1BNSA

Structural studies of barnase mutants
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
108
structure length
108
Chain Sequence
b'VINTFDGVADYLQTYHKLPDNYIAKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BARNASE
publication title Contribution of buried hydrogen bonds to protein stability. The crystal structures of two barnase mutants.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Endonuclease
total genus 30
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 1994-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1bnsA00
2BU4A 1JBRA 3HOHA 1BSAA 1T2HA 1DETA 1I3FA 3RNTA 3AGOA 3SYUA 1BNJA 3KCHA 1BRNL 2F56A 1B3SA 1BIRA 1GOVA 2BIRA 1FUTA 1GOYA 1SARA 1BRKA 4GHOA 1X1WA 1BANA 1UCKA 2AADA 3A5EA 1B2MA 1BRGA 1UCIA 1BOXA 1I2EA 1JBSA 1RTUA 1TRPA 1HYFA 1RGLA 1C54A 1ZGXA 3AGNA 1B20A 1B2XA 1TTOA 1I2FA 1TRQA 1BAOA 1I2GA 1RGEA 1RNBA 1RGKA 5GSPA 6GSPA 6RNTA 1FUSA 1RN4A 2F5MA 3AHWA 3URPA 4HAAA 3WR2A 1LOVA 2AAEA 2KF6A 1BRSA 1IYYA 3D5GA 1BNGA 1RCKA 1UCJA 1R4YA 1AY7A 7GSPA 1YVSA 1B2ZA 1BSBA 1BNEA 1DE3A 1RHLA 3BU4A 4J5GA 5HOHA 1I70A 1X1UA 2F5WA 4GSPA 1FW7A 1B21A 1LNIA 1FZUA 2KF5A 3DH2A 1RDSA 1BRHA 1PY3A 1X1XA 2GSPA 1BSCA 2C4BA 1MGWA 1GMPA 3D5IA 1G02A 1RNTA 4BU4A 1B27A 4J5KA 1BNRA 1BGSA 2KF3A 1X1YA 2F4YA 1BSEA 5BIRA 1JBTA 1I0VA 1I3IA 1BNSA 5BU4A 1RGGA 3GSPA 1BSDA 1RCLA 1RGCA 1GSPA 3WHOA 2ZA4A 3Q3FA 2RNTA 1T2IA 2HOHA 2SARA 1PYLA 7RNTA 1AQZA 3D4AA 1BRIA 1Q9EA 1YGWA 1LOWA 9RNTA 1RMSA 1BU4A 1BVIA 1BNFA 1GMRA 1RLSA 1B2SA 1BRJA 1FYSA 1RN1A 2KF4A 3BIRA 1YNVX 1RGHA 1BNIA 2RBIA 1B2UA 1CH0A 1GOUA 1RGAA 1RSNA 2KAAA 8RNTA 4HOHA 3AHSA 1A2PA 1MGRA 1GMQA 1LOYA 1LRAA 1BUJA 5RNTA 1HZ1A 1I8VA 1RGFA 3DGYA 4BIRA 1I0XA 4RNTA 1UCLA
chains in the Genus database with same CATH superfamily
4X2HA 4G1MB 3MHEA 2OQEA 1T2HA 2D42A 1OCVA 5AEUB 2C10A 2GBWB 1GS3A 3K7CA 1VQ43 3RNTA 3SYUA 1SQWA 1BNJA 1IT7A 1W6CA 1MNLA 1OF5A 1ULIB 3F7SA 3T8NA 4HM2B 1GOVA 1EG9B 1G0TA 1QMAA 1SARA 5AIGA 1BANA 2CG0A 1UCKA 3IMAB 1NNVA 3MSOA 3QK9A 4RBNA 3CXC2 1VQ53 1BRGA 3V99A 2W56B 1I2EA 2ML5A 2HMJB 1STDA 1TRPA 2WOHA 1VQ93 1O7PB 3BB9A 1U5OA 5IG5A 1TTOA 2FGTA 3A76A 3HIGA 1TRQA 4EBGA 3LTBA 3CCM3 1Q814 3WOEB 2XSHB 4Q53A 1ROVA 5AIHA 3GWRA 4R80A 2AAEA 1QAFA 1HKXA 2Y74A 2YFIB 1G96A 2IUKA 2CC3A 3BNEA 3RDEA 1AY7A 3HI7A 1O7NB 1STFI 2W56A 3KZTA 1FGOA 3BU4A 1I70A 1RKYA 2CIUA 3OWYA 3OWUA 2WGQA 2Z76A 3SX1A 2W03A 2Q07A 2W6JH 2INXA 4HM6B 4FR9A 5AIFA 2UUGC 4LMIA 4O3VA 2KF5A 4FCMA 4DKIA 1EUIC 4RNYA 2B1XB 5G1KA 3K63A 3PYJA 1YJ93 3UNLA 1K8A4 2OTL3 2MC8A 2LQVA 5TGNA 1IVXA 1IVVA 2P09A 1JKGB 3RGRA 5KP1A 1VQ83 3D5IA 1WQLB 2K3DA 2BMRB 1OH0A 2V1LA 3JVCA 1F8NA 1VZZA 1FGQA 4HM3B 3WA2X 1CYVA 3AMOB 1UI7A 1X1YA 2YFLB 1V58A 5AIIA 3CC23 1I3IA 2YX9A 5FGOA 3VF1A 1PFPA 3GZXB 4K1VA 3FZWA 5KP3A 2C11A 3S5CA 2OCTA 1IQXA 1RCLA 2GU1A 1EQKA 3GZRA 3WHOA 1EA2A 2RNTA 1DVDA 2HOHA 3JUNA 3NQYA 3LTCA 4IIAA 2SARA 7RNTA 1NJI4 1M904 1JKGA 5KP4A 1M9GA 4AKYA 1Q9EA 1YGWA 4GL6A 1UGIA 1W6GA 3BNBA 9RNTA 3T0UA 3AMOA 3BNCA 1DMMA 1RMSA 2J8XB 4LEHA 1EKMA 4EV2A 1JV2B 1O7GB 3E99A 4FMAA 3GAXA 3WMDA 4HM0B 4J8TA 5CF1A 1WNHA 1RGHA 3T8UA 4QWTA 1BNIA 1OGZA 3ZG0A 2RBIA 3NUVA 1QVG2 4HZ9B 2KXGA 4GB5A 1RGAA 2CX1A 2KAAA 4XDWA 1NO3A 3CCJ3 4ZM8A 2OQEC 3FG1A 2F86B 1U8CB 3UJMA 1MGRA 1SIHA 3D79A 1GMQA 1LRAA 1BUJA 2BNGA 2GBXB 4X2OA 3CU3A 1OHPA 1I0XA 1W01A 1JZDA 1CEWI 4RNTA 2BU4A 3G16A 3HOHA 4KVHA 1JBRA 3D3LA 1BSAA 2CK3H 2L4VA 3HK4A 3EE1A 4K61A 2CG1A 3LZAA 4U13A 1YI23 1I3FA 4CJNA 1BRNL 3Q1CA 2JQ5A 2PZVA 1SJWA 3FF2A 2A15A 3EQQB 3HX8A 1N8QA 1BIRA 3N9HA 4MMXB 2BIRA 1MOLA 5I97A 3CCE3 1K734 4GHOA 1X1WA 2O3OA 1N9EA 1OPYA 3MG2A 5D81A 2SBLA 3UB1A 3WA3A 2BT3A 3DY5A 3OWSA 4N3VA 1DMQA 1W5ZA 2UX0A 3OX9A 2R41A 3G6E3 4L8PA 2CW9A 5D82A 3LYGA 1RGEA 1RNBA 1FGTA 1VQO3 1WTHA 6GSPA 3CNXA 6RNTA 1O7MB 1FUSA 5AI1A 3URPA 2W04A 4KFFA 2P0MA 3X3ZA 5EVHA 4BTYA 4ORLA 2ZHXB 3LTDA 2KF6A 1AV4A 1BRSA 3JUMA 6STDA 3FF0A 1Q824 1NWWA 3HIIA 1ISKA 1AVKA 1ULJB 2LYXA 4XBYA 2RSXA 5M19A 7GSPA 3ECFA 1BNEA 1DE3A 1RHLA 1KWIA 1OUNA 1Q7HA 2WO0A 3NV0B 4J5GA 2IA7A 3F9SA 3NXJA 4HM8B 4HZBB 4I5QA 3S67A 5HOHA 2WOFA 4CPKA 4MJDA 2HMNB 1C7HA 1D6ZA 4XM4A 2WGOA 1FZUA 3B4PA 2KRTA 3KN4A 5G1LA 1TJDA 3DH2A 1YIJ3 1BRHA 2W9QA 4KFEA 4XB5A 1KD14 1JB2A 1PY3A 2GSPA 1IQYA 1E3VA 1T5YA 2W0QA 1IDPA 3FGYA 3FH1A 3DGOA 4N6NB 1O7HB 1RNTA 1WMNA 3CD63 1NB3I 4J5KA 5IG0A 1E3RA 3NV0A 1YJN3 1A2VA 2F4YA 2IYJA 3X40A 1JRQA 5BIRA 1I0VA 4WYKB 3LXUX 1YIT3 1DVCA 2H0IA 2HMMB 4I4KA 3F8XA 5EEOA 1BNSA 3KSED 1RN7A 3GSPA 3SXXA 1Q864 1GYBA 3CCV3 3CCR3 5IENA 3Q3FA 1TFKA 3O8YA 3LMLA 2CWVA 1UW1A 4FMDA 1AQZA 3B7CA 1Q40B 2Z77A 2XFSA 5AEWB 3D4AA 3ZG5A 1YGEA 1SIIA 2ZDJA 2Z6BA 3F7XA 2FNQA 1TU5A 3CCL3 2B24B 1K28A 2CH9A 5AYRB 5IG3A 3EN1B 1YJW3 4HYZA 1JN5B 2QEX3 1BVIA 1GMRA 1VQQA 4LGQA 1J2BA 1B2SA 2I9WA 3CPOA 1O7WB 2XH9A 2H0HA 2P38A 3FCSB 3Q90A 2XGLA 4O8SA 1OGXA 3FKAA 4BTXA 1B2UA 1IU7A 1V57A 2XRXB 1GOUA 5IW9A 2UGIA 1BUQA 5G2GA 1NU3A 1JB5A 1Q40A 4HOHA 2K0MA 3AHSA 3SVAA 4OVMA 1GY7A 1ASKA 4K90B 1LOXA 4FCJA 5RNTA 1HZ1A 1I8VA 3DGYA 1JN5A 1MWRA 4IPBA 1A90A 1NDOB 3IJEB 4FMCA 1UCLA 2CFDA 3K5TA 1Q42A 3CCQ3 3X3YA 3NHXA 3ZFZA 3CCS3 1N8R4 2GEYA 4NREA 1KC84 3X42A 1W4NA 3CME3 2OOVA 1DETA 3S29A 1UUVB 4TX4A 3B4OA 4PEJA 2F56A 4R9KA 1FGRA 1UUGB 2P0XA 1FUTA 1GOYA 3SEDA 1GY5A 5D83A 5M18A 1LNHA 3KE7A 3D9RA 3DMCA 3KSPA 3PCRA 5JPPA 3KFQC 4JRFA 3G4S3 3CC43 1YHQ3 1B2MA 1UCIA 3TDGA 2GEXA 3DXOA 3KKGA 1AR0A 1RTUA 3OXAA 1RJOA 2QGUA 3KIIA 1TP6A 3H51A 5ELUA 1I2GA 3IPTA 1RGKA 1W7CA 3EJVA 3NM7A 4AEQA 4FMBA 5JBSA 4ILFA 1MWUA 3ER7A 3SOAA 4KT3B 3D5GA 1IYYA 4WP5A 4EYCA 5LC7A 5IERA 1JB4A 1YVSA 3N8BA 1BSBA 4FCZA 3FLJA 1EEJA 2BMOB 3VGNA 5A0OB 4HM7B 1UGHI 3G713 4RZMA 1X1UA 5LC6A 3G0KA 4GSPA 2HMKB 5AYSC 3N54B 2RCDA 4BL3A 3EBYA 1K9M4 1AVLA 1RDSA 1S5AA 4N6LA 5BVBA 4N6OB 4LZIA 5BXQA 4KZ1A 1IT8A 4NPBA 2CKFB 3U97A 2C4BA 3DM8A 3CNMA 4HKVB 4HM1B 3NQZA 4XBXA 1GMPA 1RRLA 1G02A 3F40A 3NBRA 1E97A 3EN8A 2O9UX 1JZOA 4MEIA 2ZL8A 3NM2A 1FA3A 2W9PA 1BGSA 3EHCA 3LTAA 3B8LA 3F14A 3GRDA 3LT9A 5DREA 4EC6A 3NBBA 1WMOA 2BO9B 3H3HA 1VQK3 2IY2A 4STDA 3S28A 3WDGB 3FG4A 2CFKA 5BU4A 1BSDA 1D6YA 2XFTA 4H61A 1VQ63 3G8ZA 3VSYA 2ZA4A 1T2IA 4WFOA 2CWUA 2XSOB 3Q2PA 4HJLB 2XR8B 2XEPA 3STDA 1CQSA 3ALAA 3LH4A 2CX0A 1IK3A 1LXEA 1LVNA 5HGRA 3PZWA 3HZPA 3QRDA 5STDA 3V98A 1GD4A 1BNFA 2E2VA 1RLSA 5EQLA 7STDA 4N6MA 3CPW2 4WWUC 1A67A 4NHFA 1BRJA 1FYSA 1RN1A 2KF4A 1DYUA 2OTJ3 2E2UA 1OACA 4N6TA 1CH0A 4EV5A 3CCU3 1RSNA 2K54A 1TUHA 4H3UA 3PCSA 1MWSA 1IVUA 1A2KA 2GXFA 5IEPA 3MYTA 2OOVC 1A2PA 3DZLA 2L1SA 1UI8A 1N5HA 1JNQA 3BNDA 3MWZA 4KFDA 3OW22 2M7OA 4XDVA 1T3BA 2W2CA 3PS8A 4N6UA 4R1KA 3CC73 1QAKA 3ROBA 1GD3A 1W2B2 2HMOB 4CDLA 2D1WA 1R4CA 2YFJB 2Z7AA 5JPUA 4WYKA 3NX0A 1Q7Y4 3AGOA 3KCHA 1B3SA 3FSDA 3CMA3 4RNZA 1M1XB 1K41A 1Z1SA 2JDIH 1BRKA 4L7KA 3UL5A 3UL6A 2OWPA 3K9MC 2AADA 5IEOA 2MF7A 3A5EA 4R9LA 3SLUA 1VQM3 4HM4B 3LOYA 1BOXA 1JBSA 3JUOA 5CXOA 4OK0A 3DGLA 2ML6A 1HYFA 1RGLA 4HBRA 3L0RA 1ZGXA 3AGNA 2XGNA 2XF3A 1B20A 1C54A 1B2XA 1OHSA 1YVBI 1VQN3 1I2FA 2CHCA 1BAOA 2H0GA 3GZBA 2STDA 5GSPA 1US1A 1ZS7A 2CFWA 1RN4A 2F5MA 3AHWA 2RGQA 4HAAA 5CLKA 3WR2A 1RRHA 3K0ZA 4WHAA 1LOVA 2IMJA 2BMQB 2QIYA 4HM5B 3OV4A 4N6V0 3X3XA 4CCVA 3JUPA 1BNGA 1RCKA 2BHMA 2RFRA 2P05A 1TIJA 1R4YA 1OHOA 1UCJA 3DGNA 1B2ZA 1KSIA 1ZO2A 3EBTA 1QJGA 3F8HA 3LT8A 2HMLB 3M8CA 1IV9A 3U1WA 4HVNA 3PGBA 1CYUA 2CFGA 3DUKA 2FXTA 2CWTA 1IV7A 2F5WA 4EW5A 3WOFB 1B21A 1N9JA 1GY6A 1W02A 1FW7A 1LNIA 3JUQA 5IG4A 2Y73A 2KCDA 2IUJA 1HU9A 1X1XA 4JF8A 1BSCA 1LQGC 3BLZA 4MMZB 1MGWA 1ROAA 3EB8A 4IT7A 4BU4A 3J7Yd 4K1UA 1S723 1B27A 3I553 1BNRA 1VQP3 2R4IA 1QALA 2KF3A 3MG3A 1BSEA 2F99A 1JBTA 1IVWA 1SPUA 2CFLA 1TFOA 1UUWB 3SOYA 1LQMB 2F98A 4LSOA 1UDII 4O02B 1M1K4 1KQS2 3I0YA 1RGGA 4OUQA 1FGMA 1Y4KA 1D6UA 1RGCA 1VQL3 1GSPA 3X41A 4J9AA 1JJ22 5ELJA 3S27A 1W6YA 3DGMA 5DRVA 1PYLA 4O2HA 5IF6A 1BRIA 3FG3A 1L5GB 1LOWA 3EC9A 4R4KA 1QVF2 4BTWA 3WODG 4BL2A 4EXRA 1V74A 2GU3A 3I563 1BU4A 5FW5A 1ZX2A 4MMYB 1VQ73 2QA43 2E2TA 5CK6A 3MG1A 3BIRA 1W2ZA 1YNVX 5M1AA 3GZYB 1PU4A 1WMPA 3EX9A 1N5PA 4L8OA 3PXMA 5CF2A 1OF5B 3MPHA 3MKIA 8RNTA 1W00A 3NBJA 1DMNA 4AKZA 1FUWA 1MWTA 1NB5I 1LOYA 4LYLB 1IQ8A 3EF8A 8CHOA 1RGFA 2PNCA 4BIRA 4XBTA 3RGAA 3V92A
chains in the Genus database with same CATH topology
2BU4A 1JBRA 3HOHA 1BSAA 1T2HA 1DETA 1I3FA 3RNTA 3AGOA 3SYUA 1BNJA 3KCHA 1BRNL 2F56A 1B3SA 1BIRA 1GOVA 2BIRA 1FUTA 1GOYA 1SARA 1BRKA 4GHOA 1X1WA 1BANA 1UCKA 2AADA 3A5EA 1B2MA 1BRGA 1UCIA 1BOXA 1I2EA 1JBSA 1RTUA 1TRPA 1HYFA 1RGLA 1C54A 1ZGXA 3AGNA 1B20A 1B2XA 1TTOA 1I2FA 1TRQA 1BAOA 1I2GA 1RGEA 1RNBA 1RGKA 5GSPA 6GSPA 6RNTA 1FUSA 1RN4A 2F5MA 3AHWA 3URPA 4HAAA 3WR2A 1LOVA 2AAEA 2KF6A 1BRSA 1IYYA 3D5GA 1BNGA 1RCKA 1UCJA 1R4YA 1AY7A 7GSPA 1YVSA 1B2ZA 1BSBA 1BNEA 1DE3A 1RHLA 3BU4A 4J5GA 5HOHA 1I70A 1X1UA 2F5WA 4GSPA 1FW7A 1B21A 1LNIA 1FZUA 2KF5A 3DH2A 1RDSA 1BRHA 1PY3A 1X1XA 2GSPA 1BSCA 2C4BA 1MGWA 1GMPA 3D5IA 1G02A 1RNTA 4BU4A 1B27A 4J5KA 1BNRA 1BGSA 2KF3A 1X1YA 2F4YA 1BSEA 5BIRA 1JBTA 1I0VA 1I3IA 1BNSA 5BU4A 1RGGA 3GSPA 1BSDA 1RCLA 1RGCA 1GSPA 3WHOA 2ZA4A 3Q3FA 2RNTA 1T2IA 2HOHA 2SARA 1PYLA 7RNTA 1AQZA 3D4AA 1BRIA 1Q9EA 1YGWA 1LOWA 9RNTA 1RMSA 1BU4A 1BVIA 1BNFA 1GMRA 1RLSA 1B2SA 1BRJA 1FYSA 1RN1A 2KF4A 3BIRA 1YNVX 1RGHA 1BNIA 2RBIA 1B2UA 1CH0A 1GOUA 1RGAA 1RSNA 2KAAA 8RNTA 4HOHA 3AHSA 1A2PA 1MGRA 1GMQA 1LOYA 1LRAA 1BUJA 5RNTA 1HZ1A 1I8VA 1RGFA 3DGYA 4BIRA 1I0XA 4RNTA 1UCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BU4 A;  1JBR A;  3HOH A;  1BSA A;  1T2H A;  1DET A;  1I3F A;  3RNT A;  3AGO A;  3SYU A;  1BNJ A;  3KCH A;  1BRN L;  2F56 A;  1B3S A;  1BIR A;  1GOV A;  2BIR A;  1FUT A;  1GOY A;  1SAR A;  1BRK A;  4GHO A;  1X1W A;  1BAN A;  1UCK A;  2AAD A;  3A5E A;  1B2M A;  1BRG A;  1UCI A;  1BOX A;  1I2E A;  1JBS A;  1RTU A;  1TRP A;  1HYF A;  1RGL A;  1C54 A;  1ZGX A;  3AGN A;  1B20 A;  1B2X A;  1TTO A;  1I2F A;  1TRQ A;  1BAO A;  1I2G A;  1RGE A;  1RNB A;  1RGK A;  5GSP A;  6GSP A;  6RNT A;  1FUS A;  1RN4 A;  2F5M A;  3AHW A;  3URP A;  4HAA A;  3WR2 A;  1LOV A;  2AAE A;  2KF6 A;  1BRS A;  1IYY A;  3D5G A;  1BNG A;  1RCK A;  1UCJ A;  1R4Y A;  1AY7 A;  7GSP A;  1YVS A;  1B2Z A;  1BSB A;  1BNE A;  1DE3 A;  1RHL A;  3BU4 A;  4J5G A;  5HOH A;  1I70 A;  1X1U A;  2F5W A;  4GSP A;  1FW7 A;  1B21 A;  1LNI A;  1FZU A;  2KF5 A;  3DH2 A;  1RDS A;  1BRH A;  1PY3 A;  1X1X A;  2GSP A;  1BSC A;  2C4B A;  1MGW A;  1GMP A;  3D5I A;  1G02 A;  1RNT A;  4BU4 A;  1B27 A;  4J5K A;  1BNR A;  1BGS A;  2KF3 A;  1X1Y A;  2F4Y A;  1BSE A;  5BIR A;  1JBT A;  1I0V A;  1I3I A;  1BNS A;  5BU4 A;  1RGG A;  3GSP A;  1BSD A;  1RCL A;  1RGC A;  1GSP A;  3WHO A;  2ZA4 A;  3Q3F A;  2RNT A;  1T2I A;  2HOH A;  2SAR A;  1PYL A;  7RNT A;  1AQZ A;  3D4A A;  1BRI A;  1Q9E A;  1YGW A;  1LOW A;  9RNT A;  1RMS A;  1BU4 A;  1BVI A;  1BNF A;  1GMR A;  1RLS A;  1B2S A;  1BRJ A;  1FYS A;  1RN1 A;  2KF4 A;  3BIR A;  1YNV X;  1RGH A;  1BNI A;  2RBI A;  1B2U A;  1CH0 A;  1GOU A;  1RGA A;  1RSN A;  2KAA A;  8RNT A;  4HOH A;  3AHS A;  1A2P A;  1MGR A;  1GMQ A;  1LOY A;  1LRA A;  1BUJ A;  5RNT A;  1HZ1 A;  1I8V A;  1RGF A;  3DGY A;  4BIR A;  1I0X A;  4RNT A;  1UCL A; 
#chains in the Genus database with same CATH topology
 4X2H A;  4G1M B;  3MHE A;  2OQE A;  1T2H A;  2D42 A;  1OCV A;  5AEU B;  2C10 A;  2GBW B;  1GS3 A;  3K7C A;  1VQ4 3;  3RNT A;  3SYU A;  1SQW A;  1BNJ A;  1IT7 A;  1W6C A;  1MNL A;  1OF5 A;  1ULI B;  3F7S A;  3T8N A;  4HM2 B;  1GOV A;  1EG9 B;  1G0T A;  1QMA A;  1SAR A;  5AIG A;  1BAN A;  2CG0 A;  1UCK A;  3IMA B;  1NNV A;  3MSO A;  3QK9 A;  4RBN A;  3CXC 2;  1VQ5 3;  1BRG A;  3V99 A;  2W56 B;  1I2E A;  2ML5 A;  2HMJ B;  1STD A;  1TRP A;  2WOH A;  1VQ9 3;  1O7P B;  3BB9 A;  1U5O A;  5IG5 A;  1TTO A;  2FGT A;  3A76 A;  3HIG A;  1TRQ A;  4EBG A;  3LTB A;  3CCM 3;  1Q81 4;  3WOE B;  2XSH B;  4Q53 A;  1ROV A;  5AIH A;  3GWR A;  4R80 A;  2AAE A;  1QAF A;  1HKX A;  2Y74 A;  2YFI B;  1G96 A;  2IUK A;  2CC3 A;  3BNE A;  3RDE A;  1AY7 A;  3HI7 A;  1O7N B;  1STF I;  2W56 A;  3KZT A;  1FGO A;  3BU4 A;  1I70 A;  1RKY A;  2CIU A;  3OWY A;  3OWU A;  2WGQ A;  2Z76 A;  3SX1 A;  2W03 A;  2Q07 A;  2W6J H;  2INX A;  4HM6 B;  4FR9 A;  5AIF A;  2UUG C;  4LMI A;  4O3V A;  2KF5 A;  4FCM A;  4DKI A;  1EUI C;  4RNY A;  2B1X B;  5G1K A;  3K63 A;  3PYJ A;  1YJ9 3;  3UNL A;  1K8A 4;  2OTL 3;  2MC8 A;  2LQV A;  5TGN A;  1IVX A;  1IVV A;  2P09 A;  1JKG B;  3RGR A;  5KP1 A;  1VQ8 3;  3D5I A;  1WQL B;  2K3D A;  2BMR B;  1OH0 A;  2V1L A;  3JVC A;  1F8N A;  1VZZ A;  1FGQ A;  4HM3 B;  3WA2 X;  1CYV A;  3AMO B;  1UI7 A;  1X1Y A;  2YFL B;  1V58 A;  5AII A;  3CC2 3;  1I3I A;  2YX9 A;  5FGO A;  3VF1 A;  1PFP A;  3GZX B;  4K1V A;  3FZW A;  5KP3 A;  2C11 A;  3S5C A;  2OCT A;  1IQX A;  1RCL A;  2GU1 A;  1EQK A;  3GZR A;  3WHO A;  1EA2 A;  2RNT A;  1DVD A;  2HOH A;  3JUN A;  3NQY A;  3LTC A;  4IIA A;  2SAR A;  7RNT A;  1NJI 4;  1M90 4;  1JKG A;  5KP4 A;  1M9G A;  4AKY A;  1Q9E A;  1YGW A;  4GL6 A;  1UGI A;  1W6G A;  3BNB A;  9RNT A;  3T0U A;  3AMO A;  3BNC A;  1DMM A;  1RMS A;  2J8X B;  4LEH A;  1EKM A;  4EV2 A;  1JV2 B;  1O7G B;  3E99 A;  4FMA A;  3GAX A;  3WMD A;  4HM0 B;  4J8T A;  5CF1 A;  1WNH A;  1RGH A;  3T8U A;  4QWT A;  1BNI A;  1OGZ A;  3ZG0 A;  2RBI A;  3NUV A;  1QVG 2;  4HZ9 B;  2KXG A;  4GB5 A;  1RGA A;  2CX1 A;  2KAA A;  4XDW A;  1NO3 A;  3CCJ 3;  4ZM8 A;  2OQE C;  3FG1 A;  2F86 B;  1U8C B;  3UJM A;  1MGR A;  1SIH A;  3D79 A;  1GMQ A;  1LRA A;  1BUJ A;  2BNG A;  2GBX B;  4X2O A;  3CU3 A;  1OHP A;  1I0X A;  1W01 A;  1JZD A;  1CEW I;  4RNT A;  2BU4 A;  3G16 A;  3HOH A;  4KVH A;  1JBR A;  3D3L A;  1BSA A;  2CK3 H;  2L4V A;  3HK4 A;  3EE1 A;  4K61 A;  2CG1 A;  3LZA A;  4U13 A;  1YI2 3;  1I3F A;  4CJN A;  1BRN L;  3Q1C A;  2JQ5 A;  2PZV A;  1SJW A;  3FF2 A;  2A15 A;  3EQQ B;  3HX8 A;  1N8Q A;  1BIR A;  3N9H A;  4MMX B;  2BIR A;  1MOL A;  5I97 A;  3CCE 3;  1K73 4;  4GHO A;  1X1W A;  2O3O A;  1N9E A;  1OPY A;  3MG2 A;  5D81 A;  2SBL A;  3UB1 A;  3WA3 A;  2BT3 A;  3DY5 A;  3OWS A;  4N3V A;  1DMQ A;  1W5Z A;  2UX0 A;  3OX9 A;  2R41 A;  3G6E 3;  4L8P A;  2CW9 A;  5D82 A;  3LYG A;  1RGE A;  1RNB A;  1FGT A;  1VQO 3;  1WTH A;  6GSP A;  3CNX A;  6RNT A;  1O7M B;  1FUS A;  5AI1 A;  3URP A;  2W04 A;  4KFF A;  2P0M A;  3X3Z A;  5EVH A;  4BTY A;  4ORL A;  2ZHX B;  3LTD A;  2KF6 A;  1AV4 A;  1BRS A;  3JUM A;  6STD A;  3FF0 A;  1Q82 4;  1NWW A;  3HII A;  1ISK A;  1AVK A;  1ULJ B;  2LYX A;  4XBY A;  2RSX A;  5M19 A;  7GSP A;  3ECF A;  1BNE A;  1DE3 A;  1RHL A;  1KWI A;  1OUN A;  1Q7H A;  2WO0 A;  3NV0 B;  4J5G A;  2IA7 A;  3F9S A;  3NXJ A;  4HM8 B;  4HZB B;  4I5Q A;  3S67 A;  5HOH A;  2WOF A;  4CPK A;  4MJD A;  2HMN B;  1C7H A;  1D6Z A;  4XM4 A;  2WGO A;  1FZU A;  3B4P A;  2KRT A;  3KN4 A;  5G1L A;  1TJD A;  3DH2 A;  1YIJ 3;  1BRH A;  2W9Q A;  4KFE A;  4XB5 A;  1KD1 4;  1JB2 A;  1PY3 A;  2GSP A;  1IQY A;  1E3V A;  1T5Y A;  2W0Q A;  1IDP A;  3FGY A;  3FH1 A;  3DGO A;  4N6N B;  1O7H B;  1RNT A;  1WMN A;  3CD6 3;  1NB3 I;  4J5K A;  5IG0 A;  1E3R A;  3NV0 A;  1YJN 3;  1A2V A;  2F4Y A;  2IYJ A;  3X40 A;  1JRQ A;  5BIR A;  1I0V A;  4WYK B;  3LXU X;  1YIT 3;  1DVC A;  2H0I A;  2HMM B;  4I4K A;  3F8X A;  5EEO A;  1BNS A;  3KSE D;  1RN7 A;  3GSP A;  3SXX A;  1Q86 4;  1GYB A;  3CCV 3;  3CCR 3;  5IEN A;  3Q3F A;  1TFK A;  3O8Y A;  3LML A;  2CWV A;  1UW1 A;  4FMD A;  1AQZ A;  3B7C A;  1Q40 B;  2Z77 A;  2XFS A;  5AEW B;  3D4A A;  3ZG5 A;  1YGE A;  1SII A;  2ZDJ A;  2Z6B A;  3F7X A;  2FNQ A;  1TU5 A;  3CCL 3;  2B24 B;  1K28 A;  2CH9 A;  5AYR B;  5IG3 A;  3EN1 B;  1YJW 3;  4HYZ A;  1JN5 B;  2QEX 3;  1BVI A;  1GMR A;  1VQQ A;  4LGQ A;  1J2B A;  1B2S A;  2I9W A;  3CPO A;  1O7W B;  2XH9 A;  2H0H A;  2P38 A;  3FCS B;  3Q90 A;  2XGL A;  4O8S A;  1OGX A;  3FKA A;  4BTX A;  1B2U A;  1IU7 A;  1V57 A;  2XRX B;  1GOU A;  5IW9 A;  2UGI A;  1BUQ A;  5G2G A;  1NU3 A;  1JB5 A;  1Q40 A;  4HOH A;  2K0M A;  3AHS A;  3SVA A;  4OVM A;  1GY7 A;  1ASK A;  4K90 B;  1LOX A;  4FCJ A;  5RNT A;  1HZ1 A;  1I8V A;  3DGY A;  1JN5 A;  1MWR A;  4IPB A;  1A90 A;  1NDO B;  3IJE B;  4FMC A;  1UCL A;  2CFD A;  3K5T A;  1Q42 A;  3CCQ 3;  3X3Y A;  3NHX A;  3ZFZ A;  3CCS 3;  1N8R 4;  2GEY A;  4NRE A;  1KC8 4;  3X42 A;  1W4N A;  3CME 3;  2OOV A;  1DET A;  3S29 A;  1UUV B;  4TX4 A;  3B4O A;  4PEJ A;  2F56 A;  4R9K A;  1FGR A;  1UUG B;  2P0X A;  1FUT A;  1GOY A;  3SED A;  1GY5 A;  5D83 A;  5M18 A;  1LNH A;  3KE7 A;  3D9R A;  3DMC A;  3KSP A;  3PCR A;  5JPP A;  3KFQ C;  4JRF A;  3G4S 3;  3CC4 3;  1YHQ 3;  1B2M A;  1UCI A;  3TDG A;  2GEX A;  3DXO A;  3KKG A;  1AR0 A;  1RTU A;  3OXA A;  1RJO A;  2QGU A;  3KII A;  1TP6 A;  3H51 A;  5ELU A;  1I2G A;  3IPT A;  1RGK A;  1W7C A;  3EJV A;  3NM7 A;  4AEQ A;  4FMB A;  5JBS A;  4ILF A;  1MWU A;  3ER7 A;  3SOA A;  4KT3 B;  3D5G A;  1IYY A;  4WP5 A;  4EYC A;  5LC7 A;  5IER A;  1JB4 A;  1YVS A;  3N8B A;  1BSB A;  4FCZ A;  3FLJ A;  1EEJ A;  2BMO B;  3VGN A;  5A0O B;  4HM7 B;  1UGH I;  3G71 3;  4RZM A;  1X1U A;  5LC6 A;  3G0K A;  4GSP A;  2HMK B;  5AYS C;  3N54 B;  2RCD A;  4BL3 A;  3EBY A;  1K9M 4;  1AVL A;  1RDS A;  1S5A A;  4N6L A;  5BVB A;  4N6O B;  4LZI A;  5BXQ A;  4KZ1 A;  1IT8 A;  4NPB A;  2CKF B;  3U97 A;  2C4B A;  3DM8 A;  3CNM A;  4HKV B;  4HM1 B;  3NQZ A;  4XBX A;  1GMP A;  1RRL A;  1G02 A;  3F40 A;  3NBR A;  1E97 A;  3EN8 A;  2O9U X;  1JZO A;  4MEI A;  2ZL8 A;  3NM2 A;  1FA3 A;  2W9P A;  1BGS A;  3EHC A;  3LTA A;  3B8L A;  3F14 A;  3GRD A;  3LT9 A;  5DRE A;  4EC6 A;  3NBB A;  1WMO A;  2BO9 B;  3H3H A;  1VQK 3;  2IY2 A;  4STD A;  3S28 A;  3WDG B;  3FG4 A;  2CFK A;  5BU4 A;  1BSD A;  1D6Y A;  2XFT A;  4H61 A;  1VQ6 3;  3G8Z A;  3VSY A;  2ZA4 A;  1T2I A;  4WFO A;  2CWU A;  2XSO B;  3Q2P A;  4HJL B;  2XR8 B;  2XEP A;  3STD A;  1CQS A;  3ALA A;  3LH4 A;  2CX0 A;  1IK3 A;  1LXE A;  1LVN A;  5HGR A;  3PZW A;  3HZP A;  3QRD A;  5STD A;  3V98 A;  1GD4 A;  1BNF A;  2E2V A;  1RLS A;  5EQL A;  7STD A;  4N6M A;  3CPW 2;  4WWU C;  1A67 A;  4NHF A;  1BRJ A;  1FYS A;  1RN1 A;  2KF4 A;  1DYU A;  2OTJ 3;  2E2U A;  1OAC A;  4N6T A;  1CH0 A;  4EV5 A;  3CCU 3;  1RSN A;  2K54 A;  1TUH A;  4H3U A;  3PCS A;  1MWS A;  1IVU A;  1A2K A;  2GXF A;  5IEP A;  3MYT A;  2OOV C;  1A2P A;  3DZL A;  2L1S A;  1UI8 A;  1N5H A;  1JNQ A;  3BND A;  3MWZ A;  4KFD A;  3OW2 2;  2M7O A;  4XDV A;  1T3B A;  2W2C A;  3PS8 A;  4N6U A;  4R1K A;  3CC7 3;  1QAK A;  3ROB A;  1GD3 A;  1W2B 2;  2HMO B;  4CDL A;  2D1W A;  1R4C A;  2YFJ B;  2Z7A A;  5JPU A;  4WYK A;  3NX0 A;  1Q7Y 4;  3AGO A;  3KCH A;  1B3S A;  3FSD A;  3CMA 3;  4RNZ A;  1M1X B;  1K41 A;  1Z1S A;  2JDI H;  1BRK A;  4L7K A;  3UL5 A;  3UL6 A;  2OWP A;  3K9M C;  2AAD A;  5IEO A;  2MF7 A;  3A5E A;  4R9L A;  3SLU A;  1VQM 3;  4HM4 B;  3LOY A;  1BOX A;  1JBS A;  3JUO A;  5CXO A;  4OK0 A;  3DGL A;  2ML6 A;  1HYF A;  1RGL A;  4HBR A;  3L0R A;  1ZGX A;  3AGN A;  2XGN A;  2XF3 A;  1B20 A;  1C54 A;  1B2X A;  1OHS A;  1YVB I;  1VQN 3;  1I2F A;  2CHC A;  1BAO A;  2H0G A;  3GZB A;  2STD A;  5GSP A;  1US1 A;  1ZS7 A;  2CFW A;  1RN4 A;  2F5M A;  3AHW A;  2RGQ A;  4HAA A;  5CLK A;  3WR2 A;  1RRH A;  3K0Z A;  4WHA A;  1LOV A;  2IMJ A;  2BMQ B;  2QIY A;  4HM5 B;  3OV4 A;  4N6V 0;  3X3X A;  4CCV A;  3JUP A;  1BNG A;  1RCK A;  2BHM A;  2RFR A;  2P05 A;  1TIJ A;  1R4Y A;  1OHO A;  1UCJ A;  3DGN A;  1B2Z A;  1KSI A;  1ZO2 A;  3EBT A;  1QJG A;  3F8H A;  3LT8 A;  2HML B;  3M8C A;  1IV9 A;  3U1W A;  4HVN A;  3PGB A;  1CYU A;  2CFG A;  3DUK A;  2FXT A;  2CWT A;  1IV7 A;  2F5W A;  4EW5 A;  3WOF B;  1B21 A;  1N9J A;  1GY6 A;  1W02 A;  1FW7 A;  1LNI A;  3JUQ A;  5IG4 A;  2Y73 A;  2KCD A;  2IUJ A;  1HU9 A;  1X1X A;  4JF8 A;  1BSC A;  1LQG C;  3BLZ A;  4MMZ B;  1MGW A;  1ROA A;  3EB8 A;  4IT7 A;  4BU4 A;  3J7Y d;  4K1U A;  1S72 3;  1B27 A;  3I55 3;  1BNR A;  1VQP 3;  2R4I A;  1QAL A;  2KF3 A;  3MG3 A;  1BSE A;  2F99 A;  1JBT A;  1IVW A;  1SPU A;  2CFL A;  1TFO A;  1UUW B;  3SOY A;  1LQM B;  2F98 A;  4LSO A;  1UDI I;  4O02 B;  1M1K 4;  1KQS 2;  3I0Y A;  1RGG A;  4OUQ A;  1FGM A;  1Y4K A;  1D6U A;  1RGC A;  1VQL 3;  1GSP A;  3X41 A;  4J9A A;  1JJ2 2;  5ELJ A;  3S27 A;  1W6Y A;  3DGM A;  5DRV A;  1PYL A;  4O2H A;  5IF6 A;  1BRI A;  3FG3 A;  1L5G B;  1LOW A;  3EC9 A;  4R4K A;  1QVF 2;  4BTW A;  3WOD G;  4BL2 A;  4EXR A;  1V74 A;  2GU3 A;  3I56 3;  1BU4 A;  5FW5 A;  1ZX2 A;  4MMY B;  1VQ7 3;  2QA4 3;  2E2T A;  5CK6 A;  3MG1 A;  3BIR A;  1W2Z A;  1YNV X;  5M1A A;  3GZY B;  1PU4 A;  1WMP A;  3EX9 A;  1N5P A;  4L8O A;  3PXM A;  5CF2 A;  1OF5 B;  3MPH A;  3MKI A;  8RNT A;  1W00 A;  3NBJ A;  1DMN A;  4AKZ A;  1FUW A;  1MWT A;  1NB5 I;  1LOY A;  4LYL B;  1IQ8 A;  3EF8 A;  8CHO A;  1RGF A;  2PNC A;  4BIR A;  4XBT A;  3RGA A;  3V92 A; 
#chains in the Genus database with same CATH homology
 2BU4 A;  1JBR A;  3HOH A;  1BSA A;  1T2H A;  1DET A;  1I3F A;  3RNT A;  3AGO A;  3SYU A;  1BNJ A;  3KCH A;  1BRN L;  2F56 A;  1B3S A;  1BIR A;  1GOV A;  2BIR A;  1FUT A;  1GOY A;  1SAR A;  1BRK A;  4GHO A;  1X1W A;  1BAN A;  1UCK A;  2AAD A;  3A5E A;  1B2M A;  1BRG A;  1UCI A;  1BOX A;  1I2E A;  1JBS A;  1RTU A;  1TRP A;  1HYF A;  1RGL A;  1C54 A;  1ZGX A;  3AGN A;  1B20 A;  1B2X A;  1TTO A;  1I2F A;  1TRQ A;  1BAO A;  1I2G A;  1RGE A;  1RNB A;  1RGK A;  5GSP A;  6GSP A;  6RNT A;  1FUS A;  1RN4 A;  2F5M A;  3AHW A;  3URP A;  4HAA A;  3WR2 A;  1LOV A;  2AAE A;  2KF6 A;  1BRS A;  1IYY A;  3D5G A;  1BNG A;  1RCK A;  1UCJ A;  1R4Y A;  1AY7 A;  7GSP A;  1YVS A;  1B2Z A;  1BSB A;  1BNE A;  1DE3 A;  1RHL A;  3BU4 A;  4J5G A;  5HOH A;  1I70 A;  1X1U A;  2F5W A;  4GSP A;  1FW7 A;  1B21 A;  1LNI A;  1FZU A;  2KF5 A;  3DH2 A;  1RDS A;  1BRH A;  1PY3 A;  1X1X A;  2GSP A;  1BSC A;  2C4B A;  1MGW A;  1GMP A;  3D5I A;  1G02 A;  1RNT A;  4BU4 A;  1B27 A;  4J5K A;  1BNR A;  1BGS A;  2KF3 A;  1X1Y A;  2F4Y A;  1BSE A;  5BIR A;  1JBT A;  1I0V A;  1I3I A;  1BNS A;  5BU4 A;  1RGG A;  3GSP A;  1BSD A;  1RCL A;  1RGC A;  1GSP A;  3WHO A;  2ZA4 A;  3Q3F A;  2RNT A;  1T2I A;  2HOH A;  2SAR A;  1PYL A;  7RNT A;  1AQZ A;  3D4A A;  1BRI A;  1Q9E A;  1YGW A;  1LOW A;  9RNT A;  1RMS A;  1BU4 A;  1BVI A;  1BNF A;  1GMR A;  1RLS A;  1B2S A;  1BRJ A;  1FYS A;  1RN1 A;  2KF4 A;  3BIR A;  1YNV X;  1RGH A;  1BNI A;  2RBI A;  1B2U A;  1CH0 A;  1GOU A;  1RGA A;  1RSN A;  2KAA A;  8RNT A;  4HOH A;  3AHS A;  1A2P A;  1MGR A;  1GMQ A;  1LOY A;  1LRA A;  1BUJ A;  5RNT A;  1HZ1 A;  1I8V A;  1RGF A;  3DGY A;  4BIR A;  1I0X A;  4RNT A;  1UCL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...