3EBTA

Crystal structure of a ntf2-like protein of unknown function (bpss0132) from burkholderia pseudomallei k96243 at 1.30 a resolution
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
131
structure length
131
Chain Sequence
MSNNMQTVRESYEAFHRRDLPGVLAALAPDVRWTHPDGMSPYGLGGTKHGHDEVIAFIRHVPTHIAEMRLAPDEFIESGERIVVLGTRRVTAVNGRSATLKFVHVWRFENGRAVTFEDHFDTAEMIRLITA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized NTF2-like protein
publication title Crystal structure of NTF2-like protein of unknown function (YP_110153.1) from BURKHOLDERIA PSEUDOMALLEI K96243 at 1.30 A resolution
rcsb
source organism Burkholderia pseudomallei k96243
molecule tags Unknown function
total genus 42
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2008-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ebtA00
4GB5A 1GY7A 4HZ9B 3CNMA 3GWRA 1DMMA 4PEJA 3MG2A 4OVMA 1OF5A 3HX8A 2Z76A 3EHCA 1ISKA 1E3RA 5AIGA 2HMOB 2INXA 4XBYA 1UUWB 4HKVB 3DMCA 3ROBA 4MJDA 1NU3A 1GY6A 3NV0A 3F8HA 3OXAA 3OWSA 3KZTA 3D9RA 2F99A 5IG0A 2RGQA 3K7CA 4OUQA 5CK6A 3K0ZA 3G16A 1OF5B 4L8PA 2OWPA 3B7CA 5KP1A 4KVHA 3NV0B 1W6YA 2Z7AA 3HK4A 3EBYA 3JUQA 4I4KA 1E3VA 4HM8B 2STDA 3JUMA 4N3VA 3G8ZA 3OWUA 4WP5A 3UJMA 3OV4A 5JPUA 3FZWA 2XSHB 3JUOA 2BMOB 5CXOA 1W02A 3T8UA 3NHXA 1ZX2A 3F14A 3VSYA 3LYGA 4STDA 1IDPA 3DXOA 3EF8A 5IEOA 2F98A 5CLKA 2B1XB 1OCVA 3RGRA 4XB5A 1E97A 1Q40A 5D83A 3EQQB 3MG3A 1OUNA 4WWUC 3NBRA 2XSOB 2GBXB 5DRVA 1OPYA 3ECFA 3T8NA 1STDA 2RFRA 3F7SA 5TGNA 1OH0A 3OX9A 1NDOB 3SOAA 3M8CA 1DMQA 3SOYA 2HMKB 3KKGA 1O7NB 3F9SA 1O7HB 4Q53A 2XRXB 1JN5A 3ER7A 3E99A 1O7GB 4CDLA 2UX0A 5BXQA 1OGXA 2BNGA 1JKGA 1ULJB 4FCMA 3B4PA 2HMMB 3CU3A 3DM8A 1U5OA 2CHCA 3KSPA 1Z1SA 3NM2A 4LMIA 2R4IA 4J8TA 2YFJB 6STDA 4WYKA 3A76A 4R1KA 4HM7B 5JPPA 1JN5B 3EJVA 3GZXB 5IG3A 1EA2A 1CQSA 4HM2B 2B24B 1JB5A 1A2KA 4IIAA 1W01A 2QGUA 7STDA 3G0KA 3EBTA 3DUKA 3UNLA 4HM0B 4HM6B 4X2HA 3FH1A 3WMDA 4WYKB 3EN8A 1ASKA 5CF1A 1ULIB 1GY5A 1UUVB 3MG1A 2F86B 4J9AA 4HJLB 5AIIA 4HVNA 2I9WA 2HMLB 4FCJA 3EC9A 3VGNA 8CHOA 5IEPA 1S5AA 3I0YA 4XBXA 1EG9B 5AIHA 1NWWA 3FSDA 4HM4B 3JUPA 3STDA 1TP6A 3OWYA 3CNXA 3KE7A 2GBWB 1GS3A 3H3HA 1JB2A 3FKAA 5G2GA 3F8XA 5AIFA 1W00A 3MKIA 3FLJA 4L7KA 3GZYB 3RGAA 3F7XA 3BB9A 2IMJA 4R9LA 4L8OA 1QJGA 1Q40B 2HMNB 4XBTA 3EX9A 5IG4A 5CF2A 1SJWA 5HGRA 5D81A 2RCDA 3HZPA 3DZLA 3FF2A 1OHSA 2YFIB 3Q90A 5D82A 5BVBA 1QMAA 4HM5B 2QIYA 3IPTA 1Q42A 1OHPA 4LEHA 4ORLA 5IERA 4K1UA 4U13A 4XDWA 1JKGB 3B8LA 1BUQA 2PZVA 5DREA 3NXJA 2Z77A 3GRDA 5KP3A 4HM1B 1WQLB 1VZZA 4XDVA 3F40A 3EN1B 1OHOA 2GEXA 1JB4A 2BMQB 2CKFB 2JQ5A 3B4OA 3BLZA 5KP4A 3S5CA 1TUHA 1DMNA 2K54A 4HM3B 1GYBA 5IENA 5IF6A 4HZBB 2YFLB 4K1VA 4RZMA 1AR0A 1K41A 3GZRA 3FGYA 3LZAA 1O7PB 5AEWB 5AI1A 5EVHA 3MHEA 2XR8B 4X2OA 1OGZA 4LGQA 5AEUB 2HMJB 1ZO2A 4H3UA 4XM4A 2GEYA 1HKXA 5FW5A 5STDA 3MYTA 3FF0A 3MSOA 4R9KA 1O7WB 2A15A 3NUVA 2GXFA 1C7HA 1O7MB 3SEDA 3GZBA 3JUNA 5IG5A 3CPOA 2BMRB 2W2CA 3H51A
chains in the Genus database with same CATH superfamily
4GB5A 2J8XB 1QVG2 2F4YA 3WHOA 4EV2A 1UCKA 1W2B2 1GY7A 1BRSA 1YGEA 4HZ9B 2CIUA 1B21A 3CNMA 3GWRA 1RNTA 4MMYB 3CC23 1DMMA 3V99A 3WODG 4PEJA 3MG2A 3RNTA 4OVMA 1W5ZA 6RNTA 5HOHA 4G1MB 2OQEA 2FXTA 1OF5A 4BTWA 4KFDA 3NQYA 3K9MC 3HX8A 2Z76A 3EHCA 1ISKA 1LVNA 1E3RA 1G0TA 2W03A 1V57A 2ZDJA 5AIGA 1AY7A 2HMOB 1FZUA 2MC8A 2AADA 2INXA 4XBYA 1VQP3 1IU7A 1YIJ3 1UUWB 4HKVB 3WA2X 1FA3A 3DMCA 3ROBA 2P05A 2D42A 3FCSB 4CJNA 1FGRA 1NU3A 4MJDA 1RRHA 3X3YA 1YIT3 1VQN3 1GY6A 1BVIA 3NV0A 3F8HA 1RCLA 3G4S3 1BNGA 2D1WA 1RGKA 3OXAA 4WHAA 3DY5A 1ROVA 3CME3 3OWSA 1JJ22 3KZTA 2JDIH 1CYVA 3D9RA 2F99A 5IG0A 3SVAA 1FUSA 2RGQA 3K7CA 1GMPA 4OUQA 3K63A 1JNQA 5CK6A 3O8YA 3K0ZA 2MF7A 3G16A 3UL6A 1D6UA 2CWTA 1Q814 1X1UA 3X41A 4KT3B 2UGIA 2KRTA 3DGMA 3PYJA 1OF5B 1RCKA 3FG1A 4L8PA 3SX1A 2H0GA 2OWPA 3B7CA 1WNHA 1BNFA 1LOYA 4N6OB 2XFSA 3LOYA 1LOWA 1HYFA 1LXEA 1STFI 4IT7A 5KP1A 1KWIA 1UI7A 4R80A 1GOYA 4KVHA 6GSPA 3LXUX 1BNIA 1W6YA 3NV0B 2GSPA 1FUTA 1RN7A 3KSED 1BRIA 2OCTA 2Z7AA 3LT8A 3HK4A 4FR9A 3EBYA 3JUQA 1BIRA 4I4KA 4DKIA 3X3XA 1E3VA 1GSPA 3NX0A 4HM8B 1WTHA 2STDA 1BRKA 3JUMA 3G8ZA 4N3VA 3OWUA 1RTUA 2Y73A 4WP5A 1DVDA 1NO3A 2XF3A 3NBJA 3UJMA 3OV4A 5JPUA 3FZWA 1W6GA 3L0RA 4EW5A 2XSHB 3V92A 3OW22 3NM7A 1B20A 3JUOA 1B3SA 3SLUA 2BMOB 5CXOA 2P38A 1W02A 3AMOB 3LH4A 1MWSA 2KF3A 2W6JH 3NHXA 3T8UA 1I2FA 1NNVA 1PY3A 2RSXA 4FCZA 8RNTA 1DYUA 1ZX2A 3F14A 4N6NB 4OK0A 4LSOA 3BNBA 3ZG5A 1DETA 1QAFA 3VSYA 3LYGA 1TRQA 4STDA 2E2TA 1IDPA 3DXOA 1MWTA 1BRGA 1W2ZA 2Y74A 1RHLA 1W7CA 3EF8A 2K0MA 5IEOA 2F98A 1VQL3 2IUKA 3N54B 1YVSA 4N6UA 5CLKA 2OTL3 2B1XB 3N9HA 1JBRA 5M19A 4BL2A 5M18A 1OCVA 3RGRA 1LNHA 2CH9A 2W56B 4XB5A 1Q7Y4 2IUJA 4XDVA 3WDGB 2C10A 2CG0A 2C4BA 4NREA 3J7Yd 1K8A4 1V58A 4I5QA 1E97A 1Q40A 5D83A 7GSPA 1M904 1LQMB 3EQQB 3MG3A 1OUNA 4GHOA 4WWUC 3NBRA 3I563 2XSOB 3LTCA 3CPW2 1VQ63 1VQM3 4N6MA 3CCQ3 3SYUA 2BU4A 2GBXB 5DRVA 1OPYA 3ECFA 2CWVA 3G713 4AKYA 3G6E3 1BAOA 1QVF2 3T8NA 1STDA 1RDSA 3H51A 1M9GA 2RFRA 1YI23 3F7SA 4ILFA 4MEIA 5TGNA 1SPUA 1QAKA 1OH0A 1UGHI 3OX9A 1NDOB 2XH9A 3HIGA 4HAAA 2IYJA 1CEWI 3SOAA 1N5HA 1BGSA 2BIRA 3NQZA 1TIJA 2ZL8A 3GSPA 1X1XA 3M8CA 3RDEA 1DMQA 1L5GB 1D6ZA 1RRLA 1R4YA 3SOYA 3CCU3 1CYUA 1D6YA 4N6V0 2HMKB 1PFPA 3CCS3 3KKGA 1O7NB 3F9SA 3VF1A 1O7HB 3DGLA 5BIRA 1IT8A 4Q53A 5JBSA 4FMDA 2XRXB 2IY2A 4HBRA 3I553 1JN5A 2QA43 4RNYA 3ER7A 1FGOA 3U1WA 3E99A 1O7GB 1VQQA 1BNEA 3DH2A 3ZG0A 2ZA4A 2UX0A 2CG1A 4CDLA 5BXQA 1OGXA 2PNCA 5AYRB 1I8VA 2BNGA 1YJW3 1JKGA 1ULJB 2CW9A 3WOFB 4FCMA 3D3LA 3CCV3 1VQ43 3B4PA 3MPHA 2HMMB 3CU3A 4J5KA 2XGNA 4WFOA 3DM8A 1DVCA 5A0OB 3DGOA 1ZS7A 5GSPA 2RNTA 1U5OA 2CHCA 3KSPA 3JVCA 2XFTA 1Z1SA 1N9EA 2CFLA 5BU4A 2KF6A 3KCHA 3NM2A 1YHQ3 4LMIA 1RSNA 2CFDA 5ELUA 1UCLA 1VQ83 2R4IA 4J8TA 1M1K4 1UCJA 4HOHA 1S723 4IPBA 1G02A 1MWRA 2YFJB 4RNZA 6STDA 1SIHA 2L1SA 3A76A 4R1KA 4WYKA 5EQLA 1FGQA 1LQGC 2SBLA 3KIIA 4HM7B 1KD14 5JPPA 4N6TA 1JN5B 5FGOA 2RBIA 3EJVA 3GZXB 5IG3A 2FNQA 4BL3A 1QALA 1EA2A 1IVUA 1CQSA 2WGOA 2ZHXB 1FGTA 1NB3I 3DGYA 4HM2B 1AV4A 2B24B 2W04A 1IVVA 1SIIA 1JB5A 1LRAA 3CCR3 1LOVA 1A2KA 1TFKA 3LTDA 1BANA 1SARA 4IIAA 4O8SA 1W01A 2F56A 4BTXA 1GD3A 2QGUA 1B2ZA 7STDA 1F8NA 3EBTA 3G0KA 3DUKA 3UNLA 1RNBA 1JZOA 4HM0B 4HM6B 4X2HA 3FH1A 1RGLA 3WMDA 4WYKB 3AHWA 1BUJA 3S67A 4K61A 1RLSA 3CCE3 3CCM3 3T0UA 1PU4A 1K734 1T2HA 3X40A 3EN8A 1ASKA 1PYLA 1AVLA 5CF1A 4CPKA 1BSAA 2V1LA 4KFFA 1ULIB 1GY5A 1UUVB 2AAEA 1LNIA 1T5YA 3MG1A 1M1XB 3WA3A 1C54A 2F86B 2Z6BA 4J9AA 1AVKA 3PCSA 5ELJA 4J5GA 5LC6A 1J2BA 1JV2B 3EB8A 1TFOA 4HJLB 1IVWA 3IJEB 3AHSA 4KZ1A 1VQK3 5AIIA 1RGGA 4HVNA 2I9WA 2HMLB 3AGOA 4FCJA 3BNDA 1MOLA 3EC9A 3VGNA 8CHOA 5IEPA 1A90A 3MWZA 2LYXA 1S5AA 3PCRA 3I0YA 1VQ53 7RNTA 1Q9EA 4XBXA 1EG9B 5AIHA 2XEPA 1NWWA 3QRDA 1K28A 2WO0A 2OTJ3 3CCL3 1RN4A 2O9UX 3FSDA 3AGNA 1BSDA 2CFKA 1DE3A 3CMA3 1GMRA 1TTOA 4HM4B 3CC43 1BNRA 1RGEA 2F5WA 3JUPA 1G96A 4NPBA 3STDA 1KC84 5I97A 5AYSC 1JBSA 1RN1A 1W6CA 1IYYA 1RKYA 1TP6A 3OWYA 3CNXA 2CC3A 3KE7A 2GBWB 1UCIA 1GS3A 3H3HA 1JB2A 3FKAA 3KN4A 5G2GA 1IT7A 1LOXA 1V74A 3F8XA 5AIFA 1W00A 3MKIA 3GAXA 1UUGB 3FLJA 4L7KA 3CCJ3 3GZYB 3LTBA 3RGAA 3BU4A 3F7XA 4ZM8A 1BNJA 1BSEA 2CFGA 1SQWA 1ZGXA 2CK3H 3BB9A 1I0VA 1RGCA 1US1A 3FG4A 1JBTA 4EV5A 2IMJA 1N8QA 4LYLB 3S27A 4R9LA 1UDII 1N9JA 3Q3FA 1N5PA 3CD63 1FYSA 4L8OA 5G1LA 1QJGA 1Q40B 2HMNB 1AQZA 4XBTA 3EX9A 1MNLA 2XGLA 5IG4A 5CF2A 3HOHA 1KSIA 3ZFZA 1JZDA 1WMPA 1WMOA 1YVBI 2SARA 3CXC2 1BNSA 2CFWA 1IVXA 1SJWA 4JRFA 2W9QA 1FW7A 2OOVA 1TU5A 1I2EA 5HGRA 5D81A 2RCDA 2H0HA 3S28A 2BHMA 4NHFA 5LC7A 1BRHA 3BIRA 3Q2PA 1FUWA 3HZPA 1BRNL 2P0MA 3DZLA 5M1AA 3FF2A 1I3FA 3N8BA 1X1YA 3PGBA 1YNVX 1RGHA 2K3DA 1IV7A 1B27A 1OHSA 2YFIB 3Q90A 5D82A 5BVBA 1QMAA 4AKZA 2BT3A 4HM5B 1NB5I 2QIYA 1I70A 3D5GA 2KCDA 4H61A 1IQXA 3V98A 1IV9A 2CWUA 4GL6A 3X3ZA 1VQ93 3A5EA 2ML5A 1OACA 1Q7HA 2WOFA 4RNTA 1A2VA 3IPTA 2P0XA 1Y4KA 3K5TA 1KQS2 1Q42A 2W9PA 1RMSA 1A67A 1EUIC 1OHPA 2L4VA 4LEHA 4ORLA 3SXXA 1VQO3 3UL5A 5IERA 1A2PA 4K1UA 2W2CA 3TDGA 4BU4A 4MMZB 2LQVA 4U13A 4XDWA 1T3BA 2WGQA 1JKGB 3B8LA 1BUQA 2PZVA 5DREA 3EE1A 2Z77A 3GRDA 3NXJA 4CCVA 1NJI4 1B2XA 4QWTA 5KP3A 3HI7A 2KF4A 1BSCA 4GSPA 2BO9B 3WR2A 4HM1B 4BTYA 4RBNA 4O02B 1GD4A 1GOUA 1WQLB 1Q824 2FGTA 4O2HA 1VZZA 3U97A 3NBBA 1YJN3 3QK9A 1B2UA 1BOXA 3F40A 2CX1A 1JRQA 3AMOA 3EN1B 3LT9A 1OHOA 3IMAB 2GEXA 1JB4A 4EC6A 2BMQB 3KFQC 2CKFB 2F5MA 1N8R4 2JQ5A 3B4OA 1IQYA 3BLZA 5KP4A 2R41A 1ROAA 3D5IA 2UUGC 1I3IA 3S5CA 1IK3A 3Q1CA 2O3OA 1TUHA 1R4CA 2KF5A 1DMNA 1HZ1A 2K54A 3HIIA 4HM3B 1EEJA 1W4NA 1RGAA 3PZWA 1MGWA 1RGFA 1GYBA 1BU4A 2IA7A 5IENA 1UGIA 2C11A 2GU3A 5IF6A 4R4KA 4HZBB 1WMNA 3WOEB 1VQ73 2ML6A 4K90B 2W56A 4N6LA 2OQEC 2YFLB 5RNTA 3URPA 2H0IA 4K1VA 4RZMA 3X42A 3DGNA 2GU1A 2CX0A 1AR0A 4MMXB 1X1WA 1K41A 3GZRA 1BRJA 1GMQA 1UI8A 4BIRA 4O3VA 2HOHA 3FGYA 3LZAA 1YGWA 2Q07A 3S29A 1O7PB 2W0QA 2E2VA 5AEWB 5AI1A 1RJOA 2WOHA 3MHEA 5EVHA 3BNCA 5EEOA 2XR8B 2YX9A 4FMCA 1BSBA 4FMBA 1TJDA 3ALAA 4TX4A 1B2MA 3PXMA 5G1KA 1CH0A 1I0XA 4X2OA 3D79A 1OGZA 3LTAA 4LGQA 4AEQA 4EBGA 4FMAA 1Q864 1K9M4 4EYCA 1I2GA 5AEUB 2HMJB 2M7OA 2P09A 1ZO2A 4H3UA 1EKMA 1HU9A 4LZIA 4XM4A 2GEYA 1HKXA 1MWUA 2KXGA 1YJ93 1GOVA 5FW5A 5STDA 1U8CB 3PS8A 3UB1A 2QEX3 1FGMA 4HYZA 1TRPA 3MYTA 1EQKA 5IW9A 3LMLA 3FF0A 3MSOA 4R9KA 2E2UA 1MGRA 3D4AA 2OOVC 3CC73 1O7WB 2KAAA 4JF8A 1UW1A 2A15A 3NUVA 2GXFA 1C7HA 1O7MB 9RNTA 4KFEA 3FG3A 4EXRA 3SEDA 3GZBA 1B2SA 3JUNA 5IG5A 3CPOA 2BMRB 1T2IA 1IQ8A 3BNEA
chains in the Genus database with same CATH topology
4GB5A 1QVG2 4EV2A 1W2B2 1GY7A 1YGEA 4HZ9B 2CIUA 3CNMA 3GWRA 4MMYB 3CC23 1DMMA 3V99A 3WODG 4PEJA 3MG2A 4OVMA 1W5ZA 4G1MB 2OQEA 2FXTA 1OF5A 4BTWA 4KFDA 3NQYA 3K9MC 3HX8A 2Z76A 3EHCA 1ISKA 1LVNA 1E3RA 2W03A 2ZDJA 5AIGA 2HMOB 1VQP3 2MC8A 2INXA 1YIJ3 4XBYA 1IU7A 1UUWB 4HKVB 3WA2X 1FA3A 3DMCA 3ROBA 2P05A 2D42A 3FCSB 1VQN3 1FGRA 1NU3A 4MJDA 1RRHA 3X3YA 1YIT3 3CD63 1GY6A 3NV0A 3F8HA 3G4S3 2D1WA 3OXAA 4WHAA 3DY5A 1ROVA 3CME3 3OWSA 1JJ22 3KZTA 2JDIH 1CYVA 3D9RA 2F99A 5IG0A 3SVAA 2RGQA 3K7CA 4OUQA 3K63A 1JNQA 5CK6A 3O8YA 3K0ZA 2MF7A 3G16A 3UL6A 1D6UA 2CWTA 1Q814 3X41A 2KRTA 3DGMA 3PYJA 1OF5B 3FG1A 4L8PA 3SX1A 2OWPA 3B7CA 1WNHA 4N6OB 2XFSA 3LOYA 1LXEA 1STFI 4IT7A 5KP1A 1KWIA 1UI7A 4R80A 4KVHA 3LXUX 3NV0B 1W6YA 1RN7A 3KSED 2OCTA 2Z7AA 3LT8A 3HK4A 4FR9A 3EBYA 3JUQA 4I4KA 3X3XA 1E3VA 3NX0A 4HM8B 1WTHA 2STDA 3JUMA 4N3VA 3G8ZA 3OWUA 2Y73A 4WP5A 1DVDA 1NO3A 2XF3A 3NBJA 3UJMA 3OV4A 5JPUA 3FZWA 1W6GA 3L0RA 2XSHB 3V92A 3OW22 3NM7A 3SLUA 3JUOA 2BMOB 5CXOA 2P38A 1W02A 3AMOB 3LH4A 2W6JH 3NHXA 3T8UA 4FCZA 2RSXA 1DYUA 1ZX2A 3F14A 4N6NB 4OK0A 4LSOA 3BNBA 1QAFA 3VSYA 3LYGA 4STDA 2E2TA 1IDPA 3DXOA 1W2ZA 2Y74A 3EF8A 1W7CA 2K0MA 5IEOA 2F98A 1VQL3 2IUKA 3N54B 4N6UA 5CLKA 2OTL3 2B1XB 3N9HA 1OCVA 3RGRA 1LNHA 2CH9A 2W56B 4XB5A 1Q7Y4 2IUJA 3WDGB 2C10A 2CG0A 4NREA 3J7Yd 1K8A4 1E97A 1Q40A 5D83A 1M904 3EQQB 3MG3A 1OUNA 4WWUC 3I563 3NBRA 3CPW2 2XSOB 3LTCA 1VQ63 1VQM3 4N6MA 3CCQ3 2GBXB 5DRVA 1OPYA 3ECFA 2CWVA 3G713 4AKYA 3G6E3 1QVF2 3T8NA 1STDA 3H51A 1M9GA 2RFRA 1YI23 3F7SA 4MEIA 5TGNA 1SPUA 1QAKA 1OH0A 3OX9A 1NDOB 2XH9A 3HIGA 1CEWI 3SOAA 1N5HA 3NQZA 1TIJA 2ZL8A 3M8CA 3RDEA 1DMQA 1L5GB 1D6ZA 1RRLA 3SOYA 3CCU3 1CYUA 1D6YA 4N6V0 2HMKB 1PFPA 3CCS3 3KKGA 1O7NB 3F9SA 3VF1A 1O7HB 3DGLA 1IT8A 4Q53A 5JBSA 4FMDA 2XRXB 4HBRA 3I553 1JN5A 2QA43 4RNYA 3ER7A 1FGOA 3U1WA 3E99A 1O7GB 4CDLA 1PU4A 2CG1A 2UX0A 5BXQA 1OGXA 2PNCA 5AYRB 2BNGA 1YJW3 1JKGA 1ULJB 2CW9A 3WOFB 4FCMA 3D3LA 3CCV3 1VQ43 3B4PA 3MPHA 2HMMB 3CU3A 4WFOA 2XGNA 3DM8A 1DVCA 5A0OB 3DGOA 1U5OA 2CHCA 3KSPA 3JVCA 2XFTA 1Z1SA 1N9EA 2CFLA 3NM2A 1YHQ3 4LMIA 2CFDA 5ELUA 1VQ83 2R4IA 4J8TA 1M1K4 1S723 4IPBA 2YFJB 4RNZA 6STDA 1SIHA 4WYKA 3A76A 4R1KA 5EQLA 1FGQA 2SBLA 3KIIA 4HM7B 1KD14 5JPPA 4N6TA 1JN5B 5FGOA 3EJVA 3GZXB 5IG3A 2FNQA 1QALA 1EA2A 1IVUA 1CQSA 2WGOA 1FGTA 1NB3I 4HM2B 1AV4A 2B24B 2W04A 1IVVA 1SIIA 1JB5A 3CCR3 1A2KA 1TFKA 3LTDA 4IIAA 4O8SA 1W01A 4BTXA 1GD3A 2QGUA 7STDA 1F8NA 3EBTA 3G0KA 3DUKA 3UNLA 4HM0B 4HM6B 4X2HA 3FH1A 3WMDA 4WYKB 3S67A 4K61A 3CCE3 3CCM3 3T0UA 1K734 3X40A 3EN8A 1ASKA 1AVLA 5CF1A 2V1LA 4KFFA 1ULIB 1GY5A 1UUVB 3MG1A 1T5YA 3WA3A 1M1XB 2F86B 2Z6BA 4J9AA 1AVKA 3PCSA 5ELJA 5LC6A 1J2BA 1JV2B 3EB8A 1TFOA 4HJLB 1IVWA 3IJEB 4KZ1A 1VQK3 5AIIA 4HVNA 2I9WA 2HMLB 4FCJA 3BNDA 1MOLA 3EC9A 3VGNA 8CHOA 5IEPA 1A90A 3MWZA 2LYXA 1S5AA 3PCRA 3I0YA 1VQ53 4XBXA 1EG9B 5AIHA 2XEPA 1NWWA 3QRDA 1K28A 2WO0A 2OTJ3 3CCL3 2O9UX 3FSDA 2CFKA 3CMA3 4HM4B 3CC43 3JUPA 1G96A 3STDA 1KC84 5I97A 5AYSC 1W6CA 1RKYA 1TP6A 3OWYA 3CNXA 2CC3A 3KE7A 2GBWB 1GS3A 3H3HA 1JB2A 3FKAA 3KN4A 5G2GA 1IT7A 1LOXA 1V74A 3F8XA 5AIFA 1W00A 3MKIA 3GAXA 3FLJA 4L7KA 3CCJ3 3GZYB 3LTBA 3RGAA 4ZM8A 3F7XA 2CFGA 3BB9A 1SQWA 2CK3H 1US1A 3FG4A 4EV5A 2IMJA 1N8QA 3S27A 4R9LA 1N9JA 1N5PA 4L8OA 1QJGA 1Q40B 2HMNB 4XBTA 3EX9A 1MNLA 2XGLA 5IG4A 5CF2A 1KSIA 1WMPA 1WMOA 1YVBI 3CXC2 2CFWA 1IVXA 1SJWA 4JRFA 2W9QA 2OOVA 1TU5A 5HGRA 5D81A 2RCDA 3S28A 2BHMA 4NHFA 5LC7A 3Q2PA 1FUWA 3HZPA 2P0MA 3DZLA 3FF2A 3PGBA 3N8BA 1IV7A 1OHSA 2YFIB 3Q90A 5D82A 5BVBA 1QMAA 4AKZA 2BT3A 4HM5B 1NB5I 2QIYA 2KCDA 4H61A 1IQXA 3V98A 1IV9A 2CWUA 4GL6A 3X3ZA 1VQ93 2ML5A 1OACA 2WOFA 1A2VA 3IPTA 2P0XA 1Y4KA 3K5TA 1KQS2 1Q42A 2W9PA 1A67A 1OHPA 2L4VA 4LEHA 4ORLA 3SXXA 1VQO3 3UL5A 5IERA 4K1UA 3TDGA 4MMZB 2LQVA 4U13A 4XDWA 2WGQA 1JKGB 3B8LA 1BUQA 2PZVA 5DREA 3EE1A 2Z77A 3GRDA 3NXJA 4CCVA 1NJI4 4QWTA 5KP3A 3HI7A 2BO9B 4HM1B 4BTYA 4RBNA 4O02B 1GD4A 1WQLB 1Q824 2FGTA 4O2HA 1VZZA 3U97A 3NBBA 1YJN3 3QK9A 4XDVA 3F40A 1JRQA 3AMOA 3EN1B 3LT9A 1OHOA 3IMAB 2GEXA 1JB4A 4EC6A 2BMQB 3KFQC 2CKFB 1N8R4 2JQ5A 3B4OA 1IQYA 3BLZA 5KP4A 1ROAA 1IK3A 3S5CA 3Q1CA 2O3OA 1TUHA 1R4CA 1DMNA 2K54A 3HIIA 4HM3B 1W4NA 3PZWA 1GYBA 2IA7A 5IENA 2C11A 2GU3A 5IF6A 4R4KA 4HZBB 1WMNA 3WOEB 1VQ73 2ML6A 4K90B 2W56A 4N6LA 2YFLB 2OQEC 4K1VA 3X42A 4RZMA 3DGNA 2GU1A 1AR0A 4MMXB 1K41A 3GZRA 1UI8A 4O3VA 3FGYA 3LZAA 2Q07A 3S29A 1O7PB 2W0QA 2E2VA 5AEWB 5AI1A 1RJOA 2WOHA 3MHEA 5EVHA 3BNCA 5EEOA 2XR8B 2YX9A 4FMCA 4FMBA 3ALAA 4TX4A 3PXMA 4X2OA 1OGZA 3LTAA 4LGQA 4AEQA 4EBGA 4FMAA 1Q864 1K9M4 4EYCA 5AEUB 2HMJB 2M7OA 2P09A 1ZO2A 4H3UA 1HU9A 1EKMA 4LZIA 4XM4A 2GEYA 1HKXA 2KXGA 1YJ93 5FW5A 5STDA 1U8CB 3PS8A 3UB1A 2QEX3 1FGMA 4HYZA 3MYTA 1EQKA 5IW9A 3LMLA 3FF0A 3MSOA 4R9KA 2E2UA 2OOVC 3CC73 1O7WB 4JF8A 1UW1A 2A15A 3NUVA 2GXFA 1C7HA 1O7MB 4KFEA 3FG3A 4EXRA 3SEDA 3GZBA 3JUNA 5IG5A 3CPOA 2BMRB 2W2CA 1IQ8A 3BNEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GB5 A;  1GY7 A;  4HZ9 B;  3CNM A;  3GWR A;  1DMM A;  4PEJ A;  3MG2 A;  4OVM A;  1OF5 A;  3HX8 A;  2Z76 A;  3EHC A;  1ISK A;  1E3R A;  5AIG A;  2HMO B;  2INX A;  4XBY A;  1UUW B;  4HKV B;  3DMC A;  3ROB A;  4MJD A;  1NU3 A;  1GY6 A;  3NV0 A;  3F8H A;  3OXA A;  3OWS A;  3KZT A;  3D9R A;  2F99 A;  5IG0 A;  2RGQ A;  3K7C A;  4OUQ A;  5CK6 A;  3K0Z A;  3G16 A;  1OF5 B;  4L8P A;  2OWP A;  3B7C A;  5KP1 A;  4KVH A;  3NV0 B;  1W6Y A;  2Z7A A;  3HK4 A;  3EBY A;  3JUQ A;  4I4K A;  1E3V A;  4HM8 B;  2STD A;  3JUM A;  4N3V A;  3G8Z A;  3OWU A;  4WP5 A;  3UJM A;  3OV4 A;  5JPU A;  3FZW A;  2XSH B;  3JUO A;  2BMO B;  5CXO A;  1W02 A;  3T8U A;  3NHX A;  1ZX2 A;  3F14 A;  3VSY A;  3LYG A;  4STD A;  1IDP A;  3DXO A;  3EF8 A;  5IEO A;  2F98 A;  5CLK A;  2B1X B;  1OCV A;  3RGR A;  4XB5 A;  1E97 A;  1Q40 A;  5D83 A;  3EQQ B;  3MG3 A;  1OUN A;  4WWU C;  3NBR A;  2XSO B;  2GBX B;  5DRV A;  1OPY A;  3ECF A;  3T8N A;  1STD A;  2RFR A;  3F7S A;  5TGN A;  1OH0 A;  3OX9 A;  1NDO B;  3SOA A;  3M8C A;  1DMQ A;  3SOY A;  2HMK B;  3KKG A;  1O7N B;  3F9S A;  1O7H B;  4Q53 A;  2XRX B;  1JN5 A;  3ER7 A;  3E99 A;  1O7G B;  4CDL A;  2UX0 A;  5BXQ A;  1OGX A;  2BNG A;  1JKG A;  1ULJ B;  4FCM A;  3B4P A;  2HMM B;  3CU3 A;  3DM8 A;  1U5O A;  2CHC A;  3KSP A;  1Z1S A;  3NM2 A;  4LMI A;  2R4I A;  4J8T A;  2YFJ B;  6STD A;  4WYK A;  3A76 A;  4R1K A;  4HM7 B;  5JPP A;  1JN5 B;  3EJV A;  3GZX B;  5IG3 A;  1EA2 A;  1CQS A;  4HM2 B;  2B24 B;  1JB5 A;  1A2K A;  4IIA A;  1W01 A;  2QGU A;  7STD A;  3G0K A;  3EBT A;  3DUK A;  3UNL A;  4HM0 B;  4HM6 B;  4X2H A;  3FH1 A;  3WMD A;  4WYK B;  3EN8 A;  1ASK A;  5CF1 A;  1ULI B;  1GY5 A;  1UUV B;  3MG1 A;  2F86 B;  4J9A A;  4HJL B;  5AII A;  4HVN A;  2I9W A;  2HML B;  4FCJ A;  3EC9 A;  3VGN A;  8CHO A;  5IEP A;  1S5A A;  3I0Y A;  4XBX A;  1EG9 B;  5AIH A;  1NWW A;  3FSD A;  4HM4 B;  3JUP A;  3STD A;  1TP6 A;  3OWY A;  3CNX A;  3KE7 A;  2GBW B;  1GS3 A;  3H3H A;  1JB2 A;  3FKA A;  5G2G A;  3F8X A;  5AIF A;  1W00 A;  3MKI A;  3FLJ A;  4L7K A;  3GZY B;  3RGA A;  3F7X A;  3BB9 A;  2IMJ A;  4R9L A;  4L8O A;  1QJG A;  1Q40 B;  2HMN B;  4XBT A;  3EX9 A;  5IG4 A;  5CF2 A;  1SJW A;  5HGR A;  5D81 A;  2RCD A;  3HZP A;  3DZL A;  3FF2 A;  1OHS A;  2YFI B;  3Q90 A;  5D82 A;  5BVB A;  1QMA A;  4HM5 B;  2QIY A;  3IPT A;  1Q42 A;  1OHP A;  4LEH A;  4ORL A;  5IER A;  4K1U A;  4U13 A;  4XDW A;  1JKG B;  3B8L A;  1BUQ A;  2PZV A;  5DRE A;  3NXJ A;  2Z77 A;  3GRD A;  5KP3 A;  4HM1 B;  1WQL B;  1VZZ A;  4XDV A;  3F40 A;  3EN1 B;  1OHO A;  2GEX A;  1JB4 A;  2BMQ B;  2CKF B;  2JQ5 A;  3B4O A;  3BLZ A;  5KP4 A;  3S5C A;  1TUH A;  1DMN A;  2K54 A;  4HM3 B;  1GYB A;  5IEN A;  5IF6 A;  4HZB B;  2YFL B;  4K1V A;  4RZM A;  1AR0 A;  1K41 A;  3GZR A;  3FGY A;  3LZA A;  1O7P B;  5AEW B;  5AI1 A;  5EVH A;  3MHE A;  2XR8 B;  4X2O A;  1OGZ A;  4LGQ A;  5AEU B;  2HMJ B;  1ZO2 A;  4H3U A;  4XM4 A;  2GEY A;  1HKX A;  5FW5 A;  5STD A;  3MYT A;  3FF0 A;  3MSO A;  4R9K A;  1O7W B;  2A15 A;  3NUV A;  2GXF A;  1C7H A;  1O7M B;  3SED A;  3GZB A;  3JUN A;  5IG5 A;  3CPO A;  2BMR B;  2W2C A;  3H51 A; 
#chains in the Genus database with same CATH topology
 4GB5 A;  2J8X B;  1QVG 2;  2F4Y A;  3WHO A;  4EV2 A;  1UCK A;  1W2B 2;  1GY7 A;  1BRS A;  1YGE A;  4HZ9 B;  2CIU A;  1B21 A;  3CNM A;  3GWR A;  1RNT A;  4MMY B;  3CC2 3;  1DMM A;  3V99 A;  3WOD G;  4PEJ A;  3MG2 A;  3RNT A;  4OVM A;  1W5Z A;  6RNT A;  5HOH A;  4G1M B;  2OQE A;  2FXT A;  1OF5 A;  4BTW A;  4KFD A;  3NQY A;  3K9M C;  3HX8 A;  2Z76 A;  3EHC A;  1ISK A;  1LVN A;  1E3R A;  1G0T A;  2W03 A;  1V57 A;  2ZDJ A;  5AIG A;  1AY7 A;  2HMO B;  1FZU A;  2MC8 A;  2AAD A;  2INX A;  4XBY A;  1VQP 3;  1IU7 A;  1YIJ 3;  1UUW B;  4HKV B;  3WA2 X;  1FA3 A;  3DMC A;  3ROB A;  2P05 A;  2D42 A;  3FCS B;  4CJN A;  1FGR A;  1NU3 A;  4MJD A;  1RRH A;  3X3Y A;  1YIT 3;  1VQN 3;  1GY6 A;  1BVI A;  3NV0 A;  3F8H A;  1RCL A;  3G4S 3;  1BNG A;  2D1W A;  1RGK A;  3OXA A;  4WHA A;  3DY5 A;  1ROV A;  3CME 3;  3OWS A;  1JJ2 2;  3KZT A;  2JDI H;  1CYV A;  3D9R A;  2F99 A;  5IG0 A;  3SVA A;  1FUS A;  2RGQ A;  3K7C A;  1GMP A;  4OUQ A;  3K63 A;  1JNQ A;  5CK6 A;  3O8Y A;  3K0Z A;  2MF7 A;  3G16 A;  3UL6 A;  1D6U A;  2CWT A;  1Q81 4;  1X1U A;  3X41 A;  4KT3 B;  2UGI A;  2KRT A;  3DGM A;  3PYJ A;  1OF5 B;  1RCK A;  3FG1 A;  4L8P A;  3SX1 A;  2H0G A;  2OWP A;  3B7C A;  1WNH A;  1BNF A;  1LOY A;  4N6O B;  2XFS A;  3LOY A;  1LOW A;  1HYF A;  1LXE A;  1STF I;  4IT7 A;  5KP1 A;  1KWI A;  1UI7 A;  4R80 A;  1GOY A;  4KVH A;  6GSP A;  3LXU X;  1BNI A;  1W6Y A;  3NV0 B;  2GSP A;  1FUT A;  1RN7 A;  3KSE D;  1BRI A;  2OCT A;  2Z7A A;  3LT8 A;  3HK4 A;  4FR9 A;  3EBY A;  3JUQ A;  1BIR A;  4I4K A;  4DKI A;  3X3X A;  1E3V A;  1GSP A;  3NX0 A;  4HM8 B;  1WTH A;  2STD A;  1BRK A;  3JUM A;  3G8Z A;  4N3V A;  3OWU A;  1RTU A;  2Y73 A;  4WP5 A;  1DVD A;  1NO3 A;  2XF3 A;  3NBJ A;  3UJM A;  3OV4 A;  5JPU A;  3FZW A;  1W6G A;  3L0R A;  4EW5 A;  2XSH B;  3V92 A;  3OW2 2;  3NM7 A;  1B20 A;  3JUO A;  1B3S A;  3SLU A;  2BMO B;  5CXO A;  2P38 A;  1W02 A;  3AMO B;  3LH4 A;  1MWS A;  2KF3 A;  2W6J H;  3NHX A;  3T8U A;  1I2F A;  1NNV A;  1PY3 A;  2RSX A;  4FCZ A;  8RNT A;  1DYU A;  1ZX2 A;  3F14 A;  4N6N B;  4OK0 A;  4LSO A;  3BNB A;  3ZG5 A;  1DET A;  1QAF A;  3VSY A;  3LYG A;  1TRQ A;  4STD A;  2E2T A;  1IDP A;  3DXO A;  1MWT A;  1BRG A;  1W2Z A;  2Y74 A;  1RHL A;  1W7C A;  3EF8 A;  2K0M A;  5IEO A;  2F98 A;  1VQL 3;  2IUK A;  3N54 B;  1YVS A;  4N6U A;  5CLK A;  2OTL 3;  2B1X B;  3N9H A;  1JBR A;  5M19 A;  4BL2 A;  5M18 A;  1OCV A;  3RGR A;  1LNH A;  2CH9 A;  2W56 B;  4XB5 A;  1Q7Y 4;  2IUJ A;  4XDV A;  3WDG B;  2C10 A;  2CG0 A;  2C4B A;  4NRE A;  3J7Y d;  1K8A 4;  1V58 A;  4I5Q A;  1E97 A;  1Q40 A;  5D83 A;  7GSP A;  1M90 4;  1LQM B;  3EQQ B;  3MG3 A;  1OUN A;  4GHO A;  4WWU C;  3NBR A;  3I56 3;  2XSO B;  3LTC A;  3CPW 2;  1VQ6 3;  1VQM 3;  4N6M A;  3CCQ 3;  3SYU A;  2BU4 A;  2GBX B;  5DRV A;  1OPY A;  3ECF A;  2CWV A;  3G71 3;  4AKY A;  3G6E 3;  1BAO A;  1QVF 2;  3T8N A;  1STD A;  1RDS A;  3H51 A;  1M9G A;  2RFR A;  1YI2 3;  3F7S A;  4ILF A;  4MEI A;  5TGN A;  1SPU A;  1QAK A;  1OH0 A;  1UGH I;  3OX9 A;  1NDO B;  2XH9 A;  3HIG A;  4HAA A;  2IYJ A;  1CEW I;  3SOA A;  1N5H A;  1BGS A;  2BIR A;  3NQZ A;  1TIJ A;  2ZL8 A;  3GSP A;  1X1X A;  3M8C A;  3RDE A;  1DMQ A;  1L5G B;  1D6Z A;  1RRL A;  1R4Y A;  3SOY A;  3CCU 3;  1CYU A;  1D6Y A;  4N6V 0;  2HMK B;  1PFP A;  3CCS 3;  3KKG A;  1O7N B;  3F9S A;  3VF1 A;  1O7H B;  3DGL A;  5BIR A;  1IT8 A;  4Q53 A;  5JBS A;  4FMD A;  2XRX B;  2IY2 A;  4HBR A;  3I55 3;  1JN5 A;  2QA4 3;  4RNY A;  3ER7 A;  1FGO A;  3U1W A;  3E99 A;  1O7G B;  1VQQ A;  1BNE A;  3DH2 A;  3ZG0 A;  2ZA4 A;  2UX0 A;  2CG1 A;  4CDL A;  5BXQ A;  1OGX A;  2PNC A;  5AYR B;  1I8V A;  2BNG A;  1YJW 3;  1JKG A;  1ULJ B;  2CW9 A;  3WOF B;  4FCM A;  3D3L A;  3CCV 3;  1VQ4 3;  3B4P A;  3MPH A;  2HMM B;  3CU3 A;  4J5K A;  2XGN A;  4WFO A;  3DM8 A;  1DVC A;  5A0O B;  3DGO A;  1ZS7 A;  5GSP A;  2RNT A;  1U5O A;  2CHC A;  3KSP A;  3JVC A;  2XFT A;  1Z1S A;  1N9E A;  2CFL A;  5BU4 A;  2KF6 A;  3KCH A;  3NM2 A;  1YHQ 3;  4LMI A;  1RSN A;  2CFD A;  5ELU A;  1UCL A;  1VQ8 3;  2R4I A;  4J8T A;  1M1K 4;  1UCJ A;  4HOH A;  1S72 3;  4IPB A;  1G02 A;  1MWR A;  2YFJ B;  4RNZ A;  6STD A;  1SIH A;  2L1S A;  3A76 A;  4R1K A;  4WYK A;  5EQL A;  1FGQ A;  1LQG C;  2SBL A;  3KII A;  4HM7 B;  1KD1 4;  5JPP A;  4N6T A;  1JN5 B;  5FGO A;  2RBI A;  3EJV A;  3GZX B;  5IG3 A;  2FNQ A;  4BL3 A;  1QAL A;  1EA2 A;  1IVU A;  1CQS A;  2WGO A;  2ZHX B;  1FGT A;  1NB3 I;  3DGY A;  4HM2 B;  1AV4 A;  2B24 B;  2W04 A;  1IVV A;  1SII A;  1JB5 A;  1LRA A;  3CCR 3;  1LOV A;  1A2K A;  1TFK A;  3LTD A;  1BAN A;  1SAR A;  4IIA A;  4O8S A;  1W01 A;  2F56 A;  4BTX A;  1GD3 A;  2QGU A;  1B2Z A;  7STD A;  1F8N A;  3EBT A;  3G0K A;  3DUK A;  3UNL A;  1RNB A;  1JZO A;  4HM0 B;  4HM6 B;  4X2H A;  3FH1 A;  1RGL A;  3WMD A;  4WYK B;  3AHW A;  1BUJ A;  3S67 A;  4K61 A;  1RLS A;  3CCE 3;  3CCM 3;  3T0U A;  1PU4 A;  1K73 4;  1T2H A;  3X40 A;  3EN8 A;  1ASK A;  1PYL A;  1AVL A;  5CF1 A;  4CPK A;  1BSA A;  2V1L A;  4KFF A;  1ULI B;  1GY5 A;  1UUV B;  2AAE A;  1LNI A;  1T5Y A;  3MG1 A;  1M1X B;  3WA3 A;  1C54 A;  2F86 B;  2Z6B A;  4J9A A;  1AVK A;  3PCS A;  5ELJ A;  4J5G A;  5LC6 A;  1J2B A;  1JV2 B;  3EB8 A;  1TFO A;  4HJL B;  1IVW A;  3IJE B;  3AHS A;  4KZ1 A;  1VQK 3;  5AII A;  1RGG A;  4HVN A;  2I9W A;  2HML B;  3AGO A;  4FCJ A;  3BND A;  1MOL A;  3EC9 A;  3VGN A;  8CHO A;  5IEP A;  1A90 A;  3MWZ A;  2LYX A;  1S5A A;  3PCR A;  3I0Y A;  1VQ5 3;  7RNT A;  1Q9E A;  4XBX A;  1EG9 B;  5AIH A;  2XEP A;  1NWW A;  3QRD A;  1K28 A;  2WO0 A;  2OTJ 3;  3CCL 3;  1RN4 A;  2O9U X;  3FSD A;  3AGN A;  1BSD A;  2CFK A;  1DE3 A;  3CMA 3;  1GMR A;  1TTO A;  4HM4 B;  3CC4 3;  1BNR A;  1RGE A;  2F5W A;  3JUP A;  1G96 A;  4NPB A;  3STD A;  1KC8 4;  5I97 A;  5AYS C;  1JBS A;  1RN1 A;  1W6C A;  1IYY A;  1RKY A;  1TP6 A;  3OWY A;  3CNX A;  2CC3 A;  3KE7 A;  2GBW B;  1UCI A;  1GS3 A;  3H3H A;  1JB2 A;  3FKA A;  3KN4 A;  5G2G A;  1IT7 A;  1LOX A;  1V74 A;  3F8X A;  5AIF A;  1W00 A;  3MKI A;  3GAX A;  1UUG B;  3FLJ A;  4L7K A;  3CCJ 3;  3GZY B;  3LTB A;  3RGA A;  3BU4 A;  3F7X A;  4ZM8 A;  1BNJ A;  1BSE A;  2CFG A;  1SQW A;  1ZGX A;  2CK3 H;  3BB9 A;  1I0V A;  1RGC A;  1US1 A;  3FG4 A;  1JBT A;  4EV5 A;  2IMJ A;  1N8Q A;  4LYL B;  3S27 A;  4R9L A;  1UDI I;  1N9J A;  3Q3F A;  1N5P A;  3CD6 3;  1FYS A;  4L8O A;  5G1L A;  1QJG A;  1Q40 B;  2HMN B;  1AQZ A;  4XBT A;  3EX9 A;  1MNL A;  2XGL A;  5IG4 A;  5CF2 A;  3HOH A;  1KSI A;  3ZFZ A;  1JZD A;  1WMP A;  1WMO A;  1YVB I;  2SAR A;  3CXC 2;  1BNS A;  2CFW A;  1IVX A;  1SJW A;  4JRF A;  2W9Q A;  1FW7 A;  2OOV A;  1TU5 A;  1I2E A;  5HGR A;  5D81 A;  2RCD A;  2H0H A;  3S28 A;  2BHM A;  4NHF A;  5LC7 A;  1BRH A;  3BIR A;  3Q2P A;  1FUW A;  3HZP A;  1BRN L;  2P0M A;  3DZL A;  5M1A A;  3FF2 A;  1I3F A;  3N8B A;  1X1Y A;  3PGB A;  1YNV X;  1RGH A;  2K3D A;  1IV7 A;  1B27 A;  1OHS A;  2YFI B;  3Q90 A;  5D82 A;  5BVB A;  1QMA A;  4AKZ A;  2BT3 A;  4HM5 B;  1NB5 I;  2QIY A;  1I70 A;  3D5G A;  2KCD A;  4H61 A;  1IQX A;  3V98 A;  1IV9 A;  2CWU A;  4GL6 A;  3X3Z A;  1VQ9 3;  3A5E A;  2ML5 A;  1OAC A;  1Q7H A;  2WOF A;  4RNT A;  1A2V A;  3IPT A;  2P0X A;  1Y4K A;  3K5T A;  1KQS 2;  1Q42 A;  2W9P A;  1RMS A;  1A67 A;  1EUI C;  1OHP A;  2L4V A;  4LEH A;  4ORL A;  3SXX A;  1VQO 3;  3UL5 A;  5IER A;  1A2P A;  4K1U A;  2W2C A;  3TDG A;  4BU4 A;  4MMZ B;  2LQV A;  4U13 A;  4XDW A;  1T3B A;  2WGQ A;  1JKG B;  3B8L A;  1BUQ A;  2PZV A;  5DRE A;  3EE1 A;  2Z77 A;  3GRD A;  3NXJ A;  4CCV A;  1NJI 4;  1B2X A;  4QWT A;  5KP3 A;  3HI7 A;  2KF4 A;  1BSC A;  4GSP A;  2BO9 B;  3WR2 A;  4HM1 B;  4BTY A;  4RBN A;  4O02 B;  1GD4 A;  1GOU A;  1WQL B;  1Q82 4;  2FGT A;  4O2H A;  1VZZ A;  3U97 A;  3NBB A;  1YJN 3;  3QK9 A;  1B2U A;  1BOX A;  3F40 A;  2CX1 A;  1JRQ A;  3AMO A;  3EN1 B;  3LT9 A;  1OHO A;  3IMA B;  2GEX A;  1JB4 A;  4EC6 A;  2BMQ B;  3KFQ C;  2CKF B;  2F5M A;  1N8R 4;  2JQ5 A;  3B4O A;  1IQY A;  3BLZ A;  5KP4 A;  2R41 A;  1ROA A;  3D5I A;  2UUG C;  1I3I A;  3S5C A;  1IK3 A;  3Q1C A;  2O3O A;  1TUH A;  1R4C A;  2KF5 A;  1DMN A;  1HZ1 A;  2K54 A;  3HII A;  4HM3 B;  1EEJ A;  1W4N A;  1RGA A;  3PZW A;  1MGW A;  1RGF A;  1GYB A;  1BU4 A;  2IA7 A;  5IEN A;  1UGI A;  2C11 A;  2GU3 A;  5IF6 A;  4R4K A;  4HZB B;  1WMN A;  3WOE B;  1VQ7 3;  2ML6 A;  4K90 B;  2W56 A;  4N6L A;  2OQE C;  2YFL B;  5RNT A;  3URP A;  2H0I A;  4K1V A;  4RZM A;  3X42 A;  3DGN A;  2GU1 A;  2CX0 A;  1AR0 A;  4MMX B;  1X1W A;  1K41 A;  3GZR A;  1BRJ A;  1GMQ A;  1UI8 A;  4BIR A;  4O3V A;  2HOH A;  3FGY A;  3LZA A;  1YGW A;  2Q07 A;  3S29 A;  1O7P B;  2W0Q A;  2E2V A;  5AEW B;  5AI1 A;  1RJO A;  2WOH A;  3MHE A;  5EVH A;  3BNC A;  5EEO A;  2XR8 B;  2YX9 A;  4FMC A;  1BSB A;  4FMB A;  1TJD A;  3ALA A;  4TX4 A;  1B2M A;  3PXM A;  5G1K A;  1CH0 A;  1I0X A;  4X2O A;  3D79 A;  1OGZ A;  3LTA A;  4LGQ A;  4AEQ A;  4EBG A;  4FMA A;  1Q86 4;  1K9M 4;  4EYC A;  1I2G A;  5AEU B;  2HMJ B;  2M7O A;  2P09 A;  1ZO2 A;  4H3U A;  1EKM A;  1HU9 A;  4LZI A;  4XM4 A;  2GEY A;  1HKX A;  1MWU A;  2KXG A;  1YJ9 3;  1GOV A;  5FW5 A;  5STD A;  1U8C B;  3PS8 A;  3UB1 A;  2QEX 3;  1FGM A;  4HYZ A;  1TRP A;  3MYT A;  1EQK A;  5IW9 A;  3LML A;  3FF0 A;  3MSO A;  4R9K A;  2E2U A;  1MGR A;  3D4A A;  2OOV C;  3CC7 3;  1O7W B;  2KAA A;  4JF8 A;  1UW1 A;  2A15 A;  3NUV A;  2GXF A;  1C7H A;  1O7M B;  9RNT A;  4KFE A;  3FG3 A;  4EXR A;  3SED A;  3GZB A;  1B2S A;  3JUN A;  5IG5 A;  3CPO A;  2BMR B;  1T2I A;  1IQ8 A;  3BNE A; 
#chains in the Genus database with same CATH homology
 4GB5 A;  1QVG 2;  4EV2 A;  1W2B 2;  1GY7 A;  1YGE A;  4HZ9 B;  2CIU A;  3CNM A;  3GWR A;  4MMY B;  3CC2 3;  1DMM A;  3V99 A;  3WOD G;  4PEJ A;  3MG2 A;  4OVM A;  1W5Z A;  4G1M B;  2OQE A;  2FXT A;  1OF5 A;  4BTW A;  4KFD A;  3NQY A;  3K9M C;  3HX8 A;  2Z76 A;  3EHC A;  1ISK A;  1LVN A;  1E3R A;  2W03 A;  2ZDJ A;  5AIG A;  2HMO B;  1VQP 3;  2MC8 A;  2INX A;  1YIJ 3;  4XBY A;  1IU7 A;  1UUW B;  4HKV B;  3WA2 X;  1FA3 A;  3DMC A;  3ROB A;  2P05 A;  2D42 A;  3FCS B;  1VQN 3;  1FGR A;  1NU3 A;  4MJD A;  1RRH A;  3X3Y A;  1YIT 3;  3CD6 3;  1GY6 A;  3NV0 A;  3F8H A;  3G4S 3;  2D1W A;  3OXA A;  4WHA A;  3DY5 A;  1ROV A;  3CME 3;  3OWS A;  1JJ2 2;  3KZT A;  2JDI H;  1CYV A;  3D9R A;  2F99 A;  5IG0 A;  3SVA A;  2RGQ A;  3K7C A;  4OUQ A;  3K63 A;  1JNQ A;  5CK6 A;  3O8Y A;  3K0Z A;  2MF7 A;  3G16 A;  3UL6 A;  1D6U A;  2CWT A;  1Q81 4;  3X41 A;  2KRT A;  3DGM A;  3PYJ A;  1OF5 B;  3FG1 A;  4L8P A;  3SX1 A;  2OWP A;  3B7C A;  1WNH A;  4N6O B;  2XFS A;  3LOY A;  1LXE A;  1STF I;  4IT7 A;  5KP1 A;  1KWI A;  1UI7 A;  4R80 A;  4KVH A;  3LXU X;  3NV0 B;  1W6Y A;  1RN7 A;  3KSE D;  2OCT A;  2Z7A A;  3LT8 A;  3HK4 A;  4FR9 A;  3EBY A;  3JUQ A;  4I4K A;  3X3X A;  1E3V A;  3NX0 A;  4HM8 B;  1WTH A;  2STD A;  3JUM A;  4N3V A;  3G8Z A;  3OWU A;  2Y73 A;  4WP5 A;  1DVD A;  1NO3 A;  2XF3 A;  3NBJ A;  3UJM A;  3OV4 A;  5JPU A;  3FZW A;  1W6G A;  3L0R A;  2XSH B;  3V92 A;  3OW2 2;  3NM7 A;  3SLU A;  3JUO A;  2BMO B;  5CXO A;  2P38 A;  1W02 A;  3AMO B;  3LH4 A;  2W6J H;  3NHX A;  3T8U A;  4FCZ A;  2RSX A;  1DYU A;  1ZX2 A;  3F14 A;  4N6N B;  4OK0 A;  4LSO A;  3BNB A;  1QAF A;  3VSY A;  3LYG A;  4STD A;  2E2T A;  1IDP A;  3DXO A;  1W2Z A;  2Y74 A;  3EF8 A;  1W7C A;  2K0M A;  5IEO A;  2F98 A;  1VQL 3;  2IUK A;  3N54 B;  4N6U A;  5CLK A;  2OTL 3;  2B1X B;  3N9H A;  1OCV A;  3RGR A;  1LNH A;  2CH9 A;  2W56 B;  4XB5 A;  1Q7Y 4;  2IUJ A;  3WDG B;  2C10 A;  2CG0 A;  4NRE A;  3J7Y d;  1K8A 4;  1E97 A;  1Q40 A;  5D83 A;  1M90 4;  3EQQ B;  3MG3 A;  1OUN A;  4WWU C;  3I56 3;  3NBR A;  3CPW 2;  2XSO B;  3LTC A;  1VQ6 3;  1VQM 3;  4N6M A;  3CCQ 3;  2GBX B;  5DRV A;  1OPY A;  3ECF A;  2CWV A;  3G71 3;  4AKY A;  3G6E 3;  1QVF 2;  3T8N A;  1STD A;  3H51 A;  1M9G A;  2RFR A;  1YI2 3;  3F7S A;  4MEI A;  5TGN A;  1SPU A;  1QAK A;  1OH0 A;  3OX9 A;  1NDO B;  2XH9 A;  3HIG A;  1CEW I;  3SOA A;  1N5H A;  3NQZ A;  1TIJ A;  2ZL8 A;  3M8C A;  3RDE A;  1DMQ A;  1L5G B;  1D6Z A;  1RRL A;  3SOY A;  3CCU 3;  1CYU A;  1D6Y A;  4N6V 0;  2HMK B;  1PFP A;  3CCS 3;  3KKG A;  1O7N B;  3F9S A;  3VF1 A;  1O7H B;  3DGL A;  1IT8 A;  4Q53 A;  5JBS A;  4FMD A;  2XRX B;  4HBR A;  3I55 3;  1JN5 A;  2QA4 3;  4RNY A;  3ER7 A;  1FGO A;  3U1W A;  3E99 A;  1O7G B;  4CDL A;  1PU4 A;  2CG1 A;  2UX0 A;  5BXQ A;  1OGX A;  2PNC A;  5AYR B;  2BNG A;  1YJW 3;  1JKG A;  1ULJ B;  2CW9 A;  3WOF B;  4FCM A;  3D3L A;  3CCV 3;  1VQ4 3;  3B4P A;  3MPH A;  2HMM B;  3CU3 A;  4WFO A;  2XGN A;  3DM8 A;  1DVC A;  5A0O B;  3DGO A;  1U5O A;  2CHC A;  3KSP A;  3JVC A;  2XFT A;  1Z1S A;  1N9E A;  2CFL A;  3NM2 A;  1YHQ 3;  4LMI A;  2CFD A;  5ELU A;  1VQ8 3;  2R4I A;  4J8T A;  1M1K 4;  1S72 3;  4IPB A;  2YFJ B;  4RNZ A;  6STD A;  1SIH A;  4WYK A;  3A76 A;  4R1K A;  5EQL A;  1FGQ A;  2SBL A;  3KII A;  4HM7 B;  1KD1 4;  5JPP A;  4N6T A;  1JN5 B;  5FGO A;  3EJV A;  3GZX B;  5IG3 A;  2FNQ A;  1QAL A;  1EA2 A;  1IVU A;  1CQS A;  2WGO A;  1FGT A;  1NB3 I;  4HM2 B;  1AV4 A;  2B24 B;  2W04 A;  1IVV A;  1SII A;  1JB5 A;  3CCR 3;  1A2K A;  1TFK A;  3LTD A;  4IIA A;  4O8S A;  1W01 A;  4BTX A;  1GD3 A;  2QGU A;  7STD A;  1F8N A;  3EBT A;  3G0K A;  3DUK A;  3UNL A;  4HM0 B;  4HM6 B;  4X2H A;  3FH1 A;  3WMD A;  4WYK B;  3S67 A;  4K61 A;  3CCE 3;  3CCM 3;  3T0U A;  1K73 4;  3X40 A;  3EN8 A;  1ASK A;  1AVL A;  5CF1 A;  2V1L A;  4KFF A;  1ULI B;  1GY5 A;  1UUV B;  3MG1 A;  1T5Y A;  3WA3 A;  1M1X B;  2F86 B;  2Z6B A;  4J9A A;  1AVK A;  3PCS A;  5ELJ A;  5LC6 A;  1J2B A;  1JV2 B;  3EB8 A;  1TFO A;  4HJL B;  1IVW A;  3IJE B;  4KZ1 A;  1VQK 3;  5AII A;  4HVN A;  2I9W A;  2HML B;  4FCJ A;  3BND A;  1MOL A;  3EC9 A;  3VGN A;  8CHO A;  5IEP A;  1A90 A;  3MWZ A;  2LYX A;  1S5A A;  3PCR A;  3I0Y A;  1VQ5 3;  4XBX A;  1EG9 B;  5AIH A;  2XEP A;  1NWW A;  3QRD A;  1K28 A;  2WO0 A;  2OTJ 3;  3CCL 3;  2O9U X;  3FSD A;  2CFK A;  3CMA 3;  4HM4 B;  3CC4 3;  3JUP A;  1G96 A;  3STD A;  1KC8 4;  5I97 A;  5AYS C;  1W6C A;  1RKY A;  1TP6 A;  3OWY A;  3CNX A;  2CC3 A;  3KE7 A;  2GBW B;  1GS3 A;  3H3H A;  1JB2 A;  3FKA A;  3KN4 A;  5G2G A;  1IT7 A;  1LOX A;  1V74 A;  3F8X A;  5AIF A;  1W00 A;  3MKI A;  3GAX A;  3FLJ A;  4L7K A;  3CCJ 3;  3GZY B;  3LTB A;  3RGA A;  4ZM8 A;  3F7X A;  2CFG A;  3BB9 A;  1SQW A;  2CK3 H;  1US1 A;  3FG4 A;  4EV5 A;  2IMJ A;  1N8Q A;  3S27 A;  4R9L A;  1N9J A;  1N5P A;  4L8O A;  1QJG A;  1Q40 B;  2HMN B;  4XBT A;  3EX9 A;  1MNL A;  2XGL A;  5IG4 A;  5CF2 A;  1KSI A;  1WMP A;  1WMO A;  1YVB I;  3CXC 2;  2CFW A;  1IVX A;  1SJW A;  4JRF A;  2W9Q A;  2OOV A;  1TU5 A;  5HGR A;  5D81 A;  2RCD A;  3S28 A;  2BHM A;  4NHF A;  5LC7 A;  3Q2P A;  1FUW A;  3HZP A;  2P0M A;  3DZL A;  3FF2 A;  3PGB A;  3N8B A;  1IV7 A;  1OHS A;  2YFI B;  3Q90 A;  5D82 A;  5BVB A;  1QMA A;  4AKZ A;  2BT3 A;  4HM5 B;  1NB5 I;  2QIY A;  2KCD A;  4H61 A;  1IQX A;  3V98 A;  1IV9 A;  2CWU A;  4GL6 A;  3X3Z A;  1VQ9 3;  2ML5 A;  1OAC A;  2WOF A;  1A2V A;  3IPT A;  2P0X A;  1Y4K A;  3K5T A;  1KQS 2;  1Q42 A;  2W9P A;  1A67 A;  1OHP A;  2L4V A;  4LEH A;  4ORL A;  3SXX A;  1VQO 3;  3UL5 A;  5IER A;  4K1U A;  3TDG A;  4MMZ B;  2LQV A;  4U13 A;  4XDW A;  2WGQ A;  1JKG B;  3B8L A;  1BUQ A;  2PZV A;  5DRE A;  3EE1 A;  2Z77 A;  3GRD A;  3NXJ A;  4CCV A;  1NJI 4;  4QWT A;  5KP3 A;  3HI7 A;  2BO9 B;  4HM1 B;  4BTY A;  4RBN A;  4O02 B;  1GD4 A;  1WQL B;  1Q82 4;  2FGT A;  4O2H A;  1VZZ A;  3U97 A;  3NBB A;  1YJN 3;  3QK9 A;  4XDV A;  3F40 A;  1JRQ A;  3AMO A;  3EN1 B;  3LT9 A;  1OHO A;  3IMA B;  2GEX A;  1JB4 A;  4EC6 A;  2BMQ B;  3KFQ C;  2CKF B;  1N8R 4;  2JQ5 A;  3B4O A;  1IQY A;  3BLZ A;  5KP4 A;  1ROA A;  1IK3 A;  3S5C A;  3Q1C A;  2O3O A;  1TUH A;  1R4C A;  1DMN A;  2K54 A;  3HII A;  4HM3 B;  1W4N A;  3PZW A;  1GYB A;  2IA7 A;  5IEN A;  2C11 A;  2GU3 A;  5IF6 A;  4R4K A;  4HZB B;  1WMN A;  3WOE B;  1VQ7 3;  2ML6 A;  4K90 B;  2W56 A;  4N6L A;  2YFL B;  2OQE C;  4K1V A;  3X42 A;  4RZM A;  3DGN A;  2GU1 A;  1AR0 A;  4MMX B;  1K41 A;  3GZR A;  1UI8 A;  4O3V A;  3FGY A;  3LZA A;  2Q07 A;  3S29 A;  1O7P B;  2W0Q A;  2E2V A;  5AEW B;  5AI1 A;  1RJO A;  2WOH A;  3MHE A;  5EVH A;  3BNC A;  5EEO A;  2XR8 B;  2YX9 A;  4FMC A;  4FMB A;  3ALA A;  4TX4 A;  3PXM A;  4X2O A;  1OGZ A;  3LTA A;  4LGQ A;  4AEQ A;  4EBG A;  4FMA A;  1Q86 4;  1K9M 4;  4EYC A;  5AEU B;  2HMJ B;  2M7O A;  2P09 A;  1ZO2 A;  4H3U A;  1HU9 A;  1EKM A;  4LZI A;  4XM4 A;  2GEY A;  1HKX A;  2KXG A;  1YJ9 3;  5FW5 A;  5STD A;  1U8C B;  3PS8 A;  3UB1 A;  2QEX 3;  1FGM A;  4HYZ A;  3MYT A;  1EQK A;  5IW9 A;  3LML A;  3FF0 A;  3MSO A;  4R9K A;  2E2U A;  2OOV C;  3CC7 3;  1O7W B;  4JF8 A;  1UW1 A;  2A15 A;  3NUV A;  2GXF A;  1C7H A;  1O7M B;  4KFE A;  3FG3 A;  4EXR A;  3SED A;  3GZB A;  3JUN A;  5IG5 A;  3CPO A;  2BMR B;  2W2C A;  1IQ8 A;  3BNE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...