3A76A

The crystal structure of lina
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
147
structure length
147
Chain Sequence
MSDLDRLASRAAIQDLYSDKLIAVDKRQEGRLASIWWDDAEWTIEGIGTYKGPEGALDLANNVLWPMFHECIHYGTNLRLEFVSADKVNGIGDVLLLGNLVEGNQSILIAAVFTDEYERRDGVWKFSKRNACTNYFTPLAGIHFAPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of g-hexachlorocyclohexane dehydrochlorinase LinA from Sphingobium japonicum UT26
pubmed doi rcsb
source organism Sphingomonas paucimobilis
molecule tags Lyase
molecule keywords Gamma-hexachlorocyclohexane dehydrochlorinase
total genus 43
structure length 147
sequence length 147
chains with identical sequence B, C
ec nomenclature ec 4.5.1.-:
pdb deposition date 2009-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13577 SnoaL_4 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3a76A01
1ULIB 1NDOB 3NV0A 3ECFA 4HZBB 3F14A 1QMAA 1OF5A 3EHCA 5KP1A 3HK4A 2BMQB 3EX9A 2GEXA 4FCMA 4L8OA 3DUKA 2RGQA 2Z76A 5IG4A 1DMMA 2R4IA 1EA2A 2B24B 2W2CA 3GRDA 4K1UA 3JUQA 4IIAA 3ER7A 1K41A 1O7WB 1JB2A 1ZX2A 1OHOA 3HX8A 3I0YA 3JUNA 4XBXA 2A15A 3G16A 1E3VA 1TUHA 2OWPA 3E99A 1W00A 3JUPA 3MG3A 4HM0B 4HM6B 5DREA 3SOYA 4HM7B 4HKVB 4RZMA 5IERA 4OVMA 5D81A 3GZRA 1DMNA 1E97A 1JN5A 1DMQA 1OGZA 3DM8A 3EC9A 1JB5A 1OGXA 2XR8B 1Q40A 2HMOB 2RCDA 2IMJA 2K54A 2YFJB 3B7CA 3EN1B 3GZXB 3HZPA 3K0ZA 4L8PA 5AIFA 4R1KA 1A2KA 3EQQB 4HM3B 5IG5A 3FLJA 3NV0B 3G0KA 4J8TA 3FZWA 4MJDA 4R9LA 4I4KA 5IG3A 1TP6A 3EBYA 1OF5B 2Z7AA 2GBXB 4H3UA 1Z1SA 4HZ9B 4N3VA 4WYKA 2BNGA 1OH0A 2HMJB 1UUWB 1NU3A 3EN8A 2CHCA 1GS3A 2HMKB 3F8XA 3H3HA 2UX0A 5IENA 5IEPA 3NUVA 3MKIA 3STDA 2HMNB 3VSYA 4XBTA 3GZYB 1OHPA 3SOAA 1Q42A 6STDA 1GY7A 3VGNA 3CNMA 2GEYA 4HM1B 3UJMA 1OUNA 2Z77A 5BVBA 1OPYA 2I9WA 3F9SA 3FKAA 1UUVB 5CK6A 1O7GB 1BUQA 7STDA 3KE7A 3Q90A 4HVNA 2HMMB 3F7XA 4XBYA 1AR0A 1SJWA 3A76A 5JPUA 5KP4A 1O7MB 4K1VA 4X2OA 1ISKA 3MHEA 3KSPA 3T8NA 5CF1A 3EJVA 5CLKA 3SEDA 5DRVA 5AEUB 3MYTA 3FGYA 2XSHB 3B4OA 3ROBA 3B4PA 4HM5B 5FW5A 1W02A 2JQ5A 3NBRA 2F98A 3IPTA 1U5OA 3F8HA 3OWYA 4KVHA 4LEHA 5IF6A 5AIGA 1OCVA 3GZBA 5CXOA 4WP5A 1Q40B 1WQLB 3B8LA 3FF2A 3OXAA 5CF2A 5AI1A 3WMDA 3OX9A 2QIYA 3K7CA 5AIHA 2XSOB 5AIIA 3KZTA 2BMOB 1W6YA 2STDA 2GXFA 4PEJA 3M8CA 1GY5A 3MSOA 4STDA 4XDVA 5D82A 1O7HB 4LMIA 1QJGA 5BXQA 2B1XB 3EBTA 3T8UA 4CDLA 2HMLB 3CNXA 1NWWA 4FCJA 2CKFB 3S5CA 3FH1A 3D9RA 3OWUA 3NHXA 1O7PB 4J9AA 2F99A 4ORLA 2QGUA 4XM4A 5EVHA 4X2HA 1ULJB 1E3RA 1JN5B 4LGQA 1HKXA 1GYBA 3MG1A 3H51A 3JUOA 5JPPA 1IDPA 4HM4B 4L7KA 4R9KA 3DXOA 3NXJA 1ZO2A 3MG2A 1GY6A 5G2GA 3LZAA 3DMCA 1STDA 2YFLB 3OV4A 4HM8B 4WWUC 5HGRA 1VZZA 3RGRA 4XB5A 1S5AA 1W01A 3FF0A 3G8ZA 2RFRA 4HJLB 5IG0A 1O7NB 3BLZA 3KKGA 3CU3A 5IEOA 2PZVA 4WYKB 5TGNA 3RGAA 1EG9B 5AEWB 3FSDA 1CQSA 3F7SA 2XRXB 4Q53A 2GBWB 2YFIB 4GB5A 4U13A 4XDWA 3GWRA 1ASKA 5D83A 5KP3A 3BB9A 2F86B 1C7HA 4HM2B 3JUMA 1JKGB 3DZLA 3F40A 3UNLA 5STDA 3NM2A 4OUQA 2BMRB 3CPOA 3LYGA 3OWSA 2INXA 8CHOA 1OHSA 1JB4A 1JKGA 3EF8A
chains in the Genus database with same CATH superfamily
1NDOB 2O3OA 1PY3A 3NQZA 1JJ22 1QMAA 2F56A 2BT3A 3EHCA 5LC6A 3CPW2 2BMQB 3MWZA 4KFEA 4L8OA 3SLUA 1VQK3 1GMRA 2KF4A 1MGRA 1C54A 4LSOA 2CX1A 3D5GA 2JDIH 5ELJA 4DKIA 3GSPA 1W2ZA 1OHOA 3HX8A 1ROVA 1L5GB 1LXEA 1IK3A 3G16A 1E3VA 5IF6A 3E99A 1D6UA 1RCKA 1W00A 3MG3A 2SBLA 4WFOA 1W4NA 5D81A 1DMNA 3CCU3 3EC9A 1DMQA 3T0UA 1I2FA 1IYYA 3EN1B 3TDGA 1RNBA 1B2ZA 1FUTA 1UI7A 3EQQB 4R9LA 2P38A 3G0KA 4J8TA 1WNHA 3Q1CA 5AYSC 3CME3 1SPUA 5IG3A 1UI8A 1JNQA 2P0MA 1JBRA 1Z1SA 4HZ9B 1T2HA 1OH0A 1X1YA 7RNTA 3EN8A 3HIIA 5M1AA 1GS3A 2HMKB 5IEPA 3I553 2V1LA 2E2UA 3NUVA 1US1A 3S28A 3STDA 3VSYA 6STDA 1Q42A 4N6OB 3VGNA 3CNMA 3K5TA 1HYFA 2XEPA 3ZG5A 2I9WA 3AMOB 3QRDA 1KD14 1BUQA 3RNTA 3X3XA 3KN4A 1KSIA 3KFQC 1NJI4 3NX0A 2HMMB 3MPHA 4HVNA 4XBYA 1QVF2 5JPUA 3T8NA 5AEUB 5DRVA 1BU4A 3MYTA 2UGIA 1BANA 1CH0A 1B27A 3FGYA 2H0IA 2JQ5A 3NBRA 1M1K4 4KZ1A 1JBSA 1BSEA 1UCJA 1LQMB 3IPTA 1MWRA 3F8HA 3OWYA 4EC6A 1GD3A 1OCVA 3AHWA 3GZBA 1GSPA 3OXAA 4AKYA 1BNSA 1YGWA 3K7CA 2Q07A 3BU4A 4N6UA 1AVKA 1NNVA 1W6YA 2BMOB 3WMDA 1RGKA 3M8CA 4PEJA 4LZIA 4LMIA 5A0OB 5BXQA 3T8UA 4BTXA 1SARA 2CH9A 2XGLA 3D9RA 4KFDA 3NHXA 3G6E3 1IU7A 2F99A 1BRGA 4ORLA 1A90A 4XM4A 3EE1A 1G96A 3PGBA 3DY5A 3DGOA 4LGQA 3N54B 1ZGXA 9RNTA 3JUOA 3N8BA 4FCZA 1R4CA 4HM4B 1BSCA 3DXOA 2WO0A 2KRTA 3S27A 3LZAA 1QVG2 3IJEB 1STDA 3OV4A 1TJDA 1I0VA 3PXMA 1VZZA 3RGRA 3WDGB 1YJW3 4EYCA 1IVWA 3G8ZA 1R4YA 2RFRA 1WMPA 3AGNA 3JVCA 5IG0A 4EV5A 1EUIC 1M9GA 1OACA 5AEWB 4FMDA 2E2TA 2XRXB 2YFIB 1IT8A 4FMBA 4GB5A 2L1SA 3KIIA 1JKGB 1UCIA 2FGTA 1N8QA 2XF3A 1NB3I 3ALAA 2ML6A 3CC43 1BIRA 2CIUA 3CPOA 1K28A 3LYGA 3WR2A 3ZFZA 1LOVA 4HAAA 1OHSA 1BNGA 4CJNA 1RGGA 1ULIB 1DYUA 4HZBB 2UUGC 2GEXA 3EX9A 2CFGA 1B3SA 1JRQA 2RGQA 1UGIA 4QWTA 5IG4A 1DMMA 2RBIA 1EA2A 2B24B 2W2CA 2OTL3 4K1UA 3JUQA 4I5QA 1YVBI 1O7WB 3ER7A 1T2IA 3S67A 4EW5A 1S723 3A5EA 2XFTA 3D79A 1FYSA 1A67A 3I0YA 1VQL3 1KC84 1Q9EA 1VQP3 1TUHA 3SOYA 1RKYA 2OQEA 1E97A 1FGMA 1OGZA 1I70A 4X2OA 1GOVA 1Q40A 2XR8B 3HZPA 5STDA 1FGTA 3B7CA 3K0ZA 3GZXB 1K9M4 2CFDA 5M19A 3X3ZA 1LOYA 1NB5I 3LTCA 5IG5A 4HM3B 3LXUX 1WMNA 3NV0B 2W9PA 1Q7Y4 4I4KA 1MGWA 2J8XB 1PFPA 2D42A 2IUJA 2BNGA 4O8SA 3X3YA 1JBTA 1B2MA 3H3HA 3LOYA 5FGOA 4RNZA 4RNYA 4G1MB 3K9MC 5JBSA 2IUKA 3BNBA 2O9UX 3HI7A 2ZHXB 4XBTA 3SOAA 1GY7A 1FGQA 1N9JA 4HM1B 1N9EA 4O3VA 1VQO3 1RGLA 2Z77A 1SQWA 2BIRA 4R80A 1BRIA 1CEWI 1B21A 2AADA 1O7GB 5CK6A 7GSPA 7STDA 2BHMA 4O02B 3V98A 3F7XA 1VQM3 1BNRA 1AR0A 5KP4A 3Q3FA 4K1VA 5G1KA 1VQ63 2CK3H 1DETA 1M1XB 1RGFA 3AMOA 1VQ73 2MC8A 1W02A 1YVSA 2FXTA 4N6LA 3FCSB 1U5OA 1UUGB 5EEOA 3GAXA 3CCE3 3CMA3 1GOYA 1ROAA 1UDII 1WQLB 2W56A 3B8LA 2P0XA 3FF2A 1AV4A 2LYXA 5CF2A 1TRPA 3LTBA 2Y73A 3CXC2 1YIJ3 1CYUA 2QEX3 2KF6A 3MSOA 4AEQA 3DGLA 2W0QA 1RTUA 4NHFA 1N8R4 1Q864 3EBTA 1IQXA 1IT7A 2SARA 3KSED 1O7PB 4J9AA 3LTDA 5BU4A 1N5HA 2ZL8A 4KT3B 1A2VA 3AGOA 4GHOA 5EVHA 6RNTA 1ULJB 3SYUA 1IVXA 1JN5B 1BRKA 1HKXA 3MG1A 1FGRA 1VQ93 3VF1A 4L7KA 1UCKA 1ZO2A 1STFI 1RGCA 3PYJA 1W5ZA 2C10A 1TFKA 3WOEB 3D3LA 2HOHA 3CCV3 4HJLB 1O7NB 3O8YA 4ILFA 3CU3A 3CD63 3J7Yd 2ZDJA 1CYVA 3RGAA 1EG9B 2CX0A 1CQSA 4Q53A 3WHOA 1DVCA 5KP3A 1ASKA 3WOFB 2F86B 3F40A 1GMPA 3DZLA 2XGNA 3V92A 1FGOA 3X42A 3NM2A 2W9QA 1IVVA 2INXA 2KCDA 1JKGA 4HOHA 2CWVA 1X1XA 3BNDA 1RN4A 1K734 3ECFA 4JRFA 3I563 4EXRA 1B2SA 1MOLA 3HK4A 1RN1A 1QAKA 2CFKA 1NO3A 3BNCA 2OQEC 2FNQA 1K41A 1JB2A 1Q7HA 4RNTA 4XBXA 1GOUA 2OTJ3 1T5YA 3G4S3 2QA43 2A15A 4BU4A 3JUPA 1QALA 4HM0B 1JZDA 2WGOA 4HKVB 3KCHA 4OVMA 3GZRA 1JN5A 1IV7A 1RRLA 2CFWA 1OGXA 2KF3A 3NXJA 3CCM3 4L8PA 1FZUA 2IMJA 2K54A 1LNHA 1WMOA 2C11A 4NPBA 5AIFA 3SXXA 1FUSA 1A2KA 3X40A 3FLJA 1FUWA 1RRHA 1VQ43 1OF5B 4GL6A 2WGQA 3D4AA 1EKMA 1UUWB 1NU3A 5ELUA 2CHCA 3F8XA 3WA2X 5IENA 1B2UA 3NQYA 4LYLB 3ZG0A 5AYRB 1SIHA 2M7OA 2OOVC 2GSPA 3CCL3 1RDSA 2W6JH 1LNIA 1ZS7A 2GEYA 3UJMA 1OUNA 3D5IA 1I0XA 5BVBA 2KXGA 4MEIA 3LH4A 5M18A 1LOXA 2KAAA 1UUVB 2BU4A 2ZA4A 4J5KA 4K90B 3KE7A 1PU4A 3SX1A 1X1WA 3UL5A 1UCLA 2E2VA 3A76A 2IY2A 1LQGC 1O7MB 3BIRA 1BSDA 1JV2B 3KSPA 3MHEA 1K8A4 3EJVA 1ISKA 5CLKA 3SEDA 1BSBA 3FG3A 1EQKA 2L4VA 1HU9A 1TTOA 2XSHB 1DE3A 3ROBA 4K61A 4KVHA 3CCS3 1J2BA 1AVLA 1HZ1A 4WP5A 1Q40B 2CWTA 4R4KA 1Q824 1B2XA 3OX9A 1YNVX 2CC3A 5IW9A 1BGSA 5AIIA 1GD4A 1BNIA 5GSPA 2STDA 3N9HA 2GXFA 4STDA 3OW22 1GY5A 1IQ8A 4IPBA 1QJGA 2B1XB 1RGAA 4KFFA 3SVAA 2C4BA 1NWWA 4MMXB 1VQN3 2K0MA 3S5CA 3S29A 1RSNA 2F5WA 3OWUA 1LOWA 3V99A 1VQ83 1BNFA 2QGUA 4X2HA 1RGHA 1E3RA 4N6V0 1VQ53 2CFLA 3PCRA 1GYBA 1I3IA 1X1UA 1RCLA 3HOHA 1BRNL 1EEJA 4R9KA 3RDEA 1QAFA 2Y74A 1GY6A 3MG2A 3NBJA 2CG1A 1VQQA 3X41A 3EB8A 2YFLB 3K63A 1BSAA 5HGRA 4NREA 1S5AA 3FF0A 4WYKB 3FSDA 4U13A 4AKZA 4XDWA 1UGHI 1RHLA 4MMZB 1C7HA 1TRQA 3JUMA 3UNLA 4EV2A 2H0HA 4FMCA 4OUQA 8CHOA 2W56B 4N6MA 4WHAA 4TX4A 1JB4A 1D6ZA 3EF8A 4WWUC 3NV0A 2XFSA 3F14A 1OF5A 2BO9B 5KP1A 2D1WA 4FCMA 2W04A 1RN7A 1U8CB 3DUKA 1FA3A 2Z76A 1V58A 2KF5A 1RJOA 2R4IA 3CC23 3GRDA 3FG1A 1BOXA 1KWIA 4IIAA 3AHSA 2YX9A 4HYZA 3U1WA 1YGEA 1AY7A 4FR9A 1RGEA 3LT8A 1ZX2A 5RNTA 3JUNA 3PZWA 3G713 1TFOA 2GU3A 1Q814 3CCJ3 2OWPA 1RNTA 1D6YA 4HM6B 5I97A 5DREA 1W2B2 5BIRA 4HM7B 1IVUA 4RZMA 5IERA 1I8VA 1LVNA 5JPPA 3DM8A 2IYJA 4HM8B 1JB5A 5CXOA 1Y4KA 2HMOB 1MWTA 2RCDA 2CW9A 2YFJB 1W7CA 1MWUA 3QK9A 2F5MA 4R1KA 4BL2A 4MJDA 3FZWA 1JZOA 1TP6A 3EBYA 2Z7AA 2GBXB 4H3UA 4N3VA 4WYKA 1YIT3 2H0GA 2HMJB 1V57A 4BTYA 5EQLA 2UX0A 3WA3A 3MKIA 2HMNB 2Z6BA 1TU5A 1I2GA 1OHPA 3GZYB 2IA7A 1BRSA 3NBBA 1I2EA 1IQYA 3LTAA 1YI23 1OPYA 3F9SA 2RSXA 1KQS2 2P05A 1W6GA 3FKAA 1BNEA 5LC7A 3DGNA 1DVDA 3Q90A 3FG4A 1SJWA 3Q2PA 2MF7A 3U97A 1F8NA 3PCSA 1B20A 3L0RA 5CF1A 3LMLA 3DGMA 4IT7A 2K3DA 2XH9A 3B4OA 1RMSA 3B4PA 2WOFA 4HM5B 5FW5A 3CC73 1YHQ3 3DGYA 2F98A 4ZM8A 2OCTA 1MWSA 4LEHA 4N6NB 3UB1A 1BVIA 5AIGA 2W03A 4J5GA 3DH2A 1PYLA 5AI1A 2F4YA 2QIYA 5AIHA 2XSOB 3IMAB 2AAEA 1A2PA 3KZTA 2GU1A 4XDVA 5D82A 1O7HB 1AQZA 4N6TA 4CDLA 3CCR3 4HBRA 2HMLB 3CNXA 4FCJA 3UL6A 2CKFB 5G1LA 3FH1A 3PS8A 4O2HA 2WOHA 4EBGA 1YJN3 3URPA 2R41A 2RNTA 2OOVA 3HIGA 1BNJA 1FW7A 1BRHA 1G0TA 2CG0A 1I3FA 5HOHA 4BIRA 1GMQA 2CWUA 4OK0A 4CCVA 3H51A 2PNCA 1YJ93 4H61A 1IDPA 1RLSA 4MMYB 4CPKA 1TIJA 4JF8A 5G2GA 4BTWA 3DMCA 1V74A 4GSPA 3WODG 1G02A 1BAOA 1N5PA 1W01A 2P09A 4XB5A 1BRJA 4RBNA 2ML5A 3BLZA 3KKGA 5IEOA 5TGNA 2PZVA 6GSPA 2LQVA 1IV9A 1UW1A 3CCQ3 3F7SA 4FMAA 1MNLA 2GBWB 8RNTA 5D83A 3GWRA 3BB9A 1M904 1LRAA 4HM2B 4BL3A 3NM7A 3BNEA 1BUJA 2BMRB 3LT9A 3OWSA 1T3BA 1SIIA 1WTHA 1W6CA
chains in the Genus database with same CATH topology
1NDOB 2O3OA 3NQZA 1JJ22 1QMAA 2BT3A 3EHCA 5LC6A 3CPW2 2BMQB 3MWZA 4KFEA 4L8OA 3SLUA 1VQK3 4LSOA 2JDIH 5ELJA 1W2ZA 1OHOA 3HX8A 1ROVA 1L5GB 1LXEA 1IK3A 3G16A 1E3VA 3E99A 1D6UA 1W00A 3MG3A 2SBLA 4WFOA 1W4NA 5D81A 1DMNA 3CCU3 3EC9A 1DMQA 3T0UA 3EN1B 3TDGA 1UI7A 3EQQB 4R9LA 2P38A 3G0KA 4J8TA 1WNHA 3Q1CA 5AYSC 3CME3 1SPUA 5IG3A 1UI8A 1JNQA 2P0MA 1Z1SA 4HZ9B 1OH0A 3EN8A 3HIIA 5IEPA 1GS3A 2HMKB 3I553 2V1LA 2E2UA 3NUVA 1US1A 3S28A 3STDA 3VSYA 6STDA 1Q42A 4N6OB 3VGNA 3CNMA 3K5TA 2XEPA 2I9WA 3AMOB 3QRDA 1KD14 1BUQA 3X3XA 3KN4A 1KSIA 3KFQC 1NJI4 3NX0A 2HMMB 3MPHA 4HVNA 4XBYA 1QVF2 5JPUA 3T8NA 5AEUB 5DRVA 3MYTA 3FGYA 2JQ5A 3NBRA 1M1K4 4KZ1A 3IPTA 4EC6A 3F8HA 3OWYA 1GD3A 1OCVA 3GZBA 3OXAA 4AKYA 3K7CA 2Q07A 4N6UA 1AVKA 2BMOB 1W6YA 3WMDA 4PEJA 3M8CA 4LZIA 4LMIA 5A0OB 5BXQA 3T8UA 4BTXA 2CH9A 2XGLA 3D9RA 4KFDA 3NHXA 3G6E3 1IU7A 2F99A 4ORLA 1A90A 4XM4A 3EE1A 1G96A 3PGBA 3DY5A 3DGOA 4LGQA 3N54B 3JUOA 3N8BA 4FCZA 1R4CA 4HM4B 3DXOA 2WO0A 2KRTA 3S27A 3LZAA 1QVG2 3IJEB 1STDA 3OV4A 3PXMA 3RGRA 1VZZA 3WDGB 1YJW3 4EYCA 1IVWA 3G8ZA 3JVCA 2RFRA 1WMPA 5IG0A 4EV5A 1M9GA 1OACA 5AEWB 4FMDA 2E2TA 2XRXB 2YFIB 1IT8A 4FMBA 4GB5A 3KIIA 1JKGB 2FGTA 1N8QA 2XF3A 1NB3I 3ALAA 2ML6A 3CC43 2CIUA 3CPOA 1K28A 3LYGA 1OHSA 1ULIB 1DYUA 4HZBB 3EX9A 2GEXA 2CFGA 1JRQA 2RGQA 4QWTA 5IG4A 1DMMA 1EA2A 2B24B 2W2CA 2OTL3 4K1UA 3JUQA 1S723 1YVBI 1O7WB 3ER7A 3S67A 2XFTA 1A67A 3I0YA 1VQL3 1KC84 1VQP3 1TUHA 3SOYA 1RKYA 2OQEA 1E97A 1FGMA 1OGZA 4X2OA 2XR8B 1Q40A 3HZPA 5STDA 1K9M4 1FGTA 3B7CA 3K0ZA 3GZXB 1NB5I 2CFDA 3X3ZA 3LTCA 5IG5A 4HM3B 3LXUX 1WMNA 3NV0B 2W9PA 1Q7Y4 4I4KA 1PFPA 2D42A 2IUJA 2BNGA 4O8SA 3X3YA 3H3HA 3LOYA 5FGOA 4RNZA 4RNYA 4G1MB 3K9MC 5JBSA 2IUKA 3BNBA 2O9UX 3HI7A 4XBTA 3SOAA 1GY7A 1FGQA 1N9JA 4HM1B 1N9EA 4O3VA 1VQO3 2Z77A 1SQWA 4R80A 1CEWI 5CK6A 1O7GB 7STDA 2BHMA 4O02B 3V98A 3F7XA 1VQM3 1AR0A 5KP4A 4K1VA 1VQ63 2CK3H 1M1XB 3AMOA 1VQ73 2MC8A 1W02A 2FXTA 4N6LA 3FCSB 1U5OA 5EEOA 3GAXA 3CCE3 3CMA3 1ROAA 1WQLB 2W56A 3B8LA 2P0XA 3FF2A 1AV4A 2LYXA 5CF2A 3CXC2 3LTBA 2Y73A 1YIJ3 1CYUA 2QEX3 3MSOA 4AEQA 3DGLA 2W0QA 1N8R4 4NHFA 1Q864 3EBTA 1IQXA 1IT7A 3KSED 4J9AA 1O7PB 3LTDA 1N5HA 2ZL8A 1A2VA 5EVHA 1ULJB 1IVXA 1JN5B 1HKXA 3MG1A 1FGRA 1VQ93 3VF1A 4L7KA 1ZO2A 1STFI 3PYJA 1W5ZA 2C10A 1TFKA 3WOEB 3D3LA 3CCV3 4HJLB 1O7NB 3O8YA 3CU3A 3CD63 3J7Yd 2ZDJA 1CYVA 3RGAA 1EG9B 4Q53A 1CQSA 1DVCA 5KP3A 1ASKA 3WOFB 2F86B 3F40A 3DZLA 2XGNA 3V92A 1FGOA 3X42A 3NM2A 2W9QA 1IVVA 2INXA 2KCDA 1JKGA 2CWVA 3BNDA 1K734 3ECFA 4JRFA 3I563 4EXRA 1MOLA 3HK4A 1QAKA 2CFKA 1NO3A 3BNCA 2OQEC 2FNQA 1K41A 1JB2A 4XBXA 2OTJ3 1T5YA 3G4S3 2QA43 2A15A 3JUPA 1QALA 4HM0B 2WGOA 4HKVB 4OVMA 3GZRA 1JN5A 1IV7A 1RRLA 2CFWA 1OGXA 3NXJA 3CCM3 4L8PA 2IMJA 2K54A 1LNHA 1WMOA 2C11A 5AIFA 3SXXA 1A2KA 3X40A 3FLJA 1FUWA 1RRHA 1VQ43 1OF5B 4GL6A 2WGQA 1EKMA 1UUWB 1NU3A 5ELUA 2CHCA 3F8XA 3WA2X 5IENA 3NQYA 5AYRB 1SIHA 2M7OA 2OOVC 3CCL3 2W6JH 2GEYA 3UJMA 1OUNA 5BVBA 2KXGA 4MEIA 3LH4A 1LOXA 1UUVB 4K90B 3KE7A 1PU4A 3SX1A 3UL5A 2E2VA 3A76A 1O7MB 1K8A4 1ISKA 1JV2B 3KSPA 3MHEA 1EQKA 3EJVA 5CLKA 3SEDA 3FG3A 2L4VA 1HU9A 2XSHB 3ROBA 4K61A 4KVHA 3CCS3 1J2BA 1AVLA 4WP5A 1Q40B 2CWTA 4R4KA 1Q824 3OX9A 5IW9A 2CC3A 5AIIA 1GD4A 2STDA 3N9HA 2GXFA 4STDA 3OW22 1GY5A 1IQ8A 4IPBA 1QJGA 2B1XB 4KFFA 1VQN3 3SVAA 4MMXB 1NWWA 2K0MA 3S5CA 3S29A 3OWUA 3V99A 1VQ83 2QGUA 4X2HA 1E3RA 4N6V0 1VQ53 2CFLA 3PCRA 1GYBA 4R9KA 3RDEA 1QAFA 2Y74A 1GY6A 3MG2A 3NBJA 2CG1A 3X41A 3EB8A 2YFLB 3K63A 5HGRA 4NREA 1S5AA 3FF0A 4WYKB 3FSDA 4U13A 4AKZA 4XDWA 4MMZB 1C7HA 3JUMA 3UNLA 4EV2A 4FMCA 4OUQA 8CHOA 2W56B 4N6MA 4WHAA 4TX4A 1JB4A 3EF8A 1D6ZA 4WWUC 3NV0A 2XFSA 3F14A 1OF5A 2BO9B 5KP1A 2D1WA 4FCMA 2W04A 1RN7A 1U8CB 3DUKA 1FA3A 2Z76A 1RJOA 2R4IA 3CC23 3GRDA 3FG1A 4IIAA 1KWIA 3U1WA 2YX9A 4HYZA 1YGEA 3G713 4FR9A 3LT8A 1ZX2A 3JUNA 3PZWA 1TFOA 2GU3A 1Q814 3CCJ3 2OWPA 1D6YA 4HM6B 5I97A 5DREA 1W2B2 5IERA 4HM7B 1IVUA 4RZMA 1LVNA 5JPPA 3DM8A 4HM8B 1JB5A 5CXOA 1Y4KA 2RCDA 2HMOB 2YFJB 2CW9A 1W7CA 3QK9A 4R1KA 4MJDA 3FZWA 1TP6A 3EBYA 2Z7AA 2GBXB 4H3UA 4N3VA 4WYKA 1YIT3 2HMJB 4BTYA 5EQLA 2UX0A 3WA3A 3MKIA 2HMNB 2Z6BA 1TU5A 3GZYB 1OHPA 2IA7A 3NBBA 1IQYA 3LTAA 1YI23 1OPYA 3F9SA 2RSXA 1KQS2 2P05A 1W6GA 3FKAA 5LC7A 3DGNA 1DVDA 3Q90A 3FG4A 1SJWA 3Q2PA 2MF7A 3U97A 1F8NA 3PCSA 3L0RA 5CF1A 3LMLA 3DGMA 4IT7A 2XH9A 3B4OA 3B4PA 4HM5B 2WOFA 5FW5A 3CC73 1YHQ3 2F98A 4ZM8A 2OCTA 4LEHA 5IF6A 4N6NB 3UB1A 5AIGA 2W03A 5AI1A 2QIYA 5AIHA 2XSOB 3IMAB 3KZTA 2GU1A 4XDVA 5D82A 1O7HB 4N6TA 4CDLA 3CCR3 4HBRA 2HMLB 3CNXA 4FCJA 3UL6A 2CKFB 3FH1A 3PS8A 4O2HA 2WOHA 4EBGA 1YJN3 2OOVA 3HIGA 2CG0A 2CWUA 4OK0A 4CCVA 3H51A 2PNCA 1YJ93 4H61A 1IDPA 4MMYB 1TIJA 4JF8A 5G2GA 4BTWA 3DMCA 1V74A 3WODG 1N5PA 4XB5A 1W01A 2P09A 4RBNA 5TGNA 2ML5A 3BLZA 3KKGA 5IEOA 2PZVA 2LQVA 1IV9A 1UW1A 3CCQ3 3F7SA 4FMAA 1MNLA 2GBWB 5D83A 3GWRA 3BB9A 1M904 4HM2B 3NM7A 3BNEA 2BMRB 3LT9A 3OWSA 1SIIA 1WTHA 1W6CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ULI B;  1NDO B;  3NV0 A;  3ECF A;  4HZB B;  3F14 A;  1QMA A;  1OF5 A;  3EHC A;  5KP1 A;  3HK4 A;  2BMQ B;  3EX9 A;  2GEX A;  4FCM A;  4L8O A;  3DUK A;  2RGQ A;  2Z76 A;  5IG4 A;  1DMM A;  2R4I A;  1EA2 A;  2B24 B;  2W2C A;  3GRD A;  4K1U A;  3JUQ A;  4IIA A;  3ER7 A;  1K41 A;  1O7W B;  1JB2 A;  1ZX2 A;  1OHO A;  3HX8 A;  3I0Y A;  3JUN A;  4XBX A;  2A15 A;  3G16 A;  1E3V A;  1TUH A;  2OWP A;  3E99 A;  1W00 A;  3JUP A;  3MG3 A;  4HM0 B;  4HM6 B;  5DRE A;  3SOY A;  4HM7 B;  4HKV B;  4RZM A;  5IER A;  4OVM A;  5D81 A;  3GZR A;  1DMN A;  1E97 A;  1JN5 A;  1DMQ A;  1OGZ A;  3DM8 A;  3EC9 A;  1JB5 A;  1OGX A;  2XR8 B;  1Q40 A;  2HMO B;  2RCD A;  2IMJ A;  2K54 A;  2YFJ B;  3B7C A;  3EN1 B;  3GZX B;  3HZP A;  3K0Z A;  4L8P A;  5AIF A;  4R1K A;  1A2K A;  3EQQ B;  4HM3 B;  5IG5 A;  3FLJ A;  3NV0 B;  3G0K A;  4J8T A;  3FZW A;  4MJD A;  4R9L A;  4I4K A;  5IG3 A;  1TP6 A;  3EBY A;  1OF5 B;  2Z7A A;  2GBX B;  4H3U A;  1Z1S A;  4HZ9 B;  4N3V A;  4WYK A;  2BNG A;  1OH0 A;  2HMJ B;  1UUW B;  1NU3 A;  3EN8 A;  2CHC A;  1GS3 A;  2HMK B;  3F8X A;  3H3H A;  2UX0 A;  5IEN A;  5IEP A;  3NUV A;  3MKI A;  3STD A;  2HMN B;  3VSY A;  4XBT A;  3GZY B;  1OHP A;  3SOA A;  1Q42 A;  6STD A;  1GY7 A;  3VGN A;  3CNM A;  2GEY A;  4HM1 B;  3UJM A;  1OUN A;  2Z77 A;  5BVB A;  1OPY A;  2I9W A;  3F9S A;  3FKA A;  1UUV B;  5CK6 A;  1O7G B;  1BUQ A;  7STD A;  3KE7 A;  3Q90 A;  4HVN A;  2HMM B;  3F7X A;  4XBY A;  1AR0 A;  1SJW A;  3A76 A;  5JPU A;  5KP4 A;  1O7M B;  4K1V A;  4X2O A;  1ISK A;  3MHE A;  3KSP A;  3T8N A;  5CF1 A;  3EJV A;  5CLK A;  3SED A;  5DRV A;  5AEU B;  3MYT A;  3FGY A;  2XSH B;  3B4O A;  3ROB A;  3B4P A;  4HM5 B;  5FW5 A;  1W02 A;  2JQ5 A;  3NBR A;  2F98 A;  3IPT A;  1U5O A;  3F8H A;  3OWY A;  4KVH A;  4LEH A;  5IF6 A;  5AIG A;  1OCV A;  3GZB A;  5CXO A;  4WP5 A;  1Q40 B;  1WQL B;  3B8L A;  3FF2 A;  3OXA A;  5CF2 A;  5AI1 A;  3WMD A;  3OX9 A;  2QIY A;  3K7C A;  5AIH A;  2XSO B;  5AII A;  3KZT A;  2BMO B;  1W6Y A;  2STD A;  2GXF A;  4PEJ A;  3M8C A;  1GY5 A;  3MSO A;  4STD A;  4XDV A;  5D82 A;  1O7H B;  4LMI A;  1QJG A;  5BXQ A;  2B1X B;  3EBT A;  3T8U A;  4CDL A;  2HML B;  3CNX A;  1NWW A;  4FCJ A;  2CKF B;  3S5C A;  3FH1 A;  3D9R A;  3OWU A;  3NHX A;  1O7P B;  4J9A A;  2F99 A;  4ORL A;  2QGU A;  4XM4 A;  5EVH A;  4X2H A;  1ULJ B;  1E3R A;  1JN5 B;  4LGQ A;  1HKX A;  1GYB A;  3MG1 A;  3H51 A;  3JUO A;  5JPP A;  1IDP A;  4HM4 B;  4L7K A;  4R9K A;  3DXO A;  3NXJ A;  1ZO2 A;  3MG2 A;  1GY6 A;  5G2G A;  3LZA A;  3DMC A;  1STD A;  2YFL B;  3OV4 A;  4HM8 B;  4WWU C;  5HGR A;  1VZZ A;  3RGR A;  4XB5 A;  1S5A A;  1W01 A;  3FF0 A;  3G8Z A;  2RFR A;  4HJL B;  5IG0 A;  1O7N B;  3BLZ A;  3KKG A;  3CU3 A;  5IEO A;  2PZV A;  4WYK B;  5TGN A;  3RGA A;  1EG9 B;  5AEW B;  3FSD A;  1CQS A;  3F7S A;  2XRX B;  4Q53 A;  2GBW B;  2YFI B;  4GB5 A;  4U13 A;  4XDW A;  3GWR A;  1ASK A;  5D83 A;  5KP3 A;  3BB9 A;  2F86 B;  1C7H A;  4HM2 B;  3JUM A;  1JKG B;  3DZL A;  3F40 A;  3UNL A;  5STD A;  3NM2 A;  4OUQ A;  2BMR B;  3CPO A;  3LYG A;  3OWS A;  2INX A;  8CHO A;  1OHS A;  1JB4 A;  1JKG A;  3EF8 A; 
#chains in the Genus database with same CATH topology
 1NDO B;  2O3O A;  1PY3 A;  3NQZ A;  1JJ2 2;  1QMA A;  2F56 A;  2BT3 A;  3EHC A;  5LC6 A;  3CPW 2;  2BMQ B;  3MWZ A;  4KFE A;  4L8O A;  3SLU A;  1VQK 3;  1GMR A;  2KF4 A;  1MGR A;  1C54 A;  4LSO A;  2CX1 A;  3D5G A;  2JDI H;  5ELJ A;  4DKI A;  3GSP A;  1W2Z A;  1OHO A;  3HX8 A;  1ROV A;  1L5G B;  1LXE A;  1IK3 A;  3G16 A;  1E3V A;  5IF6 A;  3E99 A;  1D6U A;  1RCK A;  1W00 A;  3MG3 A;  2SBL A;  4WFO A;  1W4N A;  5D81 A;  1DMN A;  3CCU 3;  3EC9 A;  1DMQ A;  3T0U A;  1I2F A;  1IYY A;  3EN1 B;  3TDG A;  1RNB A;  1B2Z A;  1FUT A;  1UI7 A;  3EQQ B;  4R9L A;  2P38 A;  3G0K A;  4J8T A;  1WNH A;  3Q1C A;  5AYS C;  3CME 3;  1SPU A;  5IG3 A;  1UI8 A;  1JNQ A;  2P0M A;  1JBR A;  1Z1S A;  4HZ9 B;  1T2H A;  1OH0 A;  1X1Y A;  7RNT A;  3EN8 A;  3HII A;  5M1A A;  1GS3 A;  2HMK B;  5IEP A;  3I55 3;  2V1L A;  2E2U A;  3NUV A;  1US1 A;  3S28 A;  3STD A;  3VSY A;  6STD A;  1Q42 A;  4N6O B;  3VGN A;  3CNM A;  3K5T A;  1HYF A;  2XEP A;  3ZG5 A;  2I9W A;  3AMO B;  3QRD A;  1KD1 4;  1BUQ A;  3RNT A;  3X3X A;  3KN4 A;  1KSI A;  3KFQ C;  1NJI 4;  3NX0 A;  2HMM B;  3MPH A;  4HVN A;  4XBY A;  1QVF 2;  5JPU A;  3T8N A;  5AEU B;  5DRV A;  1BU4 A;  3MYT A;  2UGI A;  1BAN A;  1CH0 A;  1B27 A;  3FGY A;  2H0I A;  2JQ5 A;  3NBR A;  1M1K 4;  4KZ1 A;  1JBS A;  1BSE A;  1UCJ A;  1LQM B;  3IPT A;  1MWR A;  3F8H A;  3OWY A;  4EC6 A;  1GD3 A;  1OCV A;  3AHW A;  3GZB A;  1GSP A;  3OXA A;  4AKY A;  1BNS A;  1YGW A;  3K7C A;  2Q07 A;  3BU4 A;  4N6U A;  1AVK A;  1NNV A;  1W6Y A;  2BMO B;  3WMD A;  1RGK A;  3M8C A;  4PEJ A;  4LZI A;  4LMI A;  5A0O B;  5BXQ A;  3T8U A;  4BTX A;  1SAR A;  2CH9 A;  2XGL A;  3D9R A;  4KFD A;  3NHX A;  3G6E 3;  1IU7 A;  2F99 A;  1BRG A;  4ORL A;  1A90 A;  4XM4 A;  3EE1 A;  1G96 A;  3PGB A;  3DY5 A;  3DGO A;  4LGQ A;  3N54 B;  1ZGX A;  9RNT A;  3JUO A;  3N8B A;  4FCZ A;  1R4C A;  4HM4 B;  1BSC A;  3DXO A;  2WO0 A;  2KRT A;  3S27 A;  3LZA A;  1QVG 2;  3IJE B;  1STD A;  3OV4 A;  1TJD A;  1I0V A;  3PXM A;  1VZZ A;  3RGR A;  3WDG B;  1YJW 3;  4EYC A;  1IVW A;  3G8Z A;  1R4Y A;  2RFR A;  1WMP A;  3AGN A;  3JVC A;  5IG0 A;  4EV5 A;  1EUI C;  1M9G A;  1OAC A;  5AEW B;  4FMD A;  2E2T A;  2XRX B;  2YFI B;  1IT8 A;  4FMB A;  4GB5 A;  2L1S A;  3KII A;  1JKG B;  1UCI A;  2FGT A;  1N8Q A;  2XF3 A;  1NB3 I;  3ALA A;  2ML6 A;  3CC4 3;  1BIR A;  2CIU A;  3CPO A;  1K28 A;  3LYG A;  3WR2 A;  3ZFZ A;  1LOV A;  4HAA A;  1OHS A;  1BNG A;  4CJN A;  1RGG A;  1ULI B;  1DYU A;  4HZB B;  2UUG C;  2GEX A;  3EX9 A;  2CFG A;  1B3S A;  1JRQ A;  2RGQ A;  1UGI A;  4QWT A;  5IG4 A;  1DMM A;  2RBI A;  1EA2 A;  2B24 B;  2W2C A;  2OTL 3;  4K1U A;  3JUQ A;  4I5Q A;  1YVB I;  1O7W B;  3ER7 A;  1T2I A;  3S67 A;  4EW5 A;  1S72 3;  3A5E A;  2XFT A;  3D79 A;  1FYS A;  1A67 A;  3I0Y A;  1VQL 3;  1KC8 4;  1Q9E A;  1VQP 3;  1TUH A;  3SOY A;  1RKY A;  2OQE A;  1E97 A;  1FGM A;  1OGZ A;  1I70 A;  4X2O A;  1GOV A;  1Q40 A;  2XR8 B;  3HZP A;  5STD A;  1FGT A;  3B7C A;  3K0Z A;  3GZX B;  1K9M 4;  2CFD A;  5M19 A;  3X3Z A;  1LOY A;  1NB5 I;  3LTC A;  5IG5 A;  4HM3 B;  3LXU X;  1WMN A;  3NV0 B;  2W9P A;  1Q7Y 4;  4I4K A;  1MGW A;  2J8X B;  1PFP A;  2D42 A;  2IUJ A;  2BNG A;  4O8S A;  3X3Y A;  1JBT A;  1B2M A;  3H3H A;  3LOY A;  5FGO A;  4RNZ A;  4RNY A;  4G1M B;  3K9M C;  5JBS A;  2IUK A;  3BNB A;  2O9U X;  3HI7 A;  2ZHX B;  4XBT A;  3SOA A;  1GY7 A;  1FGQ A;  1N9J A;  4HM1 B;  1N9E A;  4O3V A;  1VQO 3;  1RGL A;  2Z77 A;  1SQW A;  2BIR A;  4R80 A;  1BRI A;  1CEW I;  1B21 A;  2AAD A;  1O7G B;  5CK6 A;  7GSP A;  7STD A;  2BHM A;  4O02 B;  3V98 A;  3F7X A;  1VQM 3;  1BNR A;  1AR0 A;  5KP4 A;  3Q3F A;  4K1V A;  5G1K A;  1VQ6 3;  2CK3 H;  1DET A;  1M1X B;  1RGF A;  3AMO A;  1VQ7 3;  2MC8 A;  1W02 A;  1YVS A;  2FXT A;  4N6L A;  3FCS B;  1U5O A;  1UUG B;  5EEO A;  3GAX A;  3CCE 3;  3CMA 3;  1GOY A;  1ROA A;  1UDI I;  1WQL B;  2W56 A;  3B8L A;  2P0X A;  3FF2 A;  1AV4 A;  2LYX A;  5CF2 A;  1TRP A;  3LTB A;  2Y73 A;  3CXC 2;  1YIJ 3;  1CYU A;  2QEX 3;  2KF6 A;  3MSO A;  4AEQ A;  3DGL A;  2W0Q A;  1RTU A;  4NHF A;  1N8R 4;  1Q86 4;  3EBT A;  1IQX A;  1IT7 A;  2SAR A;  3KSE D;  1O7P B;  4J9A A;  3LTD A;  5BU4 A;  1N5H A;  2ZL8 A;  4KT3 B;  1A2V A;  3AGO A;  4GHO A;  5EVH A;  6RNT A;  1ULJ B;  3SYU A;  1IVX A;  1JN5 B;  1BRK A;  1HKX A;  3MG1 A;  1FGR A;  1VQ9 3;  3VF1 A;  4L7K A;  1UCK A;  1ZO2 A;  1STF I;  1RGC A;  3PYJ A;  1W5Z A;  2C10 A;  1TFK A;  3WOE B;  3D3L A;  2HOH A;  3CCV 3;  4HJL B;  1O7N B;  3O8Y A;  4ILF A;  3CU3 A;  3CD6 3;  3J7Y d;  2ZDJ A;  1CYV A;  3RGA A;  1EG9 B;  2CX0 A;  1CQS A;  4Q53 A;  3WHO A;  1DVC A;  5KP3 A;  1ASK A;  3WOF B;  2F86 B;  3F40 A;  1GMP A;  3DZL A;  2XGN A;  3V92 A;  1FGO A;  3X42 A;  3NM2 A;  2W9Q A;  1IVV A;  2INX A;  2KCD A;  1JKG A;  4HOH A;  2CWV A;  1X1X A;  3BND A;  1RN4 A;  1K73 4;  3ECF A;  4JRF A;  3I56 3;  4EXR A;  1B2S A;  1MOL A;  3HK4 A;  1RN1 A;  1QAK A;  2CFK A;  1NO3 A;  3BNC A;  2OQE C;  2FNQ A;  1K41 A;  1JB2 A;  1Q7H A;  4RNT A;  4XBX A;  1GOU A;  2OTJ 3;  1T5Y A;  3G4S 3;  2QA4 3;  2A15 A;  4BU4 A;  3JUP A;  1QAL A;  4HM0 B;  1JZD A;  2WGO A;  4HKV B;  3KCH A;  4OVM A;  3GZR A;  1JN5 A;  1IV7 A;  1RRL A;  2CFW A;  1OGX A;  2KF3 A;  3NXJ A;  3CCM 3;  4L8P A;  1FZU A;  2IMJ A;  2K54 A;  1LNH A;  1WMO A;  2C11 A;  4NPB A;  5AIF A;  3SXX A;  1FUS A;  1A2K A;  3X40 A;  3FLJ A;  1FUW A;  1RRH A;  1VQ4 3;  1OF5 B;  4GL6 A;  2WGQ A;  3D4A A;  1EKM A;  1UUW B;  1NU3 A;  5ELU A;  2CHC A;  3F8X A;  3WA2 X;  5IEN A;  1B2U A;  3NQY A;  4LYL B;  3ZG0 A;  5AYR B;  1SIH A;  2M7O A;  2OOV C;  2GSP A;  3CCL 3;  1RDS A;  2W6J H;  1LNI A;  1ZS7 A;  2GEY A;  3UJM A;  1OUN A;  3D5I A;  1I0X A;  5BVB A;  2KXG A;  4MEI A;  3LH4 A;  5M18 A;  1LOX A;  2KAA A;  1UUV B;  2BU4 A;  2ZA4 A;  4J5K A;  4K90 B;  3KE7 A;  1PU4 A;  3SX1 A;  1X1W A;  3UL5 A;  1UCL A;  2E2V A;  3A76 A;  2IY2 A;  1LQG C;  1O7M B;  3BIR A;  1BSD A;  1JV2 B;  3KSP A;  3MHE A;  1K8A 4;  3EJV A;  1ISK A;  5CLK A;  3SED A;  1BSB A;  3FG3 A;  1EQK A;  2L4V A;  1HU9 A;  1TTO A;  2XSH B;  1DE3 A;  3ROB A;  4K61 A;  4KVH A;  3CCS 3;  1J2B A;  1AVL A;  1HZ1 A;  4WP5 A;  1Q40 B;  2CWT A;  4R4K A;  1Q82 4;  1B2X A;  3OX9 A;  1YNV X;  2CC3 A;  5IW9 A;  1BGS A;  5AII A;  1GD4 A;  1BNI A;  5GSP A;  2STD A;  3N9H A;  2GXF A;  4STD A;  3OW2 2;  1GY5 A;  1IQ8 A;  4IPB A;  1QJG A;  2B1X B;  1RGA A;  4KFF A;  3SVA A;  2C4B A;  1NWW A;  4MMX B;  1VQN 3;  2K0M A;  3S5C A;  3S29 A;  1RSN A;  2F5W A;  3OWU A;  1LOW A;  3V99 A;  1VQ8 3;  1BNF A;  2QGU A;  4X2H A;  1RGH A;  1E3R A;  4N6V 0;  1VQ5 3;  2CFL A;  3PCR A;  1GYB A;  1I3I A;  1X1U A;  1RCL A;  3HOH A;  1BRN L;  1EEJ A;  4R9K A;  3RDE A;  1QAF A;  2Y74 A;  1GY6 A;  3MG2 A;  3NBJ A;  2CG1 A;  1VQQ A;  3X41 A;  3EB8 A;  2YFL B;  3K63 A;  1BSA A;  5HGR A;  4NRE A;  1S5A A;  3FF0 A;  4WYK B;  3FSD A;  4U13 A;  4AKZ A;  4XDW A;  1UGH I;  1RHL A;  4MMZ B;  1C7H A;  1TRQ A;  3JUM A;  3UNL A;  4EV2 A;  2H0H A;  4FMC A;  4OUQ A;  8CHO A;  2W56 B;  4N6M A;  4WHA A;  4TX4 A;  1JB4 A;  1D6Z A;  3EF8 A;  4WWU C;  3NV0 A;  2XFS A;  3F14 A;  1OF5 A;  2BO9 B;  5KP1 A;  2D1W A;  4FCM A;  2W04 A;  1RN7 A;  1U8C B;  3DUK A;  1FA3 A;  2Z76 A;  1V58 A;  2KF5 A;  1RJO A;  2R4I A;  3CC2 3;  3GRD A;  3FG1 A;  1BOX A;  1KWI A;  4IIA A;  3AHS A;  2YX9 A;  4HYZ A;  3U1W A;  1YGE A;  1AY7 A;  4FR9 A;  1RGE A;  3LT8 A;  1ZX2 A;  5RNT A;  3JUN A;  3PZW A;  3G71 3;  1TFO A;  2GU3 A;  1Q81 4;  3CCJ 3;  2OWP A;  1RNT A;  1D6Y A;  4HM6 B;  5I97 A;  5DRE A;  1W2B 2;  5BIR A;  4HM7 B;  1IVU A;  4RZM A;  5IER A;  1I8V A;  1LVN A;  5JPP A;  3DM8 A;  2IYJ A;  4HM8 B;  1JB5 A;  5CXO A;  1Y4K A;  2HMO B;  1MWT A;  2RCD A;  2CW9 A;  2YFJ B;  1W7C A;  1MWU A;  3QK9 A;  2F5M A;  4R1K A;  4BL2 A;  4MJD A;  3FZW A;  1JZO A;  1TP6 A;  3EBY A;  2Z7A A;  2GBX B;  4H3U A;  4N3V A;  4WYK A;  1YIT 3;  2H0G A;  2HMJ B;  1V57 A;  4BTY A;  5EQL A;  2UX0 A;  3WA3 A;  3MKI A;  2HMN B;  2Z6B A;  1TU5 A;  1I2G A;  1OHP A;  3GZY B;  2IA7 A;  1BRS A;  3NBB A;  1I2E A;  1IQY A;  3LTA A;  1YI2 3;  1OPY A;  3F9S A;  2RSX A;  1KQS 2;  2P05 A;  1W6G A;  3FKA A;  1BNE A;  5LC7 A;  3DGN A;  1DVD A;  3Q90 A;  3FG4 A;  1SJW A;  3Q2P A;  2MF7 A;  3U97 A;  1F8N A;  3PCS A;  1B20 A;  3L0R A;  5CF1 A;  3LML A;  3DGM A;  4IT7 A;  2K3D A;  2XH9 A;  3B4O A;  1RMS A;  3B4P A;  2WOF A;  4HM5 B;  5FW5 A;  3CC7 3;  1YHQ 3;  3DGY A;  2F98 A;  4ZM8 A;  2OCT A;  1MWS A;  4LEH A;  4N6N B;  3UB1 A;  1BVI A;  5AIG A;  2W03 A;  4J5G A;  3DH2 A;  1PYL A;  5AI1 A;  2F4Y A;  2QIY A;  5AIH A;  2XSO B;  3IMA B;  2AAE A;  1A2P A;  3KZT A;  2GU1 A;  4XDV A;  5D82 A;  1O7H B;  1AQZ A;  4N6T A;  4CDL A;  3CCR 3;  4HBR A;  2HML B;  3CNX A;  4FCJ A;  3UL6 A;  2CKF B;  5G1L A;  3FH1 A;  3PS8 A;  4O2H A;  2WOH A;  4EBG A;  1YJN 3;  3URP A;  2R41 A;  2RNT A;  2OOV A;  3HIG A;  1BNJ A;  1FW7 A;  1BRH A;  1G0T A;  2CG0 A;  1I3F A;  5HOH A;  4BIR A;  1GMQ A;  2CWU A;  4OK0 A;  4CCV A;  3H51 A;  2PNC A;  1YJ9 3;  4H61 A;  1IDP A;  1RLS A;  4MMY B;  4CPK A;  1TIJ A;  4JF8 A;  5G2G A;  4BTW A;  3DMC A;  1V74 A;  4GSP A;  3WOD G;  1G02 A;  1BAO A;  1N5P A;  1W01 A;  2P09 A;  4XB5 A;  1BRJ A;  4RBN A;  2ML5 A;  3BLZ A;  3KKG A;  5IEO A;  5TGN A;  2PZV A;  6GSP A;  2LQV A;  1IV9 A;  1UW1 A;  3CCQ 3;  3F7S A;  4FMA A;  1MNL A;  2GBW B;  8RNT A;  5D83 A;  3GWR A;  3BB9 A;  1M90 4;  1LRA A;  4HM2 B;  4BL3 A;  3NM7 A;  3BNE A;  1BUJ A;  2BMR B;  3LT9 A;  3OWS A;  1T3B A;  1SII A;  1WTH A;  1W6C A; 
#chains in the Genus database with same CATH homology
 1NDO B;  2O3O A;  3NQZ A;  1JJ2 2;  1QMA A;  2BT3 A;  3EHC A;  5LC6 A;  3CPW 2;  2BMQ B;  3MWZ A;  4KFE A;  4L8O A;  3SLU A;  1VQK 3;  4LSO A;  2JDI H;  5ELJ A;  1W2Z A;  1OHO A;  3HX8 A;  1ROV A;  1L5G B;  1LXE A;  1IK3 A;  3G16 A;  1E3V A;  3E99 A;  1D6U A;  1W00 A;  3MG3 A;  2SBL A;  4WFO A;  1W4N A;  5D81 A;  1DMN A;  3CCU 3;  3EC9 A;  1DMQ A;  3T0U A;  3EN1 B;  3TDG A;  1UI7 A;  3EQQ B;  4R9L A;  2P38 A;  3G0K A;  4J8T A;  1WNH A;  3Q1C A;  5AYS C;  3CME 3;  1SPU A;  5IG3 A;  1UI8 A;  1JNQ A;  2P0M A;  1Z1S A;  4HZ9 B;  1OH0 A;  3EN8 A;  3HII A;  5IEP A;  1GS3 A;  2HMK B;  3I55 3;  2V1L A;  2E2U A;  3NUV A;  1US1 A;  3S28 A;  3STD A;  3VSY A;  6STD A;  1Q42 A;  4N6O B;  3VGN A;  3CNM A;  3K5T A;  2XEP A;  2I9W A;  3AMO B;  3QRD A;  1KD1 4;  1BUQ A;  3X3X A;  3KN4 A;  1KSI A;  3KFQ C;  1NJI 4;  3NX0 A;  2HMM B;  3MPH A;  4HVN A;  4XBY A;  1QVF 2;  5JPU A;  3T8N A;  5AEU B;  5DRV A;  3MYT A;  3FGY A;  2JQ5 A;  3NBR A;  1M1K 4;  4KZ1 A;  3IPT A;  4EC6 A;  3F8H A;  3OWY A;  1GD3 A;  1OCV A;  3GZB A;  3OXA A;  4AKY A;  3K7C A;  2Q07 A;  4N6U A;  1AVK A;  2BMO B;  1W6Y A;  3WMD A;  4PEJ A;  3M8C A;  4LZI A;  4LMI A;  5A0O B;  5BXQ A;  3T8U A;  4BTX A;  2CH9 A;  2XGL A;  3D9R A;  4KFD A;  3NHX A;  3G6E 3;  1IU7 A;  2F99 A;  4ORL A;  1A90 A;  4XM4 A;  3EE1 A;  1G96 A;  3PGB A;  3DY5 A;  3DGO A;  4LGQ A;  3N54 B;  3JUO A;  3N8B A;  4FCZ A;  1R4C A;  4HM4 B;  3DXO A;  2WO0 A;  2KRT A;  3S27 A;  3LZA A;  1QVG 2;  3IJE B;  1STD A;  3OV4 A;  3PXM A;  3RGR A;  1VZZ A;  3WDG B;  1YJW 3;  4EYC A;  1IVW A;  3G8Z A;  3JVC A;  2RFR A;  1WMP A;  5IG0 A;  4EV5 A;  1M9G A;  1OAC A;  5AEW B;  4FMD A;  2E2T A;  2XRX B;  2YFI B;  1IT8 A;  4FMB A;  4GB5 A;  3KII A;  1JKG B;  2FGT A;  1N8Q A;  2XF3 A;  1NB3 I;  3ALA A;  2ML6 A;  3CC4 3;  2CIU A;  3CPO A;  1K28 A;  3LYG A;  1OHS A;  1ULI B;  1DYU A;  4HZB B;  3EX9 A;  2GEX A;  2CFG A;  1JRQ A;  2RGQ A;  4QWT A;  5IG4 A;  1DMM A;  1EA2 A;  2B24 B;  2W2C A;  2OTL 3;  4K1U A;  3JUQ A;  1S72 3;  1YVB I;  1O7W B;  3ER7 A;  3S67 A;  2XFT A;  1A67 A;  3I0Y A;  1VQL 3;  1KC8 4;  1VQP 3;  1TUH A;  3SOY A;  1RKY A;  2OQE A;  1E97 A;  1FGM A;  1OGZ A;  4X2O A;  2XR8 B;  1Q40 A;  3HZP A;  5STD A;  1K9M 4;  1FGT A;  3B7C A;  3K0Z A;  3GZX B;  1NB5 I;  2CFD A;  3X3Z A;  3LTC A;  5IG5 A;  4HM3 B;  3LXU X;  1WMN A;  3NV0 B;  2W9P A;  1Q7Y 4;  4I4K A;  1PFP A;  2D42 A;  2IUJ A;  2BNG A;  4O8S A;  3X3Y A;  3H3H A;  3LOY A;  5FGO A;  4RNZ A;  4RNY A;  4G1M B;  3K9M C;  5JBS A;  2IUK A;  3BNB A;  2O9U X;  3HI7 A;  4XBT A;  3SOA A;  1GY7 A;  1FGQ A;  1N9J A;  4HM1 B;  1N9E A;  4O3V A;  1VQO 3;  2Z77 A;  1SQW A;  4R80 A;  1CEW I;  5CK6 A;  1O7G B;  7STD A;  2BHM A;  4O02 B;  3V98 A;  3F7X A;  1VQM 3;  1AR0 A;  5KP4 A;  4K1V A;  1VQ6 3;  2CK3 H;  1M1X B;  3AMO A;  1VQ7 3;  2MC8 A;  1W02 A;  2FXT A;  4N6L A;  3FCS B;  1U5O A;  5EEO A;  3GAX A;  3CCE 3;  3CMA 3;  1ROA A;  1WQL B;  2W56 A;  3B8L A;  2P0X A;  3FF2 A;  1AV4 A;  2LYX A;  5CF2 A;  3CXC 2;  3LTB A;  2Y73 A;  1YIJ 3;  1CYU A;  2QEX 3;  3MSO A;  4AEQ A;  3DGL A;  2W0Q A;  1N8R 4;  4NHF A;  1Q86 4;  3EBT A;  1IQX A;  1IT7 A;  3KSE D;  4J9A A;  1O7P B;  3LTD A;  1N5H A;  2ZL8 A;  1A2V A;  5EVH A;  1ULJ B;  1IVX A;  1JN5 B;  1HKX A;  3MG1 A;  1FGR A;  1VQ9 3;  3VF1 A;  4L7K A;  1ZO2 A;  1STF I;  3PYJ A;  1W5Z A;  2C10 A;  1TFK A;  3WOE B;  3D3L A;  3CCV 3;  4HJL B;  1O7N B;  3O8Y A;  3CU3 A;  3CD6 3;  3J7Y d;  2ZDJ A;  1CYV A;  3RGA A;  1EG9 B;  4Q53 A;  1CQS A;  1DVC A;  5KP3 A;  1ASK A;  3WOF B;  2F86 B;  3F40 A;  3DZL A;  2XGN A;  3V92 A;  1FGO A;  3X42 A;  3NM2 A;  2W9Q A;  1IVV A;  2INX A;  2KCD A;  1JKG A;  2CWV A;  3BND A;  1K73 4;  3ECF A;  4JRF A;  3I56 3;  4EXR A;  1MOL A;  3HK4 A;  1QAK A;  2CFK A;  1NO3 A;  3BNC A;  2OQE C;  2FNQ A;  1K41 A;  1JB2 A;  4XBX A;  2OTJ 3;  1T5Y A;  3G4S 3;  2QA4 3;  2A15 A;  3JUP A;  1QAL A;  4HM0 B;  2WGO A;  4HKV B;  4OVM A;  3GZR A;  1JN5 A;  1IV7 A;  1RRL A;  2CFW A;  1OGX A;  3NXJ A;  3CCM 3;  4L8P A;  2IMJ A;  2K54 A;  1LNH A;  1WMO A;  2C11 A;  5AIF A;  3SXX A;  1A2K A;  3X40 A;  3FLJ A;  1FUW A;  1RRH A;  1VQ4 3;  1OF5 B;  4GL6 A;  2WGQ A;  1EKM A;  1UUW B;  1NU3 A;  5ELU A;  2CHC A;  3F8X A;  3WA2 X;  5IEN A;  3NQY A;  5AYR B;  1SIH A;  2M7O A;  2OOV C;  3CCL 3;  2W6J H;  2GEY A;  3UJM A;  1OUN A;  5BVB A;  2KXG A;  4MEI A;  3LH4 A;  1LOX A;  1UUV B;  4K90 B;  3KE7 A;  1PU4 A;  3SX1 A;  3UL5 A;  2E2V A;  3A76 A;  1O7M B;  1K8A 4;  1ISK A;  1JV2 B;  3KSP A;  3MHE A;  1EQK A;  3EJV A;  5CLK A;  3SED A;  3FG3 A;  2L4V A;  1HU9 A;  2XSH B;  3ROB A;  4K61 A;  4KVH A;  3CCS 3;  1J2B A;  1AVL A;  4WP5 A;  1Q40 B;  2CWT A;  4R4K A;  1Q82 4;  3OX9 A;  5IW9 A;  2CC3 A;  5AII A;  1GD4 A;  2STD A;  3N9H A;  2GXF A;  4STD A;  3OW2 2;  1GY5 A;  1IQ8 A;  4IPB A;  1QJG A;  2B1X B;  4KFF A;  1VQN 3;  3SVA A;  4MMX B;  1NWW A;  2K0M A;  3S5C A;  3S29 A;  3OWU A;  3V99 A;  1VQ8 3;  2QGU A;  4X2H A;  1E3R A;  4N6V 0;  1VQ5 3;  2CFL A;  3PCR A;  1GYB A;  4R9K A;  3RDE A;  1QAF A;  2Y74 A;  1GY6 A;  3MG2 A;  3NBJ A;  2CG1 A;  3X41 A;  3EB8 A;  2YFL B;  3K63 A;  5HGR A;  4NRE A;  1S5A A;  3FF0 A;  4WYK B;  3FSD A;  4U13 A;  4AKZ A;  4XDW A;  4MMZ B;  1C7H A;  3JUM A;  3UNL A;  4EV2 A;  4FMC A;  4OUQ A;  8CHO A;  2W56 B;  4N6M A;  4WHA A;  4TX4 A;  1JB4 A;  3EF8 A;  1D6Z A;  4WWU C;  3NV0 A;  2XFS A;  3F14 A;  1OF5 A;  2BO9 B;  5KP1 A;  2D1W A;  4FCM A;  2W04 A;  1RN7 A;  1U8C B;  3DUK A;  1FA3 A;  2Z76 A;  1RJO A;  2R4I A;  3CC2 3;  3GRD A;  3FG1 A;  4IIA A;  1KWI A;  3U1W A;  2YX9 A;  4HYZ A;  1YGE A;  3G71 3;  4FR9 A;  3LT8 A;  1ZX2 A;  3JUN A;  3PZW A;  1TFO A;  2GU3 A;  1Q81 4;  3CCJ 3;  2OWP A;  1D6Y A;  4HM6 B;  5I97 A;  5DRE A;  1W2B 2;  5IER A;  4HM7 B;  1IVU A;  4RZM A;  1LVN A;  5JPP A;  3DM8 A;  4HM8 B;  1JB5 A;  5CXO A;  1Y4K A;  2RCD A;  2HMO B;  2YFJ B;  2CW9 A;  1W7C A;  3QK9 A;  4R1K A;  4MJD A;  3FZW A;  1TP6 A;  3EBY A;  2Z7A A;  2GBX B;  4H3U A;  4N3V A;  4WYK A;  1YIT 3;  2HMJ B;  4BTY A;  5EQL A;  2UX0 A;  3WA3 A;  3MKI A;  2HMN B;  2Z6B A;  1TU5 A;  3GZY B;  1OHP A;  2IA7 A;  3NBB A;  1IQY A;  3LTA A;  1YI2 3;  1OPY A;  3F9S A;  2RSX A;  1KQS 2;  2P05 A;  1W6G A;  3FKA A;  5LC7 A;  3DGN A;  1DVD A;  3Q90 A;  3FG4 A;  1SJW A;  3Q2P A;  2MF7 A;  3U97 A;  1F8N A;  3PCS A;  3L0R A;  5CF1 A;  3LML A;  3DGM A;  4IT7 A;  2XH9 A;  3B4O A;  3B4P A;  4HM5 B;  2WOF A;  5FW5 A;  3CC7 3;  1YHQ 3;  2F98 A;  4ZM8 A;  2OCT A;  4LEH A;  5IF6 A;  4N6N B;  3UB1 A;  5AIG A;  2W03 A;  5AI1 A;  2QIY A;  5AIH A;  2XSO B;  3IMA B;  3KZT A;  2GU1 A;  4XDV A;  5D82 A;  1O7H B;  4N6T A;  4CDL A;  3CCR 3;  4HBR A;  2HML B;  3CNX A;  4FCJ A;  3UL6 A;  2CKF B;  3FH1 A;  3PS8 A;  4O2H A;  2WOH A;  4EBG A;  1YJN 3;  2OOV A;  3HIG A;  2CG0 A;  2CWU A;  4OK0 A;  4CCV A;  3H51 A;  2PNC A;  1YJ9 3;  4H61 A;  1IDP A;  4MMY B;  1TIJ A;  4JF8 A;  5G2G A;  4BTW A;  3DMC A;  1V74 A;  3WOD G;  1N5P A;  4XB5 A;  1W01 A;  2P09 A;  4RBN A;  5TGN A;  2ML5 A;  3BLZ A;  3KKG A;  5IEO A;  2PZV A;  2LQV A;  1IV9 A;  1UW1 A;  3CCQ 3;  3F7S A;  4FMA A;  1MNL A;  2GBW B;  5D83 A;  3GWR A;  3BB9 A;  1M90 4;  4HM2 B;  3NM7 A;  3BNE A;  2BMR B;  3LT9 A;  3OWS A;  1SII A;  1WTH A;  1W6C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...