1BNSA

Structural studies of barnase mutants
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYIAKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endonuclease
molecule keywords BARNASE
publication title Contribution of buried hydrogen bonds to protein stability. The crystal structures of two barnase mutants.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
total genus 30
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 1994-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1bnsA00
1B2SA 2GSPA 1A2PA 5RNTA 1BNRA 3AHSA 1T2HA 1BRGA 1BNJA 1I3FA 1ZGXA 8RNTA 2F56A 1T2IA 2SARA 4RNTA 2HOHA 1B21A 2BU4A 3GSPA 1G02A 1JBTA 2F5WA 1RGLA 1FUSA 1RN4A 2BIRA 4HOHA 3URPA 1B2MA 1RGFA 1BRJA 1PY3A 2KF3A 5GSPA 1B2ZA 1HZ1A 1TRQA 1PYLA 1BRHA 1LOWA 2C4BA 3WR2A 1I3IA 4HAAA 4J5KA 1RNTA 1FYSA 1RN1A 1TRPA 1MGWA 1YVSA 1IYYA 1BGSA 7RNTA 1RCLA 1BNSA 1MGRA 1RHLA 3SYUA 1I70A 1BANA 1RGGA 1B27A 1GOVA 1BOXA 3Q3FA 1BRIA 3A5EA 1FW7A 1B2UA 1R4YA 4GHOA 2AADA 1BNIA 1BNGA 3AGOA 1RGHA 1UCJA 1BSBA 2F4YA 2KAAA 5BIRA 1X1WA 2KF4A 1X1UA 1GMRA 1I0XA 1GOYA 1RCKA 3RNTA 1BNEA 3KCHA 1RNBA 1FZUA 2RNTA 1I2EA 1I2FA 1BSAA 1I2GA 1RSNA 1UCIA 1JBSA 1BIRA 2KF5A 1BUJA 2AAEA 6GSPA 1LOYA 1UCKA 1BAOA 3AHWA 1B20A 5BU4A 9RNTA 1LOVA 1AQZA 1GOUA 3BU4A 1AY7A 1HYFA 4GSPA 1BRKA 7GSPA 1RGCA 3BIRA 1B3SA 5HOHA 1BU4A 1BSDA 1I8VA 1GMQA 1X1YA 1DE3A 3D4AA 1RGAA 3WHOA 1YGWA 3HOHA 1RLSA 1RGKA 1GMPA 1RTUA 2F5MA 4BU4A 3AGNA 1YNVX 1SARA 1BNFA 1I0VA 2ZA4A 3DH2A 4J5GA 6RNTA 1LRAA 1B2XA 1JBRA 1LNIA 1BVIA 1RGEA 1RMSA 1BSCA 1CH0A 1BRSA 2KF6A 1Q9EA 1GSPA 1UCLA 2RBIA 3DGYA 4BIRA 1TTOA 3D5IA 3D5GA 1FUTA 1C54A 1RDSA 1BRNL 1DETA 1BSEA 1X1XA
chains in the Genus database with same CATH superfamily
1IDPA 4X2OA 1B2SA 1RRLA 2GSPA 3KE7A 3UJMA 2IY2A 5RNTA 1BNRA 3KKGA 3AHSA 1W6CA 1FGMA 4HYZA 2H0GA 1RN7A 1WTHA 2QEX3 1NWWA 4FCMA 4NPBA 5IENA 4RNTA 2GEYA 2HOHA 3DGNA 4N6NB 3NUVA 5AEWB 1FGRA 2BU4A 1LOXA 5AIIA 1JV2B 1SPUA 3OX9A 1TUHA 3JUQA 1FUSA 1RN4A 3G0KA 3T0UA 4N6UA 4HOHA 2WO0A 4WYKA 4XDVA 3B4OA 1GS3A 5ELUA 4CCVA 1BRJA 3PGBA 2RCDA 1HZ1A 3FKAA 1PYLA 1BRHA 1LOWA 2W9QA 2OOVA 3DZLA 3JUPA 3S67A 3WR2A 2XRXB 2M7OA 3S28A 1W6GA 4KFEA 3LT9A 1D6YA 3FGYA 4FMAA 3FG1A 3FCSB 1FGOA 1RCLA 1MGRA 2D42A 3E99A 5HGRA 3RGAA 2GU3A 4OUQA 2CFWA 3SYUA 3X3XA 3FLJA 3LTCA 4GL6A 4WHAA 3S27A 3FG4A 1JN5B 3K9MC 3X3YA 1G0TA 3N54B 2PZVA 2F98A 3HI7A 3UB1A 1B2UA 3QK9A 3F40A 2WOHA 1EQKA 5CK6A 5M18A 5EQLA 3AGOA 4WFOA 3GAXA 1BSBA 1NDOB 1K41A 2F4YA 3CNXA 2XSHB 1ZS7A 4OVMA 4HM2B 3CCU3 1X1UA 4BL2A 1OGXA 4MMZB 4I5QA 1JKGA 3KSED 1YIJ3 4FMBA 2ZHXB 1BNEA 2KXGA 1RNBA 1US1A 3M8CA 1BSAA 2H0HA 1F8NA 1BUJA 3LTAA 1DYUA 2CKFB 2RFRA 1UCKA 4IPBA 2F99A 3PCRA 3CCQ3 1DMQA 3BNEA 2B1XB 2IMJA 5BU4A 1W7CA 9RNTA 5IEPA 2STDA 1GOUA 3BU4A 1K734 1MWTA 3KZTA 3VSYA 5IW9A 1HYFA 1MOLA 5KP4A 7GSPA 2W04A 3BIRA 2QA43 4CDLA 3NBJA 4JRFA 5BVBA 1KSIA 4HM8B 3U97A 2W56B 2BHMA 3UNLA 1VQQA 3GZXB 4CJNA 2O3OA 3HK4A 3LXUX 4H61A 4R9KA 1VQ83 2OQEA 3SEDA 3WHOA 3HOHA 1RLSA 4Q53A 1LQGC 3G8ZA 5KP3A 2CWUA 3T8NA 1VQK3 1SARA 1UGIA 3DM8A 4O3VA 3LH4A 1YJ93 3OV4A 5JPPA 1QVG2 3HIGA 1ASKA 1OPYA 1STFI 2CX1A 2F86B 2JDIH 1LVNA 4HM7B 5LC7A 3NHXA 3CPW2 1JBRA 3ROBA 2CFKA 3WOEB 2XFSA 5AEUB 1BUQA 1M904 2OCTA 4R80A 1Q9EA 2RBIA 3FZWA 1Q7Y4 1D6ZA 3GZYB 1GY7A 3D5GA 5CF1A 3CXC2 1E3RA 3CCS3 3GZBA 2CX0A 4LZIA 1JNQA 1T3BA 1C54A 5G1LA 1DETA 2BO9B 3LMLA 3NQYA 3F7XA 4X2HA 2QGUA 2ML6A 1A2PA 1W2ZA 2R4IA 1ROAA 1FUWA 2I9WA 4HVNA 5EVHA 3RDEA 3FF2A 2IUJA 1UDII 2IUKA 3EF8A 1YJN3 1NU3A 1UI8A 7STDA 2MC8A 1I3FA 2W6JH 3D79A 1CYVA 1OHSA 2F56A 3VF1A 1IVVA 1VQP3 2Q07A 2PNCA 1K9M4 1GD4A 1W4NA 1OH0A 2CHCA 4WWUC 4EXRA 5CXOA 1G02A 1JRQA 1EKMA 2K3DA 4J8TA 1CEWI 3LYGA 4RNZA 4XBYA 2K54A 5STDA 1OHOA 2LYXA 4BTWA 5M1AA 1MWUA 1ZX2A 3JUNA 1PU4A 3X42A 3H51A 4PEJA 3CC23 5GSPA 3OXAA 3D3LA 1M1XB 1W6YA 2FXTA 4ZM8A 3LOYA 1GY6A 4FCJA 4XBTA 1UUVB 2KRTA 3DGOA 4XB5A 1Q864 4LGQA 2HMMB 1IT7A 1N9JA 1YVSA 5D81A 5CF2A 5IG5A 3ER7A 3NV0A 4BL3A 1BGSA 3KFQC 1EG9B 1VQ63 3PS8A 2W2CA 1BANA 5IF6A 2YX9A 1YIT3 3ZFZA 1UI7A 2CFLA 4STDA 3Q3FA 6STDA 1PFPA 2CH9A 4HM1B 2OOVC 5IEOA 1JB2A 1M9GA 2FNQA 3DMCA 1C7HA 5G1KA 1W02A 4HM3B 1FA3A 1U5OA 3EBTA 1J2BA 4N6OB 2YFJB 1X1WA 2BMQB 2KF4A 2GBWB 3F9SA 2CG1A 1ISKA 2YFLB 1VQ53 3RGRA 4LMIA 3RNTA 4HM5B 2J8XB 1HKXA 1A2KA 1STDA 1FZUA 5JPUA 2RNTA 1KD14 5AYSC 1I2GA 1JBSA 4HM0B 1Q7HA 2KF5A 3CD63 2RGQA 2AAEA 2Z76A 4KFFA 6GSPA 2CWTA 1LOYA 1N9EA 4JF8A 4L8OA 1N8QA 3S5CA 1LOVA 1IQYA 3CU3A 3JUMA 2BT3A 3OWUA 3AMOA 4TX4A 4MMXB 1VQM3 2XFTA 2XH9A 1BRKA 2L4VA 1RGCA 3BNBA 4K61A 5HOHA 2W0QA 4I4KA 4K90B 3CCL3 5IG4A 1E3VA 1N5HA 1TFOA 3HZPA 2WOFA 3NBRA 3OWYA 1RGAA 3X41A 3V92A 4J9AA 2OTL3 3ALAA 1A90A 1O7PB 2GEXA 3NM2A 1OACA 2F5MA 4AKZA 2ZL8A 3AGNA 4BU4A 3X3ZA 1BNFA 2GXFA 1I0VA 3DH2A 4J5GA 3VGNA 1JJ22 1UGHI 5D82A 3SLUA 2XSOB 1Q40B 4FMCA 3H3HA 1AVKA 1TU5A 1O7MB 2OWPA 1AVLA 3CCV3 3V99A 1BVIA 1RGEA 1OF5A 1CH0A 1BRSA 2KF6A 2RSXA 5A0OB 3LTDA 3DXOA 3SOAA 4WP5A 1TTOA 3IMAB 2H0IA 2JQ5A 1FUTA 3G16A 3PZWA 4RZMA 3CCR3 1BSEA 1AR0A 2C11A 4R1KA 1X1XA 1NO3A 3I563 1YJW3 2K0MA 5CLKA 1V58A 4KVHA 1EA2A 1YGEA 3MYTA 3MG1A 1UW1A 2P0MA 1IV7A 1VQL3 1OHPA 1V57A 4AEQA 2MF7A 1S723 1IV9A 1BNJA 1DVDA 1N5PA 1ZGXA 3EX9A 1EUIC 8RNTA 1B21A 3CCJ3 4MMYB 4EV2A 3G6E3 1O7HB 4L8PA 3B7CA 3Q90A 4NHFA 2F5WA 1Z1SA 1GY5A 1GD3A 2BIRA 3N9HA 5I97A 1K28A 1NB3I 1SIHA 1B2MA 5FW5A 1RGFA 4WYKB 2KF3A 1IU7A 1B2ZA 3OW22 3CC73 2C4BA 3STDA 3SVAA 1I3IA 3WOFB 5DREA 3CCM3 1ROVA 1IQXA 4FCZA 4J5KA 1RNTA 3PYJA 3FF0A 2P0XA 1FYSA 1RN1A 2FGTA 4NREA 1MGWA 1MWSA 4MJDA 4RBNA 3V98A 4BTYA 3EE1A 1NJI4 3MSOA 4CPKA 3CME3 3KIIA 2CW9A 2GBXB 2INXA 1BNSA 5IERA 1JN5A 1I70A 3F7SA 3K0ZA 4LSOA 5AIGA 1B27A 4O8SA 1IK3A 1OGZA 1GYBA 1MNLA 2W9PA 4L7KA 1BOXA 3FSDA 3B8LA 2OTJ3 1BRIA 5AI1A 3A5EA 1FW7A 1OCVA 1R4YA 1WMNA 5ELJA 1IVUA 1YVBI 4HM6B 2P38A 3I553 1M1K4 4ORLA 1BNIA 4DKIA 3PCSA 1ULJB 1UCJA 2KAAA 3KSPA 3K63A 2HMJB 1WQLB 1GMRA 3BNDA 1I0XA 2Y73A 2UX0A 2R41A 1RJOA 1GOYA 1RCKA 1JKGB 3KCHA 1EEJA 3ZG5A 1RSNA 1BIRA 3DGMA 3G713 3KN4A 2HMKB 2XF3A 1VQ43 2CFDA 4FMDA 1KQS2 4QWTA 1BAOA 1B20A 2SBLA 4FR9A 4K1UA 3K5TA 2Y74A 1AQZA 4XBXA 5BXQA 4EYCA 1AY7A 1DMNA 1G96A 3LTBA 3CC43 1B3SA 5EEOA 1BU4A 4HM4B 2W56A 4R9LA 4O2HA 1O7GB 3EC9A 1BSDA 1AV4A 3FG3A 3EJVA 1I8VA 1TFKA 5IG3A 1X1YA 1DE3A 3OWSA 3D4AA 1IVWA 4XDWA 1JB5A 3ZG0A 2IA7A 2Z6BA 3UL5A 3JVCA 4U13A 1ULIB 4BTXA 1A2VA 2CG0A 1VQN3 4KZ1A 2ZA4A 3EB8A 3NM7A 1D6UA 3K7CA 1W5ZA 1B2XA 1Q814 3NXJA 3QRDA 4IT7A 3SOYA 2E2TA 1VZZA 1NB5I 3CMA3 1LNIA 3DGLA 1RMSA 3BLZA 2CK3H 2BMRB 2Z7AA 3NX0A 3DGYA 1UCLA 4BIRA 3D5IA 1W01A 3F14A 3EHCA 1RDSA 3U1WA 1BRNL 3Q1CA 3DY5A 1FGTA 1LNHA 1JB4A 4HBRA 1O7NB 1K8A4 3FH1A 4IIAA 4N6MA 4AKYA 1YI23 1N8R4 4N6V0 3IJEB 1T2HA 2WGQA 1BRGA 4G1MB 2ZDJA 3G4S3 1T2IA 2SARA 3GRDA 1S5AA 8CHOA 1SIIA 1U8CB 2QIYA 5KP1A 3JUOA 1IT8A 1IQ8A 3GSPA 1Q824 1MWRA 1Y4KA 1JBTA 3MKIA 1RGLA 1QAFA 3T8UA 1WNHA 3LZAA 4K1VA 2OQEC 3URPA 1T5YA 2CIUA 3I0YA 2D1WA 4GB5A 4H3UA 5DRVA 1PY3A 4ILFA 1QAKA 1LXEA 2B24B 4HZ9B 3DUKA 3HX8A 1TRQA 3CCE3 1UUWB 4HZBB 4HAAA 1LQMB 3GZRA 1KWIA 1TJDA 3CNMA 5M19A 2P09A 3Q2PA 1QVF2 1TRPA 2XGNA 4HJLB 1QMAA 1CQSA 3EBYA 3HIIA 1WMOA 1SJWA 3BNCA 1IYYA 7RNTA 1DVCA 5D83A 4MEIA 3S29A 1RHLA 3NV0B 4N3VA 3O8YA 2A15A 3NQZA 1RGGA 4KT3B 4KFDA 1HU9A 1NNVA 4OK0A 1GOVA 1E97A 1R4CA 1RRHA 3MHEA 3MPHA 4LYLB 5IG0A 2UGIA 4HKVB 3WODG 3MG2A 1A67A 2LQVA 5G2GA 4GHOA 4EW5A 2AADA 1VQ73 3WMDA 1W00A 4EBGA 3J7Yd 1BNGA 1RGHA 2HMNB 1W2B2 5BIRA 3WA3A 3ECFA 3NBBA 3EN1B 2CFGA 2P05A 3BB9A 3N8BA 3GWRA 4XM4A 5FGOA 1JZOA 3B4PA 3WA2X 1FGQA 3MWZA 1I2EA 1I2FA 2XGLA 3D9RA 4RNYA 1TP6A 1UCIA 2O9UX 3IPTA 2IYJA 2CWVA 4EV5A 1DMMA 1Q42A 1SQWA 2Z77A 3AHWA 3X40A 3F8XA 4LEHA 3SX1A 2L1SA 2E2VA 3PXMA 3WDGB 3EN8A 4N6TA 2GU1A 4GSPA 3AMOB 5LC6A 1O7WB 3UL6A 1IVXA 3LT8A 3A76A 3CPOA 1GMQA 2ML5A 3TDGA 1VQO3 1VQ93 1YGWA 4R4KA 5TGNA 1RGKA 1GMPA 2V1LA 1RTUA 2W03A 1OUNA 2CC3A 3SXXA 1YNVX 4EC6A 1V74A 5AIHA 3L0RA 1RKYA 1KC84 1JZDA 2XR8B 1Q40A 5AYRB 6RNTA 5JBSA 2XEPA 1LRAA 2YFIB 2BMOB 2HMOB 1QALA 1ZO2A 3MG3A 2KCDA 3F8HA 1WMPA 2E2UA 1BSCA 2WGOA 1YHQ3 1L5GB 1GSPA 1OF5B 1QJGA 4N6LA 1CYUA 1UUGB 5AIFA 2C10A 2UUGC 3EQQB 4O02B 2BNGA 2HMLB 1TIJA
chains in the Genus database with same CATH topology
1B2SA 2GSPA 1A2PA 5RNTA 1BNRA 3AHSA 1T2HA 1BRGA 1BNJA 1I3FA 1ZGXA 8RNTA 2F56A 1T2IA 2SARA 4RNTA 2HOHA 1B21A 2BU4A 3GSPA 1G02A 1JBTA 2F5WA 1RGLA 1FUSA 1RN4A 2BIRA 4HOHA 3URPA 1B2MA 1RGFA 1BRJA 1PY3A 2KF3A 5GSPA 1B2ZA 1HZ1A 1TRQA 1PYLA 1BRHA 1LOWA 2C4BA 3WR2A 1I3IA 4HAAA 4J5KA 1RNTA 1FYSA 1RN1A 1TRPA 1MGWA 1YVSA 1IYYA 1BGSA 7RNTA 1RCLA 1BNSA 1MGRA 1RHLA 3SYUA 1I70A 1BANA 1RGGA 1B27A 1GOVA 1BOXA 3Q3FA 1BRIA 3A5EA 1FW7A 1B2UA 1R4YA 4GHOA 2AADA 1BNIA 1BNGA 3AGOA 1RGHA 1UCJA 1BSBA 2F4YA 2KAAA 5BIRA 1X1WA 2KF4A 1X1UA 1GMRA 1I0XA 1GOYA 1RCKA 3RNTA 1BNEA 3KCHA 1RNBA 1FZUA 2RNTA 1I2EA 1I2FA 1BSAA 1I2GA 1RSNA 1UCIA 1JBSA 1BIRA 2KF5A 1BUJA 2AAEA 6GSPA 1LOYA 1UCKA 1BAOA 3AHWA 1B20A 5BU4A 9RNTA 1LOVA 1AQZA 1GOUA 3BU4A 1AY7A 1HYFA 4GSPA 1BRKA 7GSPA 1RGCA 3BIRA 1B3SA 5HOHA 1BU4A 1BSDA 1I8VA 1GMQA 1X1YA 1DE3A 3D4AA 1RGAA 3WHOA 1YGWA 3HOHA 1RLSA 1RGKA 1GMPA 1RTUA 2F5MA 4BU4A 3AGNA 1YNVX 1SARA 1BNFA 1I0VA 2ZA4A 3DH2A 4J5GA 6RNTA 1LRAA 1B2XA 1JBRA 1LNIA 1BVIA 1RGEA 1RMSA 1BSCA 1CH0A 1BRSA 2KF6A 1Q9EA 1GSPA 1UCLA 2RBIA 3DGYA 4BIRA 1TTOA 3D5IA 3D5GA 1FUTA 1C54A 1RDSA 1BRNL 1DETA 1BSEA 1X1XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B2S A;  2GSP A;  1A2P A;  5RNT A;  1BNR A;  3AHS A;  1T2H A;  1BRG A;  1BNJ A;  1I3F A;  1ZGX A;  8RNT A;  2F56 A;  1T2I A;  2SAR A;  4RNT A;  2HOH A;  1B21 A;  2BU4 A;  3GSP A;  1G02 A;  1JBT A;  2F5W A;  1RGL A;  1FUS A;  1RN4 A;  2BIR A;  4HOH A;  3URP A;  1B2M A;  1RGF A;  1BRJ A;  1PY3 A;  2KF3 A;  5GSP A;  1B2Z A;  1HZ1 A;  1TRQ A;  1PYL A;  1BRH A;  1LOW A;  2C4B A;  3WR2 A;  1I3I A;  4HAA A;  4J5K A;  1RNT A;  1FYS A;  1RN1 A;  1TRP A;  1MGW A;  1YVS A;  1IYY A;  1BGS A;  7RNT A;  1RCL A;  1BNS A;  1MGR A;  1RHL A;  3SYU A;  1I70 A;  1BAN A;  1RGG A;  1B27 A;  1GOV A;  1BOX A;  3Q3F A;  1BRI A;  3A5E A;  1FW7 A;  1B2U A;  1R4Y A;  4GHO A;  2AAD A;  1BNI A;  1BNG A;  3AGO A;  1RGH A;  1UCJ A;  1BSB A;  2F4Y A;  2KAA A;  5BIR A;  1X1W A;  2KF4 A;  1X1U A;  1GMR A;  1I0X A;  1GOY A;  1RCK A;  3RNT A;  1BNE A;  3KCH A;  1RNB A;  1FZU A;  2RNT A;  1I2E A;  1I2F A;  1BSA A;  1I2G A;  1RSN A;  1UCI A;  1JBS A;  1BIR A;  2KF5 A;  1BUJ A;  2AAE A;  6GSP A;  1LOY A;  1UCK A;  1BAO A;  3AHW A;  1B20 A;  5BU4 A;  9RNT A;  1LOV A;  1AQZ A;  1GOU A;  3BU4 A;  1AY7 A;  1HYF A;  4GSP A;  1BRK A;  7GSP A;  1RGC A;  3BIR A;  1B3S A;  5HOH A;  1BU4 A;  1BSD A;  1I8V A;  1GMQ A;  1X1Y A;  1DE3 A;  3D4A A;  1RGA A;  3WHO A;  1YGW A;  3HOH A;  1RLS A;  1RGK A;  1GMP A;  1RTU A;  2F5M A;  4BU4 A;  3AGN A;  1YNV X;  1SAR A;  1BNF A;  1I0V A;  2ZA4 A;  3DH2 A;  4J5G A;  6RNT A;  1LRA A;  1B2X A;  1JBR A;  1LNI A;  1BVI A;  1RGE A;  1RMS A;  1BSC A;  1CH0 A;  1BRS A;  2KF6 A;  1Q9E A;  1GSP A;  1UCL A;  2RBI A;  3DGY A;  4BIR A;  1TTO A;  3D5I A;  3D5G A;  1FUT A;  1C54 A;  1RDS A;  1BRN L;  1DET A;  1BSE A;  1X1X A; 
#chains in the Genus database with same CATH topology
 1IDP A;  4X2O A;  1B2S A;  1RRL A;  2GSP A;  3KE7 A;  3UJM A;  2IY2 A;  5RNT A;  1BNR A;  3KKG A;  3AHS A;  1W6C A;  1FGM A;  4HYZ A;  2H0G A;  1RN7 A;  1WTH A;  2QEX 3;  1NWW A;  4FCM A;  4NPB A;  5IEN A;  4RNT A;  2GEY A;  2HOH A;  3DGN A;  4N6N B;  3NUV A;  5AEW B;  1FGR A;  2BU4 A;  1LOX A;  5AII A;  1JV2 B;  1SPU A;  3OX9 A;  1TUH A;  3JUQ A;  1FUS A;  1RN4 A;  3G0K A;  3T0U A;  4N6U A;  4HOH A;  2WO0 A;  4WYK A;  4XDV A;  3B4O A;  1GS3 A;  5ELU A;  4CCV A;  1BRJ A;  3PGB A;  2RCD A;  1HZ1 A;  3FKA A;  1PYL A;  1BRH A;  1LOW A;  2W9Q A;  2OOV A;  3DZL A;  3JUP A;  3S67 A;  3WR2 A;  2XRX B;  2M7O A;  3S28 A;  1W6G A;  4KFE A;  3LT9 A;  1D6Y A;  3FGY A;  4FMA A;  3FG1 A;  3FCS B;  1FGO A;  1RCL A;  1MGR A;  2D42 A;  3E99 A;  5HGR A;  3RGA A;  2GU3 A;  4OUQ A;  2CFW A;  3SYU A;  3X3X A;  3FLJ A;  3LTC A;  4GL6 A;  4WHA A;  3S27 A;  3FG4 A;  1JN5 B;  3K9M C;  3X3Y A;  1G0T A;  3N54 B;  2PZV A;  2F98 A;  3HI7 A;  3UB1 A;  1B2U A;  3QK9 A;  3F40 A;  2WOH A;  1EQK A;  5CK6 A;  5M18 A;  5EQL A;  3AGO A;  4WFO A;  3GAX A;  1BSB A;  1NDO B;  1K41 A;  2F4Y A;  3CNX A;  2XSH B;  1ZS7 A;  4OVM A;  4HM2 B;  3CCU 3;  1X1U A;  4BL2 A;  1OGX A;  4MMZ B;  4I5Q A;  1JKG A;  3KSE D;  1YIJ 3;  4FMB A;  2ZHX B;  1BNE A;  2KXG A;  1RNB A;  1US1 A;  3M8C A;  1BSA A;  2H0H A;  1F8N A;  1BUJ A;  3LTA A;  1DYU A;  2CKF B;  2RFR A;  1UCK A;  4IPB A;  2F99 A;  3PCR A;  3CCQ 3;  1DMQ A;  3BNE A;  2B1X B;  2IMJ A;  5BU4 A;  1W7C A;  9RNT A;  5IEP A;  2STD A;  1GOU A;  3BU4 A;  1K73 4;  1MWT A;  3KZT A;  3VSY A;  5IW9 A;  1HYF A;  1MOL A;  5KP4 A;  7GSP A;  2W04 A;  3BIR A;  2QA4 3;  4CDL A;  3NBJ A;  4JRF A;  5BVB A;  1KSI A;  4HM8 B;  3U97 A;  2W56 B;  2BHM A;  3UNL A;  1VQQ A;  3GZX B;  4CJN A;  2O3O A;  3HK4 A;  3LXU X;  4H61 A;  4R9K A;  1VQ8 3;  2OQE A;  3SED A;  3WHO A;  3HOH A;  1RLS A;  4Q53 A;  1LQG C;  3G8Z A;  5KP3 A;  2CWU A;  3T8N A;  1VQK 3;  1SAR A;  1UGI A;  3DM8 A;  4O3V A;  3LH4 A;  1YJ9 3;  3OV4 A;  5JPP A;  1QVG 2;  3HIG A;  1ASK A;  1OPY A;  1STF I;  2CX1 A;  2F86 B;  2JDI H;  1LVN A;  4HM7 B;  5LC7 A;  3NHX A;  3CPW 2;  1JBR A;  3ROB A;  2CFK A;  3WOE B;  2XFS A;  5AEU B;  1BUQ A;  1M90 4;  2OCT A;  4R80 A;  1Q9E A;  2RBI A;  3FZW A;  1Q7Y 4;  1D6Z A;  3GZY B;  1GY7 A;  3D5G A;  5CF1 A;  3CXC 2;  1E3R A;  3CCS 3;  3GZB A;  2CX0 A;  4LZI A;  1JNQ A;  1T3B A;  1C54 A;  5G1L A;  1DET A;  2BO9 B;  3LML A;  3NQY A;  3F7X A;  4X2H A;  2QGU A;  2ML6 A;  1A2P A;  1W2Z A;  2R4I A;  1ROA A;  1FUW A;  2I9W A;  4HVN A;  5EVH A;  3RDE A;  3FF2 A;  2IUJ A;  1UDI I;  2IUK A;  3EF8 A;  1YJN 3;  1NU3 A;  1UI8 A;  7STD A;  2MC8 A;  1I3F A;  2W6J H;  3D79 A;  1CYV A;  1OHS A;  2F56 A;  3VF1 A;  1IVV A;  1VQP 3;  2Q07 A;  2PNC A;  1K9M 4;  1GD4 A;  1W4N A;  1OH0 A;  2CHC A;  4WWU C;  4EXR A;  5CXO A;  1G02 A;  1JRQ A;  1EKM A;  2K3D A;  4J8T A;  1CEW I;  3LYG A;  4RNZ A;  4XBY A;  2K54 A;  5STD A;  1OHO A;  2LYX A;  4BTW A;  5M1A A;  1MWU A;  1ZX2 A;  3JUN A;  1PU4 A;  3X42 A;  3H51 A;  4PEJ A;  3CC2 3;  5GSP A;  3OXA A;  3D3L A;  1M1X B;  1W6Y A;  2FXT A;  4ZM8 A;  3LOY A;  1GY6 A;  4FCJ A;  4XBT A;  1UUV B;  2KRT A;  3DGO A;  4XB5 A;  1Q86 4;  4LGQ A;  2HMM B;  1IT7 A;  1N9J A;  1YVS A;  5D81 A;  5CF2 A;  5IG5 A;  3ER7 A;  3NV0 A;  4BL3 A;  1BGS A;  3KFQ C;  1EG9 B;  1VQ6 3;  3PS8 A;  2W2C A;  1BAN A;  5IF6 A;  2YX9 A;  1YIT 3;  3ZFZ A;  1UI7 A;  2CFL A;  4STD A;  3Q3F A;  6STD A;  1PFP A;  2CH9 A;  4HM1 B;  2OOV C;  5IEO A;  1JB2 A;  1M9G A;  2FNQ A;  3DMC A;  1C7H A;  5G1K A;  1W02 A;  4HM3 B;  1FA3 A;  1U5O A;  3EBT A;  1J2B A;  4N6O B;  2YFJ B;  1X1W A;  2BMQ B;  2KF4 A;  2GBW B;  3F9S A;  2CG1 A;  1ISK A;  2YFL B;  1VQ5 3;  3RGR A;  4LMI A;  3RNT A;  4HM5 B;  2J8X B;  1HKX A;  1A2K A;  1STD A;  1FZU A;  5JPU A;  2RNT A;  1KD1 4;  5AYS C;  1I2G A;  1JBS A;  4HM0 B;  1Q7H A;  2KF5 A;  3CD6 3;  2RGQ A;  2AAE A;  2Z76 A;  4KFF A;  6GSP A;  2CWT A;  1LOY A;  1N9E A;  4JF8 A;  4L8O A;  1N8Q A;  3S5C A;  1LOV A;  1IQY A;  3CU3 A;  3JUM A;  2BT3 A;  3OWU A;  3AMO A;  4TX4 A;  4MMX B;  1VQM 3;  2XFT A;  2XH9 A;  1BRK A;  2L4V A;  1RGC A;  3BNB A;  4K61 A;  5HOH A;  2W0Q A;  4I4K A;  4K90 B;  3CCL 3;  5IG4 A;  1E3V A;  1N5H A;  1TFO A;  3HZP A;  2WOF A;  3NBR A;  3OWY A;  1RGA A;  3X41 A;  3V92 A;  4J9A A;  2OTL 3;  3ALA A;  1A90 A;  1O7P B;  2GEX A;  3NM2 A;  1OAC A;  2F5M A;  4AKZ A;  2ZL8 A;  3AGN A;  4BU4 A;  3X3Z A;  1BNF A;  2GXF A;  1I0V A;  3DH2 A;  4J5G A;  3VGN A;  1JJ2 2;  1UGH I;  5D82 A;  3SLU A;  2XSO B;  1Q40 B;  4FMC A;  3H3H A;  1AVK A;  1TU5 A;  1O7M B;  2OWP A;  1AVL A;  3CCV 3;  3V99 A;  1BVI A;  1RGE A;  1OF5 A;  1CH0 A;  1BRS A;  2KF6 A;  2RSX A;  5A0O B;  3LTD A;  3DXO A;  3SOA A;  4WP5 A;  1TTO A;  3IMA B;  2H0I A;  2JQ5 A;  1FUT A;  3G16 A;  3PZW A;  4RZM A;  3CCR 3;  1BSE A;  1AR0 A;  2C11 A;  4R1K A;  1X1X A;  1NO3 A;  3I56 3;  1YJW 3;  2K0M A;  5CLK A;  1V58 A;  4KVH A;  1EA2 A;  1YGE A;  3MYT A;  3MG1 A;  1UW1 A;  2P0M A;  1IV7 A;  1VQL 3;  1OHP A;  1V57 A;  4AEQ A;  2MF7 A;  1S72 3;  1IV9 A;  1BNJ A;  1DVD A;  1N5P A;  1ZGX A;  3EX9 A;  1EUI C;  8RNT A;  1B21 A;  3CCJ 3;  4MMY B;  4EV2 A;  3G6E 3;  1O7H B;  4L8P A;  3B7C A;  3Q90 A;  4NHF A;  2F5W A;  1Z1S A;  1GY5 A;  1GD3 A;  2BIR A;  3N9H A;  5I97 A;  1K28 A;  1NB3 I;  1SIH A;  1B2M A;  5FW5 A;  1RGF A;  4WYK B;  2KF3 A;  1IU7 A;  1B2Z A;  3OW2 2;  3CC7 3;  2C4B A;  3STD A;  3SVA A;  1I3I A;  3WOF B;  5DRE A;  3CCM 3;  1ROV A;  1IQX A;  4FCZ A;  4J5K A;  1RNT A;  3PYJ A;  3FF0 A;  2P0X A;  1FYS A;  1RN1 A;  2FGT A;  4NRE A;  1MGW A;  1MWS A;  4MJD A;  4RBN A;  3V98 A;  4BTY A;  3EE1 A;  1NJI 4;  3MSO A;  4CPK A;  3CME 3;  3KII A;  2CW9 A;  2GBX B;  2INX A;  1BNS A;  5IER A;  1JN5 A;  1I70 A;  3F7S A;  3K0Z A;  4LSO A;  5AIG A;  1B27 A;  4O8S A;  1IK3 A;  1OGZ A;  1GYB A;  1MNL A;  2W9P A;  4L7K A;  1BOX A;  3FSD A;  3B8L A;  2OTJ 3;  1BRI A;  5AI1 A;  3A5E A;  1FW7 A;  1OCV A;  1R4Y A;  1WMN A;  5ELJ A;  1IVU A;  1YVB I;  4HM6 B;  2P38 A;  3I55 3;  1M1K 4;  4ORL A;  1BNI A;  4DKI A;  3PCS A;  1ULJ B;  1UCJ A;  2KAA A;  3KSP A;  3K63 A;  2HMJ B;  1WQL B;  1GMR A;  3BND A;  1I0X A;  2Y73 A;  2UX0 A;  2R41 A;  1RJO A;  1GOY A;  1RCK A;  1JKG B;  3KCH A;  1EEJ A;  3ZG5 A;  1RSN A;  1BIR A;  3DGM A;  3G71 3;  3KN4 A;  2HMK B;  2XF3 A;  1VQ4 3;  2CFD A;  4FMD A;  1KQS 2;  4QWT A;  1BAO A;  1B20 A;  2SBL A;  4FR9 A;  4K1U A;  3K5T A;  2Y74 A;  1AQZ A;  4XBX A;  5BXQ A;  4EYC A;  1AY7 A;  1DMN A;  1G96 A;  3LTB A;  3CC4 3;  1B3S A;  5EEO A;  1BU4 A;  4HM4 B;  2W56 A;  4R9L A;  4O2H A;  1O7G B;  3EC9 A;  1BSD A;  1AV4 A;  3FG3 A;  3EJV A;  1I8V A;  1TFK A;  5IG3 A;  1X1Y A;  1DE3 A;  3OWS A;  3D4A A;  1IVW A;  4XDW A;  1JB5 A;  3ZG0 A;  2IA7 A;  2Z6B A;  3UL5 A;  3JVC A;  4U13 A;  1ULI B;  4BTX A;  1A2V A;  2CG0 A;  1VQN 3;  4KZ1 A;  2ZA4 A;  3EB8 A;  3NM7 A;  1D6U A;  3K7C A;  1W5Z A;  1B2X A;  1Q81 4;  3NXJ A;  3QRD A;  4IT7 A;  3SOY A;  2E2T A;  1VZZ A;  1NB5 I;  3CMA 3;  1LNI A;  3DGL A;  1RMS A;  3BLZ A;  2CK3 H;  2BMR B;  2Z7A A;  3NX0 A;  3DGY A;  1UCL A;  4BIR A;  3D5I A;  1W01 A;  3F14 A;  3EHC A;  1RDS A;  3U1W A;  1BRN L;  3Q1C A;  3DY5 A;  1FGT A;  1LNH A;  1JB4 A;  4HBR A;  1O7N B;  1K8A 4;  3FH1 A;  4IIA A;  4N6M A;  4AKY A;  1YI2 3;  1N8R 4;  4N6V 0;  3IJE B;  1T2H A;  2WGQ A;  1BRG A;  4G1M B;  2ZDJ A;  3G4S 3;  1T2I A;  2SAR A;  3GRD A;  1S5A A;  8CHO A;  1SII A;  1U8C B;  2QIY A;  5KP1 A;  3JUO A;  1IT8 A;  1IQ8 A;  3GSP A;  1Q82 4;  1MWR A;  1Y4K A;  1JBT A;  3MKI A;  1RGL A;  1QAF A;  3T8U A;  1WNH A;  3LZA A;  4K1V A;  2OQE C;  3URP A;  1T5Y A;  2CIU A;  3I0Y A;  2D1W A;  4GB5 A;  4H3U A;  5DRV A;  1PY3 A;  4ILF A;  1QAK A;  1LXE A;  2B24 B;  4HZ9 B;  3DUK A;  3HX8 A;  1TRQ A;  3CCE 3;  1UUW B;  4HZB B;  4HAA A;  1LQM B;  3GZR A;  1KWI A;  1TJD A;  3CNM A;  5M19 A;  2P09 A;  3Q2P A;  1QVF 2;  1TRP A;  2XGN A;  4HJL B;  1QMA A;  1CQS A;  3EBY A;  3HII A;  1WMO A;  1SJW A;  3BNC A;  1IYY A;  7RNT A;  1DVC A;  5D83 A;  4MEI A;  3S29 A;  1RHL A;  3NV0 B;  4N3V A;  3O8Y A;  2A15 A;  3NQZ A;  1RGG A;  4KT3 B;  4KFD A;  1HU9 A;  1NNV A;  4OK0 A;  1GOV A;  1E97 A;  1R4C A;  1RRH A;  3MHE A;  3MPH A;  4LYL B;  5IG0 A;  2UGI A;  4HKV B;  3WOD G;  3MG2 A;  1A67 A;  2LQV A;  5G2G A;  4GHO A;  4EW5 A;  2AAD A;  1VQ7 3;  3WMD A;  1W00 A;  4EBG A;  3J7Y d;  1BNG A;  1RGH A;  2HMN B;  1W2B 2;  5BIR A;  3WA3 A;  3ECF A;  3NBB A;  3EN1 B;  2CFG A;  2P05 A;  3BB9 A;  3N8B A;  3GWR A;  4XM4 A;  5FGO A;  1JZO A;  3B4P A;  3WA2 X;  1FGQ A;  3MWZ A;  1I2E A;  1I2F A;  2XGL A;  3D9R A;  4RNY A;  1TP6 A;  1UCI A;  2O9U X;  3IPT A;  2IYJ A;  2CWV A;  4EV5 A;  1DMM A;  1Q42 A;  1SQW A;  2Z77 A;  3AHW A;  3X40 A;  3F8X A;  4LEH A;  3SX1 A;  2L1S A;  2E2V A;  3PXM A;  3WDG B;  3EN8 A;  4N6T A;  2GU1 A;  4GSP A;  3AMO B;  5LC6 A;  1O7W B;  3UL6 A;  1IVX A;  3LT8 A;  3A76 A;  3CPO A;  1GMQ A;  2ML5 A;  3TDG A;  1VQO 3;  1VQ9 3;  1YGW A;  4R4K A;  5TGN A;  1RGK A;  1GMP A;  2V1L A;  1RTU A;  2W03 A;  1OUN A;  2CC3 A;  3SXX A;  1YNV X;  4EC6 A;  1V74 A;  5AIH A;  3L0R A;  1RKY A;  1KC8 4;  1JZD A;  2XR8 B;  1Q40 A;  5AYR B;  6RNT A;  5JBS A;  2XEP A;  1LRA A;  2YFI B;  2BMO B;  2HMO B;  1QAL A;  1ZO2 A;  3MG3 A;  2KCD A;  3F8H A;  1WMP A;  2E2U A;  1BSC A;  2WGO A;  1YHQ 3;  1L5G B;  1GSP A;  1OF5 B;  1QJG A;  4N6L A;  1CYU A;  1UUG B;  5AIF A;  2C10 A;  2UUG C;  3EQQ B;  4O02 B;  2BNG A;  2HML B;  1TIJ A; 
#chains in the Genus database with same CATH homology
 1B2S A;  2GSP A;  1A2P A;  5RNT A;  1BNR A;  3AHS A;  1T2H A;  1BRG A;  1BNJ A;  1I3F A;  1ZGX A;  8RNT A;  2F56 A;  1T2I A;  2SAR A;  4RNT A;  2HOH A;  1B21 A;  2BU4 A;  3GSP A;  1G02 A;  1JBT A;  2F5W A;  1RGL A;  1FUS A;  1RN4 A;  2BIR A;  4HOH A;  3URP A;  1B2M A;  1RGF A;  1BRJ A;  1PY3 A;  2KF3 A;  5GSP A;  1B2Z A;  1HZ1 A;  1TRQ A;  1PYL A;  1BRH A;  1LOW A;  2C4B A;  3WR2 A;  1I3I A;  4HAA A;  4J5K A;  1RNT A;  1FYS A;  1RN1 A;  1TRP A;  1MGW A;  1YVS A;  1IYY A;  1BGS A;  7RNT A;  1RCL A;  1BNS A;  1MGR A;  1RHL A;  3SYU A;  1I70 A;  1BAN A;  1RGG A;  1B27 A;  1GOV A;  1BOX A;  3Q3F A;  1BRI A;  3A5E A;  1FW7 A;  1B2U A;  1R4Y A;  4GHO A;  2AAD A;  1BNI A;  1BNG A;  3AGO A;  1RGH A;  1UCJ A;  1BSB A;  2F4Y A;  2KAA A;  5BIR A;  1X1W A;  2KF4 A;  1X1U A;  1GMR A;  1I0X A;  1GOY A;  1RCK A;  3RNT A;  1BNE A;  3KCH A;  1RNB A;  1FZU A;  2RNT A;  1I2E A;  1I2F A;  1BSA A;  1I2G A;  1RSN A;  1UCI A;  1JBS A;  1BIR A;  2KF5 A;  1BUJ A;  2AAE A;  6GSP A;  1LOY A;  1UCK A;  1BAO A;  3AHW A;  1B20 A;  5BU4 A;  9RNT A;  1LOV A;  1AQZ A;  1GOU A;  3BU4 A;  1AY7 A;  1HYF A;  4GSP A;  1BRK A;  7GSP A;  1RGC A;  3BIR A;  1B3S A;  5HOH A;  1BU4 A;  1BSD A;  1I8V A;  1GMQ A;  1X1Y A;  1DE3 A;  3D4A A;  1RGA A;  3WHO A;  1YGW A;  3HOH A;  1RLS A;  1RGK A;  1GMP A;  1RTU A;  2F5M A;  4BU4 A;  3AGN A;  1YNV X;  1SAR A;  1BNF A;  1I0V A;  2ZA4 A;  3DH2 A;  4J5G A;  6RNT A;  1LRA A;  1B2X A;  1JBR A;  1LNI A;  1BVI A;  1RGE A;  1RMS A;  1BSC A;  1CH0 A;  1BRS A;  2KF6 A;  1Q9E A;  1GSP A;  1UCL A;  2RBI A;  3DGY A;  4BIR A;  1TTO A;  3D5I A;  3D5G A;  1FUT A;  1C54 A;  1RDS A;  1BRN L;  1DET A;  1BSE A;  1X1X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...