O A;  4Q53 A;  6GSP A;  4J8T A;  2HMO B;  2CHC A;  5G1K A;  2XSH B;  1BNI A;  1N9J A;  1TRP A;  2OQE A;  2R4I A;  1BNE A;  3SXX A;  1YJN 3;  1UI8 A;  3U97 A;  5M18 A;  1UW1 A;  3KSE D;  2J8X B;  1YIJ 3;  3SOA A;  1OAC A;  4GB5 A;  2I9W A;  1YVS A;  2XGL A;  1DET A;  4R80 A;  3BLZ A;  3K9M C;  3VSY A;  1KWI A;  4O8S A;  3Q3F A;  2B24 B;  3G6E 3;  3VF1 A;  3JUM A;  1WMO A;  2W04 A;  5GSP A;  5HOH A;  3CCM 3;  5LC6 A;  8RNT A;  1STD A;  3EJV A;  5HGR A;  3DZL A;  2UGI A;  3UJM A;  1FA3 A;  3DGO A;  3EBY A;  2O9U X;  3WA2 X;  1VQQ A;  3FZW A;  2ZDJ A;  2AAE A;  4ZM8 A;  1UGI A;  3DUK A;  1AR0 A;  1DMQ A;  4I5Q A;  2YX9 A;  3LT8 A;  2W0Q A;  1TIJ A;  4HKV B;  1BVI A;  3FCS B;  3CD6 3;  3HOH A;  1FYS A;  2F99 A;  5IER A;  4CJN A;  2QEX 3;  4BL2 A;  1T5Y A;  3URP A;  2W56 B;  1E97 A;  4LZI A;  1BRJ A;  1AV4 A;  1K41 A;  3CPW 2;  3SVA A;  2JDI H;  4FCM A;  5EEO A;  3CCU 3;  3PS8 A;  4FMC A;  9RNT A;  1PYL A;  3F7S A;  3EN8 A;  1IDP A;  1IK3 A;  3DMC A;  3PCR A;  5IW9 A;  5CXO A;  3EN1 B;  2HOH A;  5IG4 A;  3LXU X;  4O3V A;  1IU7 A;  3B4P A;  3V98 A;  2UX0 A;  4H61 A;  1OH0 A;  2GEX A;  5AEU B;  5RNT A;  3BNC A;  3RNT A;  5ELJ A;  1IVU A;  1OF5 B;  4HBR A;  2K3D A;  1I2F A;  2L4V A;  3LML A;  2OOV A;  1B20 A;  4LMI A;  1K9M 4;  1UGH I;  2CW9 A;  2ZHX B;  3MYT A;  4MMX B;  2HMN B;  3WOF B;  4STD A;  1ULI B;  1Q40 B;  4H3U A;  3CCV 3;  1T2H A;  2GXF A;  1STF I;  5STD A;  1F8N A;  1OHO A;  2XEP A;  4G1M B;  2CFD A;  1M9G A;  3FF2 A;  4L7K A;  1Q86 4;  3NM7 A;  4N6M A;  1EG9 B;  1MOL A;  4WHA A;  4R9K A;  1JBT A;  3QRD A;  3PXM A;  5AIF A;  3K5T A;  4OVM A;  4FMD A;  1GYB A;  1QMA A;  2BIR A;  3MHE A;  3MWZ A;  4AEQ A;  1I0V A;  1RGC A;  2RCD A;  3E99 A;  3IMA B;  2MC8 A;  2F98 A;  3D9R A;  1RLS A;  3N54 B;  5AII A;  1RCL A;  1K28 A;  2GBW B;  3BIR A;  1GD4 A;  3IPT A;  4WYK A;  3LTC A;  2CWV A;  2V1L A;  1TP6 A;  3NBB A;  5EQL A;  3GZY B;  3T0U A;  3CCS 3;  1VQ4 3;  4HM7 B;  3SYU A;  3LH4 A;  5AIH A;  1UDI I;  4XM4 A;  1UCK A;  1EUI C;  1SQW A;  1FUW A;  1X1X A;  1O7N B;  1R4C A;  1BRK A;  1ZS7 A;  3SED A;  7RNT A;  2RNT A;  2IY2 A;  4NHF A;  1KC8 4;  1YGW A;  1X1Y A;  2P38 A;  3S29 A;  1ZX2 A;  2W2C A;  3V99 A;  1JJ2 2;  3BNB A;  1BAO A;  3AGO A;  4IIA A;  1W6C A;  2HML B;  4IT7 A;  3PGB A;  1J2B A;  2H0I A;  3AGN A;  3EBT A;  3B7C A;  4EXR A;  1RGF A;  3NX0 A;  2E2T A;  4HZ9 B;  1CEW I;  1DYU A;  1RCK A;  1I3F A;  2XR8 B;  2QGU A;  5D83 A;  4NPB A;  1IYY A;  2B1X B;  4N6N B;  2WGO A;  1B21 A;  2W9P A;  1QVG 2;  1MWS A;  2P09 A;  3FH1 A;  1GMQ A;  1BUJ A;  2STD A;  2P0M A;  3DM8 A;  1LNI A;  1VQN 3;  1W5Z A;  1BSE A;  2E2V A;  4HM6 B;  3NUV A;  1HU9 A;  2PNC A;  2CG1 A;  4JF8 A;  3F8X A;  5D82 A;  1BSD A;  3NV0 A;  3HK4 A;  4HOH A;  3RDE A;  5AYS C;  4OUQ A;  1RNB A;  1Q42 A;  1LVN A;  4N6O B;  1RGL A;  2CK3 H;  4CDL A;  3N9H A;  3G16 A;  2C4B A;  1VQ7 3;  1VQ5 3;  1DMM A;  1G02 A;  3GZB A;  1B27 A;  1YJ9 3;  5CLK A;  1WMN A;  1NB5 I;  3LTA A;  3KSP A;  1D6Z A;  4N6U A;  1NJI 4;  3UNL A;  1T2I A;  4RZM A;  1IT7 A;  3B4O A;  4KT3 B;  3DGN A;  1I2G A;  4RNT A;  3QK9 A;  4DKI A;  4RNZ A;  2CFG A;  1RGK A;  1EKM A;  1RGH A;  1ROV A;  1WQL B;  4X2H A;  1WTH A;  2H0H A;  4O02 B;  1E3V A;  1SIH A;  1US1 A;  2JQ5 A;  4OK0 A;  3AHW A;  4K1U A;  1VQK 3;  3CCR 3;  2CH9 A;  5IG3 A;  3ALA A;  4EBG A;  1G96 A;  4CPK A;  1RMS A;  1UI7 A;  5D81 A;  5BIR A;  4RNY A;  1B2X A;  1FUT A;  2WOH A;  1TTO A;  1O7P B;  5IEN A;  4FMB A;  4CCV A;  2KF3 A;  2WOF A;  1I0X A;  3JUO A;  3ER7 A;  4XB5 A;  3EB8 A;  1ZGX A;  3EHC A;  1VQL 3;  1RN4 A;  2C11 A;  5JPP A;  2K54 A;  3KCH A;  3KN4 A;  2CFW A;  3CCJ 3;  1BNR A;  1FGR A;  3NQZ A;  2F5W A;  3WR2 A;  2SAR A;  4BTW A;  2BMR B;  1N9E A;  2KXG A;  3I0Y A;  3EE1 A;  1BSB A;  1EQK A;  1YI2 3;  2Q07 A;  3PYJ A;  5AIG A;  2OWP A;  4XDV A;  4J9A A;  2XH9 A;  3WDG B;  3U1W A;  2OTJ 3;  1SPU A;  3BU4 A;  1C7H A;  3UB1 A;  2Z7A A;  1UUV B;  3PZW A;  1IQX A;  1W6G A;  1VQP 3;  1LOY A;  4BU4 A;  3FKA A;  1GY7 A;  2D42 A;  5FW5 A;  4HM2 B;  2GSP A;  3T8U A;  3G0K A;  2YFL B;  1FZU A;  3T8N A;  1JB5 A;  3JUP A;  1RRL A;  1PU4 A;  3AHS A;  3EX9 A;  3JUN A;  2OQE C;  1LNH A;  1RSN A;  2XSO B;  5LC7 A;  1FGM A;  2PZV A;  2HMK B;  3OWU A;  3SLU A;  1WNH A;  4WYK B;  2BMO B;  1KSI A;  1MGW A;  1B2Z A;  4MMY B;  1BSA A;  3LZA A;  4TX4 A;  1QAL A;  2ZL8 A;  1SAR A;  3CNX A;  1GOV A;  1A2V A;  2BO9 B;  1IQY A;  1LOV A;  4KZ1 A;  1BNG A;  1GMP A;  2F86 B;  2RSX A;  2Y74 A;  3FSD A;  3G71 3;  3MSO A;  4GSP A;  2RGQ A;  3DH2 A;  8CHO A;  1BSC A;  1B2U A;  1QVF 2;  1BNJ A;  1EA2 A;  3CU3 A;  1NNV A;  5G2G A;  1TU5 A;  1RN1 A;  3DGM A;  3HI7 A;  1NU3 A;  4HZB B;  3K63 A;  3D4A A;  6STD A;  1OUN A;  3ZG0 A;  4FCZ A;  1AY7 A;  3WA3 A;  1IT8 A;  2MF7 A;  4HYZ A;  5AI1 A;  1K73 4;  1TRQ A;  5DRE A;  3K0Z A;  5M1A A;  1Q9E A;  3TDG A;  2WO0 A;  1AQZ A;  4R1K A;  1OPY A;  4KFD A;  5AEW B;  1FW7 A;  3EQQ B;  1IV9 A;  3NXJ A;  4PEJ A;  1PFP A;  2CFL A;  3HIG A;  1CQS A;  3L0R A;  3NBR A;  3A5E A;  2K0M A;  1NB3 I;  1S72 3;  4N6V 0;  1A90 A;  2CWU A;  3KKG A;  1CYV A;  3CCQ 3;  2GU1 A;  1DVD A;  1W2Z A;  1N8R 4;  2KRT A;  2D1W A;  4HM0 B;  2GBX B;  1Z1S A;  3HZP A;  3NV0 B;  1JNQ A;  1YGE A;  2ML5 A;  3STD A;  1UCL A;  7GSP A;  1I70 A;  5IEO A;  4O2H A;  1YHQ 3;  1JN5 A;  2OCT A;  3V92 A;  3EC9 A;  1LQG C;  3G4S 3;  3D3L A;  1KD1 4;  4N6L A;  4N3V A;  3UL5 A;  3X41 A;  3LTD A;  5ELU A;  3FF0 A;  3HII A;  2CX1 A;  3B8L A;  3FGY A;  3GRD A;  1VQO 3;  1B2M A;  2KAA A;  1JKG A;  1NO3 A;  2O3O A;  1IV7 A;  1SII A;  2XF3 A;  3DGL A;  3DGY A;  2OOV C;  3KII A;  3NHX A;  1GD3 A;  1BRH A;  1W6Y A;  2XGN A;  1JV2 B;  1NDO B;  4JRF A;  1X1W A;  2BU4 A;  1ASK A;  1IVV A;  3BND A;  1S5A A;  4FMA A;  1I2E A;  5AYR B;  4BTY A;  3CC4 3;  1JB4 A;  1IVX A;  2RBI A;  2A15 A;  2LYX A;  4NRE A;  1GOU A;  1JZO A;  1ZO2 A;  3O8Y A;  3I56 3;  1RHL A;  3X3Y A;  3CMA 3;  1YNV X;  3FG3 A;  4HJL B;  2AAD A;  5JBS A;  3OX9 A;  1BUQ A;  1BNS A;  3S28 A;  1O7W B;  2GU3 A;  4HM3 B;  3JUQ A;  2WGQ A;  3KZT A;  1RGA A;  5BXQ A;  1Q82 4;  1TFK A;  1FGT A;  1V58 A;  1O7G B;  4FR9 A;  3ZFZ A;  3NQY A;  1LOX A;  3Q2P A;  3WMD A;  1VQM 3;  1GY6 A;  1GSP A;  3S67 A;  1WMP A;  4XBX A;  7STD A;  1LOW A;  3F7X A;  3LT9 A;  1Q81 4;  4QWT A;  2ML6 A;  4HM8 B;  1FGQ A;  1W02 A;  3AMO A;  1MGR A;  2FNQ A;  1V57 A;  3S27 A;  1SJW A;  1RRH A;  1K8A 4;  1OHP A;  3CNM A;  5KP1 A;  3ZG5 A;  3WOD G;  4EV2 A;  3G8Z A;  3J7Y d;  1BIR A;  5BVB A;  3F40 A;  4FCJ A;  2CIU A;  4K90 B;  5CF2 A;  1IQ8 A;  1NWW A;  5IEP A;  1OCV A;  4AKZ A;  2IA7 A;  2XFT A;  2BT3 A;  2KF5 A;  5G1L A;  5M19 A;  3CCE 3;  1QJG A;  1UUG B;  3FLJ A;  2HMJ B;  1YIT 3;  1I8V A;  1DMN A;  3F9S A;  2UUG C;  4LGQ A;  1RGE A;  2P05 A;  3MG3 A;  3RGR A;  1C54 A;  1ULJ B;  1DVC A;  1TJD A;  4K1V A;  1DE3 A;  4HVN A;  3NM2 A;  5FGO A;  4LEH A;  3VGN A;  3CC2 3;  1GOY A;  2CWT A;  4U13 A;  3X42 A;  3KE7 A;  2E2U A;  1O7M B;  3SOY A;  1JRQ A;  2BMQ B;  3OWY A;  4HM1 B;  3IJE B;  4XDW A;  2H0G A;  2CFK A;  3OV4 A;  4X2O A;  4XBT A;  4J5K A;  3CXC 2;  1LXE A;  3X3Z A;  5BU4 A;  1IVW A;  1R4Y A;  1W4N A;  1RN7 A;  2BHM A;  2IMJ A;  4K61 A;  2OTL 3;  2QIY A;  4WP5 A;  1A2K A;  5IG0 A;  3N8B A;  4N6T A;  1MWU A;  2F5M A;  1G0T A;  2INX A;  1M1X B;  3M8C A;  1BRN L;  1OHS A;  2CX0 A;  2HMM B;  3WHO A;  1Y4K A;  3OXA A;  3CC7 3;  2W03 A;  3SX1 A;  1PY3 A;  5IG5 A;  1JBR A;  1W2B 2;  3DXO A;  2Z77 A;  4EYC A;  1T3B A;  2CKF B;  1HKX A;  3MG1 A;  2Y73 A;  4KVH A;  3JVC A;  3A76 A;  1GS3 A;  1HYF A;  1JN5 B;  1JBS A;  4HM4 B;  3UL6 A;  3CPO A;  1RJO A;  2IUJ A;  1VZZ A;  5IF6 A;  3HX8 A;  2W9Q A; 
#chains in the Genus database with same CATH homology
 5HOH A;  4HAA A;  1B27 A;  8RNT A;  3D5I A;  1B2M A;  2KAA A;  4BIR A;  1T2I A;  2AAE A;  3DGY A;  1B3S A;  1BRH A;  1BU4 A;  1I2G A;  4RNT A;  1BVI A;  2F4Y A;  3HOH A;  1FYS A;  1RGK A;  2ZA4 A;  3URP A;  1RGH A;  1BRJ A;  1X1W A;  2BU4 A;  1I2E A;  3AHW A;  2RBI A;  1I3I A;  1GOU A;  1BGS A;  9RNT A;  1GMR A;  1PYL A;  1BAN A;  1RHL A;  1YNV X;  3GSP A;  1RMS A;  1BRG A;  1BRI A;  2HOH A;  2AAD A;  5BIR A;  1BNS A;  1B2X A;  1FUT A;  1UCI A;  1TTO A;  5RNT A;  2KF3 A;  1I0X A;  1RDS A;  1RGA A;  3RNT A;  1FUS A;  1ZGX A;  1RN4 A;  1BNR A;  3D5G A;  3KCH A;  1I2F A;  2F5W A;  3WR2 A;  2SAR A;  1B20 A;  1BNF A;  1BSB A;  1GSP A;  1LRA A;  1LOW A;  1RTU A;  1B2S A;  1MGR A;  1T2H A;  3BU4 A;  4J5G A;  1BRS A;  1LOY A;  4BU4 A;  1A2P A;  1CH0 A;  1X1U A;  2GSP A;  1BIR A;  1JBT A;  2BIR A;  1FZU A;  1I0V A;  1RGC A;  3AHS A;  4GHO A;  1RLS A;  1RCL A;  1RSN A;  1UCJ A;  3BIR A;  2KF5 A;  1MGW A;  1B2Z A;  1I8V A;  1BSA A;  3SYU A;  1RGE A;  1UCK A;  1SAR A;  1X1X A;  1C54 A;  1BRK A;  1GOV A;  1RGG A;  1LOV A;  7RNT A;  1DE3 A;  1BNG A;  1GMP A;  2KF6 A;  1RNT A;  2RNT A;  1GOY A;  1YGW A;  2KF4 A;  1X1Y A;  3DH2 A;  1BSC A;  1B2U A;  4GSP A;  1BNJ A;  1HZ1 A;  1BAO A;  3AGO A;  1RN1 A;  3D4A A;  1AY7 A;  4J5K A;  6RNT A;  1BOX A;  5BU4 A;  2F56 A;  3AGN A;  6GSP A;  1R4Y A;  1RGF A;  1TRQ A;  1Q9E A;  1RCK A;  1AQZ A;  1I3F A;  1BNI A;  1FW7 A;  1IYY A;  2F5M A;  1B21 A;  1BRN L;  1TRP A;  3A5E A;  1BNE A;  1BUJ A;  1GMQ A;  3WHO A;  1LNI A;  1BSE A;  1PY3 A;  1JBR A;  1YVS A;  1RNB A;  1BSD A;  1DET A;  4HOH A;  7GSP A;  1UCL A;  3Q3F A;  1RGL A;  1HYF A;  1I70 A;  1JBS A;  2C4B A;  1G02 A;  5GSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...