1BNSA

Structural studies of barnase mutants
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYIAKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Contribution of buried hydrogen bonds to protein stability. The crystal structures of two barnase mutants.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Endonuclease
molecule keywords BARNASE
total genus 30
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 1994-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1bnsA00
1FZUA 1RLSA 1B2UA 1RNTA 1RGCA 2AAEA 1PY3A 1RCLA 1TRQA 3SYUA 1C54A 1X1XA 1BRHA 1MGRA 1BSEA 1BSCA 1GSPA 1GOVA 1LOYA 2BU4A 5BU4A 1BRNL 1BRGA 4RNTA 1T2HA 3WR2A 1BAOA 1BNGA 4GSPA 1RGFA 1UCLA 1GOUA 2F56A 2GSPA 3D4AA 1YVSA 2F5WA 1B2ZA 1I0XA 1GMRA 6RNTA 2AADA 1BVIA 5GSPA 2KF3A 1SARA 1GMQA 1RGLA 1LNIA 4J5KA 1B2SA 2BIRA 1RN4A 1BGSA 3Q3FA 1BRSA 3A5EA 1I3IA 1R4YA 3AHWA 1FYSA 1CH0A 2SARA 1RTUA 2KF4A 1RGGA 2F5MA 7RNTA 2RBIA 1LOVA 1BNIA 1BIRA 1I2GA 1HZ1A 2C4BA 7GSPA 1BRIA 1FUSA 8RNTA 1BNFA 1HYFA 1FW7A 1BUJA 1UCKA 1BNSA 1YGWA 1RN1A 1B21A 1B2XA 1ZGXA 1RHLA 4BU4A 1JBRA 1RGHA 3HOHA 1I70A 2KAAA 1B2MA 3AGNA 1A2PA 5RNTA 1BRKA 1I0VA 3BIRA 1RGAA 1GOYA 1DE3A 3D5GA 2F4YA 1LRAA 1BSDA 3DH2A 1BOXA 1T2IA 1GMPA 3D5IA 4J5GA 1TRPA 1JBTA 1B20A 2KF5A 1JBSA 1BNEA 1AQZA 1UCIA 1PYLA 3BU4A 1I8VA 1Q9EA 1RCKA 1YNVX 1I2FA 9RNTA 2HOHA 3WHOA 1RNBA 1X1UA 1RGEA 2KF6A 5BIRA 1RDSA 1MGWA 1DETA 2ZA4A 1G02A 1UCJA 1BU4A 5HOHA 1I2EA 3AGOA 1BNJA 4HAAA 1I3FA 1BNRA 1LOWA 1IYYA 3RNTA 1BSBA 1BRJA 1RMSA 1RGKA 1AY7A 1RSNA 1FUTA 1X1YA 3DGYA 3URPA 4HOHA 1BANA 6GSPA 1BSAA 2RNTA 3AHSA 4GHOA 1X1WA 3GSPA 3KCHA 1B27A 1TTOA 4BIRA 1B3SA
chains in the Genus database with same CATH superfamily
1ASKA 1RNTA 1Q814 4HJLB 3I563 1W02A 3RDEA 1X1XA 5M18A 1GSPA 5BU4A 1YJN3 4RNTA 2W9PA 1A90A 1IT8A 4H61A 1BNGA 4GSPA 1KWIA 3EBYA 1UCLA 1IV7A 3F8HA 4EC6A 4R9KA 1GOUA 3ZG0A 3BLZA 4HM3B 2GSPA 2Z6BA 3A76A 5IF6A 1YVSA 3KFQC 1I0XA 3CXC2 1US1A 3HZPA 1EUIC 2KF3A 3F8XA 1D6YA 3X41A 1FA3A 4J5KA 2RSXA 2BIRA 1RN4A 1LNHA 4IPBA 1YGEA 1TIJA 5AIHA 5IENA 4R9LA 4J9AA 1NNVA 3AHWA 1IQYA 4BTWA 2OTJ3 2H0HA 1STDA 3WDGB 4PEJA 1K28A 3KE7A 4EYCA 3T8NA 2KF4A 3LT9A 1RGGA 3IPTA 4ZM8A 1IVUA 2F99A 3CC43 1BNIA 3DGMA 1PU4A 3F14A 1JRQA 7GSPA 1BRIA 3UJMA 5BXQA 8RNTA 1FGOA 2RGQA 2YFJB 3SVAA 1M1XB 1UCKA 3B4PA 1BNSA 2Q07A 2IY2A 3AMOA 1DMNA 1IDPA 1AVKA 2CKFB 3WODG 3I0YA 3VSYA 1JB2A 4HZBB 5STDA 1WMNA 3HOHA 3JUOA 1FGMA 1YIT3 3WOEB 1BRKA 3ZFZA 1EKMA 4FCJA 5AYRB 4K61A 1O7HB 5AYSC 3BB9A 4MMYB 3BNBA 4HM4B 4J5GA 3D5IA 1TRPA 4XBTA 3S5CA 1D6ZA 1GY6A 1B20A 2KF5A 4JF8A 5I97A 1OGZA 1BNEA 2WO0A 3X42A 3DGOA 3PXMA 4AKZA 1AR0A 3MYTA 3DXOA 4I4KA 3KIIA 3HIIA 2CG1A 3EQQB 1J2BA 4RZMA 5CF1A 2CFGA 2BNGA 1TFOA 3GZYB 3LTDA 1LVNA 1OACA 4HM7B 2A15A 1O7PB 3V92A 1T3BA 3EJVA 5BIRA 1OCVA 2LQVA 1G02A 1MWSA 1JV2B 2YFLB 3MG3A 1R4CA 3NX0A 1UCJA 4NPBA 1BU4A 3UL5A 1I2EA 3PCSA 2FNQA 3X3ZA 3HI7A 2YX9A 1VQK3 1UGIA 3CNXA 4HM6B 1BNJA 1IT7A 1SIHA 3MG1A 1VQN3 1K734 2PZVA 1MWTA 1W2B2 2GBWB 5ELUA 1OPYA 3LTCA 3KN4A 2CC3A 1AY7A 1RGKA 3DGYA 5EQLA 1FGTA 2MC8A 3URPA 3ROBA 2KCDA 3FG3A 2O3OA 4HVNA 1YIJ3 3FF0A 1D6UA 2BMRB 1BSAA 1WMOA 4RBNA 3AHSA 3N9HA 2XR8B 3GSPA 5CF2A 3K7CA 5JPPA 4LMIA 1GD3A 5EEOA 4N6NB 1K9M4 4G1MB 4XDVA 1JB5A 1RGCA 5IEPA 4H3UA 1NU3A 1W4NA 1Y4KA 1FW7A 4K1UA 1NO3A 2STDA 1M9GA 3FG1A 1NJI4 2IMJA 3KZTA 1T2HA 1JKGA 5LC6A 3X3XA 2CWTA 3BNCA 2WOHA 4RNYA 3CNMA 1E3VA 3D79A 1JN5A 4LGQA 3CCL3 2K0MA 1N8R4 2M7OA 3FKAA 3D4AA 4KFDA 1QVF2 3NBRA 5M1AA 6RNTA 2HMNB 2AADA 3T0UA 4AEQA 3FF2A 5AIIA 4I5QA 1GMQA 5TGNA 1SQWA 2FGTA 1BGSA 1OF5A 2CFKA 2JQ5A 2XRXB 3KSPA 1W6CA 3LH4A 4LZIA 4N6MA 3HK4A 1YI23 3CCV3 3G4S3 1R4YA 3GRDA 3NV0A 1VQ43 3K63A 3LOYA 3FG4A 1VQ53 3MHEA 1VQ73 4IT7A 3FSDA 4IIAA 3V98A 2P0MA 2C11A 4MEIA 3NXJA 8CHOA 3LXUX 3G713 1Q864 4RNZA 3CMA3 2W56A 2F5MA 3CU3A 4WFOA 2GEYA 2W03A 4N6OB 1KQS2 1RJOA 4WP5A 2K54A 2Z77A 1HZ1A 2RCDA 4N6UA 1S5AA 1BNFA 1HYFA 3F7SA 3UL6A 1VQL3 1A67A 2GBXB 3CD63 3EHCA 4CDLA 3CC23 2H0IA 1RKYA 5CK6A 4R80A 1IQXA 2XGLA 1ZGXA 4HKVB 1RHLA 5IG3A 3SEDA 4EW5A 2P09A 4BU4A 3VF1A 1JBRA 2H0GA 2W6JH 1MWUA 1QJGA 4NHFA 1OHOA 2XF3A 1A2PA 3PCRA 3LTBA 5RNTA 2P05A 2E2TA 3D9RA 2CX1A 1YVBI 3GZXB 3K0ZA 3S67A 3JUPA 1N9EA 3S28A 1QVG2 2CH9A 1U8CB 2OOVC 3DH2A 1BOXA 1O7GB 1T2IA 4O3VA 4EV5A 1GMPA 4MJDA 5KP4A 4FR9A 3I553 3FCSB 1FUWA 1GYBA 2SBLA 1AQZA 1TFKA 4HM1B 4ILFA 2P38A 5IG5A 1LXEA 3BU4A 4N6LA 1Q7Y4 1DMQA 4HM2B 1VZZA 4LEHA 1NDOB 1Q9EA 2F98A 1YNVX 1U5OA 3GZBA 9RNTA 3L0RA 3WHOA 5M19A 2Z7AA 3DGNA 7STDA 4KT3B 1X1UA 2KF6A 3LT8A 1RDSA 1IK3A 4FCZA 4FMBA 1ULJB 1FGQA 1IVVA 1N5HA 2UGIA 1O7MB 3DM8A 3RGRA 3HX8A 3OWUA 4Q53A 3VGNA 4HAAA 1VQ63 3KSED 2QEX3 1VQO3 4K1VA 2HMJB 1LOWA 1OUNA 5AI1A 1JKGB 3MPHA 2YFIB 1WTHA 5DRVA 4R1KA 3RNTA 4CPKA 1BSBA 1RRHA 4EXRA 2E2UA 2QA43 1IYYA 1CYUA 1RMSA 3G16A 4J8TA 1RSNA 1W01A 1X1YA 3CPOA 4KZ1A 1MWRA 3NM2A 3BNDA 3X40A 2CWUA 3S27A 3OXAA 1OH0A 2D1WA 3E99A 6GSPA 1KSIA 1RN7A 2B24B 1G0TA 2GU3A 5CLKA 4HBRA 1X1WA 4HZ9B 3KCHA 2CX0A 3B4OA 2W0QA 2J8XB 1B3SA 2IA7A 1FZUA 1RLSA 1B2UA 1PY3A 1RCLA 2CWVA 3LZAA 3PYJA 1TP6A 2CW9A 3SYUA 1C54A 3EBTA 1IQ8A 3UB1A 1MGRA 1LOYA 1BSCA 4OVMA 5ELJA 1V74A 1V58A 2BU4A 3NBBA 2WOFA 1BRNL 2IUKA 2CFDA 4O8SA 3F40A 1CYVA 2W9QA 2UX0A 3LMLA 1A2KA 1RGFA 3EF8A 2INXA 3CCQ3 2F56A 3N54B 3U97A 2BMQB 1UUWB 1EG9B 1K41A 2ZL8A 3BNEA 5GSPA 2K3DA 3F7XA 4XM4A 1WQLB 1LNIA 2ML6A 2KXGA 1JZDA 3Q3FA 4X2HA 2HMLB 1BRSA 3A5EA 3OWYA 4KFEA 1HU9A 1I3IA 1W6GA 3N8BA 2CK3H 1N5PA 1FYSA 1IV9A 1CH0A 4BL3A 1LOXA 4CCVA 3CME3 3FLJA 4N6TA 1ZS7A 2HMMB 1QAFA 1CEWI 2SARA 3IJEB 4WWUC 4STDA 5G2GA 7RNTA 5BVBA 5JBSA 3G0KA 1I2GA 2F86B 3FZWA 5KP3A 3UNLA 1EEJA 1NB3I 3EB8A 2PNCA 4KFFA 2O9UX 4QWTA 5IEOA 1RN1A 1B21A 5IW9A 3LTAA 1B2XA 1OF5B 4FCMA 1IU7A 3B7CA 1Q7HA 2CFWA 1M1K4 1VQQA 1RGHA 4CJNA 2CIUA 3ER7A 1I70A 3TDGA 1I0VA 2D42A 1GOYA 3SOYA 3CCJ3 1K8A4 1EQKA 2F4YA 1OGXA 4OUQA 4EV2A 3MWZA 2W56B 1E97A 2OOVA 2HMKB 1VQM3 1Q40A 2CHCA 1YJW3 3JUNA 2BO9B 2WGOA 1ROVA 1JBSA 3PGBA 2IYJA 5A0OB 1ISKA 2BHMA 2ML5A 1RCKA 3S29A 2OWPA 4O2HA 3WA3A 2HOHA 5KP1A 1AV4A 1RNBA 2Y73A 3DGLA 1PFPA 5AEWB 2QIYA 1JNQA 4LSOA 1MGWA 1NB5I 3CCR3 5AIFA 4GL6A 2E2VA 3CCE3 3NQYA 4HM8B 4N3VA 1I3FA 3JUMA 2OCTA 1SPUA 3CCS3 1YJ93 3ZG5A 4EBGA 3U1WA 4XB5A 1UGHI 1GD4A 4ORLA 2I9WA 3GWRA 4WHAA 4HOHA 3F9SA 1UUGB 4N6V0 1BANA 5JPUA 1BUQA 1OHSA 4OK0A 4U13A 1QMAA 5FW5A 5D81A 1B27A 1Q42A 3EX9A 1O7WB 3QK9A 1O7NB 1L5GB 3WOFB 3EE1A 4BIRA 1W7CA 3OW22 3X3YA 2L1SA 2XGNA 3DUKA 4FMAA 2AAEA 1SJWA 3WA2X 1TRQA 2ZHXB 1SIIA 2LYXA 2UUGC 1BRHA 1JB4A 3QRDA 1BSEA 4XBXA 1GOVA 3MKIA 3DY5A 1GY5A 1BRGA 5EVHA 3V99A 2GXFA 3WR2A 1BAOA 1N9JA 5D82A 5HGRA 3Q1CA 1T5YA 1ULIB 1QAKA 2OTL3 1WNHA 1OHPA 1ZX2A 1ROAA 2L4VA 1E3RA 4XDWA 1JN5B 1S723 2JDIH 2BMOB 4NREA 4FMDA 1M904 4GB5A 2F5WA 1B2ZA 3GZRA 1GMRA 3O8YA 3CC73 1YHQ3 1BVIA 3G6E3 3JUQA 1SARA 4JRFA 5IG0A 2CG0A 1RGLA 3AMOB 1Z1SA 2ZDJA 3T8UA 1B2SA 2R4IA 5D83A 4WYKA 3GAXA 3RGAA 5G1LA 3IMAB 1ZO2A 2XSHB 4L7KA 5AEUB 1AVLA 2W04A 3Q90A 2OQEA 2XFSA 4MMZB 3NV0B 2W2CA 1W6YA 2GU1A 1STFI 1MNLA 2RFRA 3G8ZA 3MSOA 1RTUA 3EN8A 2B1XB 2HMOB 1JZOA 1LOVA 2RBIA 2Y74A 3FH1A 1BIRA 3PS8A 4BL2A 1MOLA 4R4KA 5FGOA 2C4BA 3K5TA 2XFTA 1W00A 1DMMA 1FUSA 1C7HA 1FGRA 2MF7A 2R41A 5DREA 1V57A 3CCU3 1UDII 3STDA 1BUJA 2WGQA 1G96A 1W5ZA 1YGWA 2C10A 3FGYA 3CCM3 1IVXA 3KKGA 3NHXA 3CPW2 3NM7A 3Q2PA 1KC84 3B8LA 3ALAA 3SX1A 4DKIA 1RRLA 1DVCA 5CXOA 1TUHA 2KAAA 1B2MA 1UI8A 3AGNA 3K9MC 3BIRA 2OQEC 1RGAA 2Z76A 1W2ZA 1DE3A 3D5GA 3D3LA 1LRAA 5G1KA 5AIGA 3SXXA 1DVDA 1BSDA 3H3HA 1VQP3 1HKXA 1JBTA 2XSOB 3EC9A 1NWWA 2CFLA 4X2OA 5IG4A 1UUVB 1IVWA 6STDA 1UCIA 1PYLA 3OV4A 2FXTA 1VQ93 1I8VA 1DYUA 1JJ22 2XH9A 4XBYA 1I2FA 5LC7A 1Q824 4BTYA 5IERA 1F8NA 1UI7A 1QALA 1RGEA 3NQZA 1TJDA 1LQMB 3SLUA 2XEPA 1DETA 2ZA4A 4KVHA 3M8CA 4L8OA 4AKYA 5HOHA 1GS3A 1UW1A 4L8PA 4BTXA 3AGOA 3WMDA 1N8QA 4O02B 3LYGA 2KRTA 2BT3A 1EA2A 1Q40B 4HM5B 2QGUA 1BNRA 3MG2A 3OWSA 3NUVA 4HYZA 3J7Yd 1BRJA 2V1LA 3EN1B 1WMPA 3DMCA 4K90B 1VQ83 2GEXA 4HM0B 1FUTA 4TX4A 3ECFA 1GY7A 4MMXB 3PZWA 2P0XA 2IUJA 3NBJA 2RNTA 4FMCA 1LQGC 1TU5A 3HIGA 1CQSA 3H51A 4GHOA 4LYLB 3OX9A 3DZLA 1TTOA 1KD14 3JVCA 4WYKB 1A2VA 3SOAA
chains in the Genus database with same CATH topology
1FZUA 1RLSA 1B2UA 1RNTA 1RGCA 2AAEA 1PY3A 1RCLA 1TRQA 3SYUA 1C54A 1X1XA 1BRHA 1MGRA 1BSEA 1BSCA 1GSPA 1GOVA 1LOYA 2BU4A 5BU4A 1BRNL 1BRGA 4RNTA 1T2HA 3WR2A 1BAOA 1BNGA 4GSPA 1RGFA 1UCLA 1GOUA 2F56A 2GSPA 3D4AA 1YVSA 2F5WA 1B2ZA 1I0XA 1GMRA 6RNTA 2AADA 1BVIA 5GSPA 2KF3A 1SARA 1GMQA 1RGLA 1LNIA 4J5KA 1B2SA 2BIRA 1RN4A 1BGSA 3Q3FA 1BRSA 3A5EA 1I3IA 1R4YA 3AHWA 1FYSA 1CH0A 2SARA 1RTUA 2KF4A 1RGGA 2F5MA 7RNTA 2RBIA 1LOVA 1BNIA 1BIRA 1I2GA 1HZ1A 2C4BA 7GSPA 1BRIA 1FUSA 8RNTA 1BNFA 1HYFA 1FW7A 1BUJA 1UCKA 1BNSA 1YGWA 1RN1A 1B21A 1B2XA 1ZGXA 1RHLA 4BU4A 1JBRA 1RGHA 3HOHA 1I70A 2KAAA 1B2MA 3AGNA 1A2PA 5RNTA 1BRKA 1I0VA 3BIRA 1RGAA 1GOYA 1DE3A 3D5GA 2F4YA 1LRAA 1BSDA 3DH2A 1BOXA 1T2IA 1GMPA 3D5IA 4J5GA 1TRPA 1JBTA 1B20A 2KF5A 1JBSA 1BNEA 1AQZA 1UCIA 1PYLA 3BU4A 1I8VA 1Q9EA 1RCKA 1YNVX 1I2FA 9RNTA 2HOHA 3WHOA 1RNBA 1X1UA 1RGEA 2KF6A 5BIRA 1RDSA 1MGWA 1DETA 2ZA4A 1G02A 1UCJA 1BU4A 5HOHA 1I2EA 3AGOA 1BNJA 4HAAA 1I3FA 1BNRA 1LOWA 1IYYA 3RNTA 1BSBA 1BRJA 1RMSA 1RGKA 1AY7A 1RSNA 1FUTA 1X1YA 3DGYA 3URPA 4HOHA 1BANA 6GSPA 1BSAA 2RNTA 3AHSA 4GHOA 1X1WA 3GSPA 3KCHA 1B27A 1TTOA 4BIRA 1B3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZU A;  1RLS A;  1B2U A;  1RNT A;  1RGC A;  2AAE A;  1PY3 A;  1RCL A;  1TRQ A;  3SYU A;  1C54 A;  1X1X A;  1BRH A;  1MGR A;  1BSE A;  1BSC A;  1GSP A;  1GOV A;  1LOY A;  2BU4 A;  5BU4 A;  1BRN L;  1BRG A;  4RNT A;  1T2H A;  3WR2 A;  1BAO A;  1BNG A;  4GSP A;  1RGF A;  1UCL A;  1GOU A;  2F56 A;  2GSP A;  3D4A A;  1YVS A;  2F5W A;  1B2Z A;  1I0X A;  1GMR A;  6RNT A;  2AAD A;  1BVI A;  5GSP A;  2KF3 A;  1SAR A;  1GMQ A;  1RGL A;  1LNI A;  4J5K A;  1B2S A;  2BIR A;  1RN4 A;  1BGS A;  3Q3F A;  1BRS A;  3A5E A;  1I3I A;  1R4Y A;  3AHW A;  1FYS A;  1CH0 A;  2SAR A;  1RTU A;  2KF4 A;  1RGG A;  2F5M A;  7RNT A;  2RBI A;  1LOV A;  1BNI A;  1BIR A;  1I2G A;  1HZ1 A;  2C4B A;  7GSP A;  1BRI A;  1FUS A;  8RNT A;  1BNF A;  1HYF A;  1FW7 A;  1BUJ A;  1UCK A;  1BNS A;  1YGW A;  1RN1 A;  1B21 A;  1B2X A;  1ZGX A;  1RHL A;  4BU4 A;  1JBR A;  1RGH A;  3HOH A;  1I70 A;  2KAA A;  1B2M A;  3AGN A;  1A2P A;  5RNT A;  1BRK A;  1I0V A;  3BIR A;  1RGA A;  1GOY A;  1DE3 A;  3D5G A;  2F4Y A;  1LRA A;  1BSD A;  3DH2 A;  1BOX A;  1T2I A;  1GMP A;  3D5I A;  4J5G A;  1TRP A;  1JBT A;  1B20 A;  2KF5 A;  1JBS A;  1BNE A;  1AQZ A;  1UCI A;  1PYL A;  3BU4 A;  1I8V A;  1Q9E A;  1RCK A;  1YNV X;  1I2F A;  9RNT A;  2HOH A;  3WHO A;  1RNB A;  1X1U A;  1RGE A;  2KF6 A;  5BIR A;  1RDS A;  1MGW A;  1DET A;  2ZA4 A;  1G02 A;  1UCJ A;  1BU4 A;  5HOH A;  1I2E A;  3AGO A;  1BNJ A;  4HAA A;  1I3F A;  1BNR A;  1LOW A;  1IYY A;  3RNT A;  1BSB A;  1BRJ A;  1RMS A;  1RGK A;  1AY7 A;  1RSN A;  1FUT A;  1X1Y A;  3DGY A;  3URP A;  4HOH A;  1BAN A;  6GSP A;  1BSA A;  2RNT A;  3AHS A;  4GHO A;  1X1W A;  3GSP A;  3KCH A;  1B27 A;  1TTO A;  4BIR A;  1B3S A; 
#chains in the Genus database with same CATH topology
 1ASK A;  1RNT A;  1Q81 4;  4HJL B;  3I56 3;  1W02 A;  3RDE A;  1X1X A;  5M18 A;  1GSP A;  5BU4 A;  1YJN 3;  4RNT A;  2W9P A;  1A90 A;  1IT8 A;  4H61 A;  1BNG A;  4GSP A;  1KWI A;  3EBY A;  1UCL A;  1IV7 A;  3F8H A;  4EC6 A;  4R9K A;  1GOU A;  3ZG0 A;  3BLZ A;  4HM3 B;  2GSP A;  2Z6B A;  3A76 A;  5IF6 A;  1YVS A;  3KFQ C;  1I0X A;  3CXC 2;  1US1 A;  3HZP A;  1EUI C;  2KF3 A;  3F8X A;  1D6Y A;  3X41 A;  1FA3 A;  4J5K A;  2RSX A;  2BIR A;  1RN4 A;  1LNH A;  4IPB A;  1YGE A;  1TIJ A;  5AIH A;  5IEN A;  4R9L A;  4J9A A;  1NNV A;  3AHW A;  1IQY A;  4BTW A;  2OTJ 3;  2H0H A;  1STD A;  3WDG B;  4PEJ A;  1K28 A;  3KE7 A;  4EYC A;  3T8N A;  2KF4 A;  3LT9 A;  1RGG A;  3IPT A;  4ZM8 A;  1IVU A;  2F99 A;  3CC4 3;  1BNI A;  3DGM A;  1PU4 A;  3F14 A;  1JRQ A;  7GSP A;  1BRI A;  3UJM A;  5BXQ A;  8RNT A;  1FGO A;  2RGQ A;  2YFJ B;  3SVA A;  1M1X B;  1UCK A;  3B4P A;  1BNS A;  2Q07 A;  2IY2 A;  3AMO A;  1DMN A;  1IDP A;  1AVK A;  2CKF B;  3WOD G;  3I0Y A;  3VSY A;  1JB2 A;  4HZB B;  5STD A;  1WMN A;  3HOH A;  3JUO A;  1FGM A;  1YIT 3;  3WOE B;  1BRK A;  3ZFZ A;  1EKM A;  4FCJ A;  5AYR B;  4K61 A;  1O7H B;  5AYS C;  3BB9 A;  4MMY B;  3BNB A;  4HM4 B;  4J5G A;  3D5I A;  1TRP A;  4XBT A;  3S5C A;  1D6Z A;  1GY6 A;  1B20 A;  2KF5 A;  4JF8 A;  5I97 A;  1OGZ A;  1BNE A;  2WO0 A;  3X42 A;  3DGO A;  3PXM A;  4AKZ A;  1AR0 A;  3MYT A;  3DXO A;  4I4K A;  3KII A;  3HII A;  2CG1 A;  3EQQ B;  1J2B A;  4RZM A;  5CF1 A;  2CFG A;  2BNG A;  1TFO A;  3GZY B;  3LTD A;  1LVN A;  1OAC A;  4HM7 B;  2A15 A;  1O7P B;  3V92 A;  1T3B A;  3EJV A;  5BIR A;  1OCV A;  2LQV A;  1G02 A;  1MWS A;  1JV2 B;  2YFL B;  3MG3 A;  1R4C A;  3NX0 A;  1UCJ A;  4NPB A;  1BU4 A;  3UL5 A;  1I2E A;  3PCS A;  2FNQ A;  3X3Z A;  3HI7 A;  2YX9 A;  1VQK 3;  1UGI A;  3CNX A;  4HM6 B;  1BNJ A;  1IT7 A;  1SIH A;  3MG1 A;  1VQN 3;  1K73 4;  2PZV A;  1MWT A;  1W2B 2;  2GBW B;  5ELU A;  1OPY A;  3LTC A;  3KN4 A;  2CC3 A;  1AY7 A;  1RGK A;  3DGY A;  5EQL A;  1FGT A;  2MC8 A;  3URP A;  3ROB A;  2KCD A;  3FG3 A;  2O3O A;  4HVN A;  1YIJ 3;  3FF0 A;  1D6U A;  2BMR B;  1BSA A;  1WMO A;  4RBN A;  3AHS A;  3N9H A;  2XR8 B;  3GSP A;  5CF2 A;  3K7C A;  5JPP A;  4LMI A;  1GD3 A;  5EEO A;  4N6N B;  1K9M 4;  4G1M B;  4XDV A;  1JB5 A;  1RGC A;  5IEP A;  4H3U A;  1NU3 A;  1W4N A;  1Y4K A;  1FW7 A;  4K1U A;  1NO3 A;  2STD A;  1M9G A;  3FG1 A;  1NJI 4;  2IMJ A;  3KZT A;  1T2H A;  1JKG A;  5LC6 A;  3X3X A;  2CWT A;  3BNC A;  2WOH A;  4RNY A;  3CNM A;  1E3V A;  3D79 A;  1JN5 A;  4LGQ A;  3CCL 3;  2K0M A;  1N8R 4;  2M7O A;  3FKA A;  3D4A A;  4KFD A;  1QVF 2;  3NBR A;  5M1A A;  6RNT A;  2HMN B;  2AAD A;  3T0U A;  4AEQ A;  3FF2 A;  5AII A;  4I5Q A;  1GMQ A;  5TGN A;  1SQW A;  2FGT A;  1BGS A;  1OF5 A;  2CFK A;  2JQ5 A;  2XRX B;  3KSP A;  1W6C A;  3LH4 A;  4LZI A;  4N6M A;  3HK4 A;  1YI2 3;  3CCV 3;  3G4S 3;  1R4Y A;  3GRD A;  3NV0 A;  1VQ4 3;  3K63 A;  3LOY A;  3FG4 A;  1VQ5 3;  3MHE A;  1VQ7 3;  4IT7 A;  3FSD A;  4IIA A;  3V98 A;  2P0M A;  2C11 A;  4MEI A;  3NXJ A;  8CHO A;  3LXU X;  3G71 3;  1Q86 4;  4RNZ A;  3CMA 3;  2W56 A;  2F5M A;  3CU3 A;  4WFO A;  2GEY A;  2W03 A;  4N6O B;  1KQS 2;  1RJO A;  4WP5 A;  2K54 A;  2Z77 A;  1HZ1 A;  2RCD A;  4N6U A;  1S5A A;  1BNF A;  1HYF A;  3F7S A;  3UL6 A;  1VQL 3;  1A67 A;  2GBX B;  3CD6 3;  3EHC A;  4CDL A;  3CC2 3;  2H0I A;  1RKY A;  5CK6 A;  4R80 A;  1IQX A;  2XGL A;  1ZGX A;  4HKV B;  1RHL A;  5IG3 A;  3SED A;  4EW5 A;  2P09 A;  4BU4 A;  3VF1 A;  1JBR A;  2H0G A;  2W6J H;  1MWU A;  1QJG A;  4NHF A;  1OHO A;  2XF3 A;  1A2P A;  3PCR A;  3LTB A;  5RNT A;  2P05 A;  2E2T A;  3D9R A;  2CX1 A;  1YVB I;  3GZX B;  3K0Z A;  3S67 A;  3JUP A;  1N9E A;  3S28 A;  1QVG 2;  2CH9 A;  1U8C B;  2OOV C;  3DH2 A;  1BOX A;  1O7G B;  1T2I A;  4O3V A;  4EV5 A;  1GMP A;  4MJD A;  5KP4 A;  4FR9 A;  3I55 3;  3FCS B;  1FUW A;  1GYB A;  2SBL A;  1AQZ A;  1TFK A;  4HM1 B;  4ILF A;  2P38 A;  5IG5 A;  1LXE A;  3BU4 A;  4N6L A;  1Q7Y 4;  1DMQ A;  4HM2 B;  1VZZ A;  4LEH A;  1NDO B;  1Q9E A;  2F98 A;  1YNV X;  1U5O A;  3GZB A;  9RNT A;  3L0R A;  3WHO A;  5M19 A;  2Z7A A;  3DGN A;  7STD A;  4KT3 B;  1X1U A;  2KF6 A;  3LT8 A;  1RDS A;  1IK3 A;  4FCZ A;  4FMB A;  1ULJ B;  1FGQ A;  1IVV A;  1N5H A;  2UGI A;  1O7M B;  3DM8 A;  3RGR A;  3HX8 A;  3OWU A;  4Q53 A;  3VGN A;  4HAA A;  1VQ6 3;  3KSE D;  2QEX 3;  1VQO 3;  4K1V A;  2HMJ B;  1LOW A;  1OUN A;  5AI1 A;  1JKG B;  3MPH A;  2YFI B;  1WTH A;  5DRV A;  4R1K A;  3RNT A;  4CPK A;  1BSB A;  1RRH A;  4EXR A;  2E2U A;  2QA4 3;  1IYY A;  1CYU A;  1RMS A;  3G16 A;  4J8T A;  1RSN A;  1W01 A;  1X1Y A;  3CPO A;  4KZ1 A;  1MWR A;  3NM2 A;  3BND A;  3X40 A;  2CWU A;  3S27 A;  3OXA A;  1OH0 A;  2D1W A;  3E99 A;  6GSP A;  1KSI A;  1RN7 A;  2B24 B;  1G0T A;  2GU3 A;  5CLK A;  4HBR A;  1X1W A;  4HZ9 B;  3KCH A;  2CX0 A;  3B4O A;  2W0Q A;  2J8X B;  1B3S A;  2IA7 A;  1FZU A;  1RLS A;  1B2U A;  1PY3 A;  1RCL A;  2CWV A;  3LZA A;  3PYJ A;  1TP6 A;  2CW9 A;  3SYU A;  1C54 A;  3EBT A;  1IQ8 A;  3UB1 A;  1MGR A;  1LOY A;  1BSC A;  4OVM A;  5ELJ A;  1V74 A;  1V58 A;  2BU4 A;  3NBB A;  2WOF A;  1BRN L;  2IUK A;  2CFD A;  4O8S A;  3F40 A;  1CYV A;  2W9Q A;  2UX0 A;  3LML A;  1A2K A;  1RGF A;  3EF8 A;  2INX A;  3CCQ 3;  2F56 A;  3N54 B;  3U97 A;  2BMQ B;  1UUW B;  1EG9 B;  1K41 A;  2ZL8 A;  3BNE A;  5GSP A;  2K3D A;  3F7X A;  4XM4 A;  1WQL B;  1LNI A;  2ML6 A;  2KXG A;  1JZD A;  3Q3F A;  4X2H A;  2HML B;  1BRS A;  3A5E A;  3OWY A;  4KFE A;  1HU9 A;  1I3I A;  1W6G A;  3N8B A;  2CK3 H;  1N5P A;  1FYS A;  1IV9 A;  1CH0 A;  4BL3 A;  1LOX A;  4CCV A;  3CME 3;  3FLJ A;  4N6T A;  1ZS7 A;  2HMM B;  1QAF A;  1CEW I;  2SAR A;  3IJE B;  4WWU C;  4STD A;  5G2G A;  7RNT A;  5BVB A;  5JBS A;  3G0K A;  1I2G A;  2F86 B;  3FZW A;  5KP3 A;  3UNL A;  1EEJ A;  1NB3 I;  3EB8 A;  2PNC A;  4KFF A;  2O9U X;  4QWT A;  5IEO A;  1RN1 A;  1B21 A;  5IW9 A;  3LTA A;  1B2X A;  1OF5 B;  4FCM A;  1IU7 A;  3B7C A;  1Q7H A;  2CFW A;  1M1K 4;  1VQQ A;  1RGH A;  4CJN A;  2CIU A;  3ER7 A;  1I70 A;  3TDG A;  1I0V A;  2D42 A;  1GOY A;  3SOY A;  3CCJ 3;  1K8A 4;  1EQK A;  2F4Y A;  1OGX A;  4OUQ A;  4EV2 A;  3MWZ A;  2W56 B;  1E97 A;  2OOV A;  2HMK B;  1VQM 3;  1Q40 A;  2CHC A;  1YJW 3;  3JUN A;  2BO9 B;  2WGO A;  1ROV A;  1JBS A;  3PGB A;  2IYJ A;  5A0O B;  1ISK A;  2BHM A;  2ML5 A;  1RCK A;  3S29 A;  2OWP A;  4O2H A;  3WA3 A;  2HOH A;  5KP1 A;  1AV4 A;  1RNB A;  2Y73 A;  3DGL A;  1PFP A;  5AEW B;  2QIY A;  1JNQ A;  4LSO A;  1MGW A;  1NB5 I;  3CCR 3;  5AIF A;  4GL6 A;  2E2V A;  3CCE 3;  3NQY A;  4HM8 B;  4N3V A;  1I3F A;  3JUM A;  2OCT A;  1SPU A;  3CCS 3;  1YJ9 3;  3ZG5 A;  4EBG A;  3U1W A;  4XB5 A;  1UGH I;  1GD4 A;  4ORL A;  2I9W A;  3GWR A;  4WHA A;  4HOH A;  3F9S A;  1UUG B;  4N6V 0;  1BAN A;  5JPU A;  1BUQ A;  1OHS A;  4OK0 A;  4U13 A;  1QMA A;  5FW5 A;  5D81 A;  1B27 A;  1Q42 A;  3EX9 A;  1O7W B;  3QK9 A;  1O7N B;  1L5G B;  3WOF B;  3EE1 A;  4BIR A;  1W7C A;  3OW2 2;  3X3Y A;  2L1S A;  2XGN A;  3DUK A;  4FMA A;  2AAE A;  1SJW A;  3WA2 X;  1TRQ A;  2ZHX B;  1SII A;  2LYX A;  2UUG C;  1BRH A;  1JB4 A;  3QRD A;  1BSE A;  4XBX A;  1GOV A;  3MKI A;  3DY5 A;  1GY5 A;  1BRG A;  5EVH A;  3V99 A;  2GXF A;  3WR2 A;  1BAO A;  1N9J A;  5D82 A;  5HGR A;  3Q1C A;  1T5Y A;  1ULI B;  1QAK A;  2OTL 3;  1WNH A;  1OHP A;  1ZX2 A;  1ROA A;  2L4V A;  1E3R A;  4XDW A;  1JN5 B;  1S72 3;  2JDI H;  2BMO B;  4NRE A;  4FMD A;  1M90 4;  4GB5 A;  2F5W A;  1B2Z A;  3GZR A;  1GMR A;  3O8Y A;  3CC7 3;  1YHQ 3;  1BVI A;  3G6E 3;  3JUQ A;  1SAR A;  4JRF A;  5IG0 A;  2CG0 A;  1RGL A;  3AMO B;  1Z1S A;  2ZDJ A;  3T8U A;  1B2S A;  2R4I A;  5D83 A;  4WYK A;  3GAX A;  3RGA A;  5G1L A;  3IMA B;  1ZO2 A;  2XSH B;  4L7K A;  5AEU B;  1AVL A;  2W04 A;  3Q90 A;  2OQE A;  2XFS A;  4MMZ B;  3NV0 B;  2W2C A;  1W6Y A;  2GU1 A;  1STF I;  1MNL A;  2RFR A;  3G8Z A;  3MSO A;  1RTU A;  3EN8 A;  2B1X B;  2HMO B;  1JZO A;  1LOV A;  2RBI A;  2Y74 A;  3FH1 A;  1BIR A;  3PS8 A;  4BL2 A;  1MOL A;  4R4K A;  5FGO A;  2C4B A;  3K5T A;  2XFT A;  1W00 A;  1DMM A;  1FUS A;  1C7H A;  1FGR A;  2MF7 A;  2R41 A;  5DRE A;  1V57 A;  3CCU 3;  1UDI I;  3STD A;  1BUJ A;  2WGQ A;  1G96 A;  1W5Z A;  1YGW A;  2C10 A;  3FGY A;  3CCM 3;  1IVX A;  3KKG A;  3NHX A;  3CPW 2;  3NM7 A;  3Q2P A;  1KC8 4;  3B8L A;  3ALA A;  3SX1 A;  4DKI A;  1RRL A;  1DVC A;  5CXO A;  1TUH A;  2KAA A;  1B2M A;  1UI8 A;  3AGN A;  3K9M C;  3BIR A;  2OQE C;  1RGA A;  2Z76 A;  1W2Z A;  1DE3 A;  3D5G A;  3D3L A;  1LRA A;  5G1K A;  5AIG A;  3SXX A;  1DVD A;  1BSD A;  3H3H A;  1VQP 3;  1HKX A;  1JBT A;  2XSO B;  3EC9 A;  1NWW A;  2CFL A;  4X2O A;  5IG4 A;  1UUV B;  1IVW A;  6STD A;  1UCI A;  1PYL A;  3OV4 A;  2FXT A;  1VQ9 3;  1I8V A;  1DYU A;  1JJ2 2;  2XH9 A;  4XBY A;  1I2F A;  5LC7 A;  1Q82 4;  4BTY A;  5IER A;  1F8N A;  1UI7 A;  1QAL A;  1RGE A;  3NQZ A;  1TJD A;  1LQM B;  3SLU A;  2XEP A;  1DET A;  2ZA4 A;  4KVH A;  3M8C A;  4L8O A;  4AKY A;  5HOH A;  1GS3 A;  1UW1 A;  4L8P A;  4BTX A;  3AGO A;  3WMD A;  1N8Q A;  4O02 B;  3LYG A;  2KRT A;  2BT3 A;  1EA2 A;  1Q40 B;  4HM5 B;  2QGU A;  1BNR A;  3MG2 A;  3OWS A;  3NUV A;  4HYZ A;  3J7Y d;  1BRJ A;  2V1L A;  3EN1 B;  1WMP A;  3DMC A;  4K90 B;  1VQ8 3;  2GEX A;  4HM0 B;  1FUT A;  4TX4 A;  3ECF A;  1GY7 A;  4MMX B;  3PZW A;  2P0X A;  2IUJ A;  3NBJ A;  2RNT A;  4FMC A;  1LQG C;  1TU5 A;  3HIG A;  1CQS A;  3H51 A;  4GHO A;  4LYL B;  3OX9 A;  3DZL A;  1TTO A;  1KD1 4;  3JVC A;  4WYK B;  1A2V A;  3SOA A; 
#chains in the Genus database with same CATH homology
 1FZU A;  1RLS A;  1B2U A;  1RNT A;  1RGC A;  2AAE A;  1PY3 A;  1RCL A;  1TRQ A;  3SYU A;  1C54 A;  1X1X A;  1BRH A;  1MGR A;  1BSE A;  1BSC A;  1GSP A;  1GOV A;  1LOY A;  2BU4 A;  5BU4 A;  1BRN L;  1BRG A;  4RNT A;  1T2H A;  3WR2 A;  1BAO A;  1BNG A;  4GSP A;  1RGF A;  1UCL A;  1GOU A;  2F56 A;  2GSP A;  3D4A A;  1YVS A;  2F5W A;  1B2Z A;  1I0X A;  1GMR A;  6RNT A;  2AAD A;  1BVI A;  5GSP A;  2KF3 A;  1SAR A;  1GMQ A;  1RGL A;  1LNI A;  4J5K A;  1B2S A;  2BIR A;  1RN4 A;  1BGS A;  3Q3F A;  1BRS A;  3A5E A;  1I3I A;  1R4Y A;  3AHW A;  1FYS A;  1CH0 A;  2SAR A;  1RTU A;  2KF4 A;  1RGG A;  2F5M A;  7RNT A;  2RBI A;  1LOV A;  1BNI A;  1BIR A;  1I2G A;  1HZ1 A;  2C4B A;  7GSP A;  1BRI A;  1FUS A;  8RNT A;  1BNF A;  1HYF A;  1FW7 A;  1BUJ A;  1UCK A;  1BNS A;  1YGW A;  1RN1 A;  1B21 A;  1B2X A;  1ZGX A;  1RHL A;  4BU4 A;  1JBR A;  1RGH A;  3HOH A;  1I70 A;  2KAA A;  1B2M A;  3AGN A;  1A2P A;  5RNT A;  1BRK A;  1I0V A;  3BIR A;  1RGA A;  1GOY A;  1DE3 A;  3D5G A;  2F4Y A;  1LRA A;  1BSD A;  3DH2 A;  1BOX A;  1T2I A;  1GMP A;  3D5I A;  4J5G A;  1TRP A;  1JBT A;  1B20 A;  2KF5 A;  1JBS A;  1BNE A;  1AQZ A;  1UCI A;  1PYL A;  3BU4 A;  1I8V A;  1Q9E A;  1RCK A;  1YNV X;  1I2F A;  9RNT A;  2HOH A;  3WHO A;  1RNB A;  1X1U A;  1RGE A;  2KF6 A;  5BIR A;  1RDS A;  1MGW A;  1DET A;  2ZA4 A;  1G02 A;  1UCJ A;  1BU4 A;  5HOH A;  1I2E A;  3AGO A;  1BNJ A;  4HAA A;  1I3F A;  1BNR A;  1LOW A;  1IYY A;  3RNT A;  1BSB A;  1BRJ A;  1RMS A;  1RGK A;  1AY7 A;  1RSN A;  1FUT A;  1X1Y A;  3DGY A;  3URP A;  4HOH A;  1BAN A;  6GSP A;  1BSA A;  2RNT A;  3AHS A;  4GHO A;  1X1W A;  3GSP A;  3KCH A;  1B27 A;  1TTO A;  4BIR A;  1B3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...