3EBTA

Crystal structure of a ntf2-like protein of unknown function (bpss0132) from burkholderia pseudomallei k96243 at 1.30 a resolution
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
131
structure length
131
Chain Sequence
MSNNMQTVRESYEAFHRRDLPGVLAALAPDVRWTHPDGMSPYGLGGTKHGHDEVIAFIRHVPTHIAEMRLAPDEFIESGERIVVLGTRRVTAVNGRSATLKFVHVWRFENGRAVTFEDHFDTAEMIRLITA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords uncharacterized NTF2-like protein
publication title Crystal structure of NTF2-like protein of unknown function (YP_110153.1) from BURKHOLDERIA PSEUDOMALLEI K96243 at 1.30 A resolution
rcsb
source organism Burkholderia pseudomallei k96243
total genus 42
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2008-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ebtA00
3RGRA 4LEHA 3MSOA 3SOYA 2QGUA 4WWUC 1VZZA 1Z1SA 1GYBA 4CDLA 2GEYA 1GY6A 4R9KA 1OGXA 1DMNA 3MYTA 2B24B 1NWWA 5IENA 2CKFB 2RCDA 5AIGA 2STDA 3JUPA 3CNXA 1GY7A 1BUQA 3EJVA 4HM4B 3RGAA 4N3VA 4OUQA 4XM4A 2GBXB 1OHOA 2HMKB 2Z76A 3GRDA 3H51A 1JB4A 2INXA 1JB2A 3F8XA 1Q42A 5AEWB 5EVHA 3KE7A 3NV0A 5IG5A 3VGNA 3Q90A 3EHCA 5KP1A 3DUKA 2GXFA 3HX8A 2RGQA 3KKGA 2K54A 1IDPA 3T8UA 3MHEA 2JQ5A 3FKAA 3MG2A 1OHSA 3HZPA 4XDWA 1E97A 1ISKA 3K0ZA 2HMMB 2GBWB 2B1XB 4HM6B 3LZAA 2F98A 4R1KA 1ULIB 6STDA 3GZRA 5KP4A 4MJDA 3B8LA 3FH1A 1OHPA 5AIHA 1OCVA 3OWSA 3ROBA 2BMQB 5AEUB 2F99A 3HK4A 3IPTA 4STDA 3JUMA 1SJWA 3F8HA 1GS3A 2YFJB 3JUOA 4HZBB 5JPPA 3FF0A 1S5AA 4PEJA 3NBRA 4HM3B 5AIIA 4K1VA 1OGZA 3GZBA 2HMJB 1JN5A 5FW5A 4L8PA 4K1UA 1W02A 3G16A 4XBYA 5BVBA 4GB5A 3D9RA 3KSPA 3F7SA 1E3VA 1HKXA 4HKVB 2BMRB 5KP3A 5AIFA 3NHXA 3H3HA 1U5OA 2I9WA 3JUNA 5D81A 2UX0A 3NV0B 3EC9A 4HM2B 3FGYA 3CNMA 1JB5A 5CLKA 4L8OA 5G2GA 3BB9A 4XDVA 3F14A 5CF2A 4HJLB 8CHOA 4HZ9B 4LMIA 2HMLB 4H3UA 2CHCA 3EQQB 5IG3A 1QMAA 2XRXB 3DMCA 4LGQA 1UUWB 3B4OA 3F7XA 5CF1A 4HM8B 4U13A 3FZWA 4J9AA 2YFIB 3NUVA 2HMNB 2R4IA 4OVMA 3EN8A 5IF6A 2GEXA 4HVNA 1O7MB 3OV4A 3T8NA 3NM2A 1C7HA 5CXOA 1EG9B 3A76A 4X2HA 3STDA 3S5CA 5IEPA 3ER7A 3CU3A 2QIYA 3MG1A 1EA2A 1W00A 4R9LA 1ASKA 4XBTA 1UUVB 3I0YA 3OWYA 5DRVA 1AR0A 5STDA 1W01A 3B7CA 3G8ZA 4WYKA 5TGNA 1GY5A 3B4PA 2OWPA 3KZTA 3OWUA 2BNGA 5AI1A 4X2OA 1O7HB 1W6YA 1JN5B 3FSDA 2XSOB 5D82A 1JKGB 1QJGA 1A2KA 4IIAA 3GWRA 1Q40B 1JKGA 1K41A 1OUNA 1Q40A 3FLJA 1ULJB 2IMJA 1E3RA 3DM8A 3UNLA 4Q53A 3MG3A 2F86B 2Z7AA 2A15A 3EX9A 4HM7B 2W2CA 3EF8A 3EBYA 1NDOB 4FCMA 7STDA 1ZX2A 4L7KA 1WQLB 5IG0A 3OXAA 1NU3A 4ORLA 3SOAA 1CQSA 3VSYA 1OH0A 1O7GB 4WP5A 1STDA 3MKIA 5IERA 1O7PB 2Z77A 5IEOA 4HM5B 3DXOA 1OF5B 2YFLB 5D83A 3UJMA 4HM0B 3WMDA 1OF5A 4XB5A 3CPOA 3GZXB 2HMOB 2BMOB 1DMMA 1TUHA 3EN1B 4J8TA 1O7WB 3F40A 5BXQA 2PZVA 3M8CA 4XBXA 3F9SA 3K7CA 3E99A 5JPUA 4I4KA 1TP6A 1O7NB 3LYGA 3JUQA 5DREA 2XR8B 1OPYA 4KVHA 5CK6A 1DMQA 3SEDA 2XSHB 2RFRA 4HM1B 3DZLA 4FCJA 3EBTA 1ZO2A 5IG4A 3GZYB 3G0KA 5HGRA 3ECFA 3OX9A 3FF2A 4RZMA 3NXJA 4WYKB 3BLZA
chains in the Genus database with same CATH superfamily
1UW1A 3RGRA 1WNHA 3ZG0A 4LEHA 4CPKA 2MF7A 2UUGC 2F5MA 3MSOA 3FCSB 1T2IA 3SOYA 1IQXA 2QGUA 4KZ1A 1QALA 4WWUC 1VZZA 1Z1SA 1BRSA 1BU4A 1JNQA 3WODG 1YHQ3 1B2MA 2CWTA 1B21A 4N6NB 1GYBA 1EEJA 4CDLA 2YX9A 1VQM3 1TTOA 3CCR3 1RGCA 4LSOA 2IYJA 3DGNA 1Q9EA 2GEYA 1W4NA 1GY6A 1C54A 4R9KA 3ZFZA 1OGXA 1I70A 3LT9A 1DMNA 3MYTA 2B24B 4N6TA 3S28A 1IQ8A 2W9PA 1NWWA 5IENA 3S27A 4FMDA 1IT7A 2CKFB 5G1KA 2RCDA 4CCVA 1R4CA 5AIGA 2STDA 1B2XA 2BHMA 3WOEB 3JUPA 1US1A 3KFQC 4N6V0 4R80A 1TJDA 1JBSA 1AV4A 3CNXA 1VQP3 1GY7A 3DGLA 1IVWA 3CXC2 2L1SA 3EJVA 1UCKA 3N9HA 1GD4A 1BUQA 1JV2B 1R4YA 2LYXA 1RRHA 1X1UA 1IU7A 1NNVA 1QAKA 4HM4B 3CCV3 3VF1A 1AY7A 1QAFA 2PNCA 3AHWA 5LC6A 1I0VA 3RGAA 1B2ZA 1YVBI 2CW9A 3SLUA 4HYZA 2MC8A 1A67A 2BT3A 2K3DA 2CFWA 4N3VA 5BU4A 1FW7A 3BIRA 1M1K4 2LQVA 1RGGA 4OUQA 2OQEC 4XM4A 2GBXB 2W0QA 3K63A 3LMLA 1OHOA 3N8BA 1IK3A 2HMKB 2CG0A 2Z76A 3GRDA 3H51A 1JB4A 3N54B 4JRFA 2O9UX 2INXA 1CYVA 3SYUA 1JB2A 3F8XA 1N5HA 1YIJ3 3RNTA 1Q42A 5AEWB 4EC6A 4NHFA 5EVHA 1DE3A 3DY5A 3NQYA 3KE7A 3NV0A 5IG5A 3VGNA 4JF8A 3Q90A 3EHCA 4GL6A 2CFLA 3EB8A 1RJOA 3DUKA 1MWTA 4R4KA 5KP1A 3CCM3 2KF3A 3CPW2 1SIHA 2GXFA 3HX8A 2D1WA 1PY3A 2RGQA 5LC7A 3KKGA 2K54A 3KN4A 1LOYA 1IDPA 1I3IA 3LOYA 1BIRA 3HOHA 1BSBA 3T8UA 3MHEA 2JQ5A 2WOFA 1BRJA 3FKAA 1YJ93 1NJI4 4G1MB 1UGIA 3MG2A 1OHSA 1Q814 3HZPA 4RNTA 4O02B 4KFDA 8RNTA 4XDWA 1E97A 1Q864 1BNGA 3SX1A 2P38A 4MEIA 1B27A 1B2UA 1BNRA 1S723 1ISKA 1IV7A 2CX1A 4K90B 3X3YA 1GMPA 1YNVX 3X41A 3K0ZA 2HMMB 3AGOA 1AQZA 2GBWB 1LNHA 2B1XB 1FUSA 1UI8A 1AVKA 4HM6B 5ELUA 3LZAA 2E2UA 2P0XA 3CCJ3 1FGOA 3UL5A 1VQ83 4KFEA 1Q7Y4 4IT7A 2F98A 4R1KA 3UL6A 1ULIB 2ML5A 5EQLA 1TFKA 6STDA 3I563 4FCZA 3GZRA 5KP4A 4MJDA 1T3BA 1LOVA 4J5GA 3B8LA 3FH1A 5BIRA 4MMYB 1W2ZA 1OHPA 2W6JH 4KT3B 5AIHA 3V98A 1QVF2 3CD63 1IVXA 2H0IA 3UB1A 2SARA 2WOHA 1DVCA 2AAEA 4WHAA 1W6CA 1OCVA 1VQN3 3OWSA 3PYJA 3ROBA 3Q2PA 1VQ93 2BMQB 2W9QA 2JDIH 3LXUX 5AYRB 2KXGA 1RGLA 5AEUB 3CME3 2BIRA 4ILFA 2F99A 1K734 3D4AA 3D5IA 1I2FA 4TX4A 1NO3A 1KC84 3BNEA 3S67A 1Y4KA 3MPHA 3OW22 2Y74A 3X42A 5JBSA 3HK4A 1G02A 3PS8A 1FGQA 3IPTA 4STDA 1LVNA 2F56A 3JUMA 3JVCA 5I97A 3G6E3 1RRLA 4FMAA 1KQS2 3CCU3 4QWTA 1M9GA 1MGRA 3WDGB 1SJWA 1BRHA 3F8HA 1GS3A 1IVVA 1RKYA 1T5YA 2ZDJA 2YFJB 3JUOA 3RDEA 1J2BA 4HZBB 1YVSA 1I2EA 1ZS7A 1Q7HA 3NBBA 5JPPA 1VQ63 3FF0A 1FUWA 1S5AA 1WMNA 3NBRA 4PEJA 2R41A 4HM3B 3AHSA 5AIIA 2KAAA 4K1VA 1OGZA 3GZBA 2HMJB 1JN5A 2OQEA 4BIRA 1VQ43 5FW5A 1UDII 1GMQA 2CFGA 3AGNA 2M7OA 1HZ1A 2E2VA 3DGYA 4L8PA 3S29A 3J7Yd 4K1UA 1W02A 1YGWA 3G16A 3GAXA 4XBYA 1JZOA 5BVBA 4GB5A 1BRKA 4EV5A 2QA43 4CJNA 1MWUA 4OK0A 5GSPA 1EQKA 3D9RA 3KSPA 3F7SA 3PXMA 3CMA3 1E3VA 4H61A 1RSNA 1HKXA 1W5ZA 4HKVB 1I2GA 2BMRB 3NBJA 5KP3A 1BANA 1DETA 1TU5A 1T2HA 2C10A 3PCSA 3NHXA 3H3HA 5AIFA 3WR2A 1M904 4RBNA 1U5OA 5AYSC 2V1LA 2I9WA 1YI23 3JUNA 2J8XB 5D81A 1PFPA 2FXTA 1N9JA 2UX0A 3NV0B 4RNZA 3EC9A 1RN1A 1BSCA 5A0OB 1UGHI 1RCKA 4HBRA 4EYCA 1IYYA 4HM2B 3FGYA 4O3VA 3CNMA 1JB5A 4LYLB 3PGBA 1N8QA 3DGOA 4L8OA 5CLKA 3CCL3 1UCJA 1RGFA 1BNSA 1X1XA 5G2GA 3X3XA 3BB9A 1D6UA 4XDVA 2F4YA 2KCDA 3F14A 5CF2A 4HOHA 3KSED 3NQZA 2RNTA 5M18A 1QVG2 3CC43 6RNTA 2CC3A 3BNDA 4HJLB 3LTDA 3BLZA 8CHOA 4HZ9B 1VQK3 2HOHA 4LMIA 3WOFB 1JBTA 3X40A 2HMLB 2FNQA 2W03A 1W6GA 4N6MA 2RSXA 4H3UA 2CHCA 3EQQB 3CC73 1FGMA 3CCE3 5IG3A 1LOXA 1RNTA 1QMAA 1VQL3 2XRXB 2CX0A 1GOYA 2XH9A 3IJEB 3KCHA 7RNTA 3DMCA 4LGQA 1UUWB 3G713 2CIUA 3B4OA 2K0MA 4MMZB 4EW5A 1YJN3 1I8VA 1HYFA 3F7XA 5CF1A 6GSPA 1K9M4 1RLSA 3I553 3LH4A 1VQ73 4HM8B 2XGNA 2OCTA 4U13A 1RNBA 3TDGA 3FZWA 4J9AA 2YFIB 3NUVA 2HMNB 1RN4A 2OOVC 4EV2A 2R4IA 3Q1CA 4OVMA 1OACA 3EN8A 5IF6A 1FGTA 2GEXA 4HVNA 1O7MB 5ELJA 1JRQA 3OV4A 1IV9A 1FYSA 1FGRA 2WGQA 3T8NA 3NM2A 2CWUA 2W56B 1UCIA 3PZWA 1C7HA 2GU1A 2WGOA 5CXOA 2Z6BA 1ROAA 1EG9B 3A76A 2W56A 1LRAA 1N5PA 2ZHXB 4X2HA 3STDA 3V92A 3S5CA 5IEPA 3X3ZA 4N6LA 2GU3A 1GMRA 1SARA 3ER7A 1BNFA 1YGEA 4GSPA 1W7CA 3DGMA 3CU3A 3FG1A 2QIYA 3K9MC 1U8CB 1B2SA 3MG1A 1IVUA 1EA2A 1RMSA 2KRTA 1ZGXA 1W00A 1MNLA 3O8YA 3LTBA 1LQGC 4R9LA 2W04A 1X1YA 5HOHA 2BO9B 3CCS3 4WFOA 1MOLA 4BTYA 1ASKA 2CK3H 4XBTA 1GSPA 1A2PA 1BGSA 2IUJA 1BNJA 4EBGA 1UUVB 3I0YA 1GD3A 5FGOA 3OWYA 1NB3I 3HI7A 5DRVA 2GSPA 9RNTA 1AR0A 5STDA 3A5EA 3WA3A 3CCQ3 1EKMA 1W01A 3B7CA 3G8ZA 1A2VA 4WYKA 1RDSA 1RTUA 2CH9A 5TGNA 1GY5A 4N6OB 3B4PA 1HU9A 2OWPA 1YIT3 3KZTA 4NPBA 2CWVA 2IUKA 3OWUA 2BNGA 5AI1A 2FGTA 4X2OA 1O7HB 1YJW3 1M1XB 2D42A 1W6YA 5M1AA 1K8A4 1JN5B 3D5GA 3FSDA 2XSOB 3SVAA 4IPBA 1SPUA 3ZG5A 3BNBA 5D82A 1JKGB 1QJGA 1A2KA 4IIAA 3K5TA 1BOXA 3GWRA 1BRNL 1Q40B 2UGIA 1JKGA 1K41A 1V57A 1OUNA 1Q40A 1JZDA 1RGKA 3FLJA 4GHOA 1ULJB 4LZIA 4O2HA 1LNIA 2KF4A 2IMJA 4BL3A 1E3RA 1VQO3 3DM8A 3NM7A 3UNLA 4BU4A 4Q53A 3MG3A 1RN7A 1UI7A 1BUJA 2F86B 3LT8A 1KSIA 1JJ22 2P0MA 1EUIC 1K28A 2Z7AA 1A90A 1B20A 3HIIA 1CYUA 2RBIA 1LXEA 2IA7A 2XF3A 2A15A 4BTXA 3EX9A 4HM7B 2W2CA 4ZM8A 3EF8A 3EBYA 4AEQA 1FUTA 1B3SA 3QK9A 1RGAA 1BRIA 1ROVA 1NDOB 1N8R4 3HIGA 1BNIA 2BU4A 4FCMA 4MMXB 1DVDA 3MWZA 2WO0A 1PYLA 7STDA 1LQMB 1GOUA 1ZX2A 4L7KA 3CC23 3WA2X 1WQLB 1L5GB 5IG0A 3NX0A 3OXAA 3EE1A 1NU3A 4ORLA 2H0GA 4RNYA 1TIJA 2IY2A 3DH2A 3SOAA 2OTL3 1CQSA 2QEX3 2P09A 1UUGB 2XEPA 2ML6A 3VSYA 1OH0A 3T0UA 2C11A 2CFKA 1MWRA 2P05A 1X1WA 1O7GB 4WP5A 1KD14 1MGWA 1STDA 1BNEA 1WMPA 3MKIA 5IERA 1TRPA 1D6ZA 1SQWA 1VQ53 1O7PB 2XFSA 2KF6A 2Z77A 5G1LA 1N9EA 1RHLA 1KWIA 4HM5B 5IEOA 1F8NA 1BAOA 3DXOA 3FG4A 1RGHA 2XFTA 2OOVA 1UCLA 1Q824 2OTJ3 1OF5B 1SIIA 2YFLB 5D83A 4N6UA 1WMOA 4HM0B 3UJMA 3WHOA 1OF5A 4XB5A 3WMDA 1TRQA 1BSAA 3CPOA 3LTAA 1FZUA 3GZXB 4FMCA 1DYUA 2HMOB 3L0RA 1V58A 3U97A 2BMOB 1DMMA 1TUHA 3EN1B 1BSEA 4J8TA 2ZL8A 1O7WB 2Y73A 4DKIA 4AKYA 3F40A 5BXQA 2E2TA 3AMOB 1RCLA 2PZVA 3M8CA 1G96A 4XBXA 3V99A 2CG1A 3AMOA 3U1WA 2AADA 3IMAB 4I5QA 4BL2A 3F9SA 3GSPA 3KIIA 1AVLA 1V74A 3FG3A 1FA3A 1D6YA 2Q07A 3BNCA 2CFDA 3K7CA 1VQQA 3LTCA 3E99A 4BTWA 5JPUA 1W2B2 4I4KA 1TP6A 1BRGA 3D79A 4K61A 1BVIA 1O7NB 3LYGA 3JUQA 3PCRA 5DREA 7GSPA 1PU4A 1MWSA 2XR8B 5IW9A 1OPYA 2XGLA 2L4VA 3QRDA 2C4BA 4KVHA 1JBRA 4HAAA 5CK6A 1DMQA 1I3FA 3SEDA 2XSHB 5M19A 4FR9A 2RFRA 4HM1B 3DZLA 1GOVA 4FCJA 2ZA4A 1WTHA 3ALAA 1NB5I 1I0XA 2SBLA 1LOWA 3EBTA 4EXRA 1G0TA 1RGEA 1ZO2A 5IG4A 3SXXA 1TFOA 2KF5A 3GZYB 1CEWI 1STFI 3D3LA 3G4S3 3G0KA 2O3OA 3BU4A 4NREA 5HGRA 2F5WA 3ECFA 3OX9A 4O8SA 4KFFA 4AKZA 5RNTA 4J5KA 1IT8A 3FF2A 4RZMA 1BSDA 3NXJA 4FMBA 5EEOA 3Q3FA 4WYKB 3URPA 1CH0A 1IQYA 2H0HA
chains in the Genus database with same CATH topology
1UW1A 3RGRA 1WNHA 4LEHA 2MF7A 3MSOA 3FCSB 3SOYA 1IQXA 2QGUA 4KZ1A 1QALA 4WWUC 1VZZA 1Z1SA 1JNQA 3WODG 1YHQ3 2CWTA 4N6NB 1VQM3 1GYBA 4CDLA 2YX9A 3CCR3 4LSOA 3DGNA 2GEYA 1W4NA 1GY6A 4R9KA 1OGXA 3LT9A 1DMNA 3MYTA 2B24B 4N6TA 3S28A 1IQ8A 2W9PA 1NWWA 5IENA 3S27A 4FMDA 1IT7A 2CKFB 2RCDA 4CCVA 1R4CA 5AIGA 2STDA 2BHMA 3WOEB 3JUPA 1US1A 3KFQC 4N6V0 4R80A 1AV4A 3CNXA 1VQP3 1GY7A 3DGLA 1IVWA 3CXC2 1BUQA 3EJVA 3N9HA 1GD4A 1JV2B 2LYXA 1RRHA 1IU7A 4HM4B 1QAKA 3CCV3 3VF1A 1QAFA 2PNCA 5LC6A 3RGAA 1YVBI 2CW9A 3SLUA 4HYZA 2MC8A 1A67A 2BT3A 2CFWA 4N3VA 1M1K4 2LQVA 4OUQA 4XM4A 2OQEC 2GBXB 2W0QA 3K63A 3LMLA 1OHOA 3N8BA 1IK3A 2HMKB 2CG0A 2Z76A 3GRDA 3H51A 1JB4A 3N54B 4JRFA 2O9UX 2INXA 1CYVA 1JB2A 3F8XA 1N5HA 1YIJ3 1Q42A 5AEWB 4EC6A 4NHFA 5EVHA 3DY5A 3NQYA 3KE7A 3NV0A 5IG5A 3VGNA 4JF8A 3Q90A 3EHCA 4GL6A 2CFLA 3EB8A 1RJOA 3DUKA 4R4KA 5KP1A 3CCM3 3CPW2 1SIHA 2GXFA 3HX8A 2D1WA 2RGQA 5LC7A 3KKGA 2K54A 3KN4A 1IDPA 3LOYA 3T8UA 3MHEA 2JQ5A 2WOFA 3FKAA 1YJ93 1NJI4 4G1MB 3MG2A 1OHSA 1Q814 3HZPA 4O02B 4KFDA 4XDWA 1E97A 1Q864 3SX1A 2P38A 4MEIA 1S723 1ISKA 1IV7A 4K90B 3X3YA 3X41A 3K0ZA 2HMMB 2GBWB 1LNHA 2B1XB 1UI8A 1AVKA 4HM6B 5ELUA 3LZAA 2E2UA 2P0XA 3CCJ3 1FGOA 3UL5A 1VQ83 4KFEA 1Q7Y4 4IT7A 2F98A 4R1KA 3UL6A 1ULIB 2ML5A 5EQLA 1TFKA 6STDA 3I563 4FCZA 3GZRA 5KP4A 4MJDA 3B8LA 3FH1A 1QVF2 4MMYB 1W2ZA 1OHPA 2W6JH 5AIHA 3V98A 3CD63 1IVXA 3UB1A 4WHAA 2WOHA 1DVCA 1W6CA 1OCVA 1VQN3 3OWSA 3PYJA 3ROBA 3Q2PA 1VQ93 2BMQB 2W9QA 2JDIH 3LXUX 5AYRB 2KXGA 5AEUB 3CME3 2F99A 1K734 4TX4A 1NO3A 1KC84 3BNEA 3S67A 1Y4KA 3MPHA 3OW22 2Y74A 3X42A 5JBSA 3HK4A 3PS8A 1FGQA 3IPTA 4STDA 1LVNA 3JUMA 3JVCA 5I97A 3G6E3 1RRLA 4FMAA 1KQS2 3CCU3 4QWTA 1M9GA 3WDGB 1SJWA 3F8HA 1GS3A 1IVVA 1RKYA 2ZDJA 1T5YA 2YFJB 3JUOA 3RDEA 1J2BA 4HZBB 3NBBA 5JPPA 1VQ63 3FF0A 1FUWA 1S5AA 1WMNA 3NBRA 4PEJA 4HM3B 5AIIA 4K1VA 1OGZA 3GZBA 2HMJB 1JN5A 2OQEA 1VQ43 5FW5A 2CFGA 2M7OA 2E2VA 4L8PA 3S29A 3J7Yd 4K1UA 1W02A 3G16A 3GAXA 4XBYA 5BVBA 4GB5A 4EV5A 2QA43 1EQKA 4OK0A 3D9RA 3KSPA 3F7SA 3PXMA 3CMA3 1E3VA 4H61A 1HKXA 1W5ZA 4HKVB 2BMRB 5KP3A 3NBJA 1TU5A 2C10A 3PCSA 3NHXA 3H3HA 5AIFA 1M904 4RBNA 1U5OA 5AYSC 2V1LA 2I9WA 1YI23 3JUNA 5D81A 1PFPA 2FXTA 1N9JA 2UX0A 3NV0B 4RNZA 3EC9A 5A0OB 4HBRA 4EYCA 4HM2B 3FGYA 4O3VA 3CNMA 1JB5A 3PGBA 1N8QA 3DGOA 4L8OA 5CLKA 3CCL3 5G2GA 3X3XA 3BB9A 1D6UA 4XDVA 2KCDA 3F14A 5CF2A 3KSED 3NQZA 3CC43 1QVG2 2CC3A 3BNDA 4HJLB 3LTDA 8CHOA 4HZ9B 1VQK3 4LMIA 3WOFB 3X40A 2HMLB 2FNQA 2W03A 1W6GA 4N6MA 2RSXA 4H3UA 2CHCA 3EQQB 3CC73 1FGMA 3CCE3 5IG3A 1LOXA 1QMAA 1VQL3 2XRXB 2XH9A 3IJEB 3DMCA 4LGQA 1UUWB 3G713 2CIUA 3B4OA 2K0MA 4MMZB 1YJN3 3F7XA 5CF1A 1K9M4 3I553 3LH4A 1VQ73 4HM8B 2XGNA 2OCTA 4U13A 3TDGA 3FZWA 4J9AA 2YFIB 3NUVA 2HMNB 2OOVC 4EV2A 2R4IA 3Q1CA 4OVMA 1OACA 3EN8A 5IF6A 1FGTA 2GEXA 4HVNA 1O7MB 5ELJA 1JRQA 3OV4A 1IV9A 1FGRA 2WGQA 3T8NA 3NM2A 2CWUA 2W56B 3PZWA 1C7HA 2GU1A 2WGOA 5CXOA 2Z6BA 1ROAA 1EG9B 3A76A 2W56A 1N5PA 3V92A 4X2HA 3STDA 3S5CA 5IEPA 3X3ZA 4N6LA 2GU3A 3ER7A 1YGEA 1W7CA 3DGMA 3CU3A 3FG1A 2QIYA 3K9MC 1U8CB 3MG1A 1IVUA 1EA2A 2KRTA 1W00A 1MNLA 3O8YA 3LTBA 4R9LA 2BO9B 3CCS3 4WFOA 1MOLA 4BTYA 1ASKA 2CK3H 4XBTA 2IUJA 4EBGA 1UUVB 3I0YA 1GD3A 5FGOA 3OWYA 1NB3I 3HI7A 5DRVA 1AR0A 5STDA 3WA3A 3CCQ3 1EKMA 1W01A 3B7CA 3G8ZA 1A2VA 4WYKA 2CH9A 5TGNA 1GY5A 4N6OB 3B4PA 1HU9A 2OWPA 1YIT3 3KZTA 2CWVA 2IUKA 3OWUA 2BNGA 5AI1A 2FGTA 4X2OA 1O7HB 1YJW3 1M1XB 2D42A 1W6YA 1K8A4 1JN5B 3FSDA 2XSOB 3SVAA 4IPBA 1SPUA 3BNBA 5D82A 1JKGB 1QJGA 1A2KA 4IIAA 3K5TA 3GWRA 1Q40B 1JKGA 1K41A 1OUNA 1Q40A 3FLJA 1ULJB 4LZIA 4O2HA 2IMJA 1E3RA 1VQO3 3DM8A 3NM7A 3UNLA 4Q53A 3MG3A 1RN7A 1UI7A 2F86B 3LT8A 1KSIA 1JJ22 2P0MA 1K28A 2Z7AA 1A90A 3HIIA 1CYUA 1LXEA 2IA7A 2XF3A 2A15A 4BTXA 3EX9A 4HM7B 2W2CA 4ZM8A 3EF8A 3EBYA 4AEQA 3QK9A 1ROVA 1NDOB 1N8R4 3HIGA 4MMXB 1DVDA 4FCMA 3MWZA 2WO0A 7STDA 1ZX2A 4L7KA 3CC23 3WA2X 1WQLB 1L5GB 5IG0A 3NX0A 3OXAA 3EE1A 1NU3A 4ORLA 4RNYA 1TIJA 3SOAA 2OTL3 1CQSA 2QEX3 2P09A 2XEPA 2ML6A 3VSYA 1OH0A 3T0UA 2C11A 2CFKA 2P05A 1O7GB 4WP5A 1KD14 1STDA 1WMPA 3MKIA 5IERA 1D6ZA 1SQWA 1VQ53 1O7PB 2XFSA 2Z77A 5IEOA 1N9EA 1KWIA 4HM5B 1F8NA 3DXOA 3FG4A 2OOVA 2XFTA 2OTJ3 1Q824 1OF5B 1SIIA 2YFLB 5D83A 4N6UA 1WMOA 4HM0B 3UJMA 3WMDA 1OF5A 4XB5A 3CPOA 3LTAA 3GZXB 4FMCA 1DYUA 2HMOB 3L0RA 3U97A 2BMOB 1DMMA 1TUHA 3EN1B 4J8TA 2ZL8A 1O7WB 2Y73A 4AKYA 3F40A 5BXQA 2E2TA 3AMOB 2PZVA 3M8CA 1G96A 4XBXA 3V99A 2CG1A 3AMOA 3U1WA 3IMAB 3F9SA 3KIIA 1AVLA 1V74A 3FG3A 1FA3A 1D6YA 2Q07A 3BNCA 2CFDA 3K7CA 3LTCA 4BTWA 3E99A 5JPUA 1W2B2 4I4KA 1TP6A 4K61A 1O7NB 3LYGA 3JUQA 3PCRA 5DREA 1PU4A 5IW9A 2XR8B 1OPYA 2XGLA 2L4VA 3QRDA 4KVHA 5CK6A 1DMQA 3SEDA 2XSHB 4FR9A 2RFRA 4HM1B 3DZLA 4FCJA 1WTHA 3ALAA 1NB5I 2SBLA 3EBTA 4EXRA 1ZO2A 5IG4A 3SXXA 1TFOA 3GZYB 1CEWI 1STFI 3D3LA 3G4S3 3G0KA 2O3OA 4NREA 5HGRA 3ECFA 3OX9A 4O8SA 4KFFA 4AKZA 1IT8A 3FF2A 4RZMA 3NXJA 4FMBA 5EEOA 4WYKB 3BLZA 1IQYA 2W04A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RGR A;  4LEH A;  3MSO A;  3SOY A;  2QGU A;  4WWU C;  1VZZ A;  1Z1S A;  1GYB A;  4CDL A;  2GEY A;  1GY6 A;  4R9K A;  1OGX A;  1DMN A;  3MYT A;  2B24 B;  1NWW A;  5IEN A;  2CKF B;  2RCD A;  5AIG A;  2STD A;  3JUP A;  3CNX A;  1GY7 A;  1BUQ A;  3EJV A;  4HM4 B;  3RGA A;  4N3V A;  4OUQ A;  4XM4 A;  2GBX B;  1OHO A;  2HMK B;  2Z76 A;  3GRD A;  3H51 A;  1JB4 A;  2INX A;  1JB2 A;  3F8X A;  1Q42 A;  5AEW B;  5EVH A;  3KE7 A;  3NV0 A;  5IG5 A;  3VGN A;  3Q90 A;  3EHC A;  5KP1 A;  3DUK A;  2GXF A;  3HX8 A;  2RGQ A;  3KKG A;  2K54 A;  1IDP A;  3T8U A;  3MHE A;  2JQ5 A;  3FKA A;  3MG2 A;  1OHS A;  3HZP A;  4XDW A;  1E97 A;  1ISK A;  3K0Z A;  2HMM B;  2GBW B;  2B1X B;  4HM6 B;  3LZA A;  2F98 A;  4R1K A;  1ULI B;  6STD A;  3GZR A;  5KP4 A;  4MJD A;  3B8L A;  3FH1 A;  1OHP A;  5AIH A;  1OCV A;  3OWS A;  3ROB A;  2BMQ B;  5AEU B;  2F99 A;  3HK4 A;  3IPT A;  4STD A;  3JUM A;  1SJW A;  3F8H A;  1GS3 A;  2YFJ B;  3JUO A;  4HZB B;  5JPP A;  3FF0 A;  1S5A A;  4PEJ A;  3NBR A;  4HM3 B;  5AII A;  4K1V A;  1OGZ A;  3GZB A;  2HMJ B;  1JN5 A;  5FW5 A;  4L8P A;  4K1U A;  1W02 A;  3G16 A;  4XBY A;  5BVB A;  4GB5 A;  3D9R A;  3KSP A;  3F7S A;  1E3V A;  1HKX A;  4HKV B;  2BMR B;  5KP3 A;  5AIF A;  3NHX A;  3H3H A;  1U5O A;  2I9W A;  3JUN A;  5D81 A;  2UX0 A;  3NV0 B;  3EC9 A;  4HM2 B;  3FGY A;  3CNM A;  1JB5 A;  5CLK A;  4L8O A;  5G2G A;  3BB9 A;  4XDV A;  3F14 A;  5CF2 A;  4HJL B;  8CHO A;  4HZ9 B;  4LMI A;  2HML B;  4H3U A;  2CHC A;  3EQQ B;  5IG3 A;  1QMA A;  2XRX B;  3DMC A;  4LGQ A;  1UUW B;  3B4O A;  3F7X A;  5CF1 A;  4HM8 B;  4U13 A;  3FZW A;  4J9A A;  2YFI B;  3NUV A;  2HMN B;  2R4I A;  4OVM A;  3EN8 A;  5IF6 A;  2GEX A;  4HVN A;  1O7M B;  3OV4 A;  3T8N A;  3NM2 A;  1C7H A;  5CXO A;  1EG9 B;  3A76 A;  4X2H A;  3STD A;  3S5C A;  5IEP A;  3ER7 A;  3CU3 A;  2QIY A;  3MG1 A;  1EA2 A;  1W00 A;  4R9L A;  1ASK A;  4XBT A;  1UUV B;  3I0Y A;  3OWY A;  5DRV A;  1AR0 A;  5STD A;  1W01 A;  3B7C A;  3G8Z A;  4WYK A;  5TGN A;  1GY5 A;  3B4P A;  2OWP A;  3KZT A;  3OWU A;  2BNG A;  5AI1 A;  4X2O A;  1O7H B;  1W6Y A;  1JN5 B;  3FSD A;  2XSO B;  5D82 A;  1JKG B;  1QJG A;  1A2K A;  4IIA A;  3GWR A;  1Q40 B;  1JKG A;  1K41 A;  1OUN A;  1Q40 A;  3FLJ A;  1ULJ B;  2IMJ A;  1E3R A;  3DM8 A;  3UNL A;  4Q53 A;  3MG3 A;  2F86 B;  2Z7A A;  2A15 A;  3EX9 A;  4HM7 B;  2W2C A;  3EF8 A;  3EBY A;  1NDO B;  4FCM A;  7STD A;  1ZX2 A;  4L7K A;  1WQL B;  5IG0 A;  3OXA A;  1NU3 A;  4ORL A;  3SOA A;  1CQS A;  3VSY A;  1OH0 A;  1O7G B;  4WP5 A;  1STD A;  3MKI A;  5IER A;  1O7P B;  2Z77 A;  5IEO A;  4HM5 B;  3DXO A;  1OF5 B;  2YFL B;  5D83 A;  3UJM A;  4HM0 B;  3WMD A;  1OF5 A;  4XB5 A;  3CPO A;  3GZX B;  2HMO B;  2BMO B;  1DMM A;  1TUH A;  3EN1 B;  4J8T A;  1O7W B;  3F40 A;  5BXQ A;  2PZV A;  3M8C A;  4XBX A;  3F9S A;  3K7C A;  3E99 A;  5JPU A;  4I4K A;  1TP6 A;  1O7N B;  3LYG A;  3JUQ A;  5DRE A;  2XR8 B;  1OPY A;  4KVH A;  5CK6 A;  1DMQ A;  3SED A;  2XSH B;  2RFR A;  4HM1 B;  3DZL A;  4FCJ A;  3EBT A;  1ZO2 A;  5IG4 A;  3GZY B;  3G0K A;  5HGR A;  3ECF A;  3OX9 A;  3FF2 A;  4RZM A;  3NXJ A;  4WYK B;  3BLZ A; 
#chains in the Genus database with same CATH topology
 1UW1 A;  3RGR A;  1WNH A;  3ZG0 A;  4LEH A;  4CPK A;  2MF7 A;  2UUG C;  2F5M A;  3MSO A;  3FCS B;  1T2I A;  3SOY A;  1IQX A;  2QGU A;  4KZ1 A;  1QAL A;  4WWU C;  1VZZ A;  1Z1S A;  1BRS A;  1BU4 A;  1JNQ A;  3WOD G;  1YHQ 3;  1B2M A;  2CWT A;  1B21 A;  4N6N B;  1GYB A;  1EEJ A;  4CDL A;  2YX9 A;  1VQM 3;  1TTO A;  3CCR 3;  1RGC A;  4LSO A;  2IYJ A;  3DGN A;  1Q9E A;  2GEY A;  1W4N A;  1GY6 A;  1C54 A;  4R9K A;  3ZFZ A;  1OGX A;  1I70 A;  3LT9 A;  1DMN A;  3MYT A;  2B24 B;  4N6T A;  3S28 A;  1IQ8 A;  2W9P A;  1NWW A;  5IEN A;  3S27 A;  4FMD A;  1IT7 A;  2CKF B;  5G1K A;  2RCD A;  4CCV A;  1R4C A;  5AIG A;  2STD A;  1B2X A;  2BHM A;  3WOE B;  3JUP A;  1US1 A;  3KFQ C;  4N6V 0;  4R80 A;  1TJD A;  1JBS A;  1AV4 A;  3CNX A;  1VQP 3;  1GY7 A;  3DGL A;  1IVW A;  3CXC 2;  2L1S A;  3EJV A;  1UCK A;  3N9H A;  1GD4 A;  1BUQ A;  1JV2 B;  1R4Y A;  2LYX A;  1RRH A;  1X1U A;  1IU7 A;  1NNV A;  1QAK A;  4HM4 B;  3CCV 3;  3VF1 A;  1AY7 A;  1QAF A;  2PNC A;  3AHW A;  5LC6 A;  1I0V A;  3RGA A;  1B2Z A;  1YVB I;  2CW9 A;  3SLU A;  4HYZ A;  2MC8 A;  1A67 A;  2BT3 A;  2K3D A;  2CFW A;  4N3V A;  5BU4 A;  1FW7 A;  3BIR A;  1M1K 4;  2LQV A;  1RGG A;  4OUQ A;  2OQE C;  4XM4 A;  2GBX B;  2W0Q A;  3K63 A;  3LML A;  1OHO A;  3N8B A;  1IK3 A;  2HMK B;  2CG0 A;  2Z76 A;  3GRD A;  3H51 A;  1JB4 A;  3N54 B;  4JRF A;  2O9U X;  2INX A;  1CYV A;  3SYU A;  1JB2 A;  3F8X A;  1N5H A;  1YIJ 3;  3RNT A;  1Q42 A;  5AEW B;  4EC6 A;  4NHF A;  5EVH A;  1DE3 A;  3DY5 A;  3NQY A;  3KE7 A;  3NV0 A;  5IG5 A;  3VGN A;  4JF8 A;  3Q90 A;  3EHC A;  4GL6 A;  2CFL A;  3EB8 A;  1RJO A;  3DUK A;  1MWT A;  4R4K A;  5KP1 A;  3CCM 3;  2KF3 A;  3CPW 2;  1SIH A;  2GXF A;  3HX8 A;  2D1W A;  1PY3 A;  2RGQ A;  5LC7 A;  3KKG A;  2K54 A;  3KN4 A;  1LOY A;  1IDP A;  1I3I A;  3LOY A;  1BIR A;  3HOH A;  1BSB A;  3T8U A;  3MHE A;  2JQ5 A;  2WOF A;  1BRJ A;  3FKA A;  1YJ9 3;  1NJI 4;  4G1M B;  1UGI A;  3MG2 A;  1OHS A;  1Q81 4;  3HZP A;  4RNT A;  4O02 B;  4KFD A;  8RNT A;  4XDW A;  1E97 A;  1Q86 4;  1BNG A;  3SX1 A;  2P38 A;  4MEI A;  1B27 A;  1B2U A;  1BNR A;  1S72 3;  1ISK A;  1IV7 A;  2CX1 A;  4K90 B;  3X3Y A;  1GMP A;  1YNV X;  3X41 A;  3K0Z A;  2HMM B;  3AGO A;  1AQZ A;  2GBW B;  1LNH A;  2B1X B;  1FUS A;  1UI8 A;  1AVK A;  4HM6 B;  5ELU A;  3LZA A;  2E2U A;  2P0X A;  3CCJ 3;  1FGO A;  3UL5 A;  1VQ8 3;  4KFE A;  1Q7Y 4;  4IT7 A;  2F98 A;  4R1K A;  3UL6 A;  1ULI B;  2ML5 A;  5EQL A;  1TFK A;  6STD A;  3I56 3;  4FCZ A;  3GZR A;  5KP4 A;  4MJD A;  1T3B A;  1LOV A;  4J5G A;  3B8L A;  3FH1 A;  5BIR A;  4MMY B;  1W2Z A;  1OHP A;  2W6J H;  4KT3 B;  5AIH A;  3V98 A;  1QVF 2;  3CD6 3;  1IVX A;  2H0I A;  3UB1 A;  2SAR A;  2WOH A;  1DVC A;  2AAE A;  4WHA A;  1W6C A;  1OCV A;  1VQN 3;  3OWS A;  3PYJ A;  3ROB A;  3Q2P A;  1VQ9 3;  2BMQ B;  2W9Q A;  2JDI H;  3LXU X;  5AYR B;  2KXG A;  1RGL A;  5AEU B;  3CME 3;  2BIR A;  4ILF A;  2F99 A;  1K73 4;  3D4A A;  3D5I A;  1I2F A;  4TX4 A;  1NO3 A;  1KC8 4;  3BNE A;  3S67 A;  1Y4K A;  3MPH A;  3OW2 2;  2Y74 A;  3X42 A;  5JBS A;  3HK4 A;  1G02 A;  3PS8 A;  1FGQ A;  3IPT A;  4STD A;  1LVN A;  2F56 A;  3JUM A;  3JVC A;  5I97 A;  3G6E 3;  1RRL A;  4FMA A;  1KQS 2;  3CCU 3;  4QWT A;  1M9G A;  1MGR A;  3WDG B;  1SJW A;  1BRH A;  3F8H A;  1GS3 A;  1IVV A;  1RKY A;  1T5Y A;  2ZDJ A;  2YFJ B;  3JUO A;  3RDE A;  1J2B A;  4HZB B;  1YVS A;  1I2E A;  1ZS7 A;  1Q7H A;  3NBB A;  5JPP A;  1VQ6 3;  3FF0 A;  1FUW A;  1S5A A;  1WMN A;  3NBR A;  4PEJ A;  2R41 A;  4HM3 B;  3AHS A;  5AII A;  2KAA A;  4K1V A;  1OGZ A;  3GZB A;  2HMJ B;  1JN5 A;  2OQE A;  4BIR A;  1VQ4 3;  5FW5 A;  1UDI I;  1GMQ A;  2CFG A;  3AGN A;  2M7O A;  1HZ1 A;  2E2V A;  3DGY A;  4L8P A;  3S29 A;  3J7Y d;  4K1U A;  1W02 A;  1YGW A;  3G16 A;  3GAX A;  4XBY A;  1JZO A;  5BVB A;  4GB5 A;  1BRK A;  4EV5 A;  2QA4 3;  4CJN A;  1MWU A;  4OK0 A;  5GSP A;  1EQK A;  3D9R A;  3KSP A;  3F7S A;  3PXM A;  3CMA 3;  1E3V A;  4H61 A;  1RSN A;  1HKX A;  1W5Z A;  4HKV B;  1I2G A;  2BMR B;  3NBJ A;  5KP3 A;  1BAN A;  1DET A;  1TU5 A;  1T2H A;  2C10 A;  3PCS A;  3NHX A;  3H3H A;  5AIF A;  3WR2 A;  1M90 4;  4RBN A;  1U5O A;  5AYS C;  2V1L A;  2I9W A;  1YI2 3;  3JUN A;  2J8X B;  5D81 A;  1PFP A;  2FXT A;  1N9J A;  2UX0 A;  3NV0 B;  4RNZ A;  3EC9 A;  1RN1 A;  1BSC A;  5A0O B;  1UGH I;  1RCK A;  4HBR A;  4EYC A;  1IYY A;  4HM2 B;  3FGY A;  4O3V A;  3CNM A;  1JB5 A;  4LYL B;  3PGB A;  1N8Q A;  3DGO A;  4L8O A;  5CLK A;  3CCL 3;  1UCJ A;  1RGF A;  1BNS A;  1X1X A;  5G2G A;  3X3X A;  3BB9 A;  1D6U A;  4XDV A;  2F4Y A;  2KCD A;  3F14 A;  5CF2 A;  4HOH A;  3KSE D;  3NQZ A;  2RNT A;  5M18 A;  1QVG 2;  3CC4 3;  6RNT A;  2CC3 A;  3BND A;  4HJL B;  3LTD A;  3BLZ A;  8CHO A;  4HZ9 B;  1VQK 3;  2HOH A;  4LMI A;  3WOF B;  1JBT A;  3X40 A;  2HML B;  2FNQ A;  2W03 A;  1W6G A;  4N6M A;  2RSX A;  4H3U A;  2CHC A;  3EQQ B;  3CC7 3;  1FGM A;  3CCE 3;  5IG3 A;  1LOX A;  1RNT A;  1QMA A;  1VQL 3;  2XRX B;  2CX0 A;  1GOY A;  2XH9 A;  3IJE B;  3KCH A;  7RNT A;  3DMC A;  4LGQ A;  1UUW B;  3G71 3;  2CIU A;  3B4O A;  2K0M A;  4MMZ B;  4EW5 A;  1YJN 3;  1I8V A;  1HYF A;  3F7X A;  5CF1 A;  6GSP A;  1K9M 4;  1RLS A;  3I55 3;  3LH4 A;  1VQ7 3;  4HM8 B;  2XGN A;  2OCT A;  4U13 A;  1RNB A;  3TDG A;  3FZW A;  4J9A A;  2YFI B;  3NUV A;  2HMN B;  1RN4 A;  2OOV C;  4EV2 A;  2R4I A;  3Q1C A;  4OVM A;  1OAC A;  3EN8 A;  5IF6 A;  1FGT A;  2GEX A;  4HVN A;  1O7M B;  5ELJ A;  1JRQ A;  3OV4 A;  1IV9 A;  1FYS A;  1FGR A;  2WGQ A;  3T8N A;  3NM2 A;  2CWU A;  2W56 B;  1UCI A;  3PZW A;  1C7H A;  2GU1 A;  2WGO A;  5CXO A;  2Z6B A;  1ROA A;  1EG9 B;  3A76 A;  2W56 A;  1LRA A;  1N5P A;  2ZHX B;  4X2H A;  3STD A;  3V92 A;  3S5C A;  5IEP A;  3X3Z A;  4N6L A;  2GU3 A;  1GMR A;  1SAR A;  3ER7 A;  1BNF A;  1YGE A;  4GSP A;  1W7C A;  3DGM A;  3CU3 A;  3FG1 A;  2QIY A;  3K9M C;  1U8C B;  1B2S A;  3MG1 A;  1IVU A;  1EA2 A;  1RMS A;  2KRT A;  1ZGX A;  1W00 A;  1MNL A;  3O8Y A;  3LTB A;  1LQG C;  4R9L A;  2W04 A;  1X1Y A;  5HOH A;  2BO9 B;  3CCS 3;  4WFO A;  1MOL A;  4BTY A;  1ASK A;  2CK3 H;  4XBT A;  1GSP A;  1A2P A;  1BGS A;  2IUJ A;  1BNJ A;  4EBG A;  1UUV B;  3I0Y A;  1GD3 A;  5FGO A;  3OWY A;  1NB3 I;  3HI7 A;  5DRV A;  2GSP A;  9RNT A;  1AR0 A;  5STD A;  3A5E A;  3WA3 A;  3CCQ 3;  1EKM A;  1W01 A;  3B7C A;  3G8Z A;  1A2V A;  4WYK A;  1RDS A;  1RTU A;  2CH9 A;  5TGN A;  1GY5 A;  4N6O B;  3B4P A;  1HU9 A;  2OWP A;  1YIT 3;  3KZT A;  4NPB A;  2CWV A;  2IUK A;  3OWU A;  2BNG A;  5AI1 A;  2FGT A;  4X2O A;  1O7H B;  1YJW 3;  1M1X B;  2D42 A;  1W6Y A;  5M1A A;  1K8A 4;  1JN5 B;  3D5G A;  3FSD A;  2XSO B;  3SVA A;  4IPB A;  1SPU A;  3ZG5 A;  3BNB A;  5D82 A;  1JKG B;  1QJG A;  1A2K A;  4IIA A;  3K5T A;  1BOX A;  3GWR A;  1BRN L;  1Q40 B;  2UGI A;  1JKG A;  1K41 A;  1V57 A;  1OUN A;  1Q40 A;  1JZD A;  1RGK A;  3FLJ A;  4GHO A;  1ULJ B;  4LZI A;  4O2H A;  1LNI A;  2KF4 A;  2IMJ A;  4BL3 A;  1E3R A;  1VQO 3;  3DM8 A;  3NM7 A;  3UNL A;  4BU4 A;  4Q53 A;  3MG3 A;  1RN7 A;  1UI7 A;  1BUJ A;  2F86 B;  3LT8 A;  1KSI A;  1JJ2 2;  2P0M A;  1EUI C;  1K28 A;  2Z7A A;  1A90 A;  1B20 A;  3HII A;  1CYU A;  2RBI A;  1LXE A;  2IA7 A;  2XF3 A;  2A15 A;  4BTX A;  3EX9 A;  4HM7 B;  2W2C A;  4ZM8 A;  3EF8 A;  3EBY A;  4AEQ A;  1FUT A;  1B3S A;  3QK9 A;  1RGA A;  1BRI A;  1ROV A;  1NDO B;  1N8R 4;  3HIG A;  1BNI A;  2BU4 A;  4FCM A;  4MMX B;  1DVD A;  3MWZ A;  2WO0 A;  1PYL A;  7STD A;  1LQM B;  1GOU A;  1ZX2 A;  4L7K A;  3CC2 3;  3WA2 X;  1WQL B;  1L5G B;  5IG0 A;  3NX0 A;  3OXA A;  3EE1 A;  1NU3 A;  4ORL A;  2H0G A;  4RNY A;  1TIJ A;  2IY2 A;  3DH2 A;  3SOA A;  2OTL 3;  1CQS A;  2QEX 3;  2P09 A;  1UUG B;  2XEP A;  2ML6 A;  3VSY A;  1OH0 A;  3T0U A;  2C11 A;  2CFK A;  1MWR A;  2P05 A;  1X1W A;  1O7G B;  4WP5 A;  1KD1 4;  1MGW A;  1STD A;  1BNE A;  1WMP A;  3MKI A;  5IER A;  1TRP A;  1D6Z A;  1SQW A;  1VQ5 3;  1O7P B;  2XFS A;  2KF6 A;  2Z77 A;  5G1L A;  1N9E A;  1RHL A;  1KWI A;  4HM5 B;  5IEO A;  1F8N A;  1BAO A;  3DXO A;  3FG4 A;  1RGH A;  2XFT A;  2OOV A;  1UCL A;  1Q82 4;  2OTJ 3;  1OF5 B;  1SII A;  2YFL B;  5D83 A;  4N6U A;  1WMO A;  4HM0 B;  3UJM A;  3WHO A;  1OF5 A;  4XB5 A;  3WMD A;  1TRQ A;  1BSA A;  3CPO A;  3LTA A;  1FZU A;  3GZX B;  4FMC A;  1DYU A;  2HMO B;  3L0R A;  1V58 A;  3U97 A;  2BMO B;  1DMM A;  1TUH A;  3EN1 B;  1BSE A;  4J8T A;  2ZL8 A;  1O7W B;  2Y73 A;  4DKI A;  4AKY A;  3F40 A;  5BXQ A;  2E2T A;  3AMO B;  1RCL A;  2PZV A;  3M8C A;  1G96 A;  4XBX A;  3V99 A;  2CG1 A;  3AMO A;  3U1W A;  2AAD A;  3IMA B;  4I5Q A;  4BL2 A;  3F9S A;  3GSP A;  3KII A;  1AVL A;  1V74 A;  3FG3 A;  1FA3 A;  1D6Y A;  2Q07 A;  3BNC A;  2CFD A;  3K7C A;  1VQQ A;  3LTC A;  3E99 A;  4BTW A;  5JPU A;  1W2B 2;  4I4K A;  1TP6 A;  1BRG A;  3D79 A;  4K61 A;  1BVI A;  1O7N B;  3LYG A;  3JUQ A;  3PCR A;  5DRE A;  7GSP A;  1PU4 A;  1MWS A;  2XR8 B;  5IW9 A;  1OPY A;  2XGL A;  2L4V A;  3QRD A;  2C4B A;  4KVH A;  1JBR A;  4HAA A;  5CK6 A;  1DMQ A;  1I3F A;  3SED A;  2XSH B;  5M19 A;  4FR9 A;  2RFR A;  4HM1 B;  3DZL A;  1GOV A;  4FCJ A;  2ZA4 A;  1WTH A;  3ALA A;  1NB5 I;  1I0X A;  2SBL A;  1LOW A;  3EBT A;  4EXR A;  1G0T A;  1RGE A;  1ZO2 A;  5IG4 A;  3SXX A;  1TFO A;  2KF5 A;  3GZY B;  1CEW I;  1STF I;  3D3L A;  3G4S 3;  3G0K A;  2O3O A;  3BU4 A;  4NRE A;  5HGR A;  2F5W A;  3ECF A;  3OX9 A;  4O8S A;  4KFF A;  4AKZ A;  5RNT A;  4J5K A;  1IT8 A;  3FF2 A;  4RZM A;  1BSD A;  3NXJ A;  4FMB A;  5EEO A;  3Q3F A;  4WYK B;  3URP A;  1CH0 A;  1IQY A;  2H0H A; 
#chains in the Genus database with same CATH homology
 1UW1 A;  3RGR A;  1WNH A;  4LEH A;  2MF7 A;  3MSO A;  3FCS B;  3SOY A;  1IQX A;  2QGU A;  4KZ1 A;  1QAL A;  4WWU C;  1VZZ A;  1Z1S A;  1JNQ A;  3WOD G;  1YHQ 3;  2CWT A;  4N6N B;  1VQM 3;  1GYB A;  4CDL A;  2YX9 A;  3CCR 3;  4LSO A;  3DGN A;  2GEY A;  1W4N A;  1GY6 A;  4R9K A;  1OGX A;  3LT9 A;  1DMN A;  3MYT A;  2B24 B;  4N6T A;  3S28 A;  1IQ8 A;  2W9P A;  1NWW A;  5IEN A;  3S27 A;  4FMD A;  1IT7 A;  2CKF B;  2RCD A;  4CCV A;  1R4C A;  5AIG A;  2STD A;  2BHM A;  3WOE B;  3JUP A;  1US1 A;  3KFQ C;  4N6V 0;  4R80 A;  1AV4 A;  3CNX A;  1VQP 3;  1GY7 A;  3DGL A;  1IVW A;  3CXC 2;  1BUQ A;  3EJV A;  3N9H A;  1GD4 A;  1JV2 B;  2LYX A;  1RRH A;  1IU7 A;  4HM4 B;  1QAK A;  3CCV 3;  3VF1 A;  1QAF A;  2PNC A;  5LC6 A;  3RGA A;  1YVB I;  2CW9 A;  3SLU A;  4HYZ A;  2MC8 A;  1A67 A;  2BT3 A;  2CFW A;  4N3V A;  1M1K 4;  2LQV A;  4OUQ A;  4XM4 A;  2OQE C;  2GBX B;  2W0Q A;  3K63 A;  3LML A;  1OHO A;  3N8B A;  1IK3 A;  2HMK B;  2CG0 A;  2Z76 A;  3GRD A;  3H51 A;  1JB4 A;  3N54 B;  4JRF A;  2O9U X;  2INX A;  1CYV A;  1JB2 A;  3F8X A;  1N5H A;  1YIJ 3;  1Q42 A;  5AEW B;  4EC6 A;  4NHF A;  5EVH A;  3DY5 A;  3NQY A;  3KE7 A;  3NV0 A;  5IG5 A;  3VGN A;  4JF8 A;  3Q90 A;  3EHC A;  4GL6 A;  2CFL A;  3EB8 A;  1RJO A;  3DUK A;  4R4K A;  5KP1 A;  3CCM 3;  3CPW 2;  1SIH A;  2GXF A;  3HX8 A;  2D1W A;  2RGQ A;  5LC7 A;  3KKG A;  2K54 A;  3KN4 A;  1IDP A;  3LOY A;  3T8U A;  3MHE A;  2JQ5 A;  2WOF A;  3FKA A;  1YJ9 3;  1NJI 4;  4G1M B;  3MG2 A;  1OHS A;  1Q81 4;  3HZP A;  4O02 B;  4KFD A;  4XDW A;  1E97 A;  1Q86 4;  3SX1 A;  2P38 A;  4MEI A;  1S72 3;  1ISK A;  1IV7 A;  4K90 B;  3X3Y A;  3X41 A;  3K0Z A;  2HMM B;  2GBW B;  1LNH A;  2B1X B;  1UI8 A;  1AVK A;  4HM6 B;  5ELU A;  3LZA A;  2E2U A;  2P0X A;  3CCJ 3;  1FGO A;  3UL5 A;  1VQ8 3;  4KFE A;  1Q7Y 4;  4IT7 A;  2F98 A;  4R1K A;  3UL6 A;  1ULI B;  2ML5 A;  5EQL A;  1TFK A;  6STD A;  3I56 3;  4FCZ A;  3GZR A;  5KP4 A;  4MJD A;  3B8L A;  3FH1 A;  1QVF 2;  4MMY B;  1W2Z A;  1OHP A;  2W6J H;  5AIH A;  3V98 A;  3CD6 3;  1IVX A;  3UB1 A;  4WHA A;  2WOH A;  1DVC A;  1W6C A;  1OCV A;  1VQN 3;  3OWS A;  3PYJ A;  3ROB A;  3Q2P A;  1VQ9 3;  2BMQ B;  2W9Q A;  2JDI H;  3LXU X;  5AYR B;  2KXG A;  5AEU B;  3CME 3;  2F99 A;  1K73 4;  4TX4 A;  1NO3 A;  1KC8 4;  3BNE A;  3S67 A;  1Y4K A;  3MPH A;  3OW2 2;  2Y74 A;  3X42 A;  5JBS A;  3HK4 A;  3PS8 A;  1FGQ A;  3IPT A;  4STD A;  1LVN A;  3JUM A;  3JVC A;  5I97 A;  3G6E 3;  1RRL A;  4FMA A;  1KQS 2;  3CCU 3;  4QWT A;  1M9G A;  3WDG B;  1SJW A;  3F8H A;  1GS3 A;  1IVV A;  1RKY A;  2ZDJ A;  1T5Y A;  2YFJ B;  3JUO A;  3RDE A;  1J2B A;  4HZB B;  3NBB A;  5JPP A;  1VQ6 3;  3FF0 A;  1FUW A;  1S5A A;  1WMN A;  3NBR A;  4PEJ A;  4HM3 B;  5AII A;  4K1V A;  1OGZ A;  3GZB A;  2HMJ B;  1JN5 A;  2OQE A;  1VQ4 3;  5FW5 A;  2CFG A;  2M7O A;  2E2V A;  4L8P A;  3S29 A;  3J7Y d;  4K1U A;  1W02 A;  3G16 A;  3GAX A;  4XBY A;  5BVB A;  4GB5 A;  4EV5 A;  2QA4 3;  1EQK A;  4OK0 A;  3D9R A;  3KSP A;  3F7S A;  3PXM A;  3CMA 3;  1E3V A;  4H61 A;  1HKX A;  1W5Z A;  4HKV B;  2BMR B;  5KP3 A;  3NBJ A;  1TU5 A;  2C10 A;  3PCS A;  3NHX A;  3H3H A;  5AIF A;  1M90 4;  4RBN A;  1U5O A;  5AYS C;  2V1L A;  2I9W A;  1YI2 3;  3JUN A;  5D81 A;  1PFP A;  2FXT A;  1N9J A;  2UX0 A;  3NV0 B;  4RNZ A;  3EC9 A;  5A0O B;  4HBR A;  4EYC A;  4HM2 B;  3FGY A;  4O3V A;  3CNM A;  1JB5 A;  3PGB A;  1N8Q A;  3DGO A;  4L8O A;  5CLK A;  3CCL 3;  5G2G A;  3X3X A;  3BB9 A;  1D6U A;  4XDV A;  2KCD A;  3F14 A;  5CF2 A;  3KSE D;  3NQZ A;  3CC4 3;  1QVG 2;  2CC3 A;  3BND A;  4HJL B;  3LTD A;  8CHO A;  4HZ9 B;  1VQK 3;  4LMI A;  3WOF B;  3X40 A;  2HML B;  2FNQ A;  2W03 A;  1W6G A;  4N6M A;  2RSX A;  4H3U A;  2CHC A;  3EQQ B;  3CC7 3;  1FGM A;  3CCE 3;  5IG3 A;  1LOX A;  1QMA A;  1VQL 3;  2XRX B;  2XH9 A;  3IJE B;  3DMC A;  4LGQ A;  1UUW B;  3G71 3;  2CIU A;  3B4O A;  2K0M A;  4MMZ B;  1YJN 3;  3F7X A;  5CF1 A;  1K9M 4;  3I55 3;  3LH4 A;  1VQ7 3;  4HM8 B;  2XGN A;  2OCT A;  4U13 A;  3TDG A;  3FZW A;  4J9A A;  2YFI B;  3NUV A;  2HMN B;  2OOV C;  4EV2 A;  2R4I A;  3Q1C A;  4OVM A;  1OAC A;  3EN8 A;  5IF6 A;  1FGT A;  2GEX A;  4HVN A;  1O7M B;  5ELJ A;  1JRQ A;  3OV4 A;  1IV9 A;  1FGR A;  2WGQ A;  3T8N A;  3NM2 A;  2CWU A;  2W56 B;  3PZW A;  1C7H A;  2GU1 A;  2WGO A;  5CXO A;  2Z6B A;  1ROA A;  1EG9 B;  3A76 A;  2W56 A;  1N5P A;  3V92 A;  4X2H A;  3STD A;  3S5C A;  5IEP A;  3X3Z A;  4N6L A;  2GU3 A;  3ER7 A;  1YGE A;  1W7C A;  3DGM A;  3CU3 A;  3FG1 A;  2QIY A;  3K9M C;  1U8C B;  3MG1 A;  1IVU A;  1EA2 A;  2KRT A;  1W00 A;  1MNL A;  3O8Y A;  3LTB A;  4R9L A;  2BO9 B;  3CCS 3;  4WFO A;  1MOL A;  4BTY A;  1ASK A;  2CK3 H;  4XBT A;  2IUJ A;  4EBG A;  1UUV B;  3I0Y A;  1GD3 A;  5FGO A;  3OWY A;  1NB3 I;  3HI7 A;  5DRV A;  1AR0 A;  5STD A;  3WA3 A;  3CCQ 3;  1EKM A;  1W01 A;  3B7C A;  3G8Z A;  1A2V A;  4WYK A;  2CH9 A;  5TGN A;  1GY5 A;  4N6O B;  3B4P A;  1HU9 A;  2OWP A;  1YIT 3;  3KZT A;  2CWV A;  2IUK A;  3OWU A;  2BNG A;  5AI1 A;  2FGT A;  4X2O A;  1O7H B;  1YJW 3;  1M1X B;  2D42 A;  1W6Y A;  1K8A 4;  1JN5 B;  3FSD A;  2XSO B;  3SVA A;  4IPB A;  1SPU A;  3BNB A;  5D82 A;  1JKG B;  1QJG A;  1A2K A;  4IIA A;  3K5T A;  3GWR A;  1Q40 B;  1JKG A;  1K41 A;  1OUN A;  1Q40 A;  3FLJ A;  1ULJ B;  4LZI A;  4O2H A;  2IMJ A;  1E3R A;  1VQO 3;  3DM8 A;  3NM7 A;  3UNL A;  4Q53 A;  3MG3 A;  1RN7 A;  1UI7 A;  2F86 B;  3LT8 A;  1KSI A;  1JJ2 2;  2P0M A;  1K28 A;  2Z7A A;  1A90 A;  3HII A;  1CYU A;  1LXE A;  2IA7 A;  2XF3 A;  2A15 A;  4BTX A;  3EX9 A;  4HM7 B;  2W2C A;  4ZM8 A;  3EF8 A;  3EBY A;  4AEQ A;  3QK9 A;  1ROV A;  1NDO B;  1N8R 4;  3HIG A;  4MMX B;  1DVD A;  4FCM A;  3MWZ A;  2WO0 A;  7STD A;  1ZX2 A;  4L7K A;  3CC2 3;  3WA2 X;  1WQL B;  1L5G B;  5IG0 A;  3NX0 A;  3OXA A;  3EE1 A;  1NU3 A;  4ORL A;  4RNY A;  1TIJ A;  3SOA A;  2OTL 3;  1CQS A;  2QEX 3;  2P09 A;  2XEP A;  2ML6 A;  3VSY A;  1OH0 A;  3T0U A;  2C11 A;  2CFK A;  2P05 A;  1O7G B;  4WP5 A;  1KD1 4;  1STD A;  1WMP A;  3MKI A;  5IER A;  1D6Z A;  1SQW A;  1VQ5 3;  1O7P B;  2XFS A;  2Z77 A;  5IEO A;  1N9E A;  1KWI A;  4HM5 B;  1F8N A;  3DXO A;  3FG4 A;  2OOV A;  2XFT A;  2OTJ 3;  1Q82 4;  1OF5 B;  1SII A;  2YFL B;  5D83 A;  4N6U A;  1WMO A;  4HM0 B;  3UJM A;  3WMD A;  1OF5 A;  4XB5 A;  3CPO A;  3LTA A;  3GZX B;  4FMC A;  1DYU A;  2HMO B;  3L0R A;  3U97 A;  2BMO B;  1DMM A;  1TUH A;  3EN1 B;  4J8T A;  2ZL8 A;  1O7W B;  2Y73 A;  4AKY A;  3F40 A;  5BXQ A;  2E2T A;  3AMO B;  2PZV A;  3M8C A;  1G96 A;  4XBX A;  3V99 A;  2CG1 A;  3AMO A;  3U1W A;  3IMA B;  3F9S A;  3KII A;  1AVL A;  1V74 A;  3FG3 A;  1FA3 A;  1D6Y A;  2Q07 A;  3BNC A;  2CFD A;  3K7C A;  3LTC A;  4BTW A;  3E99 A;  5JPU A;  1W2B 2;  4I4K A;  1TP6 A;  4K61 A;  1O7N B;  3LYG A;  3JUQ A;  3PCR A;  5DRE A;  1PU4 A;  5IW9 A;  2XR8 B;  1OPY A;  2XGL A;  2L4V A;  3QRD A;  4KVH A;  5CK6 A;  1DMQ A;  3SED A;  2XSH B;  4FR9 A;  2RFR A;  4HM1 B;  3DZL A;  4FCJ A;  1WTH A;  3ALA A;  1NB5 I;  2SBL A;  3EBT A;  4EXR A;  1ZO2 A;  5IG4 A;  3SXX A;  1TFO A;  3GZY B;  1CEW I;  1STF I;  3D3L A;  3G4S 3;  3G0K A;  2O3O A;  4NRE A;  5HGR A;  3ECF A;  3OX9 A;  4O8S A;  4KFF A;  4AKZ A;  1IT8 A;  3FF2 A;  4RZM A;  3NXJ A;  4FMB A;  5EEO A;  4WYK B;  3BLZ A;  1IQY A;  2W04 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...