1BNSA

Structural studies of barnase mutants
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYIAKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Contribution of buried hydrogen bonds to protein stability. The crystal structures of two barnase mutants.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Endonuclease
molecule keywords BARNASE
total genus 30
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 1994-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1bnsA00
1BRSA 1RLSA 2C4BA 3AGNA 3WHOA 2GSPA 1CH0A 1BUJA 1BNRA 1BSEA 1BU4A 1X1UA 1B27A 1FUTA 1GMPA 2KF4A 3AHWA 1BRIA 1IYYA 3DGYA 1I70A 1RNTA 1HYFA 2KF5A 1AQZA 1I2FA 1I3FA 3BIRA 1RSNA 1DETA 3HOHA 4HOHA 2F5WA 1RTUA 1BNEA 1HZ1A 1GMQA 1TTOA 1BRKA 1B2ZA 1RGAA 3GSPA 2ZA4A 1GSPA 2KAAA 1FUSA 1BVIA 3SYUA 1I0XA 2AAEA 1RDSA 3D4AA 1BSDA 4BU4A 1JBTA 1BGSA 3URPA 1BSAA 2KF6A 2AADA 1B2XA 2HOHA 1T2IA 1BSBA 1BNSA 1YVSA 1I0VA 1GOYA 1Q9EA 1BIRA 1BOXA 1A2PA 1B2UA 1LRAA 1RHLA 1PYLA 1RGHA 2F5MA 4HAAA 1BRHA 1X1YA 1RMSA 6GSPA 1X1WA 1YGWA 1B2MA 3A5EA 1B21A 1TRPA 3AHSA 3WR2A 4BIRA 3Q3FA 6RNTA 1I2GA 5BIRA 7GSPA 2RNTA 1B20A 3D5GA 2RBIA 1LOWA 1RN1A 1LOYA 4J5KA 4RNTA 1RGEA 3AGOA 4J5GA 3D5IA 4GHOA 1BRNL 9RNTA 1LOVA 5BU4A 1RGCA 1RGFA 1T2HA 1BRJA 1JBSA 1BNFA 1RCKA 1BSCA 3DH2A 1FW7A 1G02A 2SARA 1R4YA 5GSPA 1FYSA 3RNTA 1C54A 1GOUA 1RGGA 1B3SA 1DE3A 1ZGXA 1RCLA 1RN4A 1BNIA 1MGWA 1BAOA 1BANA 1LNIA 1TRQA 1PY3A 1X1XA 1I8VA 1SARA 7RNTA 1RGKA 1GMRA 2BU4A 1GOVA 1BNJA 3KCHA 5RNTA 1YNVX 1BNGA 1MGRA 1UCLA 2KF3A 2F56A 1AY7A 1JBRA 2F4YA 5HOHA 1BRGA 2BIRA 1UCKA 1UCJA 1I2EA 1RNBA 1I3IA 1RGLA 1B2SA 1FZUA 3BU4A 8RNTA 1UCIA 4GSPA
chains in the Genus database with same CATH superfamily
1M1XB 3M8CA 3NQZA 3MG3A 5D82A 2H0GA 1KSIA 1K8A4 4NHFA 3WHOA 2SBLA 3K7CA 2C11A 3RDEA 4XBTA 1BU4A 1ZX2A 1B27A 3D9RA 3NHXA 1GMPA 2FXTA 2KF4A 3CCU3 1A90A 5IW9A 2CG1A 1RRLA 3GRDA 4ZM8A 2KF5A 1YVBI 2GU1A 2I9WA 1GY5A 2BNGA 1ZO2A 2WO0A 3PZWA 5G2GA 5JBSA 1W6YA 2QA43 1LQGC 3NQYA 2CFWA 2Y73A 2F5WA 4H3UA 4MMZB 5IG4A 1BNEA 2ML5A 3NV0B 5KP3A 2UGIA 2Z76A 4LGQA 2B1XB 2XSHB 3ZFZA 1GS3A 1V74A 3FF0A 2GBWB 3AMOB 3GSPA 2ZA4A 2KAAA 3MYTA 4XDWA 1VQP3 3FGYA 3HI7A 4HM2B 1BVIA 2W56A 1I0XA 1RDSA 1TFOA 1BSDA 4BL3A 3G0KA 4BU4A 1JRQA 3Q1CA 4FMAA 2HMJB 4FMCA 1OACA 4N6MA 5DRVA 2KF6A 1QALA 3CXC2 1W01A 4HBRA 1FGQA 1TFKA 3OWSA 3F8XA 2HOHA 1JNQA 1BSBA 3GZYB 1YVSA 3BNDA 1ROAA 2E2UA 1V57A 1GD3A 4R9LA 4EV2A 4HM4B 3FG4A 5FW5A 1T5YA 4FMDA 4H61A 3HIGA 2OOVA 2XGLA 3T0UA 5BVBA 1RMSA 6GSPA 2HMNB 3N9HA 2LYXA 4KVHA 2W6JH 4AKYA 1KD14 3E99A 4HZBB 2WGOA 1A2KA 1UUWB 2WOFA 7GSPA 5BIRA 5M18A 3SX1A 5D81A 4WYKB 1LOYA 1ASKA 2IYJA 2W2CA 4EV5A 3EBTA 3GZRA 4L7KA 7STDA 4N6LA 3QK9A 5IF6A 3WODG 3Q2PA 1GY6A 1JKGA 2CW9A 1RGCA 3N8BA 1T2HA 4EXRA 1GYBA 1OF5A 1WTHA 4WHAA 3PS8A 2SARA 3HX8A 1R4YA 1FYSA 3RNTA 1W6CA 3EHCA 3DGNA 1RGGA 4NPBA 2OWPA 1LXEA 1UI8A 1UUVB 2O3OA 3B4OA 3LTDA 2BO9B 1NB3I 1LNHA 4LEHA 3CD63 1NJI4 1VQ53 3LZAA 1Q7HA 3BLZA 1OCVA 3KSED 3DGMA 3EBYA 5G1LA 3WMDA 1YIJ3 1Y4KA 3IJEB 4O8SA 7RNTA 1GMRA 3EN1B 3G6E3 1GOVA 3KCHA 1W4NA 2MC8A 3WOFB 2CFKA 3F14A 3FH1A 4MMYB 1UUGB 4CCVA 5A0OB 2OQEA 2F56A 5HOHA 2YX9A 1STDA 3CCL3 2QGUA 1QAFA 2BIRA 3D79A 4L8PA 1JB5A 3JUNA 1G96A 2W04A 2F98A 4XM4A 4MJDA 2ZL8A 2IUKA 3BU4A 5DREA 3X3YA 8RNTA 3KSPA 4AEQA 1D6ZA 4MMXB 2M7OA 1KWIA 1W7CA 3PXMA 3WOEB 2GSPA 2OQEC 3BNEA 2CIUA 1TJDA 1X1UA 3RGAA 1FUTA 1N5HA 3AHWA 3OXAA 2GXFA 5AIFA 3CMA3 1W2B2 1CEWI 2PZVA 3CU3A 1BRIA 1N9EA 2XFTA 2E2VA 2JQ5A 1I70A 3WA3A 1S723 2YFLB 3F8HA 1NDOB 3ROBA 2KCDA 1YJ93 2QIYA 2K3DA 1I2FA 2GU3A 2BHMA 2HMKB 3BIRA 3KIIA 1TU5A 2CWUA 1T3BA 1VQO3 2HMMB 3CC73 3LT9A 4IT7A 1HZ1A 3DGOA 1Q824 2XH9A 1EQKA 5LC7A 2CX0A 2UX0A 3K0ZA 3LTBA 4HKVB 5KP4A 3I0YA 3S28A 1W2ZA 2XF3A 1SJWA 4WFOA 1EEJA 2KXGA 1BGSA 4HM1B 3SEDA 1M9GA 4X2HA 1WNHA 2W0QA 2P0MA 1CYVA 3Q90A 1IU7A 2OCTA 3MG2A 1MWTA 1UW1A 1BNSA 4ILFA 5TGNA 2FNQA 1Q9EA 1GOYA 3ER7A 4R80A 3CNMA 3LTCA 4U13A 1RHLA 4HM7B 4KFFA 3JUMA 1L5GB 1FGMA 1MWSA 1WMPA 1NU3A 3TDGA 2HMLB 2STDA 1OH0A 1YGWA 1IV9A 4FCJA 1B21A 1TRPA 4L8OA 4N6OB 5ELJA 1JN5A 1OHOA 2CC3A 1WQLB 4FCMA 5AIGA 1OHPA 4BIRA 1Q42A 2IA7A 1I2GA 4DKIA 1ISKA 3H51A 1B20A 3FG1A 1VQ93 3EC9A 3CCV3 4RNTA 1GD4A 1VQ63 1RGEA 2W9PA 3AGOA 1TUHA 4J5GA 2R4IA 4J9AA 5AIHA 2B24B 3S27A 2OOVC 3I553 1BRNL 2XFSA 1LOVA 4NREA 5BU4A 3X3ZA 2LQVA 3OV4A 5IG0A 1Z1SA 1MWRA 3BNBA 4EC6A 1MNLA 1O7MB 3CCJ3 3CCM3 1FW7A 1G02A 2ZHXB 1K734 4O3VA 2F99A 2XRXB 1UDII 3EQQB 4FR9A 2MF7A 1DE3A 2PNCA 4QWTA 3G713 4OK0A 5IERA 4HYZA 1A67A 1BNIA 1RN7A 2R41A 1BAOA 1IVUA 2CHCA 3DGLA 4BL2A 2F86B 3K5TA 5STDA 1PY3A 1VZZA 1X1XA 1E3RA 4KFEA 3CCE3 2XGNA 4GB5A 2ML6A 1CQSA 1LQMB 4PEJA 1R4CA 1W00A 4OUQA 3O8YA 1YGEA 1JZDA 1U5OA 5CXOA 1MGRA 2KF3A 1O7PB 4KFDA 5KP1A 3D3LA 1JBRA 2D1WA 1TP6A 3SLUA 4HM6B 1BRGA 2H0IA 1Q814 1JN5B 1IT7A 1QVF2 1VQ43 1UCJA 4R4KA 5AYSC 1HU9A 1ZS7A 3F9SA 4KT3B 3AGNA 4HOHA 1JKGB 1BRSA 1N8QA 5AI1A 3WDGB 3F7XA 1NB5I 1RLSA 3DZLA 1VQ83 1VQL3 2XEPA 1LOXA 1OF5B 2GBXB 3MKIA 5AIIA 1BNRA 4IIAA 3B7CA 1IVVA 3KE7A 5EEOA 3VF1A 3X41A 4MEIA 3S5CA 1SIIA 2FGTA 3U1WA 2E2TA 3UL5A 5M1AA 2V1LA 3J7Yd 1IYYA 1VQQA 3DGYA 1RNTA 3DY5A 1HYFA 3K9MC 4RZMA 3SOAA 2W9QA 1AQZA 4WYKA 1Q864 3EB8A 1D6YA 1I3FA 3OW22 1RSNA 3CME3 1RTUA 1IDPA 3SOYA 3X40A 5ELUA 3B4PA 1V58A 1TTOA 4TX4A 2RGQA 1BRKA 1B2ZA 2H0HA 4R1KA 2HMOB 2O9UX 2L1SA 1YI23 1Q40B 1Q7Y4 3HIIA 1FUSA 3SYUA 3D4AA 2C10A 2CWVA 2YFJB 5JPPA 4ORLA 3STDA 3X3XA 1JBTA 3URPA 4BTYA 1ULJB 1RJOA 4HM8B 2CK3H 3CCQ3 1B2XA 1MOLA 3JVCA 1OGZA 4LZIA 4CDLA 5M19A 1UGHI 3F40A 5AEUB 2BMRB 3GWRA 2W56B 1US1A 3MPHA 2Y74A 1WMOA 3GZBA 3S29A 1A2PA 1BOXA 3UNLA 1J2BA 1AVLA 5JPUA 2F5MA 5BXQA 1K28A 3NV0A 1IQ8A 2CG0A 4HM5B 1B2MA 2RCDA 3A5EA 1FUWA 3PCSA 3RGRA 1W6GA 1N8R4 3LOYA 4K1VA 1NNVA 3AHSA 5CLKA 3WR2A 5IG5A 1IQXA 2P09A 3T8NA 2RNTA 2CWTA 5IEPA 2IY2A 3IMAB 3MG1A 4HJLB 4K90B 4EBGA 4EYCA 2W03A 2RBIA 3KFQC 1RN1A 1GY7A 3HZPA 4J5KA 3ZG5A 3F7SA 3GZXB 3I563 1AVKA 4GHOA 5AYRB 3MSOA 2CH9A 4XBYA 3FCSB 3PGBA 3H3HA 1RGFA 4HZ9B 1MWUA 1BRJA 1Q40A 1JBSA 3FKAA 4N3VA 1BSCA 3DH2A 5IENA 4N6NB 1CYUA 3NM7A 1DMNA 2J8XB 3G4S3 3FSDA 1VQK3 3JUPA 4CJNA 2RSXA 3S67A 1GOUA 1OHSA 1IVXA 2P0XA 4HVNA 1QAKA 1RN4A 1MGWA 3OX9A 3LTAA 1IT8A 1FGTA 1OGXA 5CK6A 3PYJA 2WGQA 4J8TA 1QMAA 4FCZA 2GEXA 1TRQA 1AR0A 2P38A 3CNXA 2CX1A 4N6V0 1YIT3 1RGKA 2BU4A 1DYUA 1JV2B 2YFIB 4XBXA 1N5PA 1YNVX 3VSYA 5D83A 1OUNA 1BNGA 1WMNA 3BB9A 3LT8A 1M904 2XSOB 3OWUA 2CKFB 3KN4A 3JUQA 3FZWA 4LSOA 1VQ73 1I2EA 1YJN3 1RNBA 3ALAA 1E3VA 1RGLA 1B2SA 1FZUA 1S5AA 3NBBA 1UCIA 4O2HA 1W02A 3CC23 2C4BA 3B8LA 4OVMA 3L0RA 1CH0A 1IVWA 1BUJA 1YHQ3 1BSEA 3V92A 5IG3A 3UB1A 2UUGC 4I5QA 4XDVA 4WWUC 1FA3A 3NXJA 1D6UA 4RNZA 1OPYA 3N54B 3HOHA 1DETA 1JB2A 1RRHA 2ZDJA 4GL6A 1TIJA 3LMLA 2KRTA 3JUOA 4LMIA 1LVNA 4G1MB 1NWWA 3QRDA 1GMQA 1N9JA 3FLJA 1UGIA 4JF8A 4R9KA 5G1KA 2Z6BA 2L4VA 1RGAA 3HK4A 1GSPA 3UL6A 3DXOA 3AMOA 3EX9A 3MHEA 4K61A 4FMBA 2AAEA 1EG9B 1IQYA 2Q07A 3LH4A 1FGRA 2D42A 4Q53A 2QEX3 5EQLA 1BSAA 3V99A 1K9M4 4KZ1A 4WP5A 3CCS3 2P05A 3NUVA 2AADA 1EA2A 4STDA 2BMOB 3SVAA 4AKZA 1HKXA 1T2IA 2IMJA 1PU4A 3EN8A 3KZTA 3EF8A 1I0VA 3LXUX 1QVG2 3GAXA 4HM0B 5I97A 1BIRA 3SXXA 2A15A 3A76A 4X2OA 3WA2X 1IV7A 3G16A 5LC6A 1B2UA 1LRAA 5FGOA 3NBJA 1YJW3 1M1K4 1PYLA 1RGHA 1JJ22 3PCRA 3ZG0A 3LYGA 2INXA 4HAAA 1BRHA 1X1YA 2Z77A 2BMQB 1PFPA 1X1WA 2CFDA 2K0MA 2IUJA 2JDIH 1UI7A 1W5ZA 1EKMA 2RFRA 3G8ZA 1ROVA 1EUIC 3Q3FA 1DMMA 5CF1A 6RNTA 1VQN3 3CPOA 3VGNA 4EW5A 1DMQA 6STDA 3D5GA 1LOWA 1JZOA 3EJVA 3BNCA 3NX0A 3EE1A 4LYLB 3IPTA 3D5IA 1SPUA 9RNTA 3UJMA 2OTJ3 2WOHA 4RBNA 8CHOA 2GEYA 1AV4A 3OWYA 1BNFA 1RCKA 3KKGA 4K1UA 4BTWA 1G0TA 4RNYA 3NM2A 5GSPA 1O7NB 1C54A 1DVCA 3CPW2 3DMCA 5CF2A 1B3SA 1U8CB 1O7WB 1NO3A 1C7HA 1FGOA 1O7HB 1RCLA 1ZGXA 3DM8A 2BT3A 4XB5A 3X42A 1SIHA 1RKYA 3T8UA 1E97A 1BANA 1STFI 2XR8B 4I4KA 5AEWB 3CCR3 1KC84 2CFGA 1LNIA 1K41A 4N6TA 4O02B 2CFLA 2OTL3 3ECFA 3NBRA 1I8VA 1F8NA 1SARA 4IPBA 2Z7AA 5IEOA 1QJGA 1BNJA 5EVHA 5RNTA 3K63A 1O7GB 3CC43 3U97A 1UCLA 2K54A 3V98A 1AY7A 4CPKA 1KQS2 2F4YA 1VQM3 1DVDA 3DUKA 3FF2A 1SQWA 1UCKA 4JRFA 4N6UA 4BTXA 1ULIB 1IK3A 1BUQA 3MWZA 3FG3A 1I3IA 4HM3B 5HGRA 1A2VA 1JB4A 4GSPA
chains in the Genus database with same CATH topology
1BRSA 1RLSA 2C4BA 3AGNA 3WHOA 2GSPA 1CH0A 1BUJA 1BNRA 1BSEA 1BU4A 1X1UA 1B27A 1FUTA 1GMPA 2KF4A 3AHWA 1BRIA 1IYYA 3DGYA 1I70A 1RNTA 1HYFA 2KF5A 1AQZA 1I2FA 1I3FA 3BIRA 1RSNA 1DETA 3HOHA 4HOHA 2F5WA 1RTUA 1BNEA 1HZ1A 1GMQA 1TTOA 1BRKA 1B2ZA 1RGAA 3GSPA 2ZA4A 1GSPA 2KAAA 1FUSA 1BVIA 3SYUA 1I0XA 2AAEA 1RDSA 3D4AA 1BSDA 4BU4A 1JBTA 1BGSA 3URPA 1BSAA 2KF6A 2AADA 1B2XA 2HOHA 1T2IA 1BSBA 1BNSA 1YVSA 1I0VA 1GOYA 1Q9EA 1BIRA 1BOXA 1A2PA 1B2UA 1LRAA 1RHLA 1PYLA 1RGHA 2F5MA 4HAAA 1BRHA 1X1YA 1RMSA 6GSPA 1X1WA 1YGWA 1B2MA 3A5EA 1B21A 1TRPA 3AHSA 3WR2A 4BIRA 3Q3FA 6RNTA 1I2GA 5BIRA 7GSPA 2RNTA 1B20A 3D5GA 2RBIA 1LOWA 1RN1A 1LOYA 4J5KA 4RNTA 1RGEA 3AGOA 4J5GA 3D5IA 4GHOA 1BRNL 9RNTA 1LOVA 5BU4A 1RGCA 1RGFA 1T2HA 1BRJA 1JBSA 1BNFA 1RCKA 1BSCA 3DH2A 1FW7A 1G02A 2SARA 1R4YA 5GSPA 1FYSA 3RNTA 1C54A 1GOUA 1RGGA 1B3SA 1DE3A 1ZGXA 1RCLA 1RN4A 1BNIA 1MGWA 1BAOA 1BANA 1LNIA 1TRQA 1PY3A 1X1XA 1I8VA 1SARA 7RNTA 1RGKA 1GMRA 2BU4A 1GOVA 1BNJA 3KCHA 5RNTA 1YNVX 1BNGA 1MGRA 1UCLA 2KF3A 2F56A 1AY7A 1JBRA 2F4YA 5HOHA 1BRGA 2BIRA 1UCKA 1UCJA 1I2EA 1RNBA 1I3IA 1RGLA 1B2SA 1FZUA 3BU4A 8RNTA 1UCIA 4GSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BRS A;  1RLS A;  2C4B A;  3AGN A;  3WHO A;  2GSP A;  1CH0 A;  1BUJ A;  1BNR A;  1BSE A;  1BU4 A;  1X1U A;  1B27 A;  1FUT A;  1GMP A;  2KF4 A;  3AHW A;  1BRI A;  1IYY A;  3DGY A;  1I70 A;  1RNT A;  1HYF A;  2KF5 A;  1AQZ A;  1I2F A;  1I3F A;  3BIR A;  1RSN A;  1DET A;  3HOH A;  4HOH A;  2F5W A;  1RTU A;  1BNE A;  1HZ1 A;  1GMQ A;  1TTO A;  1BRK A;  1B2Z A;  1RGA A;  3GSP A;  2ZA4 A;  1GSP A;  2KAA A;  1FUS A;  1BVI A;  3SYU A;  1I0X A;  2AAE A;  1RDS A;  3D4A A;  1BSD A;  4BU4 A;  1JBT A;  1BGS A;  3URP A;  1BSA A;  2KF6 A;  2AAD A;  1B2X A;  2HOH A;  1T2I A;  1BSB A;  1BNS A;  1YVS A;  1I0V A;  1GOY A;  1Q9E A;  1BIR A;  1BOX A;  1A2P A;  1B2U A;  1LRA A;  1RHL A;  1PYL A;  1RGH A;  2F5M A;  4HAA A;  1BRH A;  1X1Y A;  1RMS A;  6GSP A;  1X1W A;  1YGW A;  1B2M A;  3A5E A;  1B21 A;  1TRP A;  3AHS A;  3WR2 A;  4BIR A;  3Q3F A;  6RNT A;  1I2G A;  5BIR A;  7GSP A;  2RNT A;  1B20 A;  3D5G A;  2RBI A;  1LOW A;  1RN1 A;  1LOY A;  4J5K A;  4RNT A;  1RGE A;  3AGO A;  4J5G A;  3D5I A;  4GHO A;  1BRN L;  9RNT A;  1LOV A;  5BU4 A;  1RGC A;  1RGF A;  1T2H A;  1BRJ A;  1JBS A;  1BNF A;  1RCK A;  1BSC A;  3DH2 A;  1FW7 A;  1G02 A;  2SAR A;  1R4Y A;  5GSP A;  1FYS A;  3RNT A;  1C54 A;  1GOU A;  1RGG A;  1B3S A;  1DE3 A;  1ZGX A;  1RCL A;  1RN4 A;  1BNI A;  1MGW A;  1BAO A;  1BAN A;  1LNI A;  1TRQ A;  1PY3 A;  1X1X A;  1I8V A;  1SAR A;  7RNT A;  1RGK A;  1GMR A;  2BU4 A;  1GOV A;  1BNJ A;  3KCH A;  5RNT A;  1YNV X;  1BNG A;  1MGR A;  1UCL A;  2KF3 A;  2F56 A;  1AY7 A;  1JBR A;  2F4Y A;  5HOH A;  1BRG A;  2BIR A;  1UCK A;  1UCJ A;  1I2E A;  1RNB A;  1I3I A;  1RGL A;  1B2S A;  1FZU A;  3BU4 A;  8RNT A;  1UCI A;  4GSP A; 
#chains in the Genus database with same CATH topology
 1M1X B;  3M8C A;  3NQZ A;  3MG3 A;  5D82 A;  2H0G A;  1KSI A;  1K8A 4;  4NHF A;  3WHO A;  2SBL A;  3K7C A;  2C11 A;  3RDE A;  4XBT A;  1BU4 A;  1ZX2 A;  1B27 A;  3D9R A;  3NHX A;  1GMP A;  2FXT A;  2KF4 A;  3CCU 3;  1A90 A;  5IW9 A;  2CG1 A;  1RRL A;  3GRD A;  4ZM8 A;  2KF5 A;  1YVB I;  2GU1 A;  2I9W A;  1GY5 A;  2BNG A;  1ZO2 A;  2WO0 A;  3PZW A;  5G2G A;  5JBS A;  1W6Y A;  2QA4 3;  1LQG C;  3NQY A;  2CFW A;  2Y73 A;  2F5W A;  4H3U A;  4MMZ B;  5IG4 A;  1BNE A;  2ML5 A;  3NV0 B;  5KP3 A;  2UGI A;  2Z76 A;  4LGQ A;  2B1X B;  2XSH B;  3ZFZ A;  1GS3 A;  1V74 A;  3FF0 A;  2GBW B;  3AMO B;  3GSP A;  2ZA4 A;  2KAA A;  3MYT A;  4XDW A;  1VQP 3;  3FGY A;  3HI7 A;  4HM2 B;  1BVI A;  2W56 A;  1I0X A;  1RDS A;  1TFO A;  1BSD A;  4BL3 A;  3G0K A;  4BU4 A;  1JRQ A;  3Q1C A;  4FMA A;  2HMJ B;  4FMC A;  1OAC A;  4N6M A;  5DRV A;  2KF6 A;  1QAL A;  3CXC 2;  1W01 A;  4HBR A;  1FGQ A;  1TFK A;  3OWS A;  3F8X A;  2HOH A;  1JNQ A;  1BSB A;  3GZY B;  1YVS A;  3BND A;  1ROA A;  2E2U A;  1V57 A;  1GD3 A;  4R9L A;  4EV2 A;  4HM4 B;  3FG4 A;  5FW5 A;  1T5Y A;  4FMD A;  4H61 A;  3HIG A;  2OOV A;  2XGL A;  3T0U A;  5BVB A;  1RMS A;  6GSP A;  2HMN B;  3N9H A;  2LYX A;  4KVH A;  2W6J H;  4AKY A;  1KD1 4;  3E99 A;  4HZB B;  2WGO A;  1A2K A;  1UUW B;  2WOF A;  7GSP A;  5BIR A;  5M18 A;  3SX1 A;  5D81 A;  4WYK B;  1LOY A;  1ASK A;  2IYJ A;  2W2C A;  4EV5 A;  3EBT A;  3GZR A;  4L7K A;  7STD A;  4N6L A;  3QK9 A;  5IF6 A;  3WOD G;  3Q2P A;  1GY6 A;  1JKG A;  2CW9 A;  1RGC A;  3N8B A;  1T2H A;  4EXR A;  1GYB A;  1OF5 A;  1WTH A;  4WHA A;  3PS8 A;  2SAR A;  3HX8 A;  1R4Y A;  1FYS A;  3RNT A;  1W6C A;  3EHC A;  3DGN A;  1RGG A;  4NPB A;  2OWP A;  1LXE A;  1UI8 A;  1UUV B;  2O3O A;  3B4O A;  3LTD A;  2BO9 B;  1NB3 I;  1LNH A;  4LEH A;  3CD6 3;  1NJI 4;  1VQ5 3;  3LZA A;  1Q7H A;  3BLZ A;  1OCV A;  3KSE D;  3DGM A;  3EBY A;  5G1L A;  3WMD A;  1YIJ 3;  1Y4K A;  3IJE B;  4O8S A;  7RNT A;  1GMR A;  3EN1 B;  3G6E 3;  1GOV A;  3KCH A;  1W4N A;  2MC8 A;  3WOF B;  2CFK A;  3F14 A;  3FH1 A;  4MMY B;  1UUG B;  4CCV A;  5A0O B;  2OQE A;  2F56 A;  5HOH A;  2YX9 A;  1STD A;  3CCL 3;  2QGU A;  1QAF A;  2BIR A;  3D79 A;  4L8P A;  1JB5 A;  3JUN A;  1G96 A;  2W04 A;  2F98 A;  4XM4 A;  4MJD A;  2ZL8 A;  2IUK A;  3BU4 A;  5DRE A;  3X3Y A;  8RNT A;  3KSP A;  4AEQ A;  1D6Z A;  4MMX B;  2M7O A;  1KWI A;  1W7C A;  3PXM A;  3WOE B;  2GSP A;  2OQE C;  3BNE A;  2CIU A;  1TJD A;  1X1U A;  3RGA A;  1FUT A;  1N5H A;  3AHW A;  3OXA A;  2GXF A;  5AIF A;  3CMA 3;  1W2B 2;  1CEW I;  2PZV A;  3CU3 A;  1BRI A;  1N9E A;  2XFT A;  2E2V A;  2JQ5 A;  1I70 A;  3WA3 A;  1S72 3;  2YFL B;  3F8H A;  1NDO B;  3ROB A;  2KCD A;  1YJ9 3;  2QIY A;  2K3D A;  1I2F A;  2GU3 A;  2BHM A;  2HMK B;  3BIR A;  3KII A;  1TU5 A;  2CWU A;  1T3B A;  1VQO 3;  2HMM B;  3CC7 3;  3LT9 A;  4IT7 A;  1HZ1 A;  3DGO A;  1Q82 4;  2XH9 A;  1EQK A;  5LC7 A;  2CX0 A;  2UX0 A;  3K0Z A;  3LTB A;  4HKV B;  5KP4 A;  3I0Y A;  3S28 A;  1W2Z A;  2XF3 A;  1SJW A;  4WFO A;  1EEJ A;  2KXG A;  1BGS A;  4HM1 B;  3SED A;  1M9G A;  4X2H A;  1WNH A;  2W0Q A;  2P0M A;  1CYV A;  3Q90 A;  1IU7 A;  2OCT A;  3MG2 A;  1MWT A;  1UW1 A;  1BNS A;  4ILF A;  5TGN A;  2FNQ A;  1Q9E A;  1GOY A;  3ER7 A;  4R80 A;  3CNM A;  3LTC A;  4U13 A;  1RHL A;  4HM7 B;  4KFF A;  3JUM A;  1L5G B;  1FGM A;  1MWS A;  1WMP A;  1NU3 A;  3TDG A;  2HML B;  2STD A;  1OH0 A;  1YGW A;  1IV9 A;  4FCJ A;  1B21 A;  1TRP A;  4L8O A;  4N6O B;  5ELJ A;  1JN5 A;  1OHO A;  2CC3 A;  1WQL B;  4FCM A;  5AIG A;  1OHP A;  4BIR A;  1Q42 A;  2IA7 A;  1I2G A;  4DKI A;  1ISK A;  3H51 A;  1B20 A;  3FG1 A;  1VQ9 3;  3EC9 A;  3CCV 3;  4RNT A;  1GD4 A;  1VQ6 3;  1RGE A;  2W9P A;  3AGO A;  1TUH A;  4J5G A;  2R4I A;  4J9A A;  5AIH A;  2B24 B;  3S27 A;  2OOV C;  3I55 3;  1BRN L;  2XFS A;  1LOV A;  4NRE A;  5BU4 A;  3X3Z A;  2LQV A;  3OV4 A;  5IG0 A;  1Z1S A;  1MWR A;  3BNB A;  4EC6 A;  1MNL A;  1O7M B;  3CCJ 3;  3CCM 3;  1FW7 A;  1G02 A;  2ZHX B;  1K73 4;  4O3V A;  2F99 A;  2XRX B;  1UDI I;  3EQQ B;  4FR9 A;  2MF7 A;  1DE3 A;  2PNC A;  4QWT A;  3G71 3;  4OK0 A;  5IER A;  4HYZ A;  1A67 A;  1BNI A;  1RN7 A;  2R41 A;  1BAO A;  1IVU A;  2CHC A;  3DGL A;  4BL2 A;  2F86 B;  3K5T A;  5STD A;  1PY3 A;  1VZZ A;  1X1X A;  1E3R A;  4KFE A;  3CCE 3;  2XGN A;  4GB5 A;  2ML6 A;  1CQS A;  1LQM B;  4PEJ A;  1R4C A;  1W00 A;  4OUQ A;  3O8Y A;  1YGE A;  1JZD A;  1U5O A;  5CXO A;  1MGR A;  2KF3 A;  1O7P B;  4KFD A;  5KP1 A;  3D3L A;  1JBR A;  2D1W A;  1TP6 A;  3SLU A;  4HM6 B;  1BRG A;  2H0I A;  1Q81 4;  1JN5 B;  1IT7 A;  1QVF 2;  1VQ4 3;  1UCJ A;  4R4K A;  5AYS C;  1HU9 A;  1ZS7 A;  3F9S A;  4KT3 B;  3AGN A;  4HOH A;  1JKG B;  1BRS A;  1N8Q A;  5AI1 A;  3WDG B;  3F7X A;  1NB5 I;  1RLS A;  3DZL A;  1VQ8 3;  1VQL 3;  2XEP A;  1LOX A;  1OF5 B;  2GBX B;  3MKI A;  5AII A;  1BNR A;  4IIA A;  3B7C A;  1IVV A;  3KE7 A;  5EEO A;  3VF1 A;  3X41 A;  4MEI A;  3S5C A;  1SII A;  2FGT A;  3U1W A;  2E2T A;  3UL5 A;  5M1A A;  2V1L A;  3J7Y d;  1IYY A;  1VQQ A;  3DGY A;  1RNT A;  3DY5 A;  1HYF A;  3K9M C;  4RZM A;  3SOA A;  2W9Q A;  1AQZ A;  4WYK A;  1Q86 4;  3EB8 A;  1D6Y A;  1I3F A;  3OW2 2;  1RSN A;  3CME 3;  1RTU A;  1IDP A;  3SOY A;  3X40 A;  5ELU A;  3B4P A;  1V58 A;  1TTO A;  4TX4 A;  2RGQ A;  1BRK A;  1B2Z A;  2H0H A;  4R1K A;  2HMO B;  2O9U X;  2L1S A;  1YI2 3;  1Q40 B;  1Q7Y 4;  3HII A;  1FUS A;  3SYU A;  3D4A A;  2C10 A;  2CWV A;  2YFJ B;  5JPP A;  4ORL A;  3STD A;  3X3X A;  1JBT A;  3URP A;  4BTY A;  1ULJ B;  1RJO A;  4HM8 B;  2CK3 H;  3CCQ 3;  1B2X A;  1MOL A;  3JVC A;  1OGZ A;  4LZI A;  4CDL A;  5M19 A;  1UGH I;  3F40 A;  5AEU B;  2BMR B;  3GWR A;  2W56 B;  1US1 A;  3MPH A;  2Y74 A;  1WMO A;  3GZB A;  3S29 A;  1A2P A;  1BOX A;  3UNL A;  1J2B A;  1AVL A;  5JPU A;  2F5M A;  5BXQ A;  1K28 A;  3NV0 A;  1IQ8 A;  2CG0 A;  4HM5 B;  1B2M A;  2RCD A;  3A5E A;  1FUW A;  3PCS A;  3RGR A;  1W6G A;  1N8R 4;  3LOY A;  4K1V A;  1NNV A;  3AHS A;  5CLK A;  3WR2 A;  5IG5 A;  1IQX A;  2P09 A;  3T8N A;  2RNT A;  2CWT A;  5IEP A;  2IY2 A;  3IMA B;  3MG1 A;  4HJL B;  4K90 B;  4EBG A;  4EYC A;  2W03 A;  2RBI A;  3KFQ C;  1RN1 A;  1GY7 A;  3HZP A;  4J5K A;  3ZG5 A;  3F7S A;  3GZX B;  3I56 3;  1AVK A;  4GHO A;  5AYR B;  3MSO A;  2CH9 A;  4XBY A;  3FCS B;  3PGB A;  3H3H A;  1RGF A;  4HZ9 B;  1MWU A;  1BRJ A;  1Q40 A;  1JBS A;  3FKA A;  4N3V A;  1BSC A;  3DH2 A;  5IEN A;  4N6N B;  1CYU A;  3NM7 A;  1DMN A;  2J8X B;  3G4S 3;  3FSD A;  1VQK 3;  3JUP A;  4CJN A;  2RSX A;  3S67 A;  1GOU A;  1OHS A;  1IVX A;  2P0X A;  4HVN A;  1QAK A;  1RN4 A;  1MGW A;  3OX9 A;  3LTA A;  1IT8 A;  1FGT A;  1OGX A;  5CK6 A;  3PYJ A;  2WGQ A;  4J8T A;  1QMA A;  4FCZ A;  2GEX A;  1TRQ A;  1AR0 A;  2P38 A;  3CNX A;  2CX1 A;  4N6V 0;  1YIT 3;  1RGK A;  2BU4 A;  1DYU A;  1JV2 B;  2YFI B;  4XBX A;  1N5P A;  1YNV X;  3VSY A;  5D83 A;  1OUN A;  1BNG A;  1WMN A;  3BB9 A;  3LT8 A;  1M90 4;  2XSO B;  3OWU A;  2CKF B;  3KN4 A;  3JUQ A;  3FZW A;  4LSO A;  1VQ7 3;  1I2E A;  1YJN 3;  1RNB A;  3ALA A;  1E3V A;  1RGL A;  1B2S A;  1FZU A;  1S5A A;  3NBB A;  1UCI A;  4O2H A;  1W02 A;  3CC2 3;  2C4B A;  3B8L A;  4OVM A;  3L0R A;  1CH0 A;  1IVW A;  1BUJ A;  1YHQ 3;  1BSE A;  3V92 A;  5IG3 A;  3UB1 A;  2UUG C;  4I5Q A;  4XDV A;  4WWU C;  1FA3 A;  3NXJ A;  1D6U A;  4RNZ A;  1OPY A;  3N54 B;  3HOH A;  1DET A;  1JB2 A;  1RRH A;  2ZDJ A;  4GL6 A;  1TIJ A;  3LML A;  2KRT A;  3JUO A;  4LMI A;  1LVN A;  4G1M B;  1NWW A;  3QRD A;  1GMQ A;  1N9J A;  3FLJ A;  1UGI A;  4JF8 A;  4R9K A;  5G1K A;  2Z6B A;  2L4V A;  1RGA A;  3HK4 A;  1GSP A;  3UL6 A;  3DXO A;  3AMO A;  3EX9 A;  3MHE A;  4K61 A;  4FMB A;  2AAE A;  1EG9 B;  1IQY A;  2Q07 A;  3LH4 A;  1FGR A;  2D42 A;  4Q53 A;  2QEX 3;  5EQL A;  1BSA A;  3V99 A;  1K9M 4;  4KZ1 A;  4WP5 A;  3CCS 3;  2P05 A;  3NUV A;  2AAD A;  1EA2 A;  4STD A;  2BMO B;  3SVA A;  4AKZ A;  1HKX A;  1T2I A;  2IMJ A;  1PU4 A;  3EN8 A;  3KZT A;  3EF8 A;  1I0V A;  3LXU X;  1QVG 2;  3GAX A;  4HM0 B;  5I97 A;  1BIR A;  3SXX A;  2A15 A;  3A76 A;  4X2O A;  3WA2 X;  1IV7 A;  3G16 A;  5LC6 A;  1B2U A;  1LRA A;  5FGO A;  3NBJ A;  1YJW 3;  1M1K 4;  1PYL A;  1RGH A;  1JJ2 2;  3PCR A;  3ZG0 A;  3LYG A;  2INX A;  4HAA A;  1BRH A;  1X1Y A;  2Z77 A;  2BMQ B;  1PFP A;  1X1W A;  2CFD A;  2K0M A;  2IUJ A;  2JDI H;  1UI7 A;  1W5Z A;  1EKM A;  2RFR A;  3G8Z A;  1ROV A;  1EUI C;  3Q3F A;  1DMM A;  5CF1 A;  6RNT A;  1VQN 3;  3CPO A;  3VGN A;  4EW5 A;  1DMQ A;  6STD A;  3D5G A;  1LOW A;  1JZO A;  3EJV A;  3BNC A;  3NX0 A;  3EE1 A;  4LYL B;  3IPT A;  3D5I A;  1SPU A;  9RNT A;  3UJM A;  2OTJ 3;  2WOH A;  4RBN A;  8CHO A;  2GEY A;  1AV4 A;  3OWY A;  1BNF A;  1RCK A;  3KKG A;  4K1U A;  4BTW A;  1G0T A;  4RNY A;  3NM2 A;  5GSP A;  1O7N B;  1C54 A;  1DVC A;  3CPW 2;  3DMC A;  5CF2 A;  1B3S A;  1U8C B;  1O7W B;  1NO3 A;  1C7H A;  1FGO A;  1O7H B;  1RCL A;  1ZGX A;  3DM8 A;  2BT3 A;  4XB5 A;  3X42 A;  1SIH A;  1RKY A;  3T8U A;  1E97 A;  1BAN A;  1STF I;  2XR8 B;  4I4K A;  5AEW B;  3CCR 3;  1KC8 4;  2CFG A;  1LNI A;  1K41 A;  4N6T A;  4O02 B;  2CFL A;  2OTL 3;  3ECF A;  3NBR A;  1I8V A;  1F8N A;  1SAR A;  4IPB A;  2Z7A A;  5IEO A;  1QJG A;  1BNJ A;  5EVH A;  5RNT A;  3K63 A;  1O7G B;  3CC4 3;  3U97 A;  1UCL A;  2K54 A;  3V98 A;  1AY7 A;  4CPK A;  1KQS 2;  2F4Y A;  1VQM 3;  1DVD A;  3DUK A;  3FF2 A;  1SQW A;  1UCK A;  4JRF A;  4N6U A;  4BTX A;  1ULI B;  1IK3 A;  1BUQ A;  3MWZ A;  3FG3 A;  1I3I A;  4HM3 B;  5HGR A;  1A2V A;  1JB4 A;  4GSP A; 
#chains in the Genus database with same CATH homology
 1BRS A;  1RLS A;  2C4B A;  3AGN A;  3WHO A;  2GSP A;  1CH0 A;  1BUJ A;  1BNR A;  1BSE A;  1BU4 A;  1X1U A;  1B27 A;  1FUT A;  1GMP A;  2KF4 A;  3AHW A;  1BRI A;  1IYY A;  3DGY A;  1I70 A;  1RNT A;  1HYF A;  2KF5 A;  1AQZ A;  1I2F A;  1I3F A;  3BIR A;  1RSN A;  1DET A;  3HOH A;  4HOH A;  2F5W A;  1RTU A;  1BNE A;  1HZ1 A;  1GMQ A;  1TTO A;  1BRK A;  1B2Z A;  1RGA A;  3GSP A;  2ZA4 A;  1GSP A;  2KAA A;  1FUS A;  1BVI A;  3SYU A;  1I0X A;  2AAE A;  1RDS A;  3D4A A;  1BSD A;  4BU4 A;  1JBT A;  1BGS A;  3URP A;  1BSA A;  2KF6 A;  2AAD A;  1B2X A;  2HOH A;  1T2I A;  1BSB A;  1BNS A;  1YVS A;  1I0V A;  1GOY A;  1Q9E A;  1BIR A;  1BOX A;  1A2P A;  1B2U A;  1LRA A;  1RHL A;  1PYL A;  1RGH A;  2F5M A;  4HAA A;  1BRH A;  1X1Y A;  1RMS A;  6GSP A;  1X1W A;  1YGW A;  1B2M A;  3A5E A;  1B21 A;  1TRP A;  3AHS A;  3WR2 A;  4BIR A;  3Q3F A;  6RNT A;  1I2G A;  5BIR A;  7GSP A;  2RNT A;  1B20 A;  3D5G A;  2RBI A;  1LOW A;  1RN1 A;  1LOY A;  4J5K A;  4RNT A;  1RGE A;  3AGO A;  4J5G A;  3D5I A;  4GHO A;  1BRN L;  9RNT A;  1LOV A;  5BU4 A;  1RGC A;  1RGF A;  1T2H A;  1BRJ A;  1JBS A;  1BNF A;  1RCK A;  1BSC A;  3DH2 A;  1FW7 A;  1G02 A;  2SAR A;  1R4Y A;  5GSP A;  1FYS A;  3RNT A;  1C54 A;  1GOU A;  1RGG A;  1B3S A;  1DE3 A;  1ZGX A;  1RCL A;  1RN4 A;  1BNI A;  1MGW A;  1BAO A;  1BAN A;  1LNI A;  1TRQ A;  1PY3 A;  1X1X A;  1I8V A;  1SAR A;  7RNT A;  1RGK A;  1GMR A;  2BU4 A;  1GOV A;  1BNJ A;  3KCH A;  5RNT A;  1YNV X;  1BNG A;  1MGR A;  1UCL A;  2KF3 A;  2F56 A;  1AY7 A;  1JBR A;  2F4Y A;  5HOH A;  1BRG A;  2BIR A;  1UCK A;  1UCJ A;  1I2E A;  1RNB A;  1I3I A;  1RGL A;  1B2S A;  1FZU A;  3BU4 A;  8RNT A;  1UCI A;  4GSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...