1BNSA

Structural studies of barnase mutants
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYIAKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BARNASE
publication title Contribution of buried hydrogen bonds to protein stability. The crystal structures of two barnase mutants.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Endonuclease
total genus 30
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 1994-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1bnsA00
3DGYA 5RNTA 2RBIA 3D4AA 3RNTA 1LOWA 1BSBA 4BIRA 1I2EA 1X1XA 2KF4A 1I0VA 1BVIA 5HOHA 1BNRA 1T2IA 3D5GA 1Q9EA 1BSEA 3SYUA 1RGCA 3AHWA 1UCIA 1PYLA 1BRJA 2F5WA 3D5IA 1FW7A 1BAOA 1I2GA 1FUSA 1LNIA 1YGWA 2SARA 1YNVX 2KF5A 1BSCA 1LOYA 1A2PA 1RGFA 2F56A 1X1WA 1GMPA 1RN4A 1LOVA 1PY3A 1RGGA 6RNTA 1AQZA 4RNTA 1X1YA 5GSPA 1BNGA 1TRPA 3A5EA 1B2XA 1I8VA 1GOYA 2BU4A 1UCLA 1ZGXA 1BNJA 3WHOA 1BANA 3KCHA 1C54A 1BNEA 1BIRA 4HAAA 2C4BA 7RNTA 1RGAA 1GSPA 1B27A 2AAEA 3AGNA 4HOHA 1SARA 1RGEA 1GOVA 1RCLA 1RDSA 1HYFA 1BRGA 1B2ZA 1BUJA 1BU4A 1RHLA 1BSAA 2ZA4A 4GHOA 1B20A 1TTOA 1I2FA 1TRQA 1B2UA 2KF6A 1BRNL 1DETA 1FYSA 1IYYA 1MGWA 1RGKA 1RGLA 1HZ1A 2GSPA 3Q3FA 8RNTA 1GOUA 2HOHA 2F4YA 6GSPA 1FUTA 1B21A 2F5MA 1BRHA 1BOXA 1LRAA 1RLSA 1BNFA 1I3IA 1JBRA 7GSPA 1RN1A 1T2HA 5BU4A 4J5GA 1I0XA 1YVSA 1B2MA 4BU4A 2KAAA 1MGRA 1R4YA 3HOHA 1I70A 1I3FA 5BIRA 1UCJA 1B3SA 1GMRA 3WR2A 3AHSA 3AGOA 1JBSA 1BNIA 1B2SA 1BNSA 2BIRA 2RNTA 4GSPA 3DH2A 1RNBA 1AY7A 1RNTA 1BRKA 2AADA 1BGSA 1RMSA 3GSPA 1BRIA 1RTUA 3BIRA 2KF3A 3URPA 1JBTA 1RCKA 1UCKA 1DE3A 3BU4A 1FZUA 1RSNA 4J5KA 9RNTA 1CH0A 1X1UA 1GMQA 1G02A 1RGHA 1BSDA 1BRSA
chains in the Genus database with same CATH superfamily
1STDA 5RNTA 3H3HA 1VQN3 3DGLA 6STDA 2UX0A 1Z1SA 1FGRA 3PZWA 1R4CA 2RGQA 1IQ8A 3S5CA 3DM8A 2QIYA 2R41A 3NV0A 1M904 1VQL3 3D9RA 3EJVA 1I0VA 3QRDA 4N6LA 3D5GA 5IG0A 1MOLA 1JZDA 3V98A 3X41A 3G713 3DGMA 1JN5B 1SQWA 4GL6A 1PYLA 1A90A 1BRJA 2RFRA 4EW5A 1LNIA 1YGWA 4MJDA 2KF5A 2GEXA 1LOYA 1RGFA 3DGNA 1TUHA 4MMXB 2JQ5A 3K0ZA 3NBBA 2MC8A 3SEDA 1RRLA 3TDGA 1AQZA 3CCJ3 4ZM8A 1VQ83 3MPHA 1BNGA 1GY7A 2A15A 3A5EA 3EF8A 4AEQA 1I8VA 3OV4A 4PEJA 3GZBA 5ELJA 5HGRA 1Q7Y4 3CMA3 4FCMA 1YJW3 1EQKA 1BNJA 1QALA 5AIFA 3T0UA 3CCU3 4HZBB 2YFLB 2CFLA 3NBJA 1C54A 4H61A 5I97A 3EHCA 1A2KA 1UGHI 2W9QA 2W0QA 1RGAA 2ZDJA 3AGNA 3LTAA 4KVHA 5AEWB 7RNTA 1CQSA 4O2HA 1HKXA 1RKYA 1W7CA 2WOHA 3CCE3 3BNDA 1B2ZA 1ULIB 1J2BA 2Z77A 1BU4A 1BUJA 1N9JA 3L0RA 2OQEC 3NUVA 4NREA 5FGOA 5IW9A 1F8NA 1B2UA 2KF6A 2XRXB 1FYSA 3JUQA 4K1VA 1IT7A 3CCS3 2F86B 1K9M4 3K7CA 2P09A 4XDVA 3ZG5A 1LVNA 5KP4A 1HZ1A 2GSPA 1NB5I 5CK6A 3I0YA 1W02A 2GXFA 2P05A 5BVBA 6GSPA 1CYUA 4LEHA 1FUTA 1B21A 3F9SA 3IPTA 2CC3A 1BOXA 1Q42A 2O9UX 2W9PA 3KIIA 4XBXA 4CDLA 3QK9A 4J9AA 4KFEA 1RN1A 3EBYA 3OW22 3LH4A 2XGNA 1JB2A 3B4PA 1T2HA 3PCRA 1DVDA 3SOYA 3F40A 1Q864 1I0XA 3MWZA 4RNZA 5D81A 3CME3 3CCR3 2KAAA 4EC6A 2CIUA 4HJLB 4IT7A 3HOHA 3U1WA 4ORLA 5IF6A 4HKVB 4OVMA 5BIRA 1KSIA 4XDWA 3STDA 4WHAA 3KE7A 2HMKB 3AMOB 1IVVA 1T3BA 3OXAA 5AYSC 1L5GB 2K0MA 3UJMA 5CF1A 4WWUC 5EEOA 1W5ZA 4BL2A 1TU5A 1W2B2 4ILFA 3EB8A 3KN4A 3FG1A 2OTL3 1AY7A 4HM7B 2XR8B 2L1SA 5D82A 1V57A 3A76A 2D42A 5JBSA 1K28A 1MNLA 1MWTA 2WOFA 1AVKA 1E97A 4N6MA 1RTUA 5LC7A 3JUNA 3UL5A 2INXA 1UCKA 1DE3A 5IG4A 4J5KA 9RNTA 1OUNA 1CH0A 1FGMA 2M7OA 1S5AA 2B1XB 2XH9A 3G4S3 3SXXA 1G02A 2CWUA 2HMOB 1VQO3 3CCM3 1IU7A 2OOVC 1U8CB 1A2VA 5DRVA 3CCL3 2KXGA 1LOWA 2BT3A 1BSBA 3UNLA 3T8UA 1SIHA 3G0KA 5A0OB 3CXC2 3F14A 1OH0A 4WYKA 3VGNA 2JDIH 3CPW2 4CJNA 2Y73A 1G96A 4R9KA 2W04A 1IT8A 3MG2A 2QEX3 3DXOA 2SARA 2PNCA 2WO0A 4LZIA 1W6CA 1YNVX 2XFSA 3J7Yd 1BSCA 2P38A 3KFQC 3WOFB 1A2PA 4XM4A 2F56A 1MWUA 4EV5A 3F7SA 3LZAA 1RN4A 1ZS7A 2BMRB 2H0HA 2HMMB 3ALAA 3LTDA 2CW9A 1CEWI 3NQYA 4AKZA 1QMAA 3B4OA 1OF5A 1JNQA 1Q7HA 1N9EA 2RSXA 1NWWA 1K41A 2V1LA 3JVCA 1V74A 4HM6B 1YIT3 1ROAA 2XEPA 3OWUA 1YIJ3 1A67A 2CWVA 1ZGXA 4FMAA 4N6NB 1O7NB 2F99A 4BTWA 3WHOA 2PZVA 1S723 1SJWA 2CK3H 1BNEA 1BIRA 3PYJA 1M1XB 2C4BA 2HMJB 5KP3A 1JKGA 3NV0B 3NBRA 1V58A 4H3UA 4K1UA 2GU1A 5M1AA 1NO3A 1ISKA 5LC6A 3EE1A 1GS3A 1GOVA 1Q40B 1RCLA 1RDSA 3F8XA 3UB1A 4K90B 2XSHB 1BRGA 1W01A 1W6YA 1YHQ3 3WODG 1RHLA 3H51A 2ZA4A 1B20A 4NHFA 3HK4A 1TTOA 2YFJB 1TRQA 2E2TA 1UUVB 1IK3A 3B8LA 1IYYA 2XGLA 1MGWA 3N8BA 1M1K4 4LYLB 5IG3A 1FUWA 1MWRA 3FG4A 3KSED 4EBGA 1DMMA 1OCVA 3G16A 4WP5A 2STDA 2XF3A 3CCQ3 1BRHA 1C7HA 4L7KA 7GSPA 3M8CA 3LYGA 2W6JH 4JRFA 1MWSA 2Q07A 2LQVA 3GZYB 4J5GA 1N8R4 3WMDA 3NQZA 3FF2A 1WNHA 1B2MA 3KKGA 1I70A 2ML6A 3LT9A 4FCZA 4HVNA 1FGOA 4LMIA 4OK0A 1GMRA 4HM1B 1JB5A 3F8HA 4HZ9B 1JBSA 1BNIA 4BTXA 1D6UA 1D6ZA 1B2SA 3IJEB 3JUMA 1UW1A 4R80A 2H0IA 2CFWA 2WGQA 2K54A 5IERA 1IQYA 1JZOA 1RNBA 4JF8A 1NDOB 4XBTA 1RNTA 2CFKA 3EN8A 3CNMA 5M18A 1RMSA 4IPBA 3MG3A 4HBRA 2BMQB 4GB5A 3JUPA 3S27A 3UL6A 3CC23 4DKIA 3BU4A 1IQXA 8CHOA 5KP1A 1KC84 4RNYA 1K734 4HM2B 1QVG2 1EKMA 1GMQA 2W56A 1DMQA 3T8NA 3D79A 1E3VA 4BTYA 3DGYA 1PU4A 2RBIA 3D4AA 3RNTA 1QJGA 1IVWA 1LOXA 3GWRA 5ELUA 1CYVA 3RGAA 1EUIC 4BIRA 3PCSA 1NJI4 4CPKA 1OACA 2KF4A 4MMZB 7STDA 1Y4KA 1ULJB 4U13A 1VQK3 1BVIA 1GD3A 1VQ73 5HOHA 3CC73 1T2IA 4KFFA 5D83A 1O7GB 3HX8A 1TFOA 1RGCA 3DMCA 3K9MC 4O8SA 3HIIA 3VSYA 1N5HA 3MG1A 4G1MB 1EEJA 5BXQA 2F5WA 3D5IA 1FW7A 1I2GA 2BHMA 3LTCA 1AR0A 1FUSA 3NHXA 1RJOA 4FMBA 2BMOB 2OTJ3 2CFGA 3BB9A 1ROVA 1K8A4 4KZ1A 1LOVA 1PY3A 1W4NA 4HM5B 6RNTA 1GYBA 5GSPA 1TRPA 1IVXA 3ECFA 2K3DA 1M9GA 1WTHA 1GOYA 1JRQA 2P0XA 1EA2A 1WMOA 3E99A 1BANA 3KCHA 3CNXA 2YX9A 4XB5A 5CLKA 3F7XA 2YFIB 1LNHA 2AAEA 4WYKB 4HOHA 5STDA 1ZX2A 1RGEA 1VZZA 1US1A 2O3OA 4HM4B 5M19A 1UDII 4R9LA 3HI7A 4QWTA 1ASKA 4I4KA 4FCJA 1NNVA 3EX9A 1EG9B 5G1KA 5JPPA 1BSAA 1IV7A 1LQMB 3CCV3 1OGZA 4N6OB 1IV9A 4RBNA 4RZMA 1I2FA 3LMLA 3V92A 2ZL8A 4CCVA 1G0TA 2Z76A 1RGKA 1IDPA 3Q3FA 2XFTA 1GOUA 2RCDA 3FLJA 3SVAA 5AI1A 1YJN3 4FMCA 2FGTA 2F5MA 1OF5B 3CC43 2GBWB 1BNFA 1I3IA 1JBRA 3MSOA 2CX0A 1JJ22 4L8OA 1IVUA 4STDA 5EQLA 5G2GA 2J8XB 2WGOA 4XBYA 2CHCA 3MHEA 2GEYA 2Z7AA 2OWPA 5BU4A 3N54B 1YVSA 3CPOA 1Q814 2CFDA 3D3LA 4MMYB 1JKGB 1VQ93 1R4YA 2E2VA 2IUJA 3GAXA 1O7HB 1B3SA 2ZHXB 3WR2A 1NB3I 1NU3A 2D1WA 2C10A 1DVCA 4LSOA 4NPBA 3O8YA 2OCTA 1JB4A 5AYRB 1VQM3 5G1LA 3CD63 1U5OA 1FGTA 3ZFZA 1VQ43 2CKFB 2HMLB 1QVF2 1JN5A 1VQ53 4GSPA 4O02B 2IMJA 3N9HA 1Q40A 3S28A 4N6V0 5TGNA 3Q2PA 4N6UA 1BRKA 2UUGC 2FNQA 3ZG0A 4LGQA 4X2OA 2ML5A 3OWYA 1BUQA 5IEOA 3GSPA 1BRIA 4O3VA 3Q1CA 2KF3A 3B7CA 4IIAA 5AIHA 3URPA 5JPUA 1JBTA 5CXOA 1SPUA 4N6TA 1DMNA 1N8QA 1FZUA 1RSNA 2B24B 3DUKA 3PXMA 3BNBA 3GZRA 1O7WB 1VQ63 1ZO2A 1RGHA 1YI23 1WMNA 2CH9A 1BRSA 1RN7A 1LXEA 1DYUA 3HZPA 1HU9A 2IA7A 4AKYA 1I2EA 1X1XA 3EBTA 3DY5A 1UI8A 4K61A 2W2CA 3PS8A 3RDEA 4HM0B 3SX1A 3WDGB 3S29A 1QAFA 1BNRA 1UGIA 1Q9EA 1BSEA 1RRHA 3SLUA 3SYUA 1WQLB 1T5YA 3AHWA 3VF1A 1UCIA 1OHPA 2KRTA 2IY2A 3DZLA 4FMDA 4HM3B 1PFPA 3G6E3 3FCSB 2CWTA 1BAOA 2CX1A 2MF7A 4HYZA 3S67A 1KQS2 2R4IA 3KSPA 3V99A 2QA43 1GD4A 4N3VA 5AIGA 3FGYA 2LYXA 3FH1A 3EQQB 3WOEB 2I9WA 5DREA 3IMAB 3EC9A 2QGUA 1O7PB 1GMPA 1X1WA 3NM7A 4MEIA 2OQEA 1RGGA 1LQGC 2Y74A 4FR9A 4RNTA 3X42A 1X1YA 1AV4A 2IYJA 3MYTA 1B2XA 4Q53A 2IUKA 2UGIA 2BU4A 1UCLA 2SBLA 2W56B 1TIJA 3FF0A 2H0GA 3NXJA 2P0MA 1VQP3 3RGRA 4HAAA 4R1KA 1YVBI 3K63A 3KZTA 2BO9B 3GZXB 1GSPA 1B27A 5IENA 1SARA 5AEUB 3X3YA 3X3ZA 1HYFA 3AMOA 3FZWA 4L8PA 3G8ZA 1QAKA 3BNEA 4X2HA 4GHOA 3ROBA 3CU3A 3SOAA 1BRNL 1KD14 1DETA 2E2UA 3EN1B 1RGLA 4KFDA 1UUWB 8RNTA 4I5QA 2HOHA 4EV2A 2F4YA 3NM2A 1WMPA 3ER7A 1YJ93 1YGEA 5IG5A 1LRAA 2W03A 1RLSA 2Z6BA 3GRDA 2CG0A 3WA2X 4TX4A 3X40A 4R4KA 5FW5A 3PGBA 4BL3A 2F98A 1AVLA 2HMNB 1GY5A 3LXUX 4J8TA 4OUQA 1MGRA 3FKAA 4BU4A 3I553 1I3FA 3NX0A 1UCJA 1TJDA 1N5PA 3DGOA 2GU3A 3AHSA 1FGQA 3MKIA 2L4VA 3Q90A 3AGOA 3U97A 4HM8B 1STFI 1JV2B 1OHOA 1O7MB 1BNSA 1KWIA 2BIRA 2FXTA 2RNTA 3OX9A 3LOYA 2OOVA 5EVHA 2KCDA 1W2ZA 1VQQA 3BNCA 3X3XA 3DH2A 3BLZA 1UI7A 1SIIA 3FSDA 1OGXA 1W6GA 3LT8A 5CF2A 1TP6A 4EYCA 3K5TA 3HIGA 1Q824 3OWSA 1UUGB 2AADA 1W00A 3FG3A 1E3RA 1BGSA 4KT3B 2C11A 3BIRA 5AIIA 1FA3A 4WFOA 3WA3A 3LTBA 1RCKA 2CG1A 2BNGA 1TFKA 1GY6A 1D6YA 1X1UA 2GBXB 3JUOA 2XSOB 1OPYA 5IEPA 3I563 1OHSA 1BSDA 4EXRA
chains in the Genus database with same CATH topology
3DGYA 5RNTA 2RBIA 3D4AA 3RNTA 1LOWA 1BSBA 4BIRA 1I2EA 1X1XA 2KF4A 1I0VA 1BVIA 5HOHA 1BNRA 1T2IA 3D5GA 1Q9EA 1BSEA 3SYUA 1RGCA 3AHWA 1UCIA 1PYLA 1BRJA 2F5WA 3D5IA 1FW7A 1BAOA 1I2GA 1FUSA 1LNIA 1YGWA 2SARA 1YNVX 2KF5A 1BSCA 1LOYA 1A2PA 1RGFA 2F56A 1X1WA 1GMPA 1RN4A 1LOVA 1PY3A 1RGGA 6RNTA 1AQZA 4RNTA 1X1YA 5GSPA 1BNGA 1TRPA 3A5EA 1B2XA 1I8VA 1GOYA 2BU4A 1UCLA 1ZGXA 1BNJA 3WHOA 1BANA 3KCHA 1C54A 1BNEA 1BIRA 4HAAA 2C4BA 7RNTA 1RGAA 1GSPA 1B27A 2AAEA 3AGNA 4HOHA 1SARA 1RGEA 1GOVA 1RCLA 1RDSA 1HYFA 1BRGA 1B2ZA 1BUJA 1BU4A 1RHLA 1BSAA 2ZA4A 4GHOA 1B20A 1TTOA 1I2FA 1TRQA 1B2UA 2KF6A 1BRNL 1DETA 1FYSA 1IYYA 1MGWA 1RGKA 1RGLA 1HZ1A 2GSPA 3Q3FA 8RNTA 1GOUA 2HOHA 2F4YA 6GSPA 1FUTA 1B21A 2F5MA 1BRHA 1BOXA 1LRAA 1RLSA 1BNFA 1I3IA 1JBRA 7GSPA 1RN1A 1T2HA 5BU4A 4J5GA 1I0XA 1YVSA 1B2MA 4BU4A 2KAAA 1MGRA 1R4YA 3HOHA 1I70A 1I3FA 5BIRA 1UCJA 1B3SA 1GMRA 3WR2A 3AHSA 3AGOA 1JBSA 1BNIA 1B2SA 1BNSA 2BIRA 2RNTA 4GSPA 3DH2A 1RNBA 1AY7A 1RNTA 1BRKA 2AADA 1BGSA 1RMSA 3GSPA 1BRIA 1RTUA 3BIRA 2KF3A 3URPA 1JBTA 1RCKA 1UCKA 1DE3A 3BU4A 1FZUA 1RSNA 4J5KA 9RNTA 1CH0A 1X1UA 1GMQA 1G02A 1RGHA 1BSDA 1BRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DGY A;  5RNT A;  2RBI A;  3D4A A;  3RNT A;  1LOW A;  1BSB A;  4BIR A;  1I2E A;  1X1X A;  2KF4 A;  1I0V A;  1BVI A;  5HOH A;  1BNR A;  1T2I A;  3D5G A;  1Q9E A;  1BSE A;  3SYU A;  1RGC A;  3AHW A;  1UCI A;  1PYL A;  1BRJ A;  2F5W A;  3D5I A;  1FW7 A;  1BAO A;  1I2G A;  1FUS A;  1LNI A;  1YGW A;  2SAR A;  1YNV X;  2KF5 A;  1BSC A;  1LOY A;  1A2P A;  1RGF A;  2F56 A;  1X1W A;  1GMP A;  1RN4 A;  1LOV A;  1PY3 A;  1RGG A;  6RNT A;  1AQZ A;  4RNT A;  1X1Y A;  5GSP A;  1BNG A;  1TRP A;  3A5E A;  1B2X A;  1I8V A;  1GOY A;  2BU4 A;  1UCL A;  1ZGX A;  1BNJ A;  3WHO A;  1BAN A;  3KCH A;  1C54 A;  1BNE A;  1BIR A;  4HAA A;  2C4B A;  7RNT A;  1RGA A;  1GSP A;  1B27 A;  2AAE A;  3AGN A;  4HOH A;  1SAR A;  1RGE A;  1GOV A;  1RCL A;  1RDS A;  1HYF A;  1BRG A;  1B2Z A;  1BUJ A;  1BU4 A;  1RHL A;  1BSA A;  2ZA4 A;  4GHO A;  1B20 A;  1TTO A;  1I2F A;  1TRQ A;  1B2U A;  2KF6 A;  1BRN L;  1DET A;  1FYS A;  1IYY A;  1MGW A;  1RGK A;  1RGL A;  1HZ1 A;  2GSP A;  3Q3F A;  8RNT A;  1GOU A;  2HOH A;  2F4Y A;  6GSP A;  1FUT A;  1B21 A;  2F5M A;  1BRH A;  1BOX A;  1LRA A;  1RLS A;  1BNF A;  1I3I A;  1JBR A;  7GSP A;  1RN1 A;  1T2H A;  5BU4 A;  4J5G A;  1I0X A;  1YVS A;  1B2M A;  4BU4 A;  2KAA A;  1MGR A;  1R4Y A;  3HOH A;  1I70 A;  1I3F A;  5BIR A;  1UCJ A;  1B3S A;  1GMR A;  3WR2 A;  3AHS A;  3AGO A;  1JBS A;  1BNI A;  1B2S A;  1BNS A;  2BIR A;  2RNT A;  4GSP A;  3DH2 A;  1RNB A;  1AY7 A;  1RNT A;  1BRK A;  2AAD A;  1BGS A;  1RMS A;  3GSP A;  1BRI A;  1RTU A;  3BIR A;  2KF3 A;  3URP A;  1JBT A;  1RCK A;  1UCK A;  1DE3 A;  3BU4 A;  1FZU A;  1RSN A;  4J5K A;  9RNT A;  1CH0 A;  1X1U A;  1GMQ A;  1G02 A;  1RGH A;  1BSD A;  1BRS A; 
#chains in the Genus database with same CATH topology
 1STD A;  5RNT A;  3H3H A;  1VQN 3;  3DGL A;  6STD A;  2UX0 A;  1Z1S A;  1FGR A;  3PZW A;  1R4C A;  2RGQ A;  1IQ8 A;  3S5C A;  3DM8 A;  2QIY A;  2R41 A;  3NV0 A;  1M90 4;  1VQL 3;  3D9R A;  3EJV A;  1I0V A;  3QRD A;  4N6L A;  3D5G A;  5IG0 A;  1MOL A;  1JZD A;  3V98 A;  3X41 A;  3G71 3;  3DGM A;  1JN5 B;  1SQW A;  4GL6 A;  1PYL A;  1A90 A;  1BRJ A;  2RFR A;  4EW5 A;  1LNI A;  1YGW A;  4MJD A;  2KF5 A;  2GEX A;  1LOY A;  1RGF A;  3DGN A;  1TUH A;  4MMX B;  2JQ5 A;  3K0Z A;  3NBB A;  2MC8 A;  3SED A;  1RRL A;  3TDG A;  1AQZ A;  3CCJ 3;  4ZM8 A;  1VQ8 3;  3MPH A;  1BNG A;  1GY7 A;  2A15 A;  3A5E A;  3EF8 A;  4AEQ A;  1I8V A;  3OV4 A;  4PEJ A;  3GZB A;  5ELJ A;  5HGR A;  1Q7Y 4;  3CMA 3;  4FCM A;  1YJW 3;  1EQK A;  1BNJ A;  1QAL A;  5AIF A;  3T0U A;  3CCU 3;  4HZB B;  2YFL B;  2CFL A;  3NBJ A;  1C54 A;  4H61 A;  5I97 A;  3EHC A;  1A2K A;  1UGH I;  2W9Q A;  2W0Q A;  1RGA A;  2ZDJ A;  3AGN A;  3LTA A;  4KVH A;  5AEW B;  7RNT A;  1CQS A;  4O2H A;  1HKX A;  1RKY A;  1W7C A;  2WOH A;  3CCE 3;  3BND A;  1B2Z A;  1ULI B;  1J2B A;  2Z77 A;  1BU4 A;  1BUJ A;  1N9J A;  3L0R A;  2OQE C;  3NUV A;  4NRE A;  5FGO A;  5IW9 A;  1F8N A;  1B2U A;  2KF6 A;  2XRX B;  1FYS A;  3JUQ A;  4K1V A;  1IT7 A;  3CCS 3;  2F86 B;  1K9M 4;  3K7C A;  2P09 A;  4XDV A;  3ZG5 A;  1LVN A;  5KP4 A;  1HZ1 A;  2GSP A;  1NB5 I;  5CK6 A;  3I0Y A;  1W02 A;  2GXF A;  2P05 A;  5BVB A;  6GSP A;  1CYU A;  4LEH A;  1FUT A;  1B21 A;  3F9S A;  3IPT A;  2CC3 A;  1BOX A;  1Q42 A;  2O9U X;  2W9P A;  3KII A;  4XBX A;  4CDL A;  3QK9 A;  4J9A A;  4KFE A;  1RN1 A;  3EBY A;  3OW2 2;  3LH4 A;  2XGN A;  1JB2 A;  3B4P A;  1T2H A;  3PCR A;  1DVD A;  3SOY A;  3F40 A;  1Q86 4;  1I0X A;  3MWZ A;  4RNZ A;  5D81 A;  3CME 3;  3CCR 3;  2KAA A;  4EC6 A;  2CIU A;  4HJL B;  4IT7 A;  3HOH A;  3U1W A;  4ORL A;  5IF6 A;  4HKV B;  4OVM A;  5BIR A;  1KSI A;  4XDW A;  3STD A;  4WHA A;  3KE7 A;  2HMK B;  3AMO B;  1IVV A;  1T3B A;  3OXA A;  5AYS C;  1L5G B;  2K0M A;  3UJM A;  5CF1 A;  4WWU C;  5EEO A;  1W5Z A;  4BL2 A;  1TU5 A;  1W2B 2;  4ILF A;  3EB8 A;  3KN4 A;  3FG1 A;  2OTL 3;  1AY7 A;  4HM7 B;  2XR8 B;  2L1S A;  5D82 A;  1V57 A;  3A76 A;  2D42 A;  5JBS A;  1K28 A;  1MNL A;  1MWT A;  2WOF A;  1AVK A;  1E97 A;  4N6M A;  1RTU A;  5LC7 A;  3JUN A;  3UL5 A;  2INX A;  1UCK A;  1DE3 A;  5IG4 A;  4J5K A;  9RNT A;  1OUN A;  1CH0 A;  1FGM A;  2M7O A;  1S5A A;  2B1X B;  2XH9 A;  3G4S 3;  3SXX A;  1G02 A;  2CWU A;  2HMO B;  1VQO 3;  3CCM 3;  1IU7 A;  2OOV C;  1U8C B;  1A2V A;  5DRV A;  3CCL 3;  2KXG A;  1LOW A;  2BT3 A;  1BSB A;  3UNL A;  3T8U A;  1SIH A;  3G0K A;  5A0O B;  3CXC 2;  3F14 A;  1OH0 A;  4WYK A;  3VGN A;  2JDI H;  3CPW 2;  4CJN A;  2Y73 A;  1G96 A;  4R9K A;  2W04 A;  1IT8 A;  3MG2 A;  2QEX 3;  3DXO A;  2SAR A;  2PNC A;  2WO0 A;  4LZI A;  1W6C A;  1YNV X;  2XFS A;  3J7Y d;  1BSC A;  2P38 A;  3KFQ C;  3WOF B;  1A2P A;  4XM4 A;  2F56 A;  1MWU A;  4EV5 A;  3F7S A;  3LZA A;  1RN4 A;  1ZS7 A;  2BMR B;  2H0H A;  2HMM B;  3ALA A;  3LTD A;  2CW9 A;  1CEW I;  3NQY A;  4AKZ A;  1QMA A;  3B4O A;  1OF5 A;  1JNQ A;  1Q7H A;  1N9E A;  2RSX A;  1NWW A;  1K41 A;  2V1L A;  3JVC A;  1V74 A;  4HM6 B;  1YIT 3;  1ROA A;  2XEP A;  3OWU A;  1YIJ 3;  1A67 A;  2CWV A;  1ZGX A;  4FMA A;  4N6N B;  1O7N B;  2F99 A;  4BTW A;  3WHO A;  2PZV A;  1S72 3;  1SJW A;  2CK3 H;  1BNE A;  1BIR A;  3PYJ A;  1M1X B;  2C4B A;  2HMJ B;  5KP3 A;  1JKG A;  3NV0 B;  3NBR A;  1V58 A;  4H3U A;  4K1U A;  2GU1 A;  5M1A A;  1NO3 A;  1ISK A;  5LC6 A;  3EE1 A;  1GS3 A;  1GOV A;  1Q40 B;  1RCL A;  1RDS A;  3F8X A;  3UB1 A;  4K90 B;  2XSH B;  1BRG A;  1W01 A;  1W6Y A;  1YHQ 3;  3WOD G;  1RHL A;  3H51 A;  2ZA4 A;  1B20 A;  4NHF A;  3HK4 A;  1TTO A;  2YFJ B;  1TRQ A;  2E2T A;  1UUV B;  1IK3 A;  3B8L A;  1IYY A;  2XGL A;  1MGW A;  3N8B A;  1M1K 4;  4LYL B;  5IG3 A;  1FUW A;  1MWR A;  3FG4 A;  3KSE D;  4EBG A;  1DMM A;  1OCV A;  3G16 A;  4WP5 A;  2STD A;  2XF3 A;  3CCQ 3;  1BRH A;  1C7H A;  4L7K A;  7GSP A;  3M8C A;  3LYG A;  2W6J H;  4JRF A;  1MWS A;  2Q07 A;  2LQV A;  3GZY B;  4J5G A;  1N8R 4;  3WMD A;  3NQZ A;  3FF2 A;  1WNH A;  1B2M A;  3KKG A;  1I70 A;  2ML6 A;  3LT9 A;  4FCZ A;  4HVN A;  1FGO A;  4LMI A;  4OK0 A;  1GMR A;  4HM1 B;  1JB5 A;  3F8H A;  4HZ9 B;  1JBS A;  1BNI A;  4BTX A;  1D6U A;  1D6Z A;  1B2S A;  3IJE B;  3JUM A;  1UW1 A;  4R80 A;  2H0I A;  2CFW A;  2WGQ A;  2K54 A;  5IER A;  1IQY A;  1JZO A;  1RNB A;  4JF8 A;  1NDO B;  4XBT A;  1RNT A;  2CFK A;  3EN8 A;  3CNM A;  5M18 A;  1RMS A;  4IPB A;  3MG3 A;  4HBR A;  2BMQ B;  4GB5 A;  3JUP A;  3S27 A;  3UL6 A;  3CC2 3;  4DKI A;  3BU4 A;  1IQX A;  8CHO A;  5KP1 A;  1KC8 4;  4RNY A;  1K73 4;  4HM2 B;  1QVG 2;  1EKM A;  1GMQ A;  2W56 A;  1DMQ A;  3T8N A;  3D79 A;  1E3V A;  4BTY A;  3DGY A;  1PU4 A;  2RBI A;  3D4A A;  3RNT A;  1QJG A;  1IVW A;  1LOX A;  3GWR A;  5ELU A;  1CYV A;  3RGA A;  1EUI C;  4BIR A;  3PCS A;  1NJI 4;  4CPK A;  1OAC A;  2KF4 A;  4MMZ B;  7STD A;  1Y4K A;  1ULJ B;  4U13 A;  1VQK 3;  1BVI A;  1GD3 A;  1VQ7 3;  5HOH A;  3CC7 3;  1T2I A;  4KFF A;  5D83 A;  1O7G B;  3HX8 A;  1TFO A;  1RGC A;  3DMC A;  3K9M C;  4O8S A;  3HII A;  3VSY A;  1N5H A;  3MG1 A;  4G1M B;  1EEJ A;  5BXQ A;  2F5W A;  3D5I A;  1FW7 A;  1I2G A;  2BHM A;  3LTC A;  1AR0 A;  1FUS A;  3NHX A;  1RJO A;  4FMB A;  2BMO B;  2OTJ 3;  2CFG A;  3BB9 A;  1ROV A;  1K8A 4;  4KZ1 A;  1LOV A;  1PY3 A;  1W4N A;  4HM5 B;  6RNT A;  1GYB A;  5GSP A;  1TRP A;  1IVX A;  3ECF A;  2K3D A;  1M9G A;  1WTH A;  1GOY A;  1JRQ A;  2P0X A;  1EA2 A;  1WMO A;  3E99 A;  1BAN A;  3KCH A;  3CNX A;  2YX9 A;  4XB5 A;  5CLK A;  3F7X A;  2YFI B;  1LNH A;  2AAE A;  4WYK B;  4HOH A;  5STD A;  1ZX2 A;  1RGE A;  1VZZ A;  1US1 A;  2O3O A;  4HM4 B;  5M19 A;  1UDI I;  4R9L A;  3HI7 A;  4QWT A;  1ASK A;  4I4K A;  4FCJ A;  1NNV A;  3EX9 A;  1EG9 B;  5G1K A;  5JPP A;  1BSA A;  1IV7 A;  1LQM B;  3CCV 3;  1OGZ A;  4N6O B;  1IV9 A;  4RBN A;  4RZM A;  1I2F A;  3LML A;  3V92 A;  2ZL8 A;  4CCV A;  1G0T A;  2Z76 A;  1RGK A;  1IDP A;  3Q3F A;  2XFT A;  1GOU A;  2RCD A;  3FLJ A;  3SVA A;  5AI1 A;  1YJN 3;  4FMC A;  2FGT A;  2F5M A;  1OF5 B;  3CC4 3;  2GBW B;  1BNF A;  1I3I A;  1JBR A;  3MSO A;  2CX0 A;  1JJ2 2;  4L8O A;  1IVU A;  4STD A;  5EQL A;  5G2G A;  2J8X B;  2WGO A;  4XBY A;  2CHC A;  3MHE A;  2GEY A;  2Z7A A;  2OWP A;  5BU4 A;  3N54 B;  1YVS A;  3CPO A;  1Q81 4;  2CFD A;  3D3L A;  4MMY B;  1JKG B;  1VQ9 3;  1R4Y A;  2E2V A;  2IUJ A;  3GAX A;  1O7H B;  1B3S A;  2ZHX B;  3WR2 A;  1NB3 I;  1NU3 A;  2D1W A;  2C10 A;  1DVC A;  4LSO A;  4NPB A;  3O8Y A;  2OCT A;  1JB4 A;  5AYR B;  1VQM 3;  5G1L A;  3CD6 3;  1U5O A;  1FGT A;  3ZFZ A;  1VQ4 3;  2CKF B;  2HML B;  1QVF 2;  1JN5 A;  1VQ5 3;  4GSP A;  4O02 B;  2IMJ A;  3N9H A;  1Q40 A;  3S28 A;  4N6V 0;  5TGN A;  3Q2P A;  4N6U A;  1BRK A;  2UUG C;  2FNQ A;  3ZG0 A;  4LGQ A;  4X2O A;  2ML5 A;  3OWY A;  1BUQ A;  5IEO A;  3GSP A;  1BRI A;  4O3V A;  3Q1C A;  2KF3 A;  3B7C A;  4IIA A;  5AIH A;  3URP A;  5JPU A;  1JBT A;  5CXO A;  1SPU A;  4N6T A;  1DMN A;  1N8Q A;  1FZU A;  1RSN A;  2B24 B;  3DUK A;  3PXM A;  3BNB A;  3GZR A;  1O7W B;  1VQ6 3;  1ZO2 A;  1RGH A;  1YI2 3;  1WMN A;  2CH9 A;  1BRS A;  1RN7 A;  1LXE A;  1DYU A;  3HZP A;  1HU9 A;  2IA7 A;  4AKY A;  1I2E A;  1X1X A;  3EBT A;  3DY5 A;  1UI8 A;  4K61 A;  2W2C A;  3PS8 A;  3RDE A;  4HM0 B;  3SX1 A;  3WDG B;  3S29 A;  1QAF A;  1BNR A;  1UGI A;  1Q9E A;  1BSE A;  1RRH A;  3SLU A;  3SYU A;  1WQL B;  1T5Y A;  3AHW A;  3VF1 A;  1UCI A;  1OHP A;  2KRT A;  2IY2 A;  3DZL A;  4FMD A;  4HM3 B;  1PFP A;  3G6E 3;  3FCS B;  2CWT A;  1BAO A;  2CX1 A;  2MF7 A;  4HYZ A;  3S67 A;  1KQS 2;  2R4I A;  3KSP A;  3V99 A;  2QA4 3;  1GD4 A;  4N3V A;  5AIG A;  3FGY A;  2LYX A;  3FH1 A;  3EQQ B;  3WOE B;  2I9W A;  5DRE A;  3IMA B;  3EC9 A;  2QGU A;  1O7P B;  1GMP A;  1X1W A;  3NM7 A;  4MEI A;  2OQE A;  1RGG A;  1LQG C;  2Y74 A;  4FR9 A;  4RNT A;  3X42 A;  1X1Y A;  1AV4 A;  2IYJ A;  3MYT A;  1B2X A;  4Q53 A;  2IUK A;  2UGI A;  2BU4 A;  1UCL A;  2SBL A;  2W56 B;  1TIJ A;  3FF0 A;  2H0G A;  3NXJ A;  2P0M A;  1VQP 3;  3RGR A;  4HAA A;  4R1K A;  1YVB I;  3K63 A;  3KZT A;  2BO9 B;  3GZX B;  1GSP A;  1B27 A;  5IEN A;  1SAR A;  5AEU B;  3X3Y A;  3X3Z A;  1HYF A;  3AMO A;  3FZW A;  4L8P A;  3G8Z A;  1QAK A;  3BNE A;  4X2H A;  4GHO A;  3ROB A;  3CU3 A;  3SOA A;  1BRN L;  1KD1 4;  1DET A;  2E2U A;  3EN1 B;  1RGL A;  4KFD A;  1UUW B;  8RNT A;  4I5Q A;  2HOH A;  4EV2 A;  2F4Y A;  3NM2 A;  1WMP A;  3ER7 A;  1YJ9 3;  1YGE A;  5IG5 A;  1LRA A;  2W03 A;  1RLS A;  2Z6B A;  3GRD A;  2CG0 A;  3WA2 X;  4TX4 A;  3X40 A;  4R4K A;  5FW5 A;  3PGB A;  4BL3 A;  2F98 A;  1AVL A;  2HMN B;  1GY5 A;  3LXU X;  4J8T A;  4OUQ A;  1MGR A;  3FKA A;  4BU4 A;  3I55 3;  1I3F A;  3NX0 A;  1UCJ A;  1TJD A;  1N5P A;  3DGO A;  2GU3 A;  3AHS A;  1FGQ A;  3MKI A;  2L4V A;  3Q90 A;  3AGO A;  3U97 A;  4HM8 B;  1STF I;  1JV2 B;  1OHO A;  1O7M B;  1BNS A;  1KWI A;  2BIR A;  2FXT A;  2RNT A;  3OX9 A;  3LOY A;  2OOV A;  5EVH A;  2KCD A;  1W2Z A;  1VQQ A;  3BNC A;  3X3X A;  3DH2 A;  3BLZ A;  1UI7 A;  1SII A;  3FSD A;  1OGX A;  1W6G A;  3LT8 A;  5CF2 A;  1TP6 A;  4EYC A;  3K5T A;  3HIG A;  1Q82 4;  3OWS A;  1UUG B;  2AAD A;  1W00 A;  3FG3 A;  1E3R A;  1BGS A;  4KT3 B;  2C11 A;  3BIR A;  5AII A;  1FA3 A;  4WFO A;  3WA3 A;  3LTB A;  1RCK A;  2CG1 A;  2BNG A;  1TFK A;  1GY6 A;  1D6Y A;  1X1U A;  2GBX B;  3JUO A;  2XSO B;  1OPY A;  5IEP A;  3I56 3;  1OHS A;  1BSD A;  4EXR A; 
#chains in the Genus database with same CATH homology
 3DGY A;  5RNT A;  2RBI A;  3D4A A;  3RNT A;  1LOW A;  1BSB A;  4BIR A;  1I2E A;  1X1X A;  2KF4 A;  1I0V A;  1BVI A;  5HOH A;  1BNR A;  1T2I A;  3D5G A;  1Q9E A;  1BSE A;  3SYU A;  1RGC A;  3AHW A;  1UCI A;  1PYL A;  1BRJ A;  2F5W A;  3D5I A;  1FW7 A;  1BAO A;  1I2G A;  1FUS A;  1LNI A;  1YGW A;  2SAR A;  1YNV X;  2KF5 A;  1BSC A;  1LOY A;  1A2P A;  1RGF A;  2F56 A;  1X1W A;  1GMP A;  1RN4 A;  1LOV A;  1PY3 A;  1RGG A;  6RNT A;  1AQZ A;  4RNT A;  1X1Y A;  5GSP A;  1BNG A;  1TRP A;  3A5E A;  1B2X A;  1I8V A;  1GOY A;  2BU4 A;  1UCL A;  1ZGX A;  1BNJ A;  3WHO A;  1BAN A;  3KCH A;  1C54 A;  1BNE A;  1BIR A;  4HAA A;  2C4B A;  7RNT A;  1RGA A;  1GSP A;  1B27 A;  2AAE A;  3AGN A;  4HOH A;  1SAR A;  1RGE A;  1GOV A;  1RCL A;  1RDS A;  1HYF A;  1BRG A;  1B2Z A;  1BUJ A;  1BU4 A;  1RHL A;  1BSA A;  2ZA4 A;  4GHO A;  1B20 A;  1TTO A;  1I2F A;  1TRQ A;  1B2U A;  2KF6 A;  1BRN L;  1DET A;  1FYS A;  1IYY A;  1MGW A;  1RGK A;  1RGL A;  1HZ1 A;  2GSP A;  3Q3F A;  8RNT A;  1GOU A;  2HOH A;  2F4Y A;  6GSP A;  1FUT A;  1B21 A;  2F5M A;  1BRH A;  1BOX A;  1LRA A;  1RLS A;  1BNF A;  1I3I A;  1JBR A;  7GSP A;  1RN1 A;  1T2H A;  5BU4 A;  4J5G A;  1I0X A;  1YVS A;  1B2M A;  4BU4 A;  2KAA A;  1MGR A;  1R4Y A;  3HOH A;  1I70 A;  1I3F A;  5BIR A;  1UCJ A;  1B3S A;  1GMR A;  3WR2 A;  3AHS A;  3AGO A;  1JBS A;  1BNI A;  1B2S A;  1BNS A;  2BIR A;  2RNT A;  4GSP A;  3DH2 A;  1RNB A;  1AY7 A;  1RNT A;  1BRK A;  2AAD A;  1BGS A;  1RMS A;  3GSP A;  1BRI A;  1RTU A;  3BIR A;  2KF3 A;  3URP A;  1JBT A;  1RCK A;  1UCK A;  1DE3 A;  3BU4 A;  1FZU A;  1RSN A;  4J5K A;  9RNT A;  1CH0 A;  1X1U A;  1GMQ A;  1G02 A;  1RGH A;  1BSD A;  1BRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...