3EBTA

Crystal structure of a ntf2-like protein of unknown function (bpss0132) from burkholderia pseudomallei k96243 at 1.30 a resolution
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
131
structure length
131
Chain Sequence
MSNNMQTVRESYEAFHRRDLPGVLAALAPDVRWTHPDGMSPYGLGGTKHGHDEVIAFIRHVPTHIAEMRLAPDEFIESGERIVVLGTRRVTAVNGRSATLKFVHVWRFENGRAVTFEDHFDTAEMIRLITA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized NTF2-like protein
publication title Crystal structure of NTF2-like protein of unknown function (YP_110153.1) from BURKHOLDERIA PSEUDOMALLEI K96243 at 1.30 A resolution
rcsb
source organism Burkholderia pseudomallei k96243
molecule tags Unknown function
total genus 42
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2008-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ebtA00
4HZ9B 1UUWB 3CPOA 5D81A 2Z7AA 3BLZA 2CHCA 7STDA 1BUQA 1VZZA 3KE7A 1O7HB 2W2CA 5IG0A 3DXOA 1CQSA 3HX8A 1ULJB 3UNLA 5AIIA 1U5OA 2HMLB 4FCJA 3ECFA 3UJMA 4HVNA 1E97A 1A2KA 3G8ZA 2Z77A 4HM3B 5AI1A 3OXAA 4X2HA 1OHOA 4LMIA 5IEPA 3OWSA 2HMNB 4L8OA 2BMQB 3JUPA 2XSOB 4GB5A 3B7CA 3GZXB 2GEXA 3EN1B 4HJLB 5HGRA 5AIFA 5JPUA 5IENA 2XR8B 2GBXB 3Q90A 2HMJB 4R1KA 3EN8A 3JUOA 3VSYA 3CNXA 4WYKB 3H3HA 3EBTA 3FH1A 4ORLA 1AR0A 3EBYA 1K41A 1O7NB 3DMCA 5D83A 3F9SA 4N3VA 4WWUC 2CKFB 3K7CA 3FSDA 5BVBA 4HM2B 5IG3A 2YFJB 2F99A 1STDA 3G16A 4XDWA 2HMOB 4K1UA 3ER7A 2XSHB 3T8NA 4HKVB 3FGYA 3JUMA 4HM4B 1EG9B 4CDLA 5D82A 2Z76A 3VGNA 4L8PA 1ZX2A 3OX9A 2XRXB 5FW5A 3DZLA 3DUKA 3JUNA 3KZTA 6STDA 3JUQA 3E99A 3M8CA 3LYGA 3STDA 5CLKA 4WYKA 4H3UA 4MJDA 3F14A 1O7MB 2B1XB 2INXA 1DMMA 3G0KA 1C7HA 3EX9A 3OWYA 2UX0A 4XB5A 1NWWA 5IEOA 3IPTA 4R9LA 1O7WB 5AIHA 2BMOB 3SEDA 3RGRA 2RCDA 4X2OA 5IF6A 2R4IA 1GY6A 1OF5B 4HM1B 3B4PA 3H51A 1GS3A 1NU3A 3S5CA 3MHEA 4IIAA 3LZAA 2YFIB 3NBRA 5KP4A 4XBXA 1ISKA 1OGXA 8CHOA 4I4KA 5IERA 4WP5A 4J9AA 1E3VA 4PEJA 4RZMA 1OCVA 4HM5B 2RGQA 2HMMB 3MKIA 4OUQA 3BB9A 1DMNA 1Z1SA 3B4OA 1ULIB 1Q40B 2F98A 3SOYA 3OWUA 5KP3A 3NV0B 4LGQA 4STDA 3D9RA 5CK6A 5IG5A 2K54A 3GWRA 1IDPA 1OF5A 1DMQA 1OHPA 3GRDA 2F86B 3A76A 3EQQB 5KP1A 1OPYA 2BNGA 3EC9A 3FF0A 2GEYA 4HM6B 1SJWA 3GZBA 3GZYB 4XDVA 4FCMA 4HM8B 3CNMA 4HM0B 4L7KA 3HZPA 5IG4A 2IMJA 5JPPA 4K1VA 5AIGA 5CF2A 2QGUA 1QJGA 1S5AA 2YFLB 3KSPA 5DREA 1W00A 1JN5B 2I9WA 5AEWB 3EJVA 5STDA 1HKXA 5CF1A 1TP6A 5EVHA 4J8TA 5DRVA 3RGAA 2BMRB 3FLJA 3K0ZA 3DM8A 1Q40A 5CXOA 1OUNA 2PZVA 4HZBB 1UUVB 5AEUB 1JKGB 3NV0A 1OHSA 2HMKB 2JQ5A 3F7XA 3GZRA 1O7PB 3B8LA 5G2GA 3F7SA 2OWPA 1JB5A 3NHXA 1ASKA 2A15A 3FZWA 2B24B 1OH0A 3SOAA 1JB4A 3FF2A 3F8HA 3NUVA 1NDOB 3F8XA 2GBWB 1W02A 3NXJA 4XBTA 1TUHA 1GY5A 3EF8A 1JB2A 1JN5A 4XBYA 5BXQA 1EA2A 1W6YA 1QMAA 1GYBA 2QIYA 1W01A 3FKAA 3I0YA 3OV4A 2STDA 4KVHA 3EHCA 1GY7A 2RFRA 2GXFA 4HM7B 4OVMA 3MG1A 3WMDA 1OGZA 1JKGA 3MG3A 3NM2A 1E3RA 3KKGA 4Q53A 3MSOA 4U13A 1WQLB 3CU3A 3HK4A 4R9KA 5TGNA 3MYTA 4XM4A 1Q42A 3T8UA 1ZO2A 4LEHA 1O7GB 3ROBA 3F40A 3MG2A
chains in the Genus database with same CATH superfamily
4HZ9B 1UUWB 3CPOA 1Q9EA 5D81A 1DVCA 1VQ93 3LT8A 2Z7AA 4J5KA 1FUTA 1MWTA 2CFWA 3ZG0A 1GSPA 3WA2X 3WA3A 1IVUA 1YIT3 1BRSA 1UCLA 2D1WA 2F56A 1RGFA 2IY2A 2ZA4A 3CXC2 3CCE3 3BLZA 1W2B2 1K9M4 1A67A 2CHCA 1W6CA 7STDA 1NO3A 1DETA 1BUQA 1VZZA 3BNDA 4OK0A 2XGLA 2GU1A 1I0XA 3KE7A 1O7HB 1YI23 1GMQA 2W2CA 4CJNA 1A2VA 5IG0A 4LSOA 3DXOA 1CQSA 1RGKA 2BO9B 3HX8A 1N8R4 2CFGA 2Y73A 8RNTA 1Q814 1ULJB 1YNVX 4KZ1A 4EYCA 3UNLA 5AIIA 1U5OA 1GOVA 5M1AA 1KWIA 2CK3H 1W2ZA 2HMLB 1R4YA 3ECFA 4FCJA 3D5IA 1SPUA 3UJMA 3J7Yd 4HVNA 1Q7Y4 3AMOA 1AV4A 1BU4A 1E97A 1A2KA 1V58A 3G8ZA 1ROAA 2Z77A 1BNGA 2JDIH 4HM3B 1I2FA 4MEIA 4GSPA 6RNTA 5AI1A 1X1WA 4N6V0 3OXAA 4X2HA 1OHOA 4LMIA 4O8SA 4TX4A 5IEPA 3OWSA 1YGWA 1RKYA 1RDSA 2HMNB 2RNTA 4L8OA 1SQWA 1RN1A 2QEX3 2XF3A 4EXRA 1MWSA 5RNTA 1D6YA 3AHWA 1F8NA 1V57A 2BMQB 1AY7A 1NJI4 2BT3A 1AVKA 1SIHA 3JUPA 2XSOB 4GB5A 3B7CA 2KF3A 4WHAA 4BIRA 3V92A 1BRKA 2GEXA 3EN1B 3GZXB 4HJLB 5HGRA 1LOYA 5AIFA 5JPUA 1J2BA 6GSPA 5IENA 3HI7A 1T2HA 1FGMA 1WNHA 2XR8B 1IK3A 2GBXB 3Q90A 1T5YA 1Q864 2K0MA 3KCHA 2HMJB 1NNVA 3DGLA 3NBBA 4R1KA 1JV2B 2XH9A 1BNFA 2ZL8A 1QVG2 2R41A 3DGYA 4KT3B 3UL6A 3EN8A 3JUOA 3WDGB 1TFKA 1EUIC 4RNYA 1RRHA 5M19A 1KSIA 4IPBA 4K90B 1RNBA 3FG3A 1LNHA 3VSYA 3CNXA 2UGIA 4WYKB 3H3HA 4AKYA 3KFQC 3EBTA 3FH1A 4ORLA 2OOVA 1AR0A 2H0IA 3I553 1W5ZA 3EBYA 1RRLA 3S27A 5ELJA 1K41A 1O7NB 1TRQA 3DMCA 4FCZA 5D83A 4FMBA 3F9SA 4I5QA 2CH9A 1RCKA 1N8QA 1Q824 4N3VA 4WWUC 1RGCA 2CKFB 3K7CA 2FGTA 1WMOA 3FSDA 5BVBA 2P09A 1RGAA 1I2GA 2KF4A 4HM2B 5IG3A 3CCJ3 1JZOA 3WHOA 1B2ZA 2YFJB 1TJDA 1AQZA 3LMLA 2F99A 3FG1A 1VQ53 1RN4A 2BU4A 3LTDA 3D79A 1STDA 2CWUA 1RLSA 1RMSA 3G16A 3K5TA 1N5HA 3LOYA 4GL6A 3OW22 4XDWA 1KC84 1B2UA 2ZHXB 4J5GA 4N6LA 1YJ93 5FGOA 2HMOB 4K1UA 3I563 1VQP3 3ER7A 3NQZA 3BNBA 2XSHB 1TIJA 3T0UA 1VQK3 3T8NA 4HKVB 3FGYA 1RSNA 3SVAA 1A90A 5BU4A 1M904 1KQS2 1UUGB 3JUMA 4IT7A 3UB1A 1RJOA 1IVVA 1EG9B 4HM4B 4R4KA 4CDLA 1BRNL 5D82A 1FGQA 1BRJA 1Y4KA 4KFEA 2Z76A 3LT9A 3VGNA 2E2TA 1BRHA 2KF6A 3CD63 3D3LA 4L8PA 2F5MA 4KFDA 3CCV3 1ZX2A 3OX9A 2CX0A 1OACA 3K63A 3WOFB 1YVSA 3HIGA 2FXTA 1B2XA 1IQ8A 2CIUA 2XRXB 5FW5A 3DZLA 3DUKA 3JUNA 3CCU3 1CYUA 2WGOA 1GD3A 3KZTA 1BOXA 2W9PA 5G1KA 6STDA 1K734 3JUQA 2BIRA 5AYSC 4AEQA 2CG0A 3E99A 3M8CA 1LOXA 2PNCA 1BSAA 3K9MC 2QA43 3LYGA 1FW7A 2OTJ3 3STDA 1MOLA 2SBLA 1JRQA 1UI8A 5CLKA 3AGOA 3QK9A 2CG1A 1MNLA 4WYKA 3TDGA 4H3UA 1LRAA 1V74A 4MJDA 3F14A 3FCSB 1O7MB 3PYJA 1TRPA 1FGRA 1QALA 4EBGA 4ZM8A 2C4BA 2IYJA 4EV2A 1YJN3 4ILFA 2O9UX 1IT8A 2CFLA 3CCR3 1B2SA 3NBJA 2B1XB 2INXA 3N54B 2W6JH 3X3YA 3CME3 1LOWA 1DMMA 3G0KA 1C7HA 2O3OA 2SARA 3EX9A 3OWYA 1B3SA 1BAOA 2UX0A 4NREA 4RBNA 4XB5A 5LC6A 1NWWA 4BL2A 1W7CA 5IEOA 4BTYA 3IMAB 1RNTA 1IU7A 3IPTA 1O7WB 4R9LA 5AIHA 2BMOB 2RSXA 3RGRA 3SEDA 4BL3A 3G713 2RCDA 4N6NB 3A5EA 4O2HA 4X2OA 2IUJA 2GU3A 5IF6A 2R4IA 1GY6A 2CWVA 1OF5B 1BSEA 3CC23 3DH2A 4HM1B 3B4PA 1UCIA 1D6UA 3H51A 1GS3A 3WOEB 1NB5I 4JRFA 3ALAA 1NU3A 2RBIA 3URPA 7RNTA 3S5CA 3MHEA 3QRDA 1IV9A 4IIAA 3LZAA 2YFIB 3NBRA 3RNTA 5KP4A 1NB3I 2KAAA 2MF7A 1M9GA 2W03A 2Y74A 4XBXA 1X1XA 1ISKA 3KIIA 3U97A 3N8BA 1UCKA 1CH0A 1BGSA 1G02A 1HU9A 1JNQA 1N9JA 1B27A 4QWTA 1OGXA 1PY3A 2XEPA 1B2MA 3SLUA 3N9HA 4I4KA 8CHOA 3NQYA 3UL5A 5HOHA 4HYZA 2P38A 1PFPA 1DVDA 5IERA 3D5GA 1GMPA 1RGEA 4WP5A 1ROVA 3ZG5A 4J9AA 1E3VA 1BNIA 3DGMA 3EB8A 1VQ83 1T2IA 3Q3FA 1BNRA 2J8XB 4KFFA 4PEJA 4RZMA 1OCVA 3DGOA 1RHLA 1PU4A 3PS8A 4HM5B 2RGQA 1KD14 1PYLA 2HMMB 1BRGA 1FZUA 3S29A 1K8A4 3MKIA 1FUSA 2IA7A 2IUKA 3PGBA 4OUQA 2MC8A 1SIIA 3BB9A 9RNTA 3X41A 1DMNA 2KF5A 1QVF2 1K28A 1RGGA 1MGWA 1Z1SA 2HOHA 2WOFA 1TFOA 1DE3A 1IYYA 1FGTA 1VQQA 2W0QA 1BSDA 1STFI 1Q7HA 1DYUA 1FYSA 1ULIB 2L4VA 1Q40B 3B4OA 3DGNA 1BSCA 3AMOB 4CCVA 2F98A 3GSPA 4GHOA 3SOYA 2ML6A 3L0RA 2KXGA 3OWUA 3CMA3 1BNJA 5KP3A 3NV0B 4LGQA 4BU4A 5EQLA 1BNEA 4STDA 1S723 3U1WA 3D9RA 5CK6A 4HAAA 2YX9A 3RDEA 4FMDA 5IG5A 2K54A 1HZ1A 1AVLA 3GWRA 1UI7A 1W6GA 1GOUA 1IDPA 1OF5A 1UW1A 2P0MA 1HYFA 1I70A 1DMQA 1OHPA 1CYVA 1RGLA 2Q07A 2F86B 3GRDA 3LTBA 4NPBA 2ZDJA 1BUJA 1RTUA 2CFDA 3A76A 3NX0A 3EQQB 1I8VA 5KP1A 1OPYA 4FR9A 1LQMB 4EV5A 2BNGA 2OCTA 1UCJA 3EC9A 3FF0A 1R4CA 2GEYA 1JJ22 1ZS7A 2OTL3 2L1SA 2OQEC 1SJWA 1US1A 3DY5A 4HM6B 3S28A 3CCM3 3GZBA 3BIRA 7GSPA 5IW9A 1LXEA 3Q1CA 3GZYB 2XFSA 1VQN3 1I3IA 3PZWA 1G0TA 4N6TA 4O3VA 3SYUA 4XDVA 2K3DA 4BTXA 4N6OB 2CFKA 1IVWA 2F4YA 2CWTA 3GAXA 4FCMA 2ML5A 1WTHA 4HM8B 1IV7A 1W4NA 1N9EA 3CNMA 4HM0B 4L7KA 4MMYB 2WGQA 3HZPA 5IG4A 1TU5A 4LYLB 4WFOA 2IMJA 4R80A 5JPPA 4K1VA 5AIGA 3KSED 1WMPA 2KCDA 1FUWA 1I2EA 5CF2A 2QGUA 2OQEA 1QJGA 1S5AA 1LOVA 1A2PA 2UUGC 4K61A 3WODG 2YFLB 3CPW2 3KSPA 1W00A 1JN5B 1BRIA 4N6UA 2I9WA 5DREA 5AEWB 3EJVA 1B20A 1IQYA 3IJEB 1EKMA 3Q2PA 5AYRB 2H0HA 5STDA 1HKXA 3SXXA 2W56B 5CF1A 3FG4A 1TP6A 5EVHA 1SARA 4J8TA 4N6MA 5DRVA 5M18A 2C10A 1VQM3 3BU4A 2LQVA 1D6ZA 3RGAA 2BMRB 1YIJ3 3FLJA 3K0ZA 1YJW3 3DM8A 2E2VA 1Q40A 2XGNA 3CC73 2WOHA 3MPHA 5CXOA 4H61A 1JBRA 3AHSA 1IVXA 1L5GB 3G4S3 1OUNA 2PZVA 1I0VA 1UUVB 3EE1A 4HZBB 4LZIA 5AEUB 1JKGB 2W04A 3NV0A 2M7OA 1LNIA 1OHSA 2HMKB 2JQ5A 1TTOA 1RN7A 2AADA 2BHMA 2CW9A 2D42A 3F7XA 4CPKA 5JBSA 2H0GA 3AGNA 4O02B 3GZRA 1EQKA 4FMAA 1C54A 1T3BA 1VQ43 1O7PB 3B8LA 5G2GA 3F7SA 3X40A 1YHQ3 1VQL3 2OWPA 1JB5A 4HBRA 5LC7A 3NHXA 1X1YA 5GSPA 4EW5A 2C11A 1LQGC 2XFTA 1ASKA 2A15A 2P0XA 3HOHA 3FZWA 2B24B 3MWZA 1OH0A 2OOVC 3SOAA 3BNEA 3JVCA 5BIRA 1IQXA 1RCLA 2GSPA 2W9QA 1JB4A 3NM7A 1LVNA 1UGHI 3FF2A 2Z6BA 3WR2A 2LYXA 3F8HA 3V99A 3NUVA 3CCQ3 1NDOB 3F8XA 5A0OB 3CC43 2GBWB 1W02A 3NXJA 4XBTA 1VQ63 2AAEA 1TUHA 1GY5A 3X42A 1QAFA 3EF8A 4G1MB 1JB2A 2CX1A 4HOHA 4BTWA 1BSBA 1BNSA 1JBSA 3SX1A 2CC3A 1JN5A 4XBYA 5BXQA 5I97A 1GD4A 1UGIA 1EA2A 3S67A 1W6YA 1QMAA 1N5PA 1BANA 1GYBA 4AKZA 2QIYA 2W56A 3HIIA 1W01A 3ZFZA 1GOYA 1JZDA 1MWRA 1U8CB 1BIRA 3FKAA 2STDA 1EEJA 3I0YA 1I3FA 3KN4A 3OV4A 3PCRA 1M1XB 2FNQA 2P05A 2V1LA 1FGOA 4MMZB 4KVHA 3LTCA 5EEOA 2F5WA 3CCL3 3EHCA 1X1UA 3BNCA 1GY7A 5G1LA 2RFRA 1CEWI 3LH4A 1IT7A 2GXFA 1YGEA 4HM7B 4OVMA 3MG1A 3WMDA 4EC6A 3PCSA 4RNZA 1M1K4 1BVIA 1OGZA 3G6E3 2E2UA 4RNTA 3X3ZA 3CCS3 3VF1A 1JKGA 3MG3A 3O8YA 3X3XA 3NM2A 1E3RA 1WMNA 3KKGA 1MWUA 3LXUX 4Q53A 3MSOA 4U13A 1WQLB 1FA3A 3CU3A 3HK4A 4R9KA 5TGNA 4DKIA 3MYTA 3V98A 4XM4A 1RGHA 1Q42A 5ELUA 1YVBI 4FMCA 1VQ73 3T8UA 1JBTA 1VQO3 1QAKA 2KRTA 1ZO2A 4LEHA 4MMXB 3PXMA 3D4AA 3LTAA 1O7GB 4JF8A 4NHFA 1B21A 1MGRA 1UDII 2WO0A 1ZGXA 3ROBA 1G96A 3F40A 3MG2A 1GMRA
chains in the Genus database with same CATH topology
4HZ9B 1UUWB 3CPOA 5D81A 1DVCA 1VQ93 3LT8A 2Z7AA 2CFWA 3WA3A 3WA2X 1IVUA 1YIT3 2D1WA 3CCE3 1K9M4 3CXC2 1W2B2 1A67A 3BLZA 2CHCA 1W6CA 7STDA 1NO3A 1BUQA 1VZZA 3BNDA 4OK0A 2XGLA 2GU1A 3KE7A 1O7HB 1YI23 2W2CA 1A2VA 5IG0A 4LSOA 3DXOA 1CQSA 2BO9B 1N8R4 3HX8A 2CFGA 2Y73A 1Q814 1ULJB 4KZ1A 4EYCA 3UNLA 5AIIA 1U5OA 1KWIA 2CK3H 1W2ZA 2HMLB 4FCJA 3ECFA 1SPUA 3UJMA 3J7Yd 4HVNA 1Q7Y4 3AMOA 1AV4A 1E97A 1A2KA 3G8ZA 1ROAA 2Z77A 4HM3B 2JDIH 4MEIA 5AI1A 4N6V0 3OXAA 4X2HA 1OHOA 4LMIA 4O8SA 4TX4A 5IEPA 3OWSA 1RKYA 2HMNB 4L8OA 1SQWA 2QEX3 2XF3A 4EXRA 1D6YA 1F8NA 2BMQB 1NJI4 2BT3A 1AVKA 1SIHA 3JUPA 2XSOB 4GB5A 3B7CA 4WHAA 3V92A 3GZXB 2GEXA 3EN1B 4HJLB 5HGRA 5AIFA 5JPUA 1J2BA 5IENA 3HI7A 1FGMA 1WNHA 2XR8B 1IK3A 2GBXB 3Q90A 1T5YA 1Q864 2K0MA 2HMJB 3DGLA 3NBBA 4R1KA 1JV2B 2XH9A 2ZL8A 1QVG2 3UL6A 3EN8A 3JUOA 3WDGB 1TFKA 4RNYA 1RRHA 1KSIA 4IPBA 4K90B 3FG3A 1LNHA 3VSYA 3CNXA 4WYKB 3H3HA 4AKYA 3KFQC 3EBTA 3FH1A 4ORLA 2OOVA 1AR0A 3I553 1W5ZA 3EBYA 1RRLA 3S27A 5ELJA 1K41A 1O7NB 3DMCA 4FCZA 5D83A 4FMBA 3F9SA 2CH9A 1N8QA 1Q824 4N3VA 4WWUC 2CKFB 3K7CA 2FGTA 1WMOA 3FSDA 5BVBA 2P09A 4HM2B 5IG3A 3CCJ3 2YFJB 3LMLA 2F99A 3FG1A 1VQ53 3LTDA 4GL6A 1STDA 2CWUA 3G16A 3K5TA 3OW22 1N5HA 3LOYA 4XDWA 1KC84 4N6LA 1YJ93 5FGOA 2HMOB 4K1UA 3I563 1VQP3 3ER7A 3NQZA 3BNBA 2XSHB 1TIJA 3T0UA 1VQK3 3T8NA 4HKVB 3FGYA 3SVAA 1A90A 1M904 1KQS2 3JUMA 4IT7A 3UB1A 1RJOA 1IVVA 1EG9B 4HM4B 4R4KA 4CDLA 5D82A 1FGQA 1Y4KA 4KFEA 2Z76A 3LT9A 3VGNA 2E2TA 3CD63 3D3LA 4L8PA 4KFDA 3CCV3 1ZX2A 3OX9A 1OACA 3K63A 3WOFB 3HIGA 2FXTA 1IQ8A 2CIUA 2XRXB 5FW5A 3DZLA 3DUKA 3JUNA 3CCU3 1CYUA 2WGOA 1GD3A 3KZTA 2W9PA 6STDA 1K734 3JUQA 5AYSC 4AEQA 2CG0A 3E99A 3M8CA 1LOXA 2PNCA 3K9MC 2QA43 3LYGA 2OTJ3 3STDA 1MOLA 2SBLA 1JRQA 1UI8A 5CLKA 3QK9A 2CG1A 1MNLA 4WYKA 3TDGA 4H3UA 1V74A 4MJDA 3F14A 3FCSB 1O7MB 3PYJA 1FGRA 1QALA 4ZM8A 4EV2A 1YJN3 2O9UX 1IT8A 2CFLA 3CCR3 3NBJA 2B1XB 2INXA 3N54B 2W6JH 3X3YA 3CME3 1DMMA 3G0KA 1C7HA 2O3OA 3EX9A 3OWYA 2UX0A 4NREA 4RBNA 4XB5A 5LC6A 1NWWA 1W7CA 5IEOA 4BTYA 3IMAB 3IPTA 1IU7A 4R9LA 1O7WB 5AIHA 2BMOB 2RSXA 3RGRA 3SEDA 3G713 2RCDA 4N6NB 4O2HA 4X2OA 2IUJA 2GU3A 5IF6A 2R4IA 1GY6A 2CWVA 1OF5B 3CC23 4HM1B 3B4PA 1D6UA 3H51A 1GS3A 3WOEB 1NB5I 4JRFA 3ALAA 1NU3A 3S5CA 3MHEA 3QRDA 1IV9A 4IIAA 3LZAA 2YFIB 3NBRA 5KP4A 1NB3I 2MF7A 2W03A 1M9GA 2Y74A 4XBXA 1ISKA 3KIIA 3U97A 3N8BA 1HU9A 1JNQA 1N9JA 4QWTA 1OGXA 2XEPA 3SLUA 3N9HA 4I4KA 8CHOA 3NQYA 3UL5A 4HYZA 2P38A 1PFPA 1DVDA 5IERA 4WP5A 1ROVA 4J9AA 1E3VA 3DGMA 3EB8A 1VQ83 4KFFA 4PEJA 4RZMA 1OCVA 3DGOA 1PU4A 3PS8A 4HM5B 2RGQA 1KD14 2HMMB 3S29A 1K8A4 3MKIA 2IA7A 2IUKA 3PGBA 4OUQA 2MC8A 1SIIA 3BB9A 3X41A 1DMNA 1QVF2 1K28A 1Z1SA 2WOFA 1TFOA 1FGTA 2W0QA 1STFI 2L4VA 3DGNA 1DYUA 3B4OA 1ULIB 1Q40B 3AMOB 4CCVA 2F98A 3SOYA 2ML6A 3L0RA 2KXGA 3OWUA 3CMA3 5KP3A 3NV0B 4LGQA 5EQLA 4STDA 1S723 3U1WA 3D9RA 5CK6A 2YX9A 3RDEA 4FMDA 5IG5A 2K54A 3GWRA 1AVLA 1UI7A 1W6GA 1IDPA 1OF5A 1UW1A 2P0MA 1DMQA 1OHPA 1CYVA 2Q07A 3GRDA 2F86B 3LTBA 2ZDJA 2CFDA 3A76A 3NX0A 3EQQB 5KP1A 1OPYA 4FR9A 4EV5A 2BNGA 2OCTA 3EC9A 3FF0A 1R4CA 2GEYA 1JJ22 2OTL3 2OQEC 1SJWA 1US1A 3DY5A 4HM6B 3S28A 3CCM3 3GZBA 5IW9A 1LXEA 3Q1CA 3GZYB 2XFSA 1VQN3 3PZWA 4O3VA 4EBGA 4N6TA 4XDVA 4BTXA 4N6OB 2CFKA 1IVWA 3GAXA 2CWTA 4FCMA 2ML5A 1WTHA 4HM8B 1IV7A 1W4NA 1N9EA 3CNMA 4HM0B 4L7KA 4MMYB 2WGQA 3HZPA 5IG4A 1TU5A 4WFOA 2IMJA 4R80A 5JPPA 4K1VA 5AIGA 3KSED 1WMPA 2KCDA 1FUWA 5CF2A 2QGUA 2OQEA 1QJGA 1S5AA 4K61A 3WODG 2YFLB 3CPW2 3KSPA 1W00A 1JN5B 5DREA 4N6UA 2I9WA 5AEWB 3EJVA 1IQYA 3IJEB 1EKMA 3Q2PA 5AYRB 5STDA 1HKXA 3SXXA 2W56B 5CF1A 3FG4A 1TP6A 5EVHA 4J8TA 4N6MA 5DRVA 2C10A 1VQM3 2LQVA 1D6ZA 3RGAA 2BMRB 1YIJ3 3FLJA 3K0ZA 1YJW3 3DM8A 2E2VA 1Q40A 2XGNA 3CC73 2WOHA 3MPHA 5CXOA 4H61A 1IVXA 1L5GB 3G4S3 1OUNA 2PZVA 4HZBB 1UUVB 3EE1A 4LZIA 5AEUB 1JKGB 2W04A 3NV0A 2M7OA 1OHSA 2HMKB 2JQ5A 3F7XA 1RN7A 2BHMA 2CW9A 2D42A 5JBSA 4O02B 3GZRA 1EQKA 4FMAA 1VQ43 1O7PB 3B8LA 5G2GA 3F7SA 3X40A 1YHQ3 1VQL3 2OWPA 1JB5A 4HBRA 5LC7A 3NHXA 2C11A 2XFTA 1ASKA 2A15A 2P0XA 3FZWA 2B24B 3MWZA 1OH0A 2OOVC 3SOAA 3BNEA 3JVCA 1IQXA 2W9QA 1JB4A 3NM7A 1LVNA 3FF2A 2Z6BA 2LYXA 3F8HA 3V99A 3NUVA 3CCQ3 1NDOB 3F8XA 5A0OB 3CC43 2GBWB 1W02A 3NXJA 4XBTA 1VQ63 1TUHA 1GY5A 3X42A 1QAFA 3EF8A 4G1MB 1JB2A 4BTWA 3SX1A 2CC3A 1JN5A 4XBYA 5BXQA 5I97A 1GD4A 1EA2A 3S67A 1W6YA 1QMAA 1N5PA 1GYBA 4AKZA 2QIYA 2W56A 3HIIA 1W01A 3FKAA 3I0YA 3OV4A 1U8CB 2STDA 3KN4A 3PCRA 1M1XB 2FNQA 2P05A 2V1LA 1FGOA 4MMZB 4KVHA 3LTCA 5EEOA 3CCL3 3EHCA 3BNCA 1GY7A 2RFRA 1CEWI 3LH4A 1IT7A 2GXFA 1YGEA 4HM7B 4OVMA 3MG1A 3WMDA 4EC6A 3PCSA 4RNZA 1M1K4 1OGZA 3G6E3 2E2UA 3X3ZA 3CCS3 3VF1A 1JKGA 3MG3A 3O8YA 3X3XA 3NM2A 1E3RA 1WMNA 3KKGA 3LXUX 4Q53A 3MSOA 4U13A 1WQLB 1FA3A 3CU3A 3HK4A 4R9KA 5TGNA 3MYTA 3V98A 4XM4A 1Q42A 5ELUA 1YVBI 4FMCA 1VQ73 3T8UA 1VQO3 1QAKA 2KRTA 1ZO2A 4LEHA 4MMXB 3PXMA 3LTAA 1O7GB 4JF8A 4NHFA 2WO0A 3ROBA 1G96A 3F40A 3MG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HZ9 B;  1UUW B;  3CPO A;  5D81 A;  2Z7A A;  3BLZ A;  2CHC A;  7STD A;  1BUQ A;  1VZZ A;  3KE7 A;  1O7H B;  2W2C A;  5IG0 A;  3DXO A;  1CQS A;  3HX8 A;  1ULJ B;  3UNL A;  5AII A;  1U5O A;  2HML B;  4FCJ A;  3ECF A;  3UJM A;  4HVN A;  1E97 A;  1A2K A;  3G8Z A;  2Z77 A;  4HM3 B;  5AI1 A;  3OXA A;  4X2H A;  1OHO A;  4LMI A;  5IEP A;  3OWS A;  2HMN B;  4L8O A;  2BMQ B;  3JUP A;  2XSO B;  4GB5 A;  3B7C A;  3GZX B;  2GEX A;  3EN1 B;  4HJL B;  5HGR A;  5AIF A;  5JPU A;  5IEN A;  2XR8 B;  2GBX B;  3Q90 A;  2HMJ B;  4R1K A;  3EN8 A;  3JUO A;  3VSY A;  3CNX A;  4WYK B;  3H3H A;  3EBT A;  3FH1 A;  4ORL A;  1AR0 A;  3EBY A;  1K41 A;  1O7N B;  3DMC A;  5D83 A;  3F9S A;  4N3V A;  4WWU C;  2CKF B;  3K7C A;  3FSD A;  5BVB A;  4HM2 B;  5IG3 A;  2YFJ B;  2F99 A;  1STD A;  3G16 A;  4XDW A;  2HMO B;  4K1U A;  3ER7 A;  2XSH B;  3T8N A;  4HKV B;  3FGY A;  3JUM A;  4HM4 B;  1EG9 B;  4CDL A;  5D82 A;  2Z76 A;  3VGN A;  4L8P A;  1ZX2 A;  3OX9 A;  2XRX B;  5FW5 A;  3DZL A;  3DUK A;  3JUN A;  3KZT A;  6STD A;  3JUQ A;  3E99 A;  3M8C A;  3LYG A;  3STD A;  5CLK A;  4WYK A;  4H3U A;  4MJD A;  3F14 A;  1O7M B;  2B1X B;  2INX A;  1DMM A;  3G0K A;  1C7H A;  3EX9 A;  3OWY A;  2UX0 A;  4XB5 A;  1NWW A;  5IEO A;  3IPT A;  4R9L A;  1O7W B;  5AIH A;  2BMO B;  3SED A;  3RGR A;  2RCD A;  4X2O A;  5IF6 A;  2R4I A;  1GY6 A;  1OF5 B;  4HM1 B;  3B4P A;  3H51 A;  1GS3 A;  1NU3 A;  3S5C A;  3MHE A;  4IIA A;  3LZA A;  2YFI B;  3NBR A;  5KP4 A;  4XBX A;  1ISK A;  1OGX A;  8CHO A;  4I4K A;  5IER A;  4WP5 A;  4J9A A;  1E3V A;  4PEJ A;  4RZM A;  1OCV A;  4HM5 B;  2RGQ A;  2HMM B;  3MKI A;  4OUQ A;  3BB9 A;  1DMN A;  1Z1S A;  3B4O A;  1ULI B;  1Q40 B;  2F98 A;  3SOY A;  3OWU A;  5KP3 A;  3NV0 B;  4LGQ A;  4STD A;  3D9R A;  5CK6 A;  5IG5 A;  2K54 A;  3GWR A;  1IDP A;  1OF5 A;  1DMQ A;  1OHP A;  3GRD A;  2F86 B;  3A76 A;  3EQQ B;  5KP1 A;  1OPY A;  2BNG A;  3EC9 A;  3FF0 A;  2GEY A;  4HM6 B;  1SJW A;  3GZB A;  3GZY B;  4XDV A;  4FCM A;  4HM8 B;  3CNM A;  4HM0 B;  4L7K A;  3HZP A;  5IG4 A;  2IMJ A;  5JPP A;  4K1V A;  5AIG A;  5CF2 A;  2QGU A;  1QJG A;  1S5A A;  2YFL B;  3KSP A;  5DRE A;  1W00 A;  1JN5 B;  2I9W A;  5AEW B;  3EJV A;  5STD A;  1HKX A;  5CF1 A;  1TP6 A;  5EVH A;  4J8T A;  5DRV A;  3RGA A;  2BMR B;  3FLJ A;  3K0Z A;  3DM8 A;  1Q40 A;  5CXO A;  1OUN A;  2PZV A;  4HZB B;  1UUV B;  5AEU B;  1JKG B;  3NV0 A;  1OHS A;  2HMK B;  2JQ5 A;  3F7X A;  3GZR A;  1O7P B;  3B8L A;  5G2G A;  3F7S A;  2OWP A;  1JB5 A;  3NHX A;  1ASK A;  2A15 A;  3FZW A;  2B24 B;  1OH0 A;  3SOA A;  1JB4 A;  3FF2 A;  3F8H A;  3NUV A;  1NDO B;  3F8X A;  2GBW B;  1W02 A;  3NXJ A;  4XBT A;  1TUH A;  1GY5 A;  3EF8 A;  1JB2 A;  1JN5 A;  4XBY A;  5BXQ A;  1EA2 A;  1W6Y A;  1QMA A;  1GYB A;  2QIY A;  1W01 A;  3FKA A;  3I0Y A;  3OV4 A;  2STD A;  4KVH A;  3EHC A;  1GY7 A;  2RFR A;  2GXF A;  4HM7 B;  4OVM A;  3MG1 A;  3WMD A;  1OGZ A;  1JKG A;  3MG3 A;  3NM2 A;  1E3R A;  3KKG A;  4Q53 A;  3MSO A;  4U13 A;  1WQL B;  3CU3 A;  3HK4 A;  4R9K A;  5TGN A;  3MYT A;  4XM4 A;  1Q42 A;  3T8U A;  1ZO2 A;  4LEH A;  1O7G B;  3ROB A;  3F40 A;  3MG2 A; 
#chains in the Genus database with same CATH topology
 4HZ9 B;  1UUW B;  3CPO A;  1Q9E A;  5D81 A;  1DVC A;  1VQ9 3;  3LT8 A;  2Z7A A;  4J5K A;  1FUT A;  1MWT A;  2CFW A;  3ZG0 A;  1GSP A;  3WA2 X;  3WA3 A;  1IVU A;  1YIT 3;  1BRS A;  1UCL A;  2D1W A;  2F56 A;  1RGF A;  2IY2 A;  2ZA4 A;  3CXC 2;  3CCE 3;  3BLZ A;  1W2B 2;  1K9M 4;  1A67 A;  2CHC A;  1W6C A;  7STD A;  1NO3 A;  1DET A;  1BUQ A;  1VZZ A;  3BND A;  4OK0 A;  2XGL A;  2GU1 A;  1I0X A;  3KE7 A;  1O7H B;  1YI2 3;  1GMQ A;  2W2C A;  4CJN A;  1A2V A;  5IG0 A;  4LSO A;  3DXO A;  1CQS A;  1RGK A;  2BO9 B;  3HX8 A;  1N8R 4;  2CFG A;  2Y73 A;  8RNT A;  1Q81 4;  1ULJ B;  1YNV X;  4KZ1 A;  4EYC A;  3UNL A;  5AII A;  1U5O A;  1GOV A;  5M1A A;  1KWI A;  2CK3 H;  1W2Z A;  2HML B;  1R4Y A;  3ECF A;  4FCJ A;  3D5I A;  1SPU A;  3UJM A;  3J7Y d;  4HVN A;  1Q7Y 4;  3AMO A;  1AV4 A;  1BU4 A;  1E97 A;  1A2K A;  1V58 A;  3G8Z A;  1ROA A;  2Z77 A;  1BNG A;  2JDI H;  4HM3 B;  1I2F A;  4MEI A;  4GSP A;  6RNT A;  5AI1 A;  1X1W A;  4N6V 0;  3OXA A;  4X2H A;  1OHO A;  4LMI A;  4O8S A;  4TX4 A;  5IEP A;  3OWS A;  1YGW A;  1RKY A;  1RDS A;  2HMN B;  2RNT A;  4L8O A;  1SQW A;  1RN1 A;  2QEX 3;  2XF3 A;  4EXR A;  1MWS A;  5RNT A;  1D6Y A;  3AHW A;  1F8N A;  1V57 A;  2BMQ B;  1AY7 A;  1NJI 4;  2BT3 A;  1AVK A;  1SIH A;  3JUP A;  2XSO B;  4GB5 A;  3B7C A;  2KF3 A;  4WHA A;  4BIR A;  3V92 A;  1BRK A;  2GEX A;  3EN1 B;  3GZX B;  4HJL B;  5HGR A;  1LOY A;  5AIF A;  5JPU A;  1J2B A;  6GSP A;  5IEN A;  3HI7 A;  1T2H A;  1FGM A;  1WNH A;  2XR8 B;  1IK3 A;  2GBX B;  3Q90 A;  1T5Y A;  1Q86 4;  2K0M A;  3KCH A;  2HMJ B;  1NNV A;  3DGL A;  3NBB A;  4R1K A;  1JV2 B;  2XH9 A;  1BNF A;  2ZL8 A;  1QVG 2;  2R41 A;  3DGY A;  4KT3 B;  3UL6 A;  3EN8 A;  3JUO A;  3WDG B;  1TFK A;  1EUI C;  4RNY A;  1RRH A;  5M19 A;  1KSI A;  4IPB A;  4K90 B;  1RNB A;  3FG3 A;  1LNH A;  3VSY A;  3CNX A;  2UGI A;  4WYK B;  3H3H A;  4AKY A;  3KFQ C;  3EBT A;  3FH1 A;  4ORL A;  2OOV A;  1AR0 A;  2H0I A;  3I55 3;  1W5Z A;  3EBY A;  1RRL A;  3S27 A;  5ELJ A;  1K41 A;  1O7N B;  1TRQ A;  3DMC A;  4FCZ A;  5D83 A;  4FMB A;  3F9S A;  4I5Q A;  2CH9 A;  1RCK A;  1N8Q A;  1Q82 4;  4N3V A;  4WWU C;  1RGC A;  2CKF B;  3K7C A;  2FGT A;  1WMO A;  3FSD A;  5BVB A;  2P09 A;  1RGA A;  1I2G A;  2KF4 A;  4HM2 B;  5IG3 A;  3CCJ 3;  1JZO A;  3WHO A;  1B2Z A;  2YFJ B;  1TJD A;  1AQZ A;  3LML A;  2F99 A;  3FG1 A;  1VQ5 3;  1RN4 A;  2BU4 A;  3LTD A;  3D79 A;  1STD A;  2CWU A;  1RLS A;  1RMS A;  3G16 A;  3K5T A;  1N5H A;  3LOY A;  4GL6 A;  3OW2 2;  4XDW A;  1KC8 4;  1B2U A;  2ZHX B;  4J5G A;  4N6L A;  1YJ9 3;  5FGO A;  2HMO B;  4K1U A;  3I56 3;  1VQP 3;  3ER7 A;  3NQZ A;  3BNB A;  2XSH B;  1TIJ A;  3T0U A;  1VQK 3;  3T8N A;  4HKV B;  3FGY A;  1RSN A;  3SVA A;  1A90 A;  5BU4 A;  1M90 4;  1KQS 2;  1UUG B;  3JUM A;  4IT7 A;  3UB1 A;  1RJO A;  1IVV A;  1EG9 B;  4HM4 B;  4R4K A;  4CDL A;  1BRN L;  5D82 A;  1FGQ A;  1BRJ A;  1Y4K A;  4KFE A;  2Z76 A;  3LT9 A;  3VGN A;  2E2T A;  1BRH A;  2KF6 A;  3CD6 3;  3D3L A;  4L8P A;  2F5M A;  4KFD A;  3CCV 3;  1ZX2 A;  3OX9 A;  2CX0 A;  1OAC A;  3K63 A;  3WOF B;  1YVS A;  3HIG A;  2FXT A;  1B2X A;  1IQ8 A;  2CIU A;  2XRX B;  5FW5 A;  3DZL A;  3DUK A;  3JUN A;  3CCU 3;  1CYU A;  2WGO A;  1GD3 A;  3KZT A;  1BOX A;  2W9P A;  5G1K A;  6STD A;  1K73 4;  3JUQ A;  2BIR A;  5AYS C;  4AEQ A;  2CG0 A;  3E99 A;  3M8C A;  1LOX A;  2PNC A;  1BSA A;  3K9M C;  2QA4 3;  3LYG A;  1FW7 A;  2OTJ 3;  3STD A;  1MOL A;  2SBL A;  1JRQ A;  1UI8 A;  5CLK A;  3AGO A;  3QK9 A;  2CG1 A;  1MNL A;  4WYK A;  3TDG A;  4H3U A;  1LRA A;  1V74 A;  4MJD A;  3F14 A;  3FCS B;  1O7M B;  3PYJ A;  1TRP A;  1FGR A;  1QAL A;  4EBG A;  4ZM8 A;  2C4B A;  2IYJ A;  4EV2 A;  1YJN 3;  4ILF A;  2O9U X;  1IT8 A;  2CFL A;  3CCR 3;  1B2S A;  3NBJ A;  2B1X B;  2INX A;  3N54 B;  2W6J H;  3X3Y A;  3CME 3;  1LOW A;  1DMM A;  3G0K A;  1C7H A;  2O3O A;  2SAR A;  3EX9 A;  3OWY A;  1B3S A;  1BAO A;  2UX0 A;  4NRE A;  4RBN A;  4XB5 A;  5LC6 A;  1NWW A;  4BL2 A;  1W7C A;  5IEO A;  4BTY A;  3IMA B;  1RNT A;  1IU7 A;  3IPT A;  1O7W B;  4R9L A;  5AIH A;  2BMO B;  2RSX A;  3RGR A;  3SED A;  4BL3 A;  3G71 3;  2RCD A;  4N6N B;  3A5E A;  4O2H A;  4X2O A;  2IUJ A;  2GU3 A;  5IF6 A;  2R4I A;  1GY6 A;  2CWV A;  1OF5 B;  1BSE A;  3CC2 3;  3DH2 A;  4HM1 B;  3B4P A;  1UCI A;  1D6U A;  3H51 A;  1GS3 A;  3WOE B;  1NB5 I;  4JRF A;  3ALA A;  1NU3 A;  2RBI A;  3URP A;  7RNT A;  3S5C A;  3MHE A;  3QRD A;  1IV9 A;  4IIA A;  3LZA A;  2YFI B;  3NBR A;  3RNT A;  5KP4 A;  1NB3 I;  2KAA A;  2MF7 A;  1M9G A;  2W03 A;  2Y74 A;  4XBX A;  1X1X A;  1ISK A;  3KII A;  3U97 A;  3N8B A;  1UCK A;  1CH0 A;  1BGS A;  1G02 A;  1HU9 A;  1JNQ A;  1N9J A;  1B27 A;  4QWT A;  1OGX A;  1PY3 A;  2XEP A;  1B2M A;  3SLU A;  3N9H A;  4I4K A;  8CHO A;  3NQY A;  3UL5 A;  5HOH A;  4HYZ A;  2P38 A;  1PFP A;  1DVD A;  5IER A;  3D5G A;  1GMP A;  1RGE A;  4WP5 A;  1ROV A;  3ZG5 A;  4J9A A;  1E3V A;  1BNI A;  3DGM A;  3EB8 A;  1VQ8 3;  1T2I A;  3Q3F A;  1BNR A;  2J8X B;  4KFF A;  4PEJ A;  4RZM A;  1OCV A;  3DGO A;  1RHL A;  1PU4 A;  3PS8 A;  4HM5 B;  2RGQ A;  1KD1 4;  1PYL A;  2HMM B;  1BRG A;  1FZU A;  3S29 A;  1K8A 4;  3MKI A;  1FUS A;  2IA7 A;  2IUK A;  3PGB A;  4OUQ A;  2MC8 A;  1SII A;  3BB9 A;  9RNT A;  3X41 A;  1DMN A;  2KF5 A;  1QVF 2;  1K28 A;  1RGG A;  1MGW A;  1Z1S A;  2HOH A;  2WOF A;  1TFO A;  1DE3 A;  1IYY A;  1FGT A;  1VQQ A;  2W0Q A;  1BSD A;  1STF I;  1Q7H A;  1DYU A;  1FYS A;  1ULI B;  2L4V A;  1Q40 B;  3B4O A;  3DGN A;  1BSC A;  3AMO B;  4CCV A;  2F98 A;  3GSP A;  4GHO A;  3SOY A;  2ML6 A;  3L0R A;  2KXG A;  3OWU A;  3CMA 3;  1BNJ A;  5KP3 A;  3NV0 B;  4LGQ A;  4BU4 A;  5EQL A;  1BNE A;  4STD A;  1S72 3;  3U1W A;  3D9R A;  5CK6 A;  4HAA A;  2YX9 A;  3RDE A;  4FMD A;  5IG5 A;  2K54 A;  1HZ1 A;  1AVL A;  3GWR A;  1UI7 A;  1W6G A;  1GOU A;  1IDP A;  1OF5 A;  1UW1 A;  2P0M A;  1HYF A;  1I70 A;  1DMQ A;  1OHP A;  1CYV A;  1RGL A;  2Q07 A;  2F86 B;  3GRD A;  3LTB A;  4NPB A;  2ZDJ A;  1BUJ A;  1RTU A;  2CFD A;  3A76 A;  3NX0 A;  3EQQ B;  1I8V A;  5KP1 A;  1OPY A;  4FR9 A;  1LQM B;  4EV5 A;  2BNG A;  2OCT A;  1UCJ A;  3EC9 A;  3FF0 A;  1R4C A;  2GEY A;  1JJ2 2;  1ZS7 A;  2OTL 3;  2L1S A;  2OQE C;  1SJW A;  1US1 A;  3DY5 A;  4HM6 B;  3S28 A;  3CCM 3;  3GZB A;  3BIR A;  7GSP A;  5IW9 A;  1LXE A;  3Q1C A;  3GZY B;  2XFS A;  1VQN 3;  1I3I A;  3PZW A;  1G0T A;  4N6T A;  4O3V A;  3SYU A;  4XDV A;  2K3D A;  4BTX A;  4N6O B;  2CFK A;  1IVW A;  2F4Y A;  2CWT A;  3GAX A;  4FCM A;  2ML5 A;  1WTH A;  4HM8 B;  1IV7 A;  1W4N A;  1N9E A;  3CNM A;  4HM0 B;  4L7K A;  4MMY B;  2WGQ A;  3HZP A;  5IG4 A;  1TU5 A;  4LYL B;  4WFO A;  2IMJ A;  4R80 A;  5JPP A;  4K1V A;  5AIG A;  3KSE D;  1WMP A;  2KCD A;  1FUW A;  1I2E A;  5CF2 A;  2QGU A;  2OQE A;  1QJG A;  1S5A A;  1LOV A;  1A2P A;  2UUG C;  4K61 A;  3WOD G;  2YFL B;  3CPW 2;  3KSP A;  1W00 A;  1JN5 B;  1BRI A;  4N6U A;  2I9W A;  5DRE A;  5AEW B;  3EJV A;  1B20 A;  1IQY A;  3IJE B;  1EKM A;  3Q2P A;  5AYR B;  2H0H A;  5STD A;  1HKX A;  3SXX A;  2W56 B;  5CF1 A;  3FG4 A;  1TP6 A;  5EVH A;  1SAR A;  4J8T A;  4N6M A;  5DRV A;  5M18 A;  2C10 A;  1VQM 3;  3BU4 A;  2LQV A;  1D6Z A;  3RGA A;  2BMR B;  1YIJ 3;  3FLJ A;  3K0Z A;  1YJW 3;  3DM8 A;  2E2V A;  1Q40 A;  2XGN A;  3CC7 3;  2WOH A;  3MPH A;  5CXO A;  4H61 A;  1JBR A;  3AHS A;  1IVX A;  1L5G B;  3G4S 3;  1OUN A;  2PZV A;  1I0V A;  1UUV B;  3EE1 A;  4HZB B;  4LZI A;  5AEU B;  1JKG B;  2W04 A;  3NV0 A;  2M7O A;  1LNI A;  1OHS A;  2HMK B;  2JQ5 A;  1TTO A;  1RN7 A;  2AAD A;  2BHM A;  2CW9 A;  2D42 A;  3F7X A;  4CPK A;  5JBS A;  2H0G A;  3AGN A;  4O02 B;  3GZR A;  1EQK A;  4FMA A;  1C54 A;  1T3B A;  1VQ4 3;  1O7P B;  3B8L A;  5G2G A;  3F7S A;  3X40 A;  1YHQ 3;  1VQL 3;  2OWP A;  1JB5 A;  4HBR A;  5LC7 A;  3NHX A;  1X1Y A;  5GSP A;  4EW5 A;  2C11 A;  1LQG C;  2XFT A;  1ASK A;  2A15 A;  2P0X A;  3HOH A;  3FZW A;  2B24 B;  3MWZ A;  1OH0 A;  2OOV C;  3SOA A;  3BNE A;  3JVC A;  5BIR A;  1IQX A;  1RCL A;  2GSP A;  2W9Q A;  1JB4 A;  3NM7 A;  1LVN A;  1UGH I;  3FF2 A;  2Z6B A;  3WR2 A;  2LYX A;  3F8H A;  3V99 A;  3NUV A;  3CCQ 3;  1NDO B;  3F8X A;  5A0O B;  3CC4 3;  2GBW B;  1W02 A;  3NXJ A;  4XBT A;  1VQ6 3;  2AAE A;  1TUH A;  1GY5 A;  3X42 A;  1QAF A;  3EF8 A;  4G1M B;  1JB2 A;  2CX1 A;  4HOH A;  4BTW A;  1BSB A;  1BNS A;  1JBS A;  3SX1 A;  2CC3 A;  1JN5 A;  4XBY A;  5BXQ A;  5I97 A;  1GD4 A;  1UGI A;  1EA2 A;  3S67 A;  1W6Y A;  1QMA A;  1N5P A;  1BAN A;  1GYB A;  4AKZ A;  2QIY A;  2W56 A;  3HII A;  1W01 A;  3ZFZ A;  1GOY A;  1JZD A;  1MWR A;  1U8C B;  1BIR A;  3FKA A;  2STD A;  1EEJ A;  3I0Y A;  1I3F A;  3KN4 A;  3OV4 A;  3PCR A;  1M1X B;  2FNQ A;  2P05 A;  2V1L A;  1FGO A;  4MMZ B;  4KVH A;  3LTC A;  5EEO A;  2F5W A;  3CCL 3;  3EHC A;  1X1U A;  3BNC A;  1GY7 A;  5G1L A;  2RFR A;  1CEW I;  3LH4 A;  1IT7 A;  2GXF A;  1YGE A;  4HM7 B;  4OVM A;  3MG1 A;  3WMD A;  4EC6 A;  3PCS A;  4RNZ A;  1M1K 4;  1BVI A;  1OGZ A;  3G6E 3;  2E2U A;  4RNT A;  3X3Z A;  3CCS 3;  3VF1 A;  1JKG A;  3MG3 A;  3O8Y A;  3X3X A;  3NM2 A;  1E3R A;  1WMN A;  3KKG A;  1MWU A;  3LXU X;  4Q53 A;  3MSO A;  4U13 A;  1WQL B;  1FA3 A;  3CU3 A;  3HK4 A;  4R9K A;  5TGN A;  4DKI A;  3MYT A;  3V98 A;  4XM4 A;  1RGH A;  1Q42 A;  5ELU A;  1YVB I;  4FMC A;  1VQ7 3;  3T8U A;  1JBT A;  1VQO 3;  1QAK A;  2KRT A;  1ZO2 A;  4LEH A;  4MMX B;  3PXM A;  3D4A A;  3LTA A;  1O7G B;  4JF8 A;  4NHF A;  1B21 A;  1MGR A;  1UDI I;  2WO0 A;  1ZGX A;  3ROB A;  1G96 A;  3F40 A;  3MG2 A;  1GMR A; 
#chains in the Genus database with same CATH homology
 4HZ9 B;  1UUW B;  3CPO A;  5D81 A;  1DVC A;  1VQ9 3;  3LT8 A;  2Z7A A;  2CFW A;  3WA3 A;  3WA2 X;  1IVU A;  1YIT 3;  2D1W A;  3CCE 3;  1K9M 4;  3CXC 2;  1W2B 2;  1A67 A;  3BLZ A;  2CHC A;  1W6C A;  7STD A;  1NO3 A;  1BUQ A;  1VZZ A;  3BND A;  4OK0 A;  2XGL A;  2GU1 A;  3KE7 A;  1O7H B;  1YI2 3;  2W2C A;  1A2V A;  5IG0 A;  4LSO A;  3DXO A;  1CQS A;  2BO9 B;  1N8R 4;  3HX8 A;  2CFG A;  2Y73 A;  1Q81 4;  1ULJ B;  4KZ1 A;  4EYC A;  3UNL A;  5AII A;  1U5O A;  1KWI A;  2CK3 H;  1W2Z A;  2HML B;  4FCJ A;  3ECF A;  1SPU A;  3UJM A;  3J7Y d;  4HVN A;  1Q7Y 4;  3AMO A;  1AV4 A;  1E97 A;  1A2K A;  3G8Z A;  1ROA A;  2Z77 A;  4HM3 B;  2JDI H;  4MEI A;  5AI1 A;  4N6V 0;  3OXA A;  4X2H A;  1OHO A;  4LMI A;  4O8S A;  4TX4 A;  5IEP A;  3OWS A;  1RKY A;  2HMN B;  4L8O A;  1SQW A;  2QEX 3;  2XF3 A;  4EXR A;  1D6Y A;  1F8N A;  2BMQ B;  1NJI 4;  2BT3 A;  1AVK A;  1SIH A;  3JUP A;  2XSO B;  4GB5 A;  3B7C A;  4WHA A;  3V92 A;  3GZX B;  2GEX A;  3EN1 B;  4HJL B;  5HGR A;  5AIF A;  5JPU A;  1J2B A;  5IEN A;  3HI7 A;  1FGM A;  1WNH A;  2XR8 B;  1IK3 A;  2GBX B;  3Q90 A;  1T5Y A;  1Q86 4;  2K0M A;  2HMJ B;  3DGL A;  3NBB A;  4R1K A;  1JV2 B;  2XH9 A;  2ZL8 A;  1QVG 2;  3UL6 A;  3EN8 A;  3JUO A;  3WDG B;  1TFK A;  4RNY A;  1RRH A;  1KSI A;  4IPB A;  4K90 B;  3FG3 A;  1LNH A;  3VSY A;  3CNX A;  4WYK B;  3H3H A;  4AKY A;  3KFQ C;  3EBT A;  3FH1 A;  4ORL A;  2OOV A;  1AR0 A;  3I55 3;  1W5Z A;  3EBY A;  1RRL A;  3S27 A;  5ELJ A;  1K41 A;  1O7N B;  3DMC A;  4FCZ A;  5D83 A;  4FMB A;  3F9S A;  2CH9 A;  1N8Q A;  1Q82 4;  4N3V A;  4WWU C;  2CKF B;  3K7C A;  2FGT A;  1WMO A;  3FSD A;  5BVB A;  2P09 A;  4HM2 B;  5IG3 A;  3CCJ 3;  2YFJ B;  3LML A;  2F99 A;  3FG1 A;  1VQ5 3;  3LTD A;  4GL6 A;  1STD A;  2CWU A;  3G16 A;  3K5T A;  3OW2 2;  1N5H A;  3LOY A;  4XDW A;  1KC8 4;  4N6L A;  1YJ9 3;  5FGO A;  2HMO B;  4K1U A;  3I56 3;  1VQP 3;  3ER7 A;  3NQZ A;  3BNB A;  2XSH B;  1TIJ A;  3T0U A;  1VQK 3;  3T8N A;  4HKV B;  3FGY A;  3SVA A;  1A90 A;  1M90 4;  1KQS 2;  3JUM A;  4IT7 A;  3UB1 A;  1RJO A;  1IVV A;  1EG9 B;  4HM4 B;  4R4K A;  4CDL A;  5D82 A;  1FGQ A;  1Y4K A;  4KFE A;  2Z76 A;  3LT9 A;  3VGN A;  2E2T A;  3CD6 3;  3D3L A;  4L8P A;  4KFD A;  3CCV 3;  1ZX2 A;  3OX9 A;  1OAC A;  3K63 A;  3WOF B;  3HIG A;  2FXT A;  1IQ8 A;  2CIU A;  2XRX B;  5FW5 A;  3DZL A;  3DUK A;  3JUN A;  3CCU 3;  1CYU A;  2WGO A;  1GD3 A;  3KZT A;  2W9P A;  6STD A;  1K73 4;  3JUQ A;  5AYS C;  4AEQ A;  2CG0 A;  3E99 A;  3M8C A;  1LOX A;  2PNC A;  3K9M C;  2QA4 3;  3LYG A;  2OTJ 3;  3STD A;  1MOL A;  2SBL A;  1JRQ A;  1UI8 A;  5CLK A;  3QK9 A;  2CG1 A;  1MNL A;  4WYK A;  3TDG A;  4H3U A;  1V74 A;  4MJD A;  3F14 A;  3FCS B;  1O7M B;  3PYJ A;  1FGR A;  1QAL A;  4ZM8 A;  4EV2 A;  1YJN 3;  2O9U X;  1IT8 A;  2CFL A;  3CCR 3;  3NBJ A;  2B1X B;  2INX A;  3N54 B;  2W6J H;  3X3Y A;  3CME 3;  1DMM A;  3G0K A;  1C7H A;  2O3O A;  3EX9 A;  3OWY A;  2UX0 A;  4NRE A;  4RBN A;  4XB5 A;  5LC6 A;  1NWW A;  1W7C A;  5IEO A;  4BTY A;  3IMA B;  3IPT A;  1IU7 A;  4R9L A;  1O7W B;  5AIH A;  2BMO B;  2RSX A;  3RGR A;  3SED A;  3G71 3;  2RCD A;  4N6N B;  4O2H A;  4X2O A;  2IUJ A;  2GU3 A;  5IF6 A;  2R4I A;  1GY6 A;  2CWV A;  1OF5 B;  3CC2 3;  4HM1 B;  3B4P A;  1D6U A;  3H51 A;  1GS3 A;  3WOE B;  1NB5 I;  4JRF A;  3ALA A;  1NU3 A;  3S5C A;  3MHE A;  3QRD A;  1IV9 A;  4IIA A;  3LZA A;  2YFI B;  3NBR A;  5KP4 A;  1NB3 I;  2MF7 A;  2W03 A;  1M9G A;  2Y74 A;  4XBX A;  1ISK A;  3KII A;  3U97 A;  3N8B A;  1HU9 A;  1JNQ A;  1N9J A;  4QWT A;  1OGX A;  2XEP A;  3SLU A;  3N9H A;  4I4K A;  8CHO A;  3NQY A;  3UL5 A;  4HYZ A;  2P38 A;  1PFP A;  1DVD A;  5IER A;  4WP5 A;  1ROV A;  4J9A A;  1E3V A;  3DGM A;  3EB8 A;  1VQ8 3;  4KFF A;  4PEJ A;  4RZM A;  1OCV A;  3DGO A;  1PU4 A;  3PS8 A;  4HM5 B;  2RGQ A;  1KD1 4;  2HMM B;  3S29 A;  1K8A 4;  3MKI A;  2IA7 A;  2IUK A;  3PGB A;  4OUQ A;  2MC8 A;  1SII A;  3BB9 A;  3X41 A;  1DMN A;  1QVF 2;  1K28 A;  1Z1S A;  2WOF A;  1TFO A;  1FGT A;  2W0Q A;  1STF I;  2L4V A;  3DGN A;  1DYU A;  3B4O A;  1ULI B;  1Q40 B;  3AMO B;  4CCV A;  2F98 A;  3SOY A;  2ML6 A;  3L0R A;  2KXG A;  3OWU A;  3CMA 3;  5KP3 A;  3NV0 B;  4LGQ A;  5EQL A;  4STD A;  1S72 3;  3U1W A;  3D9R A;  5CK6 A;  2YX9 A;  3RDE A;  4FMD A;  5IG5 A;  2K54 A;  3GWR A;  1AVL A;  1UI7 A;  1W6G A;  1IDP A;  1OF5 A;  1UW1 A;  2P0M A;  1DMQ A;  1OHP A;  1CYV A;  2Q07 A;  3GRD A;  2F86 B;  3LTB A;  2ZDJ A;  2CFD A;  3A76 A;  3NX0 A;  3EQQ B;  5KP1 A;  1OPY A;  4FR9 A;  4EV5 A;  2BNG A;  2OCT A;  3EC9 A;  3FF0 A;  1R4C A;  2GEY A;  1JJ2 2;  2OTL 3;  2OQE C;  1SJW A;  1US1 A;  3DY5 A;  4HM6 B;  3S28 A;  3CCM 3;  3GZB A;  5IW9 A;  1LXE A;  3Q1C A;  3GZY B;  2XFS A;  1VQN 3;  3PZW A;  4O3V A;  4EBG A;  4N6T A;  4XDV A;  4BTX A;  4N6O B;  2CFK A;  1IVW A;  3GAX A;  2CWT A;  4FCM A;  2ML5 A;  1WTH A;  4HM8 B;  1IV7 A;  1W4N A;  1N9E A;  3CNM A;  4HM0 B;  4L7K A;  4MMY B;  2WGQ A;  3HZP A;  5IG4 A;  1TU5 A;  4WFO A;  2IMJ A;  4R80 A;  5JPP A;  4K1V A;  5AIG A;  3KSE D;  1WMP A;  2KCD A;  1FUW A;  5CF2 A;  2QGU A;  2OQE A;  1QJG A;  1S5A A;  4K61 A;  3WOD G;  2YFL B;  3CPW 2;  3KSP A;  1W00 A;  1JN5 B;  5DRE A;  4N6U A;  2I9W A;  5AEW B;  3EJV A;  1IQY A;  3IJE B;  1EKM A;  3Q2P A;  5AYR B;  5STD A;  1HKX A;  3SXX A;  2W56 B;  5CF1 A;  3FG4 A;  1TP6 A;  5EVH A;  4J8T A;  4N6M A;  5DRV A;  2C10 A;  1VQM 3;  2LQV A;  1D6Z A;  3RGA A;  2BMR B;  1YIJ 3;  3FLJ A;  3K0Z A;  1YJW 3;  3DM8 A;  2E2V A;  1Q40 A;  2XGN A;  3CC7 3;  2WOH A;  3MPH A;  5CXO A;  4H61 A;  1IVX A;  1L5G B;  3G4S 3;  1OUN A;  2PZV A;  4HZB B;  1UUV B;  3EE1 A;  4LZI A;  5AEU B;  1JKG B;  2W04 A;  3NV0 A;  2M7O A;  1OHS A;  2HMK B;  2JQ5 A;  3F7X A;  1RN7 A;  2BHM A;  2CW9 A;  2D42 A;  5JBS A;  4O02 B;  3GZR A;  1EQK A;  4FMA A;  1VQ4 3;  1O7P B;  3B8L A;  5G2G A;  3F7S A;  3X40 A;  1YHQ 3;  1VQL 3;  2OWP A;  1JB5 A;  4HBR A;  5LC7 A;  3NHX A;  2C11 A;  2XFT A;  1ASK A;  2A15 A;  2P0X A;  3FZW A;  2B24 B;  3MWZ A;  1OH0 A;  2OOV C;  3SOA A;  3BNE A;  3JVC A;  1IQX A;  2W9Q A;  1JB4 A;  3NM7 A;  1LVN A;  3FF2 A;  2Z6B A;  2LYX A;  3F8H A;  3V99 A;  3NUV A;  3CCQ 3;  1NDO B;  3F8X A;  5A0O B;  3CC4 3;  2GBW B;  1W02 A;  3NXJ A;  4XBT A;  1VQ6 3;  1TUH A;  1GY5 A;  3X42 A;  1QAF A;  3EF8 A;  4G1M B;  1JB2 A;  4BTW A;  3SX1 A;  2CC3 A;  1JN5 A;  4XBY A;  5BXQ A;  5I97 A;  1GD4 A;  1EA2 A;  3S67 A;  1W6Y A;  1QMA A;  1N5P A;  1GYB A;  4AKZ A;  2QIY A;  2W56 A;  3HII A;  1W01 A;  3FKA A;  3I0Y A;  3OV4 A;  1U8C B;  2STD A;  3KN4 A;  3PCR A;  1M1X B;  2FNQ A;  2P05 A;  2V1L A;  1FGO A;  4MMZ B;  4KVH A;  3LTC A;  5EEO A;  3CCL 3;  3EHC A;  3BNC A;  1GY7 A;  2RFR A;  1CEW I;  3LH4 A;  1IT7 A;  2GXF A;  1YGE A;  4HM7 B;  4OVM A;  3MG1 A;  3WMD A;  4EC6 A;  3PCS A;  4RNZ A;  1M1K 4;  1OGZ A;  3G6E 3;  2E2U A;  3X3Z A;  3CCS 3;  3VF1 A;  1JKG A;  3MG3 A;  3O8Y A;  3X3X A;  3NM2 A;  1E3R A;  1WMN A;  3KKG A;  3LXU X;  4Q53 A;  3MSO A;  4U13 A;  1WQL B;  1FA3 A;  3CU3 A;  3HK4 A;  4R9K A;  5TGN A;  3MYT A;  3V98 A;  4XM4 A;  1Q42 A;  5ELU A;  1YVB I;  4FMC A;  1VQ7 3;  3T8U A;  1VQO 3;  1QAK A;  2KRT A;  1ZO2 A;  4LEH A;  4MMX B;  3PXM A;  3LTA A;  1O7G B;  4JF8 A;  4NHF A;  2WO0 A;  3ROB A;  1G96 A;  3F40 A;  3MG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...