4I4KA

Streptomyces globisporus c-1027 9-membered enediyne conserved protein sgce6
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
138
structure length
138
Chain Sequence
STDSITSAPDAALAAVAALPARIVAAWADHDADRFADVFAEDGTMILPGLFRKGRENIRTHMAAAFAGPYKGTRVIGSPIDARLLGDGIALLITEGGILAPGETEASGDGAVRASWLAVEQDGQWRLAAYQNSPRGND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein SgcJ
publication title Crystal structure of SgcJ, an NTF2-like superfamily protein involved in biosynthesis of the nine-membered enediyne antitumor antibiotic C-1027.
pubmed doi rcsb
source organism Streptomyces globisporus
total genus 35
structure length 138
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14534 DUF4440 Domain of unknown function (DUF4440)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4i4kA00
4STDA 2HMMB 2Z7AA 2GEXA 5AIIA 3B4OA 1JB2A 3FKAA 3F8HA 1NU3A 2OWPA 3CNXA 5BVBA 3G0KA 3EC9A 1GYBA 1UUWB 2HMJB 3FSDA 3DMCA 3B7CA 1DMMA 3EBTA 4XM4A 3BB9A 3T8UA 4X2HA 5IG4A 3F9SA 1OF5A 4K1VA 2RGQA 2XRXB 3KZTA 3BLZA 3MG1A 3OXAA 4XBTA 3DZLA 1OGXA 2UX0A 4HM1B 4I4KA 1ULIB 3K0ZA 3JUPA 3GZRA 5AIHA 2YFJB 3NV0A 4HM8B 3DUKA 1DMNA 1OUNA 3KE7A 3FF0A 4HM3B 2QGUA 1GY6A 3H3HA 4XBYA 4XBXA 3NBRA 2B1XB 1WQLB 1Z1SA 5IEOA 1K41A 4HM7B 1VZZA 3CNMA 2PZVA 3MSOA 4HVNA 1STDA 1E3RA 3HZPA 4KVHA 5CLKA 2JQ5A 4HM5B 3SOAA 3FH1A 1S5AA 1OH0A 4FCMA 3B8LA 5CF1A 3RGAA 1EG9B 1W6YA 1OHPA 1U5OA 3HX8A 3MHEA 1ZO2A 3FZWA 2W2CA 5G2GA 3VGNA 1O7HB 3NXJA 5CXOA 3F40A 1AR0A 3KSPA 2R4IA 1ISKA 4L8OA 3G8ZA 5KP3A 2A15A 2F99A 5D81A 1QJGA 1JKGB 3F7SA 3GRDA 1Q40A 4WYKB 1SJWA 3SEDA 2CHCA 3MKIA 1NWWA 2GBWB 3GZXB 3VSYA 1W00A 3HK4A 5IF6A 3RGRA 4WP5A 1O7PB 3MYTA 3OV4A 2GEYA 1UUVB 1JN5B 3FF2A 5BXQA 3NUVA 2K54A 3F14A 2XR8B 8CHOA 3IPTA 3GZYB 4R9KA 5D83A 5EVHA 3EHCA 4N3VA 1ZX2A 5CF2A 1GY5A 5IG3A 3MG3A 1NDOB 3EX9A 4LEHA 3T8NA 1TUHA 1OGZA 4L7KA 3UJMA 1ULJB 3ECFA 3JUQA 2QIYA 1QMAA 4Q53A 1TP6A 4HKVB 2HMLB 3EBYA 4J9AA 4OVMA 3EQQB 3STDA 1O7WB 3NHXA 5IG0A 1GY7A 3GWRA 3JUMA 1OHSA 3DXOA 4HZBB 4RZMA 5AI1A 2STDA 3A76A 4CDLA 2Z77A 3F7XA 3M8CA 4J8TA 3Q90A 3JUOA 2INXA 3LZAA 3JUNA 1CQSA 3LYGA 1HKXA 2B24B 3EN8A 5D82A 5JPPA 5DRVA 2HMNB 3I0YA 3OWUA 2YFLB 4HZ9B 4IIAA 1O7GB 1JB4A 5AIFA 2I9WA 3S5CA 4X2OA 1JB5A 1JKGA 2RCDA 3OWYA 3H51A 5STDA 1OHOA 4WYKA 4XDVA 5HGRA 1OF5B 3OWSA 3F8XA 4HJLB 2IMJA 1W01A 4LMIA 4K1UA 2YFIB 5IEPA 2RFRA 1JN5A 2BMOB 3G16A 3MG2A 2GXFA 5IERA 4ORLA 3OX9A 2Z76A 2CKFB 4GB5A 2F98A 1OPYA 3NV0B 3WMDA 1E97A 5AEUB 4HM0B 3EF8A 3SOYA 3ER7A 1GS3A 3FLJA 5AIGA 2GBXB 3EN1B 2XSHB 3UNLA 3K7CA 3DM8A 4WWUC 4H3UA 6STDA 2BNGA 2BMRB 1BUQA 1E3VA 2F86B 3NM2A 2BMQB 4HM6B 1A2KA 4R1KA 1W02A 4R9LA 5DREA 3ROBA 1Q42A 5IENA 2HMKB 1O7MB 4FCJA 4L8PA 3KKGA 3GZBA 4XB5A 5FW5A 5IG5A 5KP1A 5TGNA 3E99A 1DMQA 1C7HA 4OUQA 3FGYA 5JPUA 4HM4B 3D9RA 3EJVA 1O7NB 5AEWB 4PEJA 4U13A 1OCVA 1ASKA 3B4PA 4LGQA 2XSOB 1Q40B 1IDPA 5CK6A 7STDA 3CPOA 2HMOB 4MJDA 4HM2B 4XDWA 5KP4A 3CU3A 1EA2A
chains in the Genus database with same CATH superfamily
4BL3A 4NPBA 8RNTA 4STDA 1I2EA 2HMMB 2GEXA 2Z7AA 2F56A 5AIIA 3B4OA 1JB2A 3AHSA 1TFKA 3FKAA 3F8HA 1FGMA 1NU3A 1VQK3 2OWPA 3CNXA 2CWVA 3UL6A 5BVBA 1I3FA 2F5MA 3G0KA 3EC9A 2Y73A 1GYBA 4I5QA 2JDIH 3T0UA 1IQYA 1IU7A 1UUWB 1T5YA 2HMJB 2KF4A 4EC6A 3FSDA 1V74A 2CX0A 3DMCA 2CWTA 3B7CA 3Q1CA 1K9M4 1RLSA 1J2BA 5EQLA 3NM7A 1DMMA 4J5GA 1QAFA 2Y74A 2CW9A 1JBSA 3EBTA 3G6E3 1LVNA 4XM4A 1B2ZA 3BB9A 4FMAA 3T8UA 4ZM8A 3WDGB 4X2HA 3X40A 4EV2A 5IG4A 1MWSA 1JJ22 4QWTA 3QRDA 2GU1A 2XFTA 3F9SA 1NB3I 2CFDA 1G02A 1OF5A 4K1VA 3CPW2 2RGQA 2HOHA 3GSPA 2XRXB 3D3LA 3KZTA 3AGNA 4NHFA 1RGHA 3WOEB 2CFGA 3BLZA 1UDII 3MG1A 3OXAA 4XBTA 5EEOA 3DGOA 3DZLA 5A0OB 3IMAB 1OGXA 2UX0A 4MEIA 1YIT3 4KFEA 3FG3A 4HM1B 5AYSC 1QAKA 3D5GA 4I4KA 2BIRA 1ULIB 1BGSA 1Q9EA 4MMXB 4DKIA 2V1LA 3K0ZA 1TJDA 3JUPA 1IVUA 3FCSB 1YGWA 1TRPA 3GZRA 3KSED 5AIHA 2QEX3 1YVSA 1B2UA 1BSAA 2YFJB 4EV5A 2K3DA 4RNYA 3NV0A 3PYJA 1W5ZA 2OTL3 4HM8B 1W6GA 3DUKA 1DMNA 1I70A 1B2SA 3KIIA 1G96A 3JVCA 5LC6A 5ELUA 1OUNA 3KE7A 2OOVA 1M1K4 1BRJA 2CFKA 3FF0A 3DY5A 4HM3B 1RGFA 1BANA 2QGUA 1GY6A 4EBGA 2WO0A 1Y4KA 3H3HA 1KC84 2BO9B 4HOHA 1WMNA 2OCTA 4XBYA 2IUJA 1US1A 1Q814 3DGLA 3SXXA 4XBXA 1T2IA 3NBRA 1LQGC 1EUIC 3NQZA 2B1XB 1WQLB 2KF6A 1Z1SA 1AQZA 1SIHA 4N6LA 5M1AA 1T3BA 5IEOA 5GSPA 2XGNA 3AHWA 3X41A 1DVCA 5JBSA 3HI7A 1RCKA 1K41A 1M1XB 1GOUA 1VQM3 2E2VA 2CFWA 1VZZA 1OACA 3CNMA 2PZVA 4HM7B 3CCL3 3N54B 3CC23 4HBRA 3MSOA 4BTWA 3AGOA 3SYUA 4BTXA 2ZA4A 3AMOA 4HVNA 1VQ53 1QALA 1WNHA 1HZ1A 3U1WA 3S27A 3G4S3 3DH2A 1STDA 1DE3A 1E3RA 3HZPA 4KVHA 1UW1A 5CLKA 1VQL3 2JQ5A 4HM5B 3SOAA 4O8SA 3FH1A 2SARA 4BL2A 1S5AA 2W03A 1OH0A 4FCMA 1TRQA 3B8LA 4LSOA 5CF1A 3RGAA 3MPHA 3UB1A 1EG9B 1W6YA 1IVWA 1OHPA 1U5OA 3HX8A 2CFLA 1N5HA 1IVXA 1CH0A 3MHEA 3QK9A 1M904 1ZO2A 4FMBA 3FZWA 2W2CA 1F8NA 5G2GA 3VGNA 1FUTA 1D6UA 1W6CA 1O7HB 3NXJA 3CC73 5CXOA 1C54A 1MGRA 2BU4A 3F40A 1BSDA 1AR0A 2P0MA 2R4IA 3KSPA 1ISKA 4L8OA 4EXRA 3G8ZA 1NO3A 5KP3A 2KF5A 2A15A 2ZDJA 2F99A 1V58A 1QJGA 5D81A 3LT8A 1JKGB 1B2XA 1CEWI 1DYUA 3F7SA 4H61A 1I8VA 1IK3A 3GRDA 3CCE3 2IUKA 1W4NA 2W04A 3S28A 3NBBA 1Q40A 3X3ZA 4WYKB 1SJWA 3WR2A 3U97A 4WHAA 1BRGA 1RGKA 1K8A4 2XEPA 2KRTA 1W7CA 3SEDA 1TFOA 4NREA 4AKYA 2CHCA 1UCKA 1JBRA 1RGAA 3MKIA 4N6NB 1NWWA 1UGHI 2GBWB 3GZXB 4KZ1A 1W00A 1LQMB 3VSYA 1Q7Y4 1A2PA 3GAXA 1YJ93 1GOYA 3HK4A 2W0QA 3X3XA 5IF6A 5BIRA 4OK0A 3RGRA 2E2TA 4WP5A 1O7PB 1FGOA 1UI7A 3MYTA 1BSCA 1RGEA 2Z6BA 2GEYA 1BNJA 3OV4A 1X1YA 1B21A 1UUVB 1JN5B 3FF2A 5BXQA 1RTUA 3NUVA 1RKYA 3EE1A 4G1MB 1BRHA 3D5IA 5RNTA 3WOFB 1SIIA 4IT7A 1Q824 1GD4A 2K54A 3F14A 3D4AA 2OQEA 4CJNA 2BHMA 1JZOA 2XR8B 3DGNA 8CHOA 4KT3B 4ILFA 1N9JA 6RNTA 1N5PA 3IPTA 2W56B 1FGTA 4O3VA 1G0TA 3GZYB 4R9KA 5D83A 5EVHA 3EHCA 2WOHA 4N3VA 1RRHA 1ZX2A 1QVG2 1NNVA 5M18A 1LOVA 2K0MA 2O9UX 1N9EA 1RNBA 3K5TA 5CF2A 1K28A 1GY5A 1RN1A 3X3YA 2H0GA 3LXUX 2IY2A 5IG3A 1BSBA 1T2HA 1ROAA 1AVKA 1RN4A 1NDOB 2ZL8A 3EX9A 3LH4A 3MG3A 3PGBA 4FMCA 2H0IA 3FG4A 4LEHA 1TUHA 3T8NA 3I563 1FA3A 1PY3A 1KWIA 4HAAA 1OGZA 4L7KA 3UJMA 1ULJB 4CPKA 3CCV3 1JV2B 3WHOA 5AYRB 1ROVA 4GHOA 1IT7A 1X1UA 2ML6A 3ECFA 2CK3H 3JUQA 2QIYA 1KQS2 1UCJA 1QMAA 2L4VA 1I3IA 2AADA 3CXC2 3CCJ3 4Q53A 1TP6A 1VQ83 1B27A 1YIJ3 2L1SA 1BRKA 5LC7A 1UUGB 2W6JH 1BU4A 2CH9A 3IJEB 1A90A 1N8QA 1I0XA 1N8R4 1W2B2 3S29A 3J7Yd 2SBLA 3KN4A 1IQ8A 1FYSA 4HKVB 2HMLB 3Q2PA 1BNSA 3EBYA 2ML5A 3PS8A 4KFFA 4BU4A 2W9QA 5BU4A 4J9AA 1BVIA 4OVMA 3EQQB 3STDA 1O7WB 4R80A 3NHXA 4RBNA 1CYVA 2P09A 1GY7A 2FXTA 3GWRA 4TX4A 1HYFA 5IG0A 3L0RA 4N6MA 1VQN3 3ZG0A 3JUMA 1RGCA 1BRNL 3NX0A 1ZS7A 2C10A 2F5WA 2CIUA 1OHSA 3DXOA 1LOXA 2M7OA 3G713 1BNEA 2GU3A 3EB8A 1JBTA 4HZBB 4RZMA 4IPBA 1BUJA 5AI1A 1IQXA 3K9MC 4N6TA 6GSPA 1GMQA 1QVF2 3HOHA 2C11A 3BNCA 1LOYA 2RNTA 2STDA 3A5EA 4LZIA 2CG0A 3A76A 4CDLA 2Z77A 3RDEA 1NB5I 1LOWA 1UCLA 1FGRA 3F7XA 3PXMA 2KXGA 2OQEC 3M8CA 4J8TA 5G1KA 1VQ73 3VF1A 1U8CB 3FG1A 3ALAA 3Q90A 1B2MA 1R4YA 1BIRA 3JUOA 1BRSA 2INXA 3LZAA 3JUNA 1CQSA 3LYGA 1YJW3 3BNDA 1BNGA 3DGMA 2R41A 1K734 1RSNA 3I553 2UUGC 1MWUA 7GSPA 3CCR3 1MGWA 2ZHXB 1HKXA 3X42A 2WOFA 3BU4A 2B24B 3EN8A 5D82A 2PNCA 1EQKA 5JPPA 1RGGA 5DRVA 3BNBA 3CMA3 1RJOA 1PU4A 1A67A 2HMNB 2BT3A 2CC3A 3I0YA 1FW7A 3CD63 3OWUA 2KF3A 2YFLB 3K63A 1WMOA 4N6UA 4HZ9B 1BOXA 4FR9A 4IIAA 1I2FA 1O7GB 1SARA 1FUSA 3NBJA 3LTCA 1JB4A 3LTAA 2OOVC 5AIFA 2FGTA 2I9WA 3KCHA 3S5CA 4X2OA 1L5GB 1JB5A 1JKGA 1AY7A 2AAEA 2P0XA 4LYLB 1EKMA 2RCDA 2IYJA 2LYXA 3SX1A 1FUWA 3ZFZA 2WGOA 3OWYA 3H51A 5STDA 1BAOA 1GD3A 1OHOA 2CX1A 4WYKA 2F4YA 3V98A 4AKZA 1YNVX 4XDVA 1M9GA 4JF8A 3D79A 2D1WA 1GSPA 3O8YA 1X1XA 3KFQC 1LNHA 5HGRA 1OF5B 3OWSA 3F8XA 1STFI 4MMZB 4HJLB 1LXEA 2MC8A 2IMJA 1W01A 2P38A 1EEJA 1TIJA 1FGQA 4O02B 2XFSA 4LMIA 5I97A 1VQP3 1A2VA 1IYYA 4K1UA 2W9PA 1GMPA 3HIGA 2P05A 2YFIB 3LT9A 5IEPA 2QA43 1CYUA 2RFRA 3MWZA 3S67A 1YGEA 1VQQA 1JN5A 2BMOB 3G16A 5FGOA 7RNTA 1MWTA 2GXFA 3LTBA 3MG2A 5IERA 1TTOA 1SPUA 3TDGA 1VQO3 1PFPA 4ORLA 3OX9A 4BTYA 3LMLA 2Z76A 2CKFB 4GB5A 4K61A 4EYCA 2F98A 1OPYA 3NV0B 3CCM3 2XH9A 1Q864 3ZG5A 2KCDA 1YJN3 2RSXA 3WMDA 1E97A 2W56A 3WODG 4EW5A 5AEUB 3OW22 4O2HA 1I2GA 3SLUA 1UCIA 4HM0B 1JNQA 2UGIA 1GOVA 1IV9A 3WA2X 1VQ93 1WTHA 3V92A 3EF8A 3SOYA 3ER7A 3CCQ3 1RGLA 2Q07A 1GS3A 3FLJA 5AIGA 2GBXB 1SQWA 3EN1B 2XGLA 3CME3 1D6YA 2KAAA 3RNTA 1YVBI 4AEQA 4GSPA 1R4CA 2XSHB 5M19A 1RCLA 4KFDA 1AVLA 3UNLA 3K7CA 3DM8A 3UL5A 2OTJ3 4WWUC 5G1LA 1RMSA 3LTDA 3URPA 1Q7HA 1TU5A 1YHQ3 2RBIA 4H3UA 6STDA 2BNGA 2BMRB 3AMOB 4N6V0 1BUQA 1E3VA 2F86B 3NM2A 1DVDA 1RN7A 2CG1A 2BMQB 3SVAA 1BRIA 4HYZA 4HM6B 1X1WA 1A2KA 1JRQA 3DGYA 4FMDA 3CCS3 1BNFA 1RNTA 3WA3A 1FZUA 2FNQA 4R1KA 1W02A 3NQYA 4R9LA 5DREA 3PZWA 2YX9A 3ROBA 2J8XB 1Q42A 1LRAA 1VQ43 2H0HA 1W2ZA 5ELJA 5IENA 1B20A 2HMKB 1O7MB 1IVVA 2O3OA 4FCJA 4L8PA 4CCVA 3KKGA 1NJI4 1KD14 3GZBA 9RNTA 1RHLA 3PCRA 2IA7A 4WFOA 1JZDA 1IT8A 4XB5A 5FW5A 5IG5A 5KP1A 1GMRA 3E99A 1DETA 5TGNA 1DMQA 3BNEA 2WGQA 3N9HA 1LNIA 3PCSA 4J5KA 1C7HA 2GSPA 4OUQA 3FGYA 4BIRA 1BSEA 1MOLA 5JPUA 4HM4B 2E2UA 1RRLA 2D42A 3D9RA 3EJVA 1KSIA 1IV7A 1WMPA 3N8BA 3V99A 4MMYB 4GL6A 1O7NB 3HIIA 3BIRA 4FCZA 5AEWB 1AV4A 1S723 4PEJA 4U13A 4N6OB 1OCVA 1ZGXA 1ASKA 3CC43 3B4PA 1VQ63 1BNRA 4LGQA 2XF3A 2XSOB 4RNTA 1I0VA 3Q3FA 1RDSA 1Q40B 1PYLA 1MWRA 1IDPA 1BNIA 2C4BA 5CK6A 7STDA 1D6ZA 1YI23 4R4KA 4K90B 3CPOA 2MF7A 1MNLA 1HU9A 2LQVA 1UGIA 1UI8A 2HMOB 3LOYA 4MJDA 4JRFA 5IW9A 1B3SA 2CWUA 3CCU3 4HM2B 5HOHA 4XDWA 5KP4A 4RNZA 3CU3A 1EA2A 1V57A
chains in the Genus database with same CATH topology
4STDA 2HMMB 2Z7AA 2GEXA 5AIIA 3B4OA 1JB2A 1TFKA 3FKAA 3F8HA 1FGMA 1NU3A 1VQK3 2OWPA 3CNXA 2CWVA 3UL6A 5BVBA 3G0KA 3EC9A 2Y73A 1GYBA 2JDIH 3T0UA 1IQYA 1IU7A 1UUWB 1T5YA 2HMJB 4EC6A 3FSDA 1V74A 3DMCA 2CWTA 3B7CA 3Q1CA 1K9M4 1J2BA 5EQLA 3NM7A 1DMMA 1QAFA 2Y74A 2CW9A 3EBTA 3G6E3 1LVNA 4XM4A 3BB9A 4FMAA 3T8UA 4ZM8A 3WDGB 4X2HA 3X40A 4EV2A 5IG4A 1JJ22 4QWTA 3QRDA 2GU1A 2XFTA 3F9SA 1NB3I 2CFDA 3CPW2 1OF5A 4K1VA 2RGQA 2XRXB 3D3LA 3KZTA 4NHFA 3WOEB 2CFGA 3BLZA 3MG1A 3OXAA 4XBTA 5EEOA 3DGOA 3DZLA 5A0OB 3IMAB 1OGXA 2UX0A 4MEIA 1YIT3 4KFEA 3FG3A 4HM1B 5AYSC 1QAKA 4I4KA 1ULIB 4MMXB 2V1LA 3K0ZA 3JUPA 1IVUA 3FCSB 3GZRA 3KSED 5AIHA 2QEX3 2YFJB 4EV5A 4RNYA 3NV0A 3PYJA 1W5ZA 2OTL3 4HM8B 1W6GA 3DUKA 1DMNA 3KIIA 1G96A 3JVCA 5LC6A 5ELUA 1OUNA 3KE7A 2OOVA 1M1K4 2CFKA 3FF0A 3DY5A 4HM3B 2QGUA 4EBGA 1GY6A 2WO0A 1Y4KA 3H3HA 1KC84 2BO9B 1WMNA 2OCTA 4XBYA 2IUJA 1US1A 1Q814 3DGLA 3SXXA 4XBXA 3NBRA 3NQZA 2B1XB 1WQLB 1Z1SA 4N6LA 1SIHA 5IEOA 2XGNA 3X41A 1DVCA 5JBSA 3HI7A 1K41A 1M1XB 1VQM3 2E2VA 2CFWA 1VZZA 1OACA 3CNMA 2PZVA 4HM7B 3CCL3 3N54B 3CC23 4HBRA 3MSOA 4BTWA 4BTXA 3AMOA 4HVNA 1VQ53 1QALA 1WNHA 3U1WA 3S27A 3G4S3 1STDA 1E3RA 3HZPA 4KVHA 1UW1A 5CLKA 1VQL3 2JQ5A 4HM5B 3SOAA 4O8SA 3FH1A 1S5AA 2W03A 1OH0A 4FCMA 3B8LA 4LSOA 5CF1A 3RGAA 3MPHA 3UB1A 1EG9B 1W6YA 1IVWA 1OHPA 1U5OA 3HX8A 2CFLA 1N5HA 1IVXA 3MHEA 3QK9A 1M904 1ZO2A 4FMBA 3FZWA 2W2CA 1F8NA 5G2GA 3VGNA 1D6UA 1W6CA 1O7HB 3NXJA 3CC73 5CXOA 3F40A 1AR0A 2P0MA 2R4IA 3KSPA 1ISKA 4L8OA 4EXRA 3G8ZA 1NO3A 5KP3A 2ZDJA 2A15A 2F99A 5D81A 1QJGA 3LT8A 1JKGB 1CEWI 1DYUA 3F7SA 4H61A 1IK3A 3GRDA 3CCE3 2IUKA 1W4NA 2W04A 3S28A 3NBBA 1Q40A 3X3ZA 4WYKB 1SJWA 3U97A 4WHAA 1K8A4 2XEPA 2KRTA 1W7CA 3SEDA 1TFOA 4NREA 4AKYA 2CHCA 3MKIA 4N6NB 1NWWA 2GBWB 3GZXB 4KZ1A 3VSYA 1W00A 1Q7Y4 3GAXA 1YJ93 3HK4A 3X3XA 2W0QA 5IF6A 4OK0A 3RGRA 2E2TA 4WP5A 1O7PB 1FGOA 1UI7A 3MYTA 2Z6BA 2GEYA 3OV4A 1UUVB 1JN5B 3FF2A 5BXQA 3NUVA 1RKYA 3EE1A 4G1MB 3WOFB 1SIIA 4IT7A 1Q824 1GD4A 2K54A 3F14A 2OQEA 2BHMA 2XR8B 3DGNA 8CHOA 1N9JA 1N5PA 3IPTA 2W56B 1FGTA 4O3VA 3GZYB 4R9KA 5D83A 5EVHA 3EHCA 2WOHA 4N3VA 1RRHA 1ZX2A 1QVG2 2K0MA 2O9UX 1N9EA 3K5TA 5CF2A 1K28A 1GY5A 3X3YA 3LXUX 5IG3A 1ROAA 1AVKA 3MG3A 1NDOB 2ZL8A 3EX9A 3LH4A 3PGBA 4FMCA 1A67A 3FG4A 4LEHA 3T8NA 1TUHA 1FA3A 3I563 1KWIA 1OGZA 4L7KA 3UJMA 1ULJB 3CCV3 1JV2B 5AYRB 1ROVA 1IT7A 2ML6A 3ECFA 2CK3H 3JUQA 2QIYA 1KQS2 1QMAA 2L4VA 3CCJ3 3CXC2 4Q53A 1TP6A 1VQ83 1YIJ3 5LC7A 2W6JH 2CH9A 3IJEB 1A90A 1N8QA 1N8R4 1W2B2 3S29A 3J7Yd 2SBLA 3KN4A 1IQ8A 4HKVB 2HMLB 3Q2PA 3EBYA 2ML5A 3PS8A 4KFFA 2W9QA 4J9AA 4OVMA 3EQQB 3STDA 1O7WB 4R80A 3NHXA 4RBNA 1CYVA 2P09A 1GY7A 2FXTA 3GWRA 4TX4A 5IG0A 3L0RA 4N6MA 1VQN3 3JUMA 3NX0A 2C10A 2CIUA 1OHSA 3DXOA 1LOXA 2M7OA 3G713 2GU3A 3EB8A 4HZBB 4RZMA 4IPBA 5AI1A 1IQXA 3K9MC 4N6TA 1QVF2 2C11A 3BNCA 2STDA 4LZIA 2CG0A 3A76A 4CDLA 2Z77A 3RDEA 1NB5I 1FGRA 3F7XA 3PXMA 2KXGA 2OQEC 3M8CA 4J8TA 1VQ73 3VF1A 1U8CB 3FG1A 3ALAA 3Q90A 3JUOA 2INXA 3LZAA 3JUNA 1CQSA 3LYGA 1YJW3 3BNDA 3DGMA 1K734 3I553 3CCR3 1HKXA 3X42A 2WOFA 2B24B 3EN8A 5D82A 2PNCA 1EQKA 5JPPA 5DRVA 3BNBA 3CMA3 1RJOA 1PU4A 2HMNB 2BT3A 2CC3A 3I0YA 3CD63 3OWUA 2YFLB 3K63A 1WMOA 4N6UA 4HZ9B 4FR9A 4IIAA 1O7GB 3NBJA 3LTCA 1JB4A 3LTAA 2OOVC 5AIFA 2FGTA 2I9WA 3S5CA 4X2OA 1L5GB 1JB5A 1JKGA 2P0XA 1EKMA 2RCDA 2LYXA 3SX1A 1FUWA 2WGOA 3OWYA 3H51A 5STDA 1GD3A 1OHOA 4WYKA 3V98A 4AKZA 4XDVA 1M9GA 4JF8A 2D1WA 3O8YA 3KFQC 1LNHA 5HGRA 1OF5B 3OWSA 3F8XA 1STFI 4MMZB 4HJLB 1LXEA 2MC8A 2IMJA 1W01A 2P38A 1TIJA 4O02B 1FGQA 5I97A 2XFSA 4LMIA 1VQP3 1A2VA 4K1UA 2W9PA 3HIGA 2P05A 2YFIB 3LT9A 5IEPA 2QA43 1CYUA 2RFRA 3MWZA 3S67A 1YGEA 1JN5A 2BMOB 3G16A 5FGOA 3LTBA 2GXFA 3MG2A 5IERA 1SPUA 3TDGA 1VQO3 1PFPA 4ORLA 3OX9A 4BTYA 3LMLA 2Z76A 2CKFB 4GB5A 4K61A 4EYCA 2F98A 1OPYA 3NV0B 3CCM3 2XH9A 1Q864 2KCDA 1YJN3 2RSXA 3WMDA 1E97A 2W56A 3WODG 5AEUB 3OW22 4O2HA 3SLUA 4HM0B 1JNQA 1IV9A 3WA2X 1WTHA 3V92A 3EF8A 3SOYA 3ER7A 3CCQ3 2Q07A 1GS3A 3FLJA 5AIGA 2GBXB 1SQWA 3EN1B 2XGLA 3CME3 1D6YA 1YVBI 4AEQA 1R4CA 2XSHB 4KFDA 1AVLA 3UNLA 3K7CA 3DM8A 3UL5A 2OTJ3 4WWUC 3LTDA 1TU5A 1YHQ3 4H3UA 6STDA 2BNGA 2BMRB 3AMOB 4N6V0 1BUQA 1E3VA 2F86B 3NM2A 1DVDA 1RN7A 2CG1A 2BMQB 3SVAA 4HYZA 4HM6B 1JRQA 1A2KA 4FMDA 3CCS3 3WA3A 2FNQA 4R1KA 1W02A 3NQYA 4R9LA 5DREA 3PZWA 2YX9A 3ROBA 1Q42A 1VQ43 1W2ZA 5ELJA 5IENA 2HMKB 1O7MB 1IVVA 2O3OA 4FCJA 4L8PA 4CCVA 3KKGA 1NJI4 1KD14 3GZBA 3PCRA 2IA7A 4WFOA 1IT8A 4XB5A 5FW5A 5IG5A 5KP1A 5TGNA 3E99A 1DMQA 3BNEA 2WGQA 3N9HA 3PCSA 1C7HA 4OUQA 3FGYA 1MOLA 5JPUA 4HM4B 2E2UA 1RRLA 2D42A 3D9RA 3EJVA 1KSIA 1IV7A 1WMPA 3N8BA 3V99A 4MMYB 4GL6A 1O7NB 3HIIA 4FCZA 5AEWB 1S723 1AV4A 1VQ93 4PEJA 4U13A 4N6OB 1OCVA 3CC43 1ASKA 3B4PA 1VQ63 4LGQA 2XF3A 2XSOB 1Q40B 1IDPA 5CK6A 7STDA 1YI23 1D6ZA 4R4KA 4K90B 3CPOA 2MF7A 1MNLA 1HU9A 2LQVA 1UI8A 2HMOB 3LOYA 4MJDA 4JRFA 5IW9A 2CWUA 3CCU3 4HM2B 4XDWA 5KP4A 4RNZA 3CU3A 1EA2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4STD A;  2HMM B;  2Z7A A;  2GEX A;  5AII A;  3B4O A;  1JB2 A;  3FKA A;  3F8H A;  1NU3 A;  2OWP A;  3CNX A;  5BVB A;  3G0K A;  3EC9 A;  1GYB A;  1UUW B;  2HMJ B;  3FSD A;  3DMC A;  3B7C A;  1DMM A;  3EBT A;  4XM4 A;  3BB9 A;  3T8U A;  4X2H A;  5IG4 A;  3F9S A;  1OF5 A;  4K1V A;  2RGQ A;  2XRX B;  3KZT A;  3BLZ A;  3MG1 A;  3OXA A;  4XBT A;  3DZL A;  1OGX A;  2UX0 A;  4HM1 B;  4I4K A;  1ULI B;  3K0Z A;  3JUP A;  3GZR A;  5AIH A;  2YFJ B;  3NV0 A;  4HM8 B;  3DUK A;  1DMN A;  1OUN A;  3KE7 A;  3FF0 A;  4HM3 B;  2QGU A;  1GY6 A;  3H3H A;  4XBY A;  4XBX A;  3NBR A;  2B1X B;  1WQL B;  1Z1S A;  5IEO A;  1K41 A;  4HM7 B;  1VZZ A;  3CNM A;  2PZV A;  3MSO A;  4HVN A;  1STD A;  1E3R A;  3HZP A;  4KVH A;  5CLK A;  2JQ5 A;  4HM5 B;  3SOA A;  3FH1 A;  1S5A A;  1OH0 A;  4FCM A;  3B8L A;  5CF1 A;  3RGA A;  1EG9 B;  1W6Y A;  1OHP A;  1U5O A;  3HX8 A;  3MHE A;  1ZO2 A;  3FZW A;  2W2C A;  5G2G A;  3VGN A;  1O7H B;  3NXJ A;  5CXO A;  3F40 A;  1AR0 A;  3KSP A;  2R4I A;  1ISK A;  4L8O A;  3G8Z A;  5KP3 A;  2A15 A;  2F99 A;  5D81 A;  1QJG A;  1JKG B;  3F7S A;  3GRD A;  1Q40 A;  4WYK B;  1SJW A;  3SED A;  2CHC A;  3MKI A;  1NWW A;  2GBW B;  3GZX B;  3VSY A;  1W00 A;  3HK4 A;  5IF6 A;  3RGR A;  4WP5 A;  1O7P B;  3MYT A;  3OV4 A;  2GEY A;  1UUV B;  1JN5 B;  3FF2 A;  5BXQ A;  3NUV A;  2K54 A;  3F14 A;  2XR8 B;  8CHO A;  3IPT A;  3GZY B;  4R9K A;  5D83 A;  5EVH A;  3EHC A;  4N3V A;  1ZX2 A;  5CF2 A;  1GY5 A;  5IG3 A;  3MG3 A;  1NDO B;  3EX9 A;  4LEH A;  3T8N A;  1TUH A;  1OGZ A;  4L7K A;  3UJM A;  1ULJ B;  3ECF A;  3JUQ A;  2QIY A;  1QMA A;  4Q53 A;  1TP6 A;  4HKV B;  2HML B;  3EBY A;  4J9A A;  4OVM A;  3EQQ B;  3STD A;  1O7W B;  3NHX A;  5IG0 A;  1GY7 A;  3GWR A;  3JUM A;  1OHS A;  3DXO A;  4HZB B;  4RZM A;  5AI1 A;  2STD A;  3A76 A;  4CDL A;  2Z77 A;  3F7X A;  3M8C A;  4J8T A;  3Q90 A;  3JUO A;  2INX A;  3LZA A;  3JUN A;  1CQS A;  3LYG A;  1HKX A;  2B24 B;  3EN8 A;  5D82 A;  5JPP A;  5DRV A;  2HMN B;  3I0Y A;  3OWU A;  2YFL B;  4HZ9 B;  4IIA A;  1O7G B;  1JB4 A;  5AIF A;  2I9W A;  3S5C A;  4X2O A;  1JB5 A;  1JKG A;  2RCD A;  3OWY A;  3H51 A;  5STD A;  1OHO A;  4WYK A;  4XDV A;  5HGR A;  1OF5 B;  3OWS A;  3F8X A;  4HJL B;  2IMJ A;  1W01 A;  4LMI A;  4K1U A;  2YFI B;  5IEP A;  2RFR A;  1JN5 A;  2BMO B;  3G16 A;  3MG2 A;  2GXF A;  5IER A;  4ORL A;  3OX9 A;  2Z76 A;  2CKF B;  4GB5 A;  2F98 A;  1OPY A;  3NV0 B;  3WMD A;  1E97 A;  5AEU B;  4HM0 B;  3EF8 A;  3SOY A;  3ER7 A;  1GS3 A;  3FLJ A;  5AIG A;  2GBX B;  3EN1 B;  2XSH B;  3UNL A;  3K7C A;  3DM8 A;  4WWU C;  4H3U A;  6STD A;  2BNG A;  2BMR B;  1BUQ A;  1E3V A;  2F86 B;  3NM2 A;  2BMQ B;  4HM6 B;  1A2K A;  4R1K A;  1W02 A;  4R9L A;  5DRE A;  3ROB A;  1Q42 A;  5IEN A;  2HMK B;  1O7M B;  4FCJ A;  4L8P A;  3KKG A;  3GZB A;  4XB5 A;  5FW5 A;  5IG5 A;  5KP1 A;  5TGN A;  3E99 A;  1DMQ A;  1C7H A;  4OUQ A;  3FGY A;  5JPU A;  4HM4 B;  3D9R A;  3EJV A;  1O7N B;  5AEW B;  4PEJ A;  4U13 A;  1OCV A;  1ASK A;  3B4P A;  4LGQ A;  2XSO B;  1Q40 B;  1IDP A;  5CK6 A;  7STD A;  3CPO A;  2HMO B;  4MJD A;  4HM2 B;  4XDW A;  5KP4 A;  3CU3 A;  1EA2 A; 
#chains in the Genus database with same CATH topology
 4BL3 A;  4NPB A;  8RNT A;  4STD A;  1I2E A;  2HMM B;  2GEX A;  2Z7A A;  2F56 A;  5AII A;  3B4O A;  1JB2 A;  3AHS A;  1TFK A;  3FKA A;  3F8H A;  1FGM A;  1NU3 A;  1VQK 3;  2OWP A;  3CNX A;  2CWV A;  3UL6 A;  5BVB A;  1I3F A;  2F5M A;  3G0K A;  3EC9 A;  2Y73 A;  1GYB A;  4I5Q A;  2JDI H;  3T0U A;  1IQY A;  1IU7 A;  1UUW B;  1T5Y A;  2HMJ B;  2KF4 A;  4EC6 A;  3FSD A;  1V74 A;  2CX0 A;  3DMC A;  2CWT A;  3B7C A;  3Q1C A;  1K9M 4;  1RLS A;  1J2B A;  5EQL A;  3NM7 A;  1DMM A;  4J5G A;  1QAF A;  2Y74 A;  2CW9 A;  1JBS A;  3EBT A;  3G6E 3;  1LVN A;  4XM4 A;  1B2Z A;  3BB9 A;  4FMA A;  3T8U A;  4ZM8 A;  3WDG B;  4X2H A;  3X40 A;  4EV2 A;  5IG4 A;  1MWS A;  1JJ2 2;  4QWT A;  3QRD A;  2GU1 A;  2XFT A;  3F9S A;  1NB3 I;  2CFD A;  1G02 A;  1OF5 A;  4K1V A;  3CPW 2;  2RGQ A;  2HOH A;  3GSP A;  2XRX B;  3D3L A;  3KZT A;  3AGN A;  4NHF A;  1RGH A;  3WOE B;  2CFG A;  3BLZ A;  1UDI I;  3MG1 A;  3OXA A;  4XBT A;  5EEO A;  3DGO A;  3DZL A;  5A0O B;  3IMA B;  1OGX A;  2UX0 A;  4MEI A;  1YIT 3;  4KFE A;  3FG3 A;  4HM1 B;  5AYS C;  1QAK A;  3D5G A;  4I4K A;  2BIR A;  1ULI B;  1BGS A;  1Q9E A;  4MMX B;  4DKI A;  2V1L A;  3K0Z A;  1TJD A;  3JUP A;  1IVU A;  3FCS B;  1YGW A;  1TRP A;  3GZR A;  3KSE D;  5AIH A;  2QEX 3;  1YVS A;  1B2U A;  1BSA A;  2YFJ B;  4EV5 A;  2K3D A;  4RNY A;  3NV0 A;  3PYJ A;  1W5Z A;  2OTL 3;  4HM8 B;  1W6G A;  3DUK A;  1DMN A;  1I70 A;  1B2S A;  3KII A;  1G96 A;  3JVC A;  5LC6 A;  5ELU A;  1OUN A;  3KE7 A;  2OOV A;  1M1K 4;  1BRJ A;  2CFK A;  3FF0 A;  3DY5 A;  4HM3 B;  1RGF A;  1BAN A;  2QGU A;  1GY6 A;  4EBG A;  2WO0 A;  1Y4K A;  3H3H A;  1KC8 4;  2BO9 B;  4HOH A;  1WMN A;  2OCT A;  4XBY A;  2IUJ A;  1US1 A;  1Q81 4;  3DGL A;  3SXX A;  4XBX A;  1T2I A;  3NBR A;  1LQG C;  1EUI C;  3NQZ A;  2B1X B;  1WQL B;  2KF6 A;  1Z1S A;  1AQZ A;  1SIH A;  4N6L A;  5M1A A;  1T3B A;  5IEO A;  5GSP A;  2XGN A;  3AHW A;  3X41 A;  1DVC A;  5JBS A;  3HI7 A;  1RCK A;  1K41 A;  1M1X B;  1GOU A;  1VQM 3;  2E2V A;  2CFW A;  1VZZ A;  1OAC A;  3CNM A;  2PZV A;  4HM7 B;  3CCL 3;  3N54 B;  3CC2 3;  4HBR A;  3MSO A;  4BTW A;  3AGO A;  3SYU A;  4BTX A;  2ZA4 A;  3AMO A;  4HVN A;  1VQ5 3;  1QAL A;  1WNH A;  1HZ1 A;  3U1W A;  3S27 A;  3G4S 3;  3DH2 A;  1STD A;  1DE3 A;  1E3R A;  3HZP A;  4KVH A;  1UW1 A;  5CLK A;  1VQL 3;  2JQ5 A;  4HM5 B;  3SOA A;  4O8S A;  3FH1 A;  2SAR A;  4BL2 A;  1S5A A;  2W03 A;  1OH0 A;  4FCM A;  1TRQ A;  3B8L A;  4LSO A;  5CF1 A;  3RGA A;  3MPH A;  3UB1 A;  1EG9 B;  1W6Y A;  1IVW A;  1OHP A;  1U5O A;  3HX8 A;  2CFL A;  1N5H A;  1IVX A;  1CH0 A;  3MHE A;  3QK9 A;  1M90 4;  1ZO2 A;  4FMB A;  3FZW A;  2W2C A;  1F8N A;  5G2G A;  3VGN A;  1FUT A;  1D6U A;  1W6C A;  1O7H B;  3NXJ A;  3CC7 3;  5CXO A;  1C54 A;  1MGR A;  2BU4 A;  3F40 A;  1BSD A;  1AR0 A;  2P0M A;  2R4I A;  3KSP A;  1ISK A;  4L8O A;  4EXR A;  3G8Z A;  1NO3 A;  5KP3 A;  2KF5 A;  2A15 A;  2ZDJ A;  2F99 A;  1V58 A;  1QJG A;  5D81 A;  3LT8 A;  1JKG B;  1B2X A;  1CEW I;  1DYU A;  3F7S A;  4H61 A;  1I8V A;  1IK3 A;  3GRD A;  3CCE 3;  2IUK A;  1W4N A;  2W04 A;  3S28 A;  3NBB A;  1Q40 A;  3X3Z A;  4WYK B;  1SJW A;  3WR2 A;  3U97 A;  4WHA A;  1BRG A;  1RGK A;  1K8A 4;  2XEP A;  2KRT A;  1W7C A;  3SED A;  1TFO A;  4NRE A;  4AKY A;  2CHC A;  1UCK A;  1JBR A;  1RGA A;  3MKI A;  4N6N B;  1NWW A;  1UGH I;  2GBW B;  3GZX B;  4KZ1 A;  1W00 A;  1LQM B;  3VSY A;  1Q7Y 4;  1A2P A;  3GAX A;  1YJ9 3;  1GOY A;  3HK4 A;  2W0Q A;  3X3X A;  5IF6 A;  5BIR A;  4OK0 A;  3RGR A;  2E2T A;  4WP5 A;  1O7P B;  1FGO A;  1UI7 A;  3MYT A;  1BSC A;  1RGE A;  2Z6B A;  2GEY A;  1BNJ A;  3OV4 A;  1X1Y A;  1B21 A;  1UUV B;  1JN5 B;  3FF2 A;  5BXQ A;  1RTU A;  3NUV A;  1RKY A;  3EE1 A;  4G1M B;  1BRH A;  3D5I A;  5RNT A;  3WOF B;  1SII A;  4IT7 A;  1Q82 4;  1GD4 A;  2K54 A;  3F14 A;  3D4A A;  2OQE A;  4CJN A;  2BHM A;  1JZO A;  2XR8 B;  3DGN A;  8CHO A;  4KT3 B;  4ILF A;  1N9J A;  6RNT A;  1N5P A;  3IPT A;  2W56 B;  1FGT A;  4O3V A;  1G0T A;  3GZY B;  4R9K A;  5D83 A;  5EVH A;  3EHC A;  2WOH A;  4N3V A;  1RRH A;  1ZX2 A;  1QVG 2;  1NNV A;  5M18 A;  1LOV A;  2K0M A;  2O9U X;  1N9E A;  1RNB A;  3K5T A;  5CF2 A;  1K28 A;  1GY5 A;  1RN1 A;  3X3Y A;  2H0G A;  3LXU X;  2IY2 A;  5IG3 A;  1BSB A;  1T2H A;  1ROA A;  1AVK A;  1RN4 A;  1NDO B;  2ZL8 A;  3EX9 A;  3LH4 A;  3MG3 A;  3PGB A;  4FMC A;  2H0I A;  3FG4 A;  4LEH A;  1TUH A;  3T8N A;  3I56 3;  1FA3 A;  1PY3 A;  1KWI A;  4HAA A;  1OGZ A;  4L7K A;  3UJM A;  1ULJ B;  4CPK A;  3CCV 3;  1JV2 B;  3WHO A;  5AYR B;  1ROV A;  4GHO A;  1IT7 A;  1X1U A;  2ML6 A;  3ECF A;  2CK3 H;  3JUQ A;  2QIY A;  1KQS 2;  1UCJ A;  1QMA A;  2L4V A;  1I3I A;  2AAD A;  3CXC 2;  3CCJ 3;  4Q53 A;  1TP6 A;  1VQ8 3;  1B27 A;  1YIJ 3;  2L1S A;  1BRK A;  5LC7 A;  1UUG B;  2W6J H;  1BU4 A;  2CH9 A;  3IJE B;  1A90 A;  1N8Q A;  1I0X A;  1N8R 4;  1W2B 2;  3S29 A;  3J7Y d;  2SBL A;  3KN4 A;  1IQ8 A;  1FYS A;  4HKV B;  2HML B;  3Q2P A;  1BNS A;  3EBY A;  2ML5 A;  3PS8 A;  4KFF A;  4BU4 A;  2W9Q A;  5BU4 A;  4J9A A;  1BVI A;  4OVM A;  3EQQ B;  3STD A;  1O7W B;  4R80 A;  3NHX A;  4RBN A;  1CYV A;  2P09 A;  1GY7 A;  2FXT A;  3GWR A;  4TX4 A;  1HYF A;  5IG0 A;  3L0R A;  4N6M A;  1VQN 3;  3ZG0 A;  3JUM A;  1RGC A;  1BRN L;  3NX0 A;  1ZS7 A;  2C10 A;  2F5W A;  2CIU A;  1OHS A;  3DXO A;  1LOX A;  2M7O A;  3G71 3;  1BNE A;  2GU3 A;  3EB8 A;  1JBT A;  4HZB B;  4RZM A;  4IPB A;  1BUJ A;  5AI1 A;  1IQX A;  3K9M C;  4N6T A;  6GSP A;  1GMQ A;  1QVF 2;  3HOH A;  2C11 A;  3BNC A;  1LOY A;  2RNT A;  2STD A;  3A5E A;  4LZI A;  2CG0 A;  3A76 A;  4CDL A;  2Z77 A;  3RDE A;  1NB5 I;  1LOW A;  1UCL A;  1FGR A;  3F7X A;  3PXM A;  2KXG A;  2OQE C;  3M8C A;  4J8T A;  5G1K A;  1VQ7 3;  3VF1 A;  1U8C B;  3FG1 A;  3ALA A;  3Q90 A;  1B2M A;  1R4Y A;  1BIR A;  3JUO A;  1BRS A;  2INX A;  3LZA A;  3JUN A;  1CQS A;  3LYG A;  1YJW 3;  3BND A;  1BNG A;  3DGM A;  2R41 A;  1K73 4;  1RSN A;  3I55 3;  2UUG C;  1MWU A;  7GSP A;  3CCR 3;  1MGW A;  2ZHX B;  1HKX A;  3X42 A;  2WOF A;  3BU4 A;  2B24 B;  3EN8 A;  5D82 A;  2PNC A;  1EQK A;  5JPP A;  1RGG A;  5DRV A;  3BNB A;  3CMA 3;  1RJO A;  1PU4 A;  1A67 A;  2HMN B;  2BT3 A;  2CC3 A;  3I0Y A;  1FW7 A;  3CD6 3;  3OWU A;  2KF3 A;  2YFL B;  3K63 A;  1WMO A;  4N6U A;  4HZ9 B;  1BOX A;  4FR9 A;  4IIA A;  1I2F A;  1O7G B;  1SAR A;  1FUS A;  3NBJ A;  3LTC A;  1JB4 A;  3LTA A;  2OOV C;  5AIF A;  2FGT A;  2I9W A;  3KCH A;  3S5C A;  4X2O A;  1L5G B;  1JB5 A;  1JKG A;  1AY7 A;  2AAE A;  2P0X A;  4LYL B;  1EKM A;  2RCD A;  2IYJ A;  2LYX A;  3SX1 A;  1FUW A;  3ZFZ A;  2WGO A;  3OWY A;  3H51 A;  5STD A;  1BAO A;  1GD3 A;  1OHO A;  2CX1 A;  4WYK A;  2F4Y A;  3V98 A;  4AKZ A;  1YNV X;  4XDV A;  1M9G A;  4JF8 A;  3D79 A;  2D1W A;  1GSP A;  3O8Y A;  1X1X A;  3KFQ C;  1LNH A;  5HGR A;  1OF5 B;  3OWS A;  3F8X A;  1STF I;  4MMZ B;  4HJL B;  1LXE A;  2MC8 A;  2IMJ A;  1W01 A;  2P38 A;  1EEJ A;  1TIJ A;  1FGQ A;  4O02 B;  2XFS A;  4LMI A;  5I97 A;  1VQP 3;  1A2V A;  1IYY A;  4K1U A;  2W9P A;  1GMP A;  3HIG A;  2P05 A;  2YFI B;  3LT9 A;  5IEP A;  2QA4 3;  1CYU A;  2RFR A;  3MWZ A;  3S67 A;  1YGE A;  1VQQ A;  1JN5 A;  2BMO B;  3G16 A;  5FGO A;  7RNT A;  1MWT A;  2GXF A;  3LTB A;  3MG2 A;  5IER A;  1TTO A;  1SPU A;  3TDG A;  1VQO 3;  1PFP A;  4ORL A;  3OX9 A;  4BTY A;  3LML A;  2Z76 A;  2CKF B;  4GB5 A;  4K61 A;  4EYC A;  2F98 A;  1OPY A;  3NV0 B;  3CCM 3;  2XH9 A;  1Q86 4;  3ZG5 A;  2KCD A;  1YJN 3;  2RSX A;  3WMD A;  1E97 A;  2W56 A;  3WOD G;  4EW5 A;  5AEU B;  3OW2 2;  4O2H A;  1I2G A;  3SLU A;  1UCI A;  4HM0 B;  1JNQ A;  2UGI A;  1GOV A;  1IV9 A;  3WA2 X;  1VQ9 3;  1WTH A;  3V92 A;  3EF8 A;  3SOY A;  3ER7 A;  3CCQ 3;  1RGL A;  2Q07 A;  1GS3 A;  3FLJ A;  5AIG A;  2GBX B;  1SQW A;  3EN1 B;  2XGL A;  3CME 3;  1D6Y A;  2KAA A;  3RNT A;  1YVB I;  4AEQ A;  4GSP A;  1R4C A;  2XSH B;  5M19 A;  1RCL A;  4KFD A;  1AVL A;  3UNL A;  3K7C A;  3DM8 A;  3UL5 A;  2OTJ 3;  4WWU C;  5G1L A;  1RMS A;  3LTD A;  3URP A;  1Q7H A;  1TU5 A;  1YHQ 3;  2RBI A;  4H3U A;  6STD A;  2BNG A;  2BMR B;  3AMO B;  4N6V 0;  1BUQ A;  1E3V A;  2F86 B;  3NM2 A;  1DVD A;  1RN7 A;  2CG1 A;  2BMQ B;  3SVA A;  1BRI A;  4HYZ A;  4HM6 B;  1X1W A;  1A2K A;  1JRQ A;  3DGY A;  4FMD A;  3CCS 3;  1BNF A;  1RNT A;  3WA3 A;  1FZU A;  2FNQ A;  4R1K A;  1W02 A;  3NQY A;  4R9L A;  5DRE A;  3PZW A;  2YX9 A;  3ROB A;  2J8X B;  1Q42 A;  1LRA A;  1VQ4 3;  2H0H A;  1W2Z A;  5ELJ A;  5IEN A;  1B20 A;  2HMK B;  1O7M B;  1IVV A;  2O3O A;  4FCJ A;  4L8P A;  4CCV A;  3KKG A;  1NJI 4;  1KD1 4;  3GZB A;  9RNT A;  1RHL A;  3PCR A;  2IA7 A;  4WFO A;  1JZD A;  1IT8 A;  4XB5 A;  5FW5 A;  5IG5 A;  5KP1 A;  1GMR A;  3E99 A;  1DET A;  5TGN A;  1DMQ A;  3BNE A;  2WGQ A;  3N9H A;  1LNI A;  3PCS A;  4J5K A;  1C7H A;  2GSP A;  4OUQ A;  3FGY A;  4BIR A;  1BSE A;  1MOL A;  5JPU A;  4HM4 B;  2E2U A;  1RRL A;  2D42 A;  3D9R A;  3EJV A;  1KSI A;  1IV7 A;  1WMP A;  3N8B A;  3V99 A;  4MMY B;  4GL6 A;  1O7N B;  3HII A;  3BIR A;  4FCZ A;  5AEW B;  1AV4 A;  1S72 3;  4PEJ A;  4U13 A;  4N6O B;  1OCV A;  1ZGX A;  1ASK A;  3CC4 3;  3B4P A;  1VQ6 3;  1BNR A;  4LGQ A;  2XF3 A;  2XSO B;  4RNT A;  1I0V A;  3Q3F A;  1RDS A;  1Q40 B;  1PYL A;  1MWR A;  1IDP A;  1BNI A;  2C4B A;  5CK6 A;  7STD A;  1D6Z A;  1YI2 3;  4R4K A;  4K90 B;  3CPO A;  2MF7 A;  1MNL A;  1HU9 A;  2LQV A;  1UGI A;  1UI8 A;  2HMO B;  3LOY A;  4MJD A;  4JRF A;  5IW9 A;  1B3S A;  2CWU A;  3CCU 3;  4HM2 B;  5HOH A;  4XDW A;  5KP4 A;  4RNZ A;  3CU3 A;  1EA2 A;  1V57 A; 
#chains in the Genus database with same CATH homology
 4STD A;  2HMM B;  2Z7A A;  2GEX A;  5AII A;  3B4O A;  1JB2 A;  1TFK A;  3FKA A;  3F8H A;  1FGM A;  1NU3 A;  1VQK 3;  2OWP A;  3CNX A;  2CWV A;  3UL6 A;  5BVB A;  3G0K A;  3EC9 A;  2Y73 A;  1GYB A;  2JDI H;  3T0U A;  1IQY A;  1IU7 A;  1UUW B;  1T5Y A;  2HMJ B;  4EC6 A;  3FSD A;  1V74 A;  3DMC A;  2CWT A;  3B7C A;  3Q1C A;  1K9M 4;  1J2B A;  5EQL A;  3NM7 A;  1DMM A;  1QAF A;  2Y74 A;  2CW9 A;  3EBT A;  3G6E 3;  1LVN A;  4XM4 A;  3BB9 A;  4FMA A;  3T8U A;  4ZM8 A;  3WDG B;  4X2H A;  3X40 A;  4EV2 A;  5IG4 A;  1JJ2 2;  4QWT A;  3QRD A;  2GU1 A;  2XFT A;  3F9S A;  1NB3 I;  2CFD A;  3CPW 2;  1OF5 A;  4K1V A;  2RGQ A;  2XRX B;  3D3L A;  3KZT A;  4NHF A;  3WOE B;  2CFG A;  3BLZ A;  3MG1 A;  3OXA A;  4XBT A;  5EEO A;  3DGO A;  3DZL A;  5A0O B;  3IMA B;  1OGX A;  2UX0 A;  4MEI A;  1YIT 3;  4KFE A;  3FG3 A;  4HM1 B;  5AYS C;  1QAK A;  4I4K A;  1ULI B;  4MMX B;  2V1L A;  3K0Z A;  3JUP A;  1IVU A;  3FCS B;  3GZR A;  3KSE D;  5AIH A;  2QEX 3;  2YFJ B;  4EV5 A;  4RNY A;  3NV0 A;  3PYJ A;  1W5Z A;  2OTL 3;  4HM8 B;  1W6G A;  3DUK A;  1DMN A;  3KII A;  1G96 A;  3JVC A;  5LC6 A;  5ELU A;  1OUN A;  3KE7 A;  2OOV A;  1M1K 4;  2CFK A;  3FF0 A;  3DY5 A;  4HM3 B;  2QGU A;  4EBG A;  1GY6 A;  2WO0 A;  1Y4K A;  3H3H A;  1KC8 4;  2BO9 B;  1WMN A;  2OCT A;  4XBY A;  2IUJ A;  1US1 A;  1Q81 4;  3DGL A;  3SXX A;  4XBX A;  3NBR A;  3NQZ A;  2B1X B;  1WQL B;  1Z1S A;  4N6L A;  1SIH A;  5IEO A;  2XGN A;  3X41 A;  1DVC A;  5JBS A;  3HI7 A;  1K41 A;  1M1X B;  1VQM 3;  2E2V A;  2CFW A;  1VZZ A;  1OAC A;  3CNM A;  2PZV A;  4HM7 B;  3CCL 3;  3N54 B;  3CC2 3;  4HBR A;  3MSO A;  4BTW A;  4BTX A;  3AMO A;  4HVN A;  1VQ5 3;  1QAL A;  1WNH A;  3U1W A;  3S27 A;  3G4S 3;  1STD A;  1E3R A;  3HZP A;  4KVH A;  1UW1 A;  5CLK A;  1VQL 3;  2JQ5 A;  4HM5 B;  3SOA A;  4O8S A;  3FH1 A;  1S5A A;  2W03 A;  1OH0 A;  4FCM A;  3B8L A;  4LSO A;  5CF1 A;  3RGA A;  3MPH A;  3UB1 A;  1EG9 B;  1W6Y A;  1IVW A;  1OHP A;  1U5O A;  3HX8 A;  2CFL A;  1N5H A;  1IVX A;  3MHE A;  3QK9 A;  1M90 4;  1ZO2 A;  4FMB A;  3FZW A;  2W2C A;  1F8N A;  5G2G A;  3VGN A;  1D6U A;  1W6C A;  1O7H B;  3NXJ A;  3CC7 3;  5CXO A;  3F40 A;  1AR0 A;  2P0M A;  2R4I A;  3KSP A;  1ISK A;  4L8O A;  4EXR A;  3G8Z A;  1NO3 A;  5KP3 A;  2ZDJ A;  2A15 A;  2F99 A;  5D81 A;  1QJG A;  3LT8 A;  1JKG B;  1CEW I;  1DYU A;  3F7S A;  4H61 A;  1IK3 A;  3GRD A;  3CCE 3;  2IUK A;  1W4N A;  2W04 A;  3S28 A;  3NBB A;  1Q40 A;  3X3Z A;  4WYK B;  1SJW A;  3U97 A;  4WHA A;  1K8A 4;  2XEP A;  2KRT A;  1W7C A;  3SED A;  1TFO A;  4NRE A;  4AKY A;  2CHC A;  3MKI A;  4N6N B;  1NWW A;  2GBW B;  3GZX B;  4KZ1 A;  3VSY A;  1W00 A;  1Q7Y 4;  3GAX A;  1YJ9 3;  3HK4 A;  3X3X A;  2W0Q A;  5IF6 A;  4OK0 A;  3RGR A;  2E2T A;  4WP5 A;  1O7P B;  1FGO A;  1UI7 A;  3MYT A;  2Z6B A;  2GEY A;  3OV4 A;  1UUV B;  1JN5 B;  3FF2 A;  5BXQ A;  3NUV A;  1RKY A;  3EE1 A;  4G1M B;  3WOF B;  1SII A;  4IT7 A;  1Q82 4;  1GD4 A;  2K54 A;  3F14 A;  2OQE A;  2BHM A;  2XR8 B;  3DGN A;  8CHO A;  1N9J A;  1N5P A;  3IPT A;  2W56 B;  1FGT A;  4O3V A;  3GZY B;  4R9K A;  5D83 A;  5EVH A;  3EHC A;  2WOH A;  4N3V A;  1RRH A;  1ZX2 A;  1QVG 2;  2K0M A;  2O9U X;  1N9E A;  3K5T A;  5CF2 A;  1K28 A;  1GY5 A;  3X3Y A;  3LXU X;  5IG3 A;  1ROA A;  1AVK A;  3MG3 A;  1NDO B;  2ZL8 A;  3EX9 A;  3LH4 A;  3PGB A;  4FMC A;  1A67 A;  3FG4 A;  4LEH A;  3T8N A;  1TUH A;  1FA3 A;  3I56 3;  1KWI A;  1OGZ A;  4L7K A;  3UJM A;  1ULJ B;  3CCV 3;  1JV2 B;  5AYR B;  1ROV A;  1IT7 A;  2ML6 A;  3ECF A;  2CK3 H;  3JUQ A;  2QIY A;  1KQS 2;  1QMA A;  2L4V A;  3CCJ 3;  3CXC 2;  4Q53 A;  1TP6 A;  1VQ8 3;  1YIJ 3;  5LC7 A;  2W6J H;  2CH9 A;  3IJE B;  1A90 A;  1N8Q A;  1N8R 4;  1W2B 2;  3S29 A;  3J7Y d;  2SBL A;  3KN4 A;  1IQ8 A;  4HKV B;  2HML B;  3Q2P A;  3EBY A;  2ML5 A;  3PS8 A;  4KFF A;  2W9Q A;  4J9A A;  4OVM A;  3EQQ B;  3STD A;  1O7W B;  4R80 A;  3NHX A;  4RBN A;  1CYV A;  2P09 A;  1GY7 A;  2FXT A;  3GWR A;  4TX4 A;  5IG0 A;  3L0R A;  4N6M A;  1VQN 3;  3JUM A;  3NX0 A;  2C10 A;  2CIU A;  1OHS A;  3DXO A;  1LOX A;  2M7O A;  3G71 3;  2GU3 A;  3EB8 A;  4HZB B;  4RZM A;  4IPB A;  5AI1 A;  1IQX A;  3K9M C;  4N6T A;  1QVF 2;  2C11 A;  3BNC A;  2STD A;  4LZI A;  2CG0 A;  3A76 A;  4CDL A;  2Z77 A;  3RDE A;  1NB5 I;  1FGR A;  3F7X A;  3PXM A;  2KXG A;  2OQE C;  3M8C A;  4J8T A;  1VQ7 3;  3VF1 A;  1U8C B;  3FG1 A;  3ALA A;  3Q90 A;  3JUO A;  2INX A;  3LZA A;  3JUN A;  1CQS A;  3LYG A;  1YJW 3;  3BND A;  3DGM A;  1K73 4;  3I55 3;  3CCR 3;  1HKX A;  3X42 A;  2WOF A;  2B24 B;  3EN8 A;  5D82 A;  2PNC A;  1EQK A;  5JPP A;  5DRV A;  3BNB A;  3CMA 3;  1RJO A;  1PU4 A;  2HMN B;  2BT3 A;  2CC3 A;  3I0Y A;  3CD6 3;  3OWU A;  2YFL B;  3K63 A;  1WMO A;  4N6U A;  4HZ9 B;  4FR9 A;  4IIA A;  1O7G B;  3NBJ A;  3LTC A;  1JB4 A;  3LTA A;  2OOV C;  5AIF A;  2FGT A;  2I9W A;  3S5C A;  4X2O A;  1L5G B;  1JB5 A;  1JKG A;  2P0X A;  1EKM A;  2RCD A;  2LYX A;  3SX1 A;  1FUW A;  2WGO A;  3OWY A;  3H51 A;  5STD A;  1GD3 A;  1OHO A;  4WYK A;  3V98 A;  4AKZ A;  4XDV A;  1M9G A;  4JF8 A;  2D1W A;  3O8Y A;  3KFQ C;  1LNH A;  5HGR A;  1OF5 B;  3OWS A;  3F8X A;  1STF I;  4MMZ B;  4HJL B;  1LXE A;  2MC8 A;  2IMJ A;  1W01 A;  2P38 A;  1TIJ A;  4O02 B;  1FGQ A;  5I97 A;  2XFS A;  4LMI A;  1VQP 3;  1A2V A;  4K1U A;  2W9P A;  3HIG A;  2P05 A;  2YFI B;  3LT9 A;  5IEP A;  2QA4 3;  1CYU A;  2RFR A;  3MWZ A;  3S67 A;  1YGE A;  1JN5 A;  2BMO B;  3G16 A;  5FGO A;  3LTB A;  2GXF A;  3MG2 A;  5IER A;  1SPU A;  3TDG A;  1VQO 3;  1PFP A;  4ORL A;  3OX9 A;  4BTY A;  3LML A;  2Z76 A;  2CKF B;  4GB5 A;  4K61 A;  4EYC A;  2F98 A;  1OPY A;  3NV0 B;  3CCM 3;  2XH9 A;  1Q86 4;  2KCD A;  1YJN 3;  2RSX A;  3WMD A;  1E97 A;  2W56 A;  3WOD G;  5AEU B;  3OW2 2;  4O2H A;  3SLU A;  4HM0 B;  1JNQ A;  1IV9 A;  3WA2 X;  1WTH A;  3V92 A;  3EF8 A;  3SOY A;  3ER7 A;  3CCQ 3;  2Q07 A;  1GS3 A;  3FLJ A;  5AIG A;  2GBX B;  1SQW A;  3EN1 B;  2XGL A;  3CME 3;  1D6Y A;  1YVB I;  4AEQ A;  1R4C A;  2XSH B;  4KFD A;  1AVL A;  3UNL A;  3K7C A;  3DM8 A;  3UL5 A;  2OTJ 3;  4WWU C;  3LTD A;  1TU5 A;  1YHQ 3;  4H3U A;  6STD A;  2BNG A;  2BMR B;  3AMO B;  4N6V 0;  1BUQ A;  1E3V A;  2F86 B;  3NM2 A;  1DVD A;  1RN7 A;  2CG1 A;  2BMQ B;  3SVA A;  4HYZ A;  4HM6 B;  1JRQ A;  1A2K A;  4FMD A;  3CCS 3;  3WA3 A;  2FNQ A;  4R1K A;  1W02 A;  3NQY A;  4R9L A;  5DRE A;  3PZW A;  2YX9 A;  3ROB A;  1Q42 A;  1VQ4 3;  1W2Z A;  5ELJ A;  5IEN A;  2HMK B;  1O7M B;  1IVV A;  2O3O A;  4FCJ A;  4L8P A;  4CCV A;  3KKG A;  1NJI 4;  1KD1 4;  3GZB A;  3PCR A;  2IA7 A;  4WFO A;  1IT8 A;  4XB5 A;  5FW5 A;  5IG5 A;  5KP1 A;  5TGN A;  3E99 A;  1DMQ A;  3BNE A;  2WGQ A;  3N9H A;  3PCS A;  1C7H A;  4OUQ A;  3FGY A;  1MOL A;  5JPU A;  4HM4 B;  2E2U A;  1RRL A;  2D42 A;  3D9R A;  3EJV A;  1KSI A;  1IV7 A;  1WMP A;  3N8B A;  3V99 A;  4MMY B;  4GL6 A;  1O7N B;  3HII A;  4FCZ A;  5AEW B;  1S72 3;  1AV4 A;  1VQ9 3;  4PEJ A;  4U13 A;  4N6O B;  1OCV A;  3CC4 3;  1ASK A;  3B4P A;  1VQ6 3;  4LGQ A;  2XF3 A;  2XSO B;  1Q40 B;  1IDP A;  5CK6 A;  7STD A;  1YI2 3;  1D6Z A;  4R4K A;  4K90 B;  3CPO A;  2MF7 A;  1MNL A;  1HU9 A;  2LQV A;  1UI8 A;  2HMO B;  3LOY A;  4MJD A;  4JRF A;  5IW9 A;  2CWU A;  3CCU 3;  4HM2 B;  4XDW A;  5KP4 A;  4RNZ A;  3CU3 A;  1EA2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...