3A76A

The crystal structure of lina
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
147
structure length
147
Chain Sequence
MSDLDRLASRAAIQDLYSDKLIAVDKRQEGRLASIWWDDAEWTIEGIGTYKGPEGALDLANNVLWPMFHECIHYGTNLRLEFVSADKVNGIGDVLLLGNLVEGNQSILIAAVFTDEYERRDGVWKFSKRNACTNYFTPLAGIHFAPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of g-hexachlorocyclohexane dehydrochlorinase LinA from Sphingobium japonicum UT26
pubmed doi rcsb
source organism Sphingomonas paucimobilis
molecule tags Lyase
molecule keywords Gamma-hexachlorocyclohexane dehydrochlorinase
total genus 43
structure length 147
sequence length 147
chains with identical sequence B, C
ec nomenclature ec 4.5.1.-:
pdb deposition date 2009-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13577 SnoaL_4 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3a76A01
4WP5A 3DZLA 3G0KA 5KP4A 1K41A 4N3VA 2GEYA 3Q90A 4HM8B 3B4PA 4LEHA 1OGXA 3CPOA 1OHOA 4STDA 2A15A 3ECFA 3SOAA 2GBXB 3DMCA 3DUKA 3OWSA 1Q40B 1JB5A 4L8OA 2HMLB 4LMIA 3FGYA 4HJLB 1GY7A 4XBTA 3OWUA 4IIAA 1O7GB 1JB2A 2BMQB 2F86B 3OWYA 1OGZA 2RFRA 3MSOA 3EC9A 4FCMA 2XR8B 3RGAA 4R9LA 5HGRA 4HM1B 3GRDA 4WWUC 1S5AA 3T8UA 1ZO2A 2HMJB 1JKGA 1OUNA 2RCDA 2YFJB 3GZXB 3K0ZA 3D9RA 3NUVA 3T8NA 2Z76A 4XDWA 4XM4A 2R4IA 3EBYA 3GZYB 3KE7A 5CXOA 1WQLB 1Z1SA 4HM3B 5CLKA 5AIGA 4J8TA 1A2KA 1OF5B 4HKVB 3EN1B 1OF5A 5AEUB 3UJMA 8CHOA 3F9SA 1C7HA 3CNXA 5IEPA 3OV4A 1OCVA 3IPTA 3MG1A 3EJVA 4HM6B 4XBXA 1JN5A 3ROBA 3F8HA 2XSOB 3F7XA 2HMKB 1ULJB 1NU3A 3B4OA 1ASKA 1CQSA 4GB5A 5TGNA 3VSYA 2CHCA 1OHSA 3OXAA 1OHPA 2Z7AA 3NV0A 2PZVA 1GS3A 3FZWA 3VGNA 2W2CA 4HZBB 4WYKA 3CU3A 4WYKB 4X2HA 3FKAA 4H3UA 2HMNB 3EN8A 5DREA 2HMOB 3CNMA 2Z77A 4L7KA 3M8CA 5EVHA 1W02A 3EF8A 5G2GA 5JPPA 3JUOA 3SOYA 2GXFA 4K1VA 1DMNA 1QJGA 7STDA 1NDOB 2INXA 4R1KA 5AI1A 2F99A 4HZ9B 2K54A 5D82A 1AR0A 2IMJA 3G8ZA 3EQQB 1GYBA 1ZX2A 2B1XB 4RZMA 3S5CA 6STDA 1GY5A 5IG4A 1W01A 1OPYA 3E99A 1O7NB 3G16A 3EX9A 1O7PB 2CKFB 1IDPA 1BUQA 4CDLA 1GY6A 5IG0A 1VZZA 5CF1A 1UUVB 3GZRA 2F98A 3HX8A 4FCJA 5JPUA 2QGUA 3MG3A 5D83A 4HM2B 3KZTA 4HVNA 3F14A 3LZAA 3STDA 4MJDA 1Q42A 2JQ5A 5CK6A 1JB4A 3MKIA 3EBTA 1ULIB 3KKGA 2YFIB 3RGRA 2RGQA 2YFLB 3B8LA 3OX9A 2BMOB 2GBWB 3GZBA 3F7SA 1HKXA 2XRXB 3BLZA 3MHEA 3MYTA 2STDA 1DMQA 2UX0A 4I4KA 4K1UA 4OVMA 3DM8A 1U5OA 3FLJA 3NBRA 4XBYA 5IEOA 2GEXA 5KP1A 1O7WB 2OWPA 3ER7A 1W00A 1SJWA 3NV0B 5CF2A 3WMDA 1Q40A 4OUQA 5BVBA 3MG2A 1STDA 1W6YA 5D81A 5KP3A 4HM7B 3SEDA 3FF0A 1O7HB 1E3VA 2BNGA 2QIYA 3LYGA 3NHXA 5AIHA 2B24B 3I0YA 3EHCA 1O7MB 2XSHB 3FSDA 4XB5A 3NXJA 1DMMA 1NWWA 3HZPA 3JUMA 3FF2A 1E3RA 1TP6A 3JUPA 4PEJA 3A76A 5AIFA 5AEWB 4XDVA 4X2OA 5IG5A 5IERA 3K7CA 4ORLA 1TUHA 2BMRB 4LGQA 4KVHA 5IG3A 1ISKA 2HMMB 3NM2A 1JN5B 3DXOA 4R9KA 1QMAA 4HM5B 1JKGB 5STDA 1EA2A 3GWRA 3B7CA 5DRVA 5IF6A 4Q53A 1UUWB 4J9AA 3BB9A 5AIIA 3H3HA 4HM4B 3H51A 3F8XA 4L8PA 4U13A 3FH1A 1EG9B 1E97A 5BXQA 3UNLA 3KSPA 3F40A 5IENA 2I9WA 3JUQA 1OH0A 3HK4A 5FW5A 4HM0B 3JUNA
chains in the Genus database with same CATH superfamily
3CME3 4EYCA 4CPKA 3G0KA 1IT8A 1K41A 5KP4A 3B4PA 1D6UA 4CCVA 1UCIA 3RDEA 5AEUB 7RNTA 5LC7A 4HJLB 4IIAA 3ZG5A 1JB2A 2BMQB 2WOFA 3IMAB 2C4BA 3K5TA 3Q2PA 3RGAA 5A0OB 2OTL3 4WWUC 1UCJA 5HOHA 1ZO2A 3DGYA 2RCDA 3K0ZA 3G6E3 3T8NA 2D42A 1X1XA 1V74A 3KE7A 2CX0A 5ELJA 1FGOA 2CW9A 3S67A 1B3SA 4HKVB 4J8TA 1IV9A 4CJNA 1OF5A 1M904 1FA3A 3L0RA 4ZM8A 3F9SA 2IA7A 3FCSB 3CNXA 4O8SA 1RKYA 1BNIA 1QVG2 4HM6B 1BRHA 4AKYA 3LT8A 1JN5A 2XSOB 3I563 3B4OA 3VSYA 3NQYA 1T5YA 1TRQA 4EW5A 1VQ63 1G0TA 1OHSA 1OHPA 3LT9A 1YGWA 3NV0A 1X1YA 3UL6A 3SVAA 1FUWA 5EQLA 3FZWA 3U1WA 4H3UA 1VQL3 5DREA 1RGLA 1W5ZA 3CNMA 3BNEA 1JZOA 3M8CA 4J5GA 3EF8A 1IVUA 1B2MA 2OQEA 1ROAA 1W2B2 5M18A 1DVCA 1RRLA 1KWIA 4RZMA 1JNQA 2IUJA 2CWUA 3S5CA 1BRIA 1GY5A 3G16A 1O7NB 1PYLA 1O7PB 1IDPA 2FGTA 1BUQA 1GY6A 1NB5I 1JV2B 4FCJA 1AY7A 2C11A 1RN4A 3MG3A 4N6LA 4IPBA 2R41A 4FMDA 3LTCA 1YJW3 4HVNA 3F14A 1KD14 1Q42A 1IQ8A 4GHOA 1JB4A 1NNVA 3EBTA 1US1A 3KKGA 3PCRA 4G1MB 4N6V0 1FYSA 4N6TA 3RGRA 3SYUA 4CDLA 5BU4A 3STDA 2XRXB 4BTXA 1DMQA 2L1SA 2P38A 2UX0A 4K1UA 1Q9EA 1IYYA 4BTWA 5IEOA 3TDGA 1R4YA 2GEXA 4QWTA 5KP1A 1J2BA 1DE3A 1GD3A 1W00A 3LTBA 1IQYA 2XGNA 3D79A 1W4NA 1VQN3 1IVXA 4OUQA 3MG2A 2QIYA 3DGLA 4EXRA 3LYGA 3NHXA 2IYJA 3I0YA 1M9GA 3FG3A 3QK9A 4OK0A 3PYJA 1STFI 1UGIA 5LC6A 3X3ZA 1N5PA 4RBNA 4N6MA 2Q07A 1I2GA 1LNHA 3HZPA 2CFGA 1E3RA 2CC3A 1FUTA 1BGSA 2IY2A 1YIJ3 1BSDA 1PFPA 4BU4A 3K7CA 3X3XA 4ORLA 3OW22 1B2ZA 5I97A 4KVHA 3KFQC 4KFDA 4R9KA 1RGEA 1VQ43 3LTAA 9RNTA 1UUWB 1WMNA 2XGLA 3EB8A 1B2UA 3H3HA 4HM4B 3F8XA 4L8PA 1KQS2 3FH1A 1E97A 1BRSA 1TFOA 1NB3I 2CFKA 2YX9A 2I9WA 3F40A 2WGQA 3JUQA 3AGNA 5FW5A 1R4CA 4BL2A 4HM0B 3D3LA 2CIUA 4GSPA 1VQ83 2C10A 2GEYA 2Y74A 4JF8A 2A15A 3ECFA 1JBRA 1V58A 1I0VA 1A2VA 4L8OA 1Q40B 1JB5A 1B2XA 2LYXA 4XBTA 1YVSA 4FCMA 1OGZA 2RFRA 5IW9A 3BNDA 3LH4A 3A5EA 3GZXB 1OUNA 3NUVA 2E2VA 2HOHA 2Z76A 1UW1A 1K734 4XDWA 1RN1A 4XM4A 2MF7A 3EBYA 2QEX3 1GOYA 3CCR3 3HIGA 5CXOA 1Z1SA 2AADA 1A2KA 1OF5B 1Y4KA 3CD63 2ZL8A 5IEPA 3MG1A 3EJVA 4N6OB 4XBXA 1LXEA 2CWVA 3F7XA 1CH0A 3F8HA 1M1XB 1UCKA 1NU3A 3K9MC 5TGNA 1CQSA 1RN7A 2P05A 1PU4A 2P0MA 2CHCA 1YJ93 4O2HA 2Z7AA 1BNFA 6GSPA 4I5QA 4LYLB 1CEWI 2W2CA 4HZBB 7GSPA 4WYKB 3FKAA 1I3IA 2F5WA 1FGTA 1YI23 1MOLA 1I0XA 1W02A 3ALAA 5JPPA 1RHLA 1IK3A 1DMNA 4WFOA 5FGOA 2INXA 4R1KA 1ZS7A 2KF5A 1MWRA 3CCU3 2OOVC 3QRDA 2ZA4A 2K54A 2KRTA 2OCTA 4WHAA 3KN4A 1JZDA 1DETA 1SIIA 1I2FA 3E99A 3DY5A 1C54A 2CKFB 2MC8A 1G96A 1W6CA 1UUVB 1IVVA 4HOHA 3KZTA 3S29A 3AMOB 1EUIC 1ULIB 4AEQA 2YFIB 4K90B 1YNVX 1SARA 1UUGB 2YFLB 3B8LA 3N54B 1HKXA 1Q864 3MPHA 3MYTA 4OVMA 2XEPA 2M7OA 3CMA3 3DM8A 3DH2A 3NBRA 1EQKA 2J8XB 2KXGA 2XFSA 8RNTA 1N8R4 4BL3A 3ER7A 3D4AA 1SJWA 4MMZB 1MGWA 1T2HA 3LXUX 2RSXA 4K61A 2GU1A 1IVWA 4HM7B 2F56A 1O7HB 1E3VA 2BNGA 1FGQA 1NJI4 1W2ZA 3NBBA 3EHCA 2XFTA 1A90A 3FSDA 4XB5A 1DMMA 3JUMA 3K63A 4KFEA 3X41A 3CCJ3 5AEWB 3A76A 5AIFA 4XDVA 5JBSA 5IG5A 3V98A 1IQXA 1RDSA 1GMQA 1RMSA 1BVIA 2CG0A 3URPA 2P09A 3DXOA 3CC23 1K8A4 1VQ93 3S27A 3WA3A 2CFDA 4EV5A 5DRVA 1MWTA 1RLSA 4MEIA 1ZGXA 4Q53A 5AIIA 3O8YA 3AMOA 3X3YA 1RJOA 5M1AA 3N9HA 1Q824 1EG9B 6RNTA 3WA2X 1TRPA 3KSED 3JUNA 2SARA 4IT7A 4N3VA 1TFKA 4HM8B 1CYUA 4LEHA 1OGXA 3CPOA 2XF3A 2KF3A 2GBXB 3DMCA 1U8CB 4LMIA 3FGYA 4R80A 3GAXA 1O7GB 2IUKA 1MGRA 1YIT3 3OWYA 3CCS3 1LRAA 1OACA 2XR8B 3EC9A 4LSOA 1RGCA 4HM1B 5HGRA 3CCV3 3Q3FA 3T8UA 1JKGA 2WOHA 2YFJB 1RCLA 1UI8A 4AKZA 1Q7Y4 2L4VA 2R4IA 2RBIA 1LNIA 2CWTA 5CLKA 1MNLA 3EN1B 1WMOA 1CYVA 2H0IA 2O3OA 2W04A 1GOVA 8CHOA 1BOXA 1C7HA 1VQM3 1KC84 2H0HA 3OV4A 2KCDA 1I70A 3D5IA 3ROBA 3UB1A 2BIRA 3SX1A 4NREA 4MMXB 1GS3A 1A67A 1B2SA 4WYKA 1RCKA 2HMNB 2Z6BA 3EN8A 2F4YA 2W03A 2HMOB 1AVLA 2Z77A 5EVHA 1IV7A 1ROVA 2GSPA 3D5GA 1IT7A 2FNQA 2KF6A 1VQP3 2CFLA 1QJGA 1I8VA 1RGFA 1TJDA 4O02B 1LVNA 2CH9A 2BT3A 2F99A 4HZ9B 5AI1A 5G1LA 3G4S3 5D82A 1W7CA 2IMJA 3EQQB 1ZX2A 3PZWA 2B1XB 3NBJA 2RNTA 4N6NB 1QALA 5IG4A 1W01A 1A2PA 1OPYA 4HBRA 1JBTA 1BSCA 3WOFB 5IG0A 5CF1A 3T0UA 1JJ22 3HX8A 2E2TA 2W0QA 5JPUA 2QGUA 2F5MA 3AHWA 5D83A 4HM2B 5GSPA 4EBGA 1YHQ3 2JDIH 2O9UX 3WHOA 2W9PA 3LZAA 4MJDA 1N8QA 4RNZA 5M19A 3CC43 2QA43 2ML5A 2BU4A 2ZHXB 2RGQA 1BNGA 2KAAA 1YVBI 1GSPA 3MHEA 1RGAA 3BLZA 3S28A 1U5OA 5ELUA 2CG1A 1M1K4 2P0XA 2E2UA 1TIJA 2OWPA 1BAOA 2D1WA 3PGBA 3HOHA 1AV4A 1VQK3 1BNRA 3ZG0A 1STDA 1W6YA 5D81A 3SEDA 3I553 3NQZA 1YGEA 3CCQ3 5G1KA 2B24B 1BIRA 2OOVA 1RNBA 3ZFZA 1W6GA 1VQO3 2SBLA 4FR9A 2XSHB 1FW7A 1DYUA 1NWWA 2W9QA 1FGRA 3NM7A 4O3VA 3WODG 1TP6A 3JUPA 1RGKA 1D6ZA 3IJEB 3CXC2 2PNCA 3LOYA 3JVCA 2FXTA 1VQ53 2H0GA 2KF4A 1UCLA 4LGQA 5IG3A 1ISKA 3NM2A 1EEJA 3FG4A 1BANA 1RSNA 1LOYA 2K0MA 1FZUA 2UUGC 3AGOA 4EV2A 1JKGB 1T2IA 3GWRA 1GMPA 5IF6A 1HYFA 3DGMA 4J9AA 1SQWA 1JBSA 3H51A 1AQZA 3HIIA 1QAFA 1K28A 1SPUA 2LQVA 5BXQA 1BSAA 3SXXA 4FMBA 4DKIA 4WP5A 1Q7HA 3DZLA 3SLUA 1LOXA 3Q90A 2BHMA 1RRHA 1F8NA 1OHOA 4STDA 1S723 3SOAA 3VF1A 3DUKA 3OWSA 2HMLB 3X40A 1GY7A 3OWUA 2F86B 3NX0A 5IERA 3MSOA 3AHSA 4BTYA 1X1WA 4R9LA 3GRDA 1S5AA 3CPW2 1MWUA 1I2EA 5AYSC 2HMJB 2XH9A 3V92A 1BSEA 4HAAA 3D9RA 1RGHA 3GSPA 4ILFA 3BIRA 3BNBA 3X42A 3GZYB 2OTJ3 2Y73A 1WQLB 5AIGA 4HM3B 2CK3H 5BIRA 1B27A 1GD4A 4JRFA 3UJMA 1K9M4 1BRKA 1HZ1A 1WTHA 1GMRA 1OCVA 1B20A 3IPTA 3WOEB 1BNEA 2K3DA 2HMKB 1ULJB 1UDII 1L5GB 1ASKA 4GB5A 3MWZA 1Q814 3OXAA 1VQQA 1YJN3 1V57A 2PZVA 3VGNA 3DGOA 3WR2A 3CU3A 1RNTA 1N9EA 4X2HA 3UL5A 2UGIA 3PS8A 4FMAA 4KFFA 4L7KA 1FGMA 1LQGC 4EC6A 5G2GA 1NO3A 4FCZA 3JUOA 3SOYA 2GXFA 4K1VA 3RNTA 3J7Yd 1NDOB 1WMPA 3LTDA 1RTUA 1AR0A 1QAKA 3G8ZA 1GYBA 1N5HA 1N9JA 1LOVA 3FG1A 6STDA 1B21A 1LOWA 1X1UA 1BSBA 2W56B 3EX9A 3LMLA 1BRGA 1T3BA 1VZZA 1HU9A 3KCHA 3GZRA 2CFWA 2F98A 4NHFA 3PXMA 1G02A 1SIHA 4KT3B 2V1LA 1TU5A 1BNSA 3BU4A 2GU3A 4N6UA 2JQ5A 5CK6A 3MKIA 3G713 1FUSA 3Q1CA 1KSIA 1BNJA 3OX9A 2BMOB 2GBWB 3GZBA 3F7SA 4RNYA 1D6YA 4BIRA 5RNTA 4I4KA 2STDA 2ZDJA 3UNLA 3FLJA 1VQ73 4XBYA 2WO0A 1WNHA 2CX1A 1O7WB 1BUJA 3NV0B 5CF2A 1MWSA 4MMYB 3WMDA 1Q40A 5BVBA 4KZ1A 5KP3A 4GL6A 3KIIA 3FF0A 2W56A 1EKMA 5AIHA 5EEOA 4R4KA 1O7MB 1UI7A 3U97A 3CCE3 1AVKA 7STDA 3NXJA 1QVF2 4TX4A 2WGOA 3BNCA 1GOUA 3FF2A 1BU4A 3CCL3 4PEJA 2W6JH 3V99A 3HI7A 4X2OA 3PCSA 2OQEC 4HYZA 3N8BA 4FMCA 4NPBA 5AYRB 1TUHA 2BMRB 1BRNL 1DVDA 2HMMB 3CC73 1JN5B 1PY3A 1QMAA 1TTOA 4HM5B 5STDA 1I3FA 1EA2A 3WDGB 3B7CA 4RNTA 4LZIA 1BRJA 1IU7A 3BB9A 1UGHI 4U13A 1LQMB 4J5KA 2AAEA 2ML6A 3DGNA 3KSPA 3CCM3 5IENA 2BO9B 1OH0A 1JRQA 3HK4A 3EE1A 4H61A 1RGGA
chains in the Genus database with same CATH topology
4EYCA 3G0KA 1IT8A 1K41A 5KP4A 3B4PA 1D6UA 4CCVA 3RDEA 5AEUB 5LC7A 4HJLB 4IIAA 1JB2A 2BMQB 2WOFA 3IMAB 3K5TA 3RGAA 3Q2PA 5A0OB 2OTL3 4WWUC 1ZO2A 3K0ZA 2RCDA 3G6E3 3T8NA 2D42A 3KE7A 1V74A 5ELJA 1FGOA 2CW9A 3S67A 4J8TA 4HKVB 1M904 1IV9A 1FA3A 1OF5A 3L0RA 4ZM8A 3F9SA 2IA7A 3FCSB 3CNXA 4O8SA 1RKYA 1QVG2 4HM6B 4AKYA 3LT8A 1JN5A 2XSOB 3I563 3B4OA 3VSYA 3NQYA 1T5YA 1VQ63 1OHSA 1OHPA 3LT9A 3NV0A 3UL6A 3SVAA 1FUWA 5EQLA 3FZWA 3U1WA 4H3UA 1VQL3 5DREA 3CNMA 1W5ZA 3BNEA 3M8CA 3EF8A 1IVUA 2OQEA 1ROAA 1W2B2 1DVCA 1RRLA 1KWIA 4RZMA 1JNQA 2IUJA 2CWUA 3S5CA 1GY5A 3G16A 1O7NB 1O7PB 1IDPA 2FGTA 1BUQA 1GY6A 1NB5I 1JV2B 4FCJA 2C11A 3MG3A 4N6LA 4IPBA 4FMDA 3LTCA 1YJW3 4HVNA 3F14A 1KD14 1Q42A 1IQ8A 1JB4A 4N6V0 3EBTA 1US1A 3KKGA 3PCRA 4G1MB 4N6TA 3RGRA 4CDLA 3STDA 2XRXB 4BTXA 1DMQA 2P38A 2UX0A 4K1UA 4BTWA 5IEOA 3TDGA 4QWTA 2GEXA 5KP1A 1J2BA 1GD3A 1W00A 3LTBA 1IQYA 2XGNA 1W4NA 1VQN3 1IVXA 4OUQA 3MG2A 3DGLA 2QIYA 4EXRA 3LYGA 3NHXA 3I0YA 1M9GA 3FG3A 3QK9A 4OK0A 3PYJA 1STFI 5LC6A 3X3ZA 1N5PA 4RBNA 4N6MA 2Q07A 3HZPA 1LNHA 2CFGA 1E3RA 2CC3A 1YIJ3 1PFPA 3K7CA 3X3XA 4ORLA 3OW22 5I97A 4KVHA 3KFQC 4KFDA 4R9KA 1VQ43 3LTAA 1UUWB 1WMNA 2XGLA 3EB8A 3H3HA 4HM4B 1KQS2 3F8XA 4L8PA 3FH1A 1E97A 1TFOA 1NB3I 2CFKA 2YX9A 2I9WA 3F40A 2WGQA 3JUQA 5FW5A 3SXXA 1R4CA 4HM0B 3D3LA 2CIUA 1VQ83 2C10A 2GEYA 2Y74A 4JF8A 2A15A 3ECFA 1A2VA 4L8OA 1Q40B 1JB5A 2LYXA 4XBTA 4FCMA 1OGZA 2RFRA 5IW9A 3BNDA 3LH4A 3GZXB 1OUNA 3NUVA 2E2VA 2Z76A 1UW1A 1K734 4XDWA 4XM4A 2QEX3 2MF7A 3EBYA 3CCR3 3HIGA 5CXOA 1Z1SA 1A2KA 1OF5B 1Y4KA 3CD63 2ZL8A 5IEPA 3MG1A 3EJVA 4N6OB 4XBXA 1LXEA 2CWVA 3F7XA 3F8HA 3K9MC 1M1XB 3CME3 1NU3A 5TGNA 1PU4A 1CQSA 1RN7A 2P05A 2P0MA 2CHCA 1YJ93 4O2HA 2Z7AA 1CEWI 2W2CA 4HZBB 4WYKB 3FKAA 1FGTA 1YI23 1MOLA 1W02A 3ALAA 5JPPA 1IK3A 1DMNA 4WFOA 5FGOA 2INXA 4R1KA 3CCU3 2OOVC 3QRDA 2K54A 2KRTA 2OCTA 4WHAA 3KN4A 1SIIA 3DY5A 3E99A 2CKFB 2MC8A 1G96A 1W6CA 1UUVB 1IVVA 3KZTA 3S29A 3AMOB 1ULIB 4AEQA 2YFIB 4K90B 2YFLB 3B8LA 3N54B 1HKXA 1Q864 3MPHA 3MYTA 4OVMA 2XEPA 2M7OA 3CMA3 3DM8A 3NBRA 1EQKA 2KXGA 2XFSA 1N8R4 3ER7A 1SJWA 4MMZB 3LXUX 2RSXA 4K61A 2GU1A 1IVWA 4HM7B 1O7HB 1E3VA 2BNGA 1FGQA 1NJI4 1W2ZA 3NBBA 3EHCA 2XFTA 1A90A 3FSDA 4XB5A 1DMMA 3JUMA 3K63A 4KFEA 3X41A 3CCJ3 5AEWB 3A76A 5AIFA 4XDVA 5JBSA 5IG5A 3V98A 1IQXA 2CG0A 2P09A 3DXOA 3CC23 1K8A4 1VQ93 3S27A 3WA3A 2CFDA 4EV5A 5DRVA 4MEIA 4Q53A 5AIIA 3O8YA 3AMOA 3X3YA 1RJOA 3N9HA 1Q824 1EG9B 3WA2X 3KSED 3JUNA 4IT7A 4N3VA 1TFKA 4HM8B 1CYUA 4LEHA 1OGXA 3CPOA 2XF3A 2GBXB 3DMCA 1U8CB 4LMIA 3FGYA 4R80A 3GAXA 1O7GB 2IUKA 1YIT3 3OWYA 3CCS3 3EC9A 1OACA 2XR8B 4LSOA 3CCV3 5HGRA 4HM1B 3T8UA 1JKGA 2WOHA 2YFJB 1UI8A 1Q7Y4 4AKZA 2L4VA 2R4IA 2CWTA 5CLKA 1MNLA 3EN1B 1WMOA 1CYVA 2O3OA 2W04A 8CHOA 1C7HA 1VQM3 1KC84 3OV4A 2KCDA 3ROBA 3UB1A 3SX1A 4NREA 4MMXB 1GS3A 1A67A 4WYKA 2HMNB 2Z6BA 3EN8A 2W03A 2HMOB 1AVLA 2Z77A 5EVHA 1IV7A 1ROVA 1IT7A 2FNQA 1VQP3 2CFLA 1QJGA 4O02B 7STDA 1QVF2 1LVNA 2BT3A 2CH9A 2F99A 4HZ9B 5AI1A 3G4S3 5D82A 1W7CA 2IMJA 3EQQB 1ZX2A 3PZWA 2B1XB 3NBJA 4N6NB 1QALA 5IG4A 1W01A 1OPYA 4HBRA 3WOFB 5IG0A 5CF1A 3T0UA 1JJ22 3HX8A 2E2TA 2W0QA 5JPUA 2QGUA 5D83A 4HM2B 4EBGA 1YHQ3 2JDIH 2O9UX 2W9PA 3LZAA 4MJDA 1N8QA 4RNZA 3CC43 2QA43 2ML5A 2RGQA 1YVBI 3MHEA 3BLZA 3S28A 1U5OA 5ELUA 2CG1A 1M1K4 2P0XA 2E2UA 1TIJA 2OWPA 2D1WA 3PGBA 1AV4A 1VQK3 1STDA 1W6YA 5D81A 3SEDA 3I553 3NQZA 1YGEA 3CCQ3 2B24B 2OOVA 1W6GA 1VQO3 2SBLA 4FR9A 2XSHB 1DYUA 1NWWA 2W9QA 1FGRA 3NM7A 4O3VA 3WODG 1TP6A 3JUPA 1D6ZA 3IJEB 3CXC2 2PNCA 3LOYA 3JVCA 2FXTA 1VQ53 5IG3A 4LGQA 1ISKA 3NM2A 3FG4A 2K0MA 4EV2A 1JKGB 3GWRA 5IF6A 3DGMA 4J9AA 1SQWA 3H51A 3HIIA 1QAFA 1K28A 1SPUA 2LQVA 5BXQA 4FMBA 4WP5A 3SLUA 3DZLA 1LOXA 3Q90A 2BHMA 1RRHA 1F8NA 1OHOA 4STDA 1S723 3SOAA 3VF1A 3DUKA 3OWSA 2HMLB 3X40A 1GY7A 3OWUA 2F86B 3NX0A 5IERA 3MSOA 4BTYA 4R9LA 3GRDA 1S5AA 3CPW2 5AYSC 3V92A 2HMJB 2XH9A 3D9RA 3BNBA 3X42A 3GZYB 2OTJ3 2Y73A 1WQLB 5AIGA 4HM3B 2CK3H 1GD4A 4JRFA 3UJMA 1K9M4 1WTHA 3WOEB 1OCVA 3IPTA 2HMKB 1ULJB 1L5GB 1ASKA 4GB5A 3MWZA 1Q814 3OXAA 1YJN3 2PZVA 3VGNA 3DGOA 3CU3A 4X2HA 1N9EA 3UL5A 3PS8A 4FMAA 4KFFA 4L7KA 1FGMA 4EC6A 5G2GA 1NO3A 4FCZA 3JUOA 3SOYA 2GXFA 4K1VA 3J7Yd 1NDOB 1WMPA 3LTDA 1AR0A 1QAKA 3G8ZA 1GYBA 1N5HA 1N9JA 3FG1A 6STDA 3LMLA 2W56B 3EX9A 1VZZA 1HU9A 3GZRA 2CFWA 2F98A 4NHFA 3PXMA 1SIHA 2V1LA 1TU5A 2GU3A 4N6UA 2JQ5A 5CK6A 3MKIA 3G713 3Q1CA 1KSIA 3OX9A 2BMOB 2GBWB 3GZBA 3F7SA 4RNYA 1D6YA 4I4KA 2STDA 2ZDJA 3UNLA 3FLJA 1VQ73 4XBYA 2WO0A 1WNHA 1O7WB 3NV0B 5CF2A 3WMDA 4MMYB 1Q40A 5BVBA 4KZ1A 5KP3A 4GL6A 3KIIA 3FF0A 2W56A 1EKMA 5AIHA 5EEOA 4R4KA 1O7MB 1UI7A 3U97A 3CCE3 1AVKA 3NXJA 4TX4A 2WGOA 3BNCA 3FF2A 3CCL3 4PEJA 2W6JH 3V99A 3HI7A 4X2OA 3PCSA 2OQEC 4HYZA 3N8BA 4FMCA 5AYRB 1TUHA 2BMRB 1DVDA 2HMMB 3CC73 1JN5B 1QMAA 4HM5B 5STDA 3WDGB 1EA2A 3B7CA 4LZIA 3BB9A 1IU7A 4U13A 2ML6A 3DGNA 3KSPA 3CCM3 5IENA 2BO9B 1OH0A 1JRQA 3HK4A 3EE1A 4H61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WP5 A;  3DZL A;  3G0K A;  5KP4 A;  1K41 A;  4N3V A;  2GEY A;  3Q90 A;  4HM8 B;  3B4P A;  4LEH A;  1OGX A;  3CPO A;  1OHO A;  4STD A;  2A15 A;  3ECF A;  3SOA A;  2GBX B;  3DMC A;  3DUK A;  3OWS A;  1Q40 B;  1JB5 A;  4L8O A;  2HML B;  4LMI A;  3FGY A;  4HJL B;  1GY7 A;  4XBT A;  3OWU A;  4IIA A;  1O7G B;  1JB2 A;  2BMQ B;  2F86 B;  3OWY A;  1OGZ A;  2RFR A;  3MSO A;  3EC9 A;  4FCM A;  2XR8 B;  3RGA A;  4R9L A;  5HGR A;  4HM1 B;  3GRD A;  4WWU C;  1S5A A;  3T8U A;  1ZO2 A;  2HMJ B;  1JKG A;  1OUN A;  2RCD A;  2YFJ B;  3GZX B;  3K0Z A;  3D9R A;  3NUV A;  3T8N A;  2Z76 A;  4XDW A;  4XM4 A;  2R4I A;  3EBY A;  3GZY B;  3KE7 A;  5CXO A;  1WQL B;  1Z1S A;  4HM3 B;  5CLK A;  5AIG A;  4J8T A;  1A2K A;  1OF5 B;  4HKV B;  3EN1 B;  1OF5 A;  5AEU B;  3UJM A;  8CHO A;  3F9S A;  1C7H A;  3CNX A;  5IEP A;  3OV4 A;  1OCV A;  3IPT A;  3MG1 A;  3EJV A;  4HM6 B;  4XBX A;  1JN5 A;  3ROB A;  3F8H A;  2XSO B;  3F7X A;  2HMK B;  1ULJ B;  1NU3 A;  3B4O A;  1ASK A;  1CQS A;  4GB5 A;  5TGN A;  3VSY A;  2CHC A;  1OHS A;  3OXA A;  1OHP A;  2Z7A A;  3NV0 A;  2PZV A;  1GS3 A;  3FZW A;  3VGN A;  2W2C A;  4HZB B;  4WYK A;  3CU3 A;  4WYK B;  4X2H A;  3FKA A;  4H3U A;  2HMN B;  3EN8 A;  5DRE A;  2HMO B;  3CNM A;  2Z77 A;  4L7K A;  3M8C A;  5EVH A;  1W02 A;  3EF8 A;  5G2G A;  5JPP A;  3JUO A;  3SOY A;  2GXF A;  4K1V A;  1DMN A;  1QJG A;  7STD A;  1NDO B;  2INX A;  4R1K A;  5AI1 A;  2F99 A;  4HZ9 B;  2K54 A;  5D82 A;  1AR0 A;  2IMJ A;  3G8Z A;  3EQQ B;  1GYB A;  1ZX2 A;  2B1X B;  4RZM A;  3S5C A;  6STD A;  1GY5 A;  5IG4 A;  1W01 A;  1OPY A;  3E99 A;  1O7N B;  3G16 A;  3EX9 A;  1O7P B;  2CKF B;  1IDP A;  1BUQ A;  4CDL A;  1GY6 A;  5IG0 A;  1VZZ A;  5CF1 A;  1UUV B;  3GZR A;  2F98 A;  3HX8 A;  4FCJ A;  5JPU A;  2QGU A;  3MG3 A;  5D83 A;  4HM2 B;  3KZT A;  4HVN A;  3F14 A;  3LZA A;  3STD A;  4MJD A;  1Q42 A;  2JQ5 A;  5CK6 A;  1JB4 A;  3MKI A;  3EBT A;  1ULI B;  3KKG A;  2YFI B;  3RGR A;  2RGQ A;  2YFL B;  3B8L A;  3OX9 A;  2BMO B;  2GBW B;  3GZB A;  3F7S A;  1HKX A;  2XRX B;  3BLZ A;  3MHE A;  3MYT A;  2STD A;  1DMQ A;  2UX0 A;  4I4K A;  4K1U A;  4OVM A;  3DM8 A;  1U5O A;  3FLJ A;  3NBR A;  4XBY A;  5IEO A;  2GEX A;  5KP1 A;  1O7W B;  2OWP A;  3ER7 A;  1W00 A;  1SJW A;  3NV0 B;  5CF2 A;  3WMD A;  1Q40 A;  4OUQ A;  5BVB A;  3MG2 A;  1STD A;  1W6Y A;  5D81 A;  5KP3 A;  4HM7 B;  3SED A;  3FF0 A;  1O7H B;  1E3V A;  2BNG A;  2QIY A;  3LYG A;  3NHX A;  5AIH A;  2B24 B;  3I0Y A;  3EHC A;  1O7M B;  2XSH B;  3FSD A;  4XB5 A;  3NXJ A;  1DMM A;  1NWW A;  3HZP A;  3JUM A;  3FF2 A;  1E3R A;  1TP6 A;  3JUP A;  4PEJ A;  3A76 A;  5AIF A;  5AEW B;  4XDV A;  4X2O A;  5IG5 A;  5IER A;  3K7C A;  4ORL A;  1TUH A;  2BMR B;  4LGQ A;  4KVH A;  5IG3 A;  1ISK A;  2HMM B;  3NM2 A;  1JN5 B;  3DXO A;  4R9K A;  1QMA A;  4HM5 B;  1JKG B;  5STD A;  1EA2 A;  3GWR A;  3B7C A;  5DRV A;  5IF6 A;  4Q53 A;  1UUW B;  4J9A A;  3BB9 A;  5AII A;  3H3H A;  4HM4 B;  3H51 A;  3F8X A;  4L8P A;  4U13 A;  3FH1 A;  1EG9 B;  1E97 A;  5BXQ A;  3UNL A;  3KSP A;  3F40 A;  5IEN A;  2I9W A;  3JUQ A;  1OH0 A;  3HK4 A;  5FW5 A;  4HM0 B;  3JUN A; 
#chains in the Genus database with same CATH topology
 3CME 3;  4EYC A;  4CPK A;  3G0K A;  1IT8 A;  1K41 A;  5KP4 A;  3B4P A;  1D6U A;  4CCV A;  1UCI A;  3RDE A;  5AEU B;  7RNT A;  5LC7 A;  4HJL B;  4IIA A;  3ZG5 A;  1JB2 A;  2BMQ B;  2WOF A;  3IMA B;  2C4B A;  3K5T A;  3Q2P A;  3RGA A;  5A0O B;  2OTL 3;  4WWU C;  1UCJ A;  5HOH A;  1ZO2 A;  3DGY A;  2RCD A;  3K0Z A;  3G6E 3;  3T8N A;  2D42 A;  1X1X A;  1V74 A;  3KE7 A;  2CX0 A;  5ELJ A;  1FGO A;  2CW9 A;  3S67 A;  1B3S A;  4HKV B;  4J8T A;  1IV9 A;  4CJN A;  1OF5 A;  1M90 4;  1FA3 A;  3L0R A;  4ZM8 A;  3F9S A;  2IA7 A;  3FCS B;  3CNX A;  4O8S A;  1RKY A;  1BNI A;  1QVG 2;  4HM6 B;  1BRH A;  4AKY A;  3LT8 A;  1JN5 A;  2XSO B;  3I56 3;  3B4O A;  3VSY A;  3NQY A;  1T5Y A;  1TRQ A;  4EW5 A;  1VQ6 3;  1G0T A;  1OHS A;  1OHP A;  3LT9 A;  1YGW A;  3NV0 A;  1X1Y A;  3UL6 A;  3SVA A;  1FUW A;  5EQL A;  3FZW A;  3U1W A;  4H3U A;  1VQL 3;  5DRE A;  1RGL A;  1W5Z A;  3CNM A;  3BNE A;  1JZO A;  3M8C A;  4J5G A;  3EF8 A;  1IVU A;  1B2M A;  2OQE A;  1ROA A;  1W2B 2;  5M18 A;  1DVC A;  1RRL A;  1KWI A;  4RZM A;  1JNQ A;  2IUJ A;  2CWU A;  3S5C A;  1BRI A;  1GY5 A;  3G16 A;  1O7N B;  1PYL A;  1O7P B;  1IDP A;  2FGT A;  1BUQ A;  1GY6 A;  1NB5 I;  1JV2 B;  4FCJ A;  1AY7 A;  2C11 A;  1RN4 A;  3MG3 A;  4N6L A;  4IPB A;  2R41 A;  4FMD A;  3LTC A;  1YJW 3;  4HVN A;  3F14 A;  1KD1 4;  1Q42 A;  1IQ8 A;  4GHO A;  1JB4 A;  1NNV A;  3EBT A;  1US1 A;  3KKG A;  3PCR A;  4G1M B;  4N6V 0;  1FYS A;  4N6T A;  3RGR A;  3SYU A;  4CDL A;  5BU4 A;  3STD A;  2XRX B;  4BTX A;  1DMQ A;  2L1S A;  2P38 A;  2UX0 A;  4K1U A;  1Q9E A;  1IYY A;  4BTW A;  5IEO A;  3TDG A;  1R4Y A;  2GEX A;  4QWT A;  5KP1 A;  1J2B A;  1DE3 A;  1GD3 A;  1W00 A;  3LTB A;  1IQY A;  2XGN A;  3D79 A;  1W4N A;  1VQN 3;  1IVX A;  4OUQ A;  3MG2 A;  2QIY A;  3DGL A;  4EXR A;  3LYG A;  3NHX A;  2IYJ A;  3I0Y A;  1M9G A;  3FG3 A;  3QK9 A;  4OK0 A;  3PYJ A;  1STF I;  1UGI A;  5LC6 A;  3X3Z A;  1N5P A;  4RBN A;  4N6M A;  2Q07 A;  1I2G A;  1LNH A;  3HZP A;  2CFG A;  1E3R A;  2CC3 A;  1FUT A;  1BGS A;  2IY2 A;  1YIJ 3;  1BSD A;  1PFP A;  4BU4 A;  3K7C A;  3X3X A;  4ORL A;  3OW2 2;  1B2Z A;  5I97 A;  4KVH A;  3KFQ C;  4KFD A;  4R9K A;  1RGE A;  1VQ4 3;  3LTA A;  9RNT A;  1UUW B;  1WMN A;  2XGL A;  3EB8 A;  1B2U A;  3H3H A;  4HM4 B;  3F8X A;  4L8P A;  1KQS 2;  3FH1 A;  1E97 A;  1BRS A;  1TFO A;  1NB3 I;  2CFK A;  2YX9 A;  2I9W A;  3F40 A;  2WGQ A;  3JUQ A;  3AGN A;  5FW5 A;  1R4C A;  4BL2 A;  4HM0 B;  3D3L A;  2CIU A;  4GSP A;  1VQ8 3;  2C10 A;  2GEY A;  2Y74 A;  4JF8 A;  2A15 A;  3ECF A;  1JBR A;  1V58 A;  1I0V A;  1A2V A;  4L8O A;  1Q40 B;  1JB5 A;  1B2X A;  2LYX A;  4XBT A;  1YVS A;  4FCM A;  1OGZ A;  2RFR A;  5IW9 A;  3BND A;  3LH4 A;  3A5E A;  3GZX B;  1OUN A;  3NUV A;  2E2V A;  2HOH A;  2Z76 A;  1UW1 A;  1K73 4;  4XDW A;  1RN1 A;  4XM4 A;  2MF7 A;  3EBY A;  2QEX 3;  1GOY A;  3CCR 3;  3HIG A;  5CXO A;  1Z1S A;  2AAD A;  1A2K A;  1OF5 B;  1Y4K A;  3CD6 3;  2ZL8 A;  5IEP A;  3MG1 A;  3EJV A;  4N6O B;  4XBX A;  1LXE A;  2CWV A;  3F7X A;  1CH0 A;  3F8H A;  1M1X B;  1UCK A;  1NU3 A;  3K9M C;  5TGN A;  1CQS A;  1RN7 A;  2P05 A;  1PU4 A;  2P0M A;  2CHC A;  1YJ9 3;  4O2H A;  2Z7A A;  1BNF A;  6GSP A;  4I5Q A;  4LYL B;  1CEW I;  2W2C A;  4HZB B;  7GSP A;  4WYK B;  3FKA A;  1I3I A;  2F5W A;  1FGT A;  1YI2 3;  1MOL A;  1I0X A;  1W02 A;  3ALA A;  5JPP A;  1RHL A;  1IK3 A;  1DMN A;  4WFO A;  5FGO A;  2INX A;  4R1K A;  1ZS7 A;  2KF5 A;  1MWR A;  3CCU 3;  2OOV C;  3QRD A;  2ZA4 A;  2K54 A;  2KRT A;  2OCT A;  4WHA A;  3KN4 A;  1JZD A;  1DET A;  1SII A;  1I2F A;  3E99 A;  3DY5 A;  1C54 A;  2CKF B;  2MC8 A;  1G96 A;  1W6C A;  1UUV B;  1IVV A;  4HOH A;  3KZT A;  3S29 A;  3AMO B;  1EUI C;  1ULI B;  4AEQ A;  2YFI B;  4K90 B;  1YNV X;  1SAR A;  1UUG B;  2YFL B;  3B8L A;  3N54 B;  1HKX A;  1Q86 4;  3MPH A;  3MYT A;  4OVM A;  2XEP A;  2M7O A;  3CMA 3;  3DM8 A;  3DH2 A;  3NBR A;  1EQK A;  2J8X B;  2KXG A;  2XFS A;  8RNT A;  1N8R 4;  4BL3 A;  3ER7 A;  3D4A A;  1SJW A;  4MMZ B;  1MGW A;  1T2H A;  3LXU X;  2RSX A;  4K61 A;  2GU1 A;  1IVW A;  4HM7 B;  2F56 A;  1O7H B;  1E3V A;  2BNG A;  1FGQ A;  1NJI 4;  1W2Z A;  3NBB A;  3EHC A;  2XFT A;  1A90 A;  3FSD A;  4XB5 A;  1DMM A;  3JUM A;  3K63 A;  4KFE A;  3X41 A;  3CCJ 3;  5AEW B;  3A76 A;  5AIF A;  4XDV A;  5JBS A;  5IG5 A;  3V98 A;  1IQX A;  1RDS A;  1GMQ A;  1RMS A;  1BVI A;  2CG0 A;  3URP A;  2P09 A;  3DXO A;  3CC2 3;  1K8A 4;  1VQ9 3;  3S27 A;  3WA3 A;  2CFD A;  4EV5 A;  5DRV A;  1MWT A;  1RLS A;  4MEI A;  1ZGX A;  4Q53 A;  5AII A;  3O8Y A;  3AMO A;  3X3Y A;  1RJO A;  5M1A A;  3N9H A;  1Q82 4;  1EG9 B;  6RNT A;  3WA2 X;  1TRP A;  3KSE D;  3JUN A;  2SAR A;  4IT7 A;  4N3V A;  1TFK A;  4HM8 B;  1CYU A;  4LEH A;  1OGX A;  3CPO A;  2XF3 A;  2KF3 A;  2GBX B;  3DMC A;  1U8C B;  4LMI A;  3FGY A;  4R80 A;  3GAX A;  1O7G B;  2IUK A;  1MGR A;  1YIT 3;  3OWY A;  3CCS 3;  1LRA A;  1OAC A;  2XR8 B;  3EC9 A;  4LSO A;  1RGC A;  4HM1 B;  5HGR A;  3CCV 3;  3Q3F A;  3T8U A;  1JKG A;  2WOH A;  2YFJ B;  1RCL A;  1UI8 A;  4AKZ A;  1Q7Y 4;  2L4V A;  2R4I A;  2RBI A;  1LNI A;  2CWT A;  5CLK A;  1MNL A;  3EN1 B;  1WMO A;  1CYV A;  2H0I A;  2O3O A;  2W04 A;  1GOV A;  8CHO A;  1BOX A;  1C7H A;  1VQM 3;  1KC8 4;  2H0H A;  3OV4 A;  2KCD A;  1I70 A;  3D5I A;  3ROB A;  3UB1 A;  2BIR A;  3SX1 A;  4NRE A;  4MMX B;  1GS3 A;  1A67 A;  1B2S A;  4WYK A;  1RCK A;  2HMN B;  2Z6B A;  3EN8 A;  2F4Y A;  2W03 A;  2HMO B;  1AVL A;  2Z77 A;  5EVH A;  1IV7 A;  1ROV A;  2GSP A;  3D5G A;  1IT7 A;  2FNQ A;  2KF6 A;  1VQP 3;  2CFL A;  1QJG A;  1I8V A;  1RGF A;  1TJD A;  4O02 B;  1LVN A;  2CH9 A;  2BT3 A;  2F99 A;  4HZ9 B;  5AI1 A;  5G1L A;  3G4S 3;  5D82 A;  1W7C A;  2IMJ A;  3EQQ B;  1ZX2 A;  3PZW A;  2B1X B;  3NBJ A;  2RNT A;  4N6N B;  1QAL A;  5IG4 A;  1W01 A;  1A2P A;  1OPY A;  4HBR A;  1JBT A;  1BSC A;  3WOF B;  5IG0 A;  5CF1 A;  3T0U A;  1JJ2 2;  3HX8 A;  2E2T A;  2W0Q A;  5JPU A;  2QGU A;  2F5M A;  3AHW A;  5D83 A;  4HM2 B;  5GSP A;  4EBG A;  1YHQ 3;  2JDI H;  2O9U X;  3WHO A;  2W9P A;  3LZA A;  4MJD A;  1N8Q A;  4RNZ A;  5M19 A;  3CC4 3;  2QA4 3;  2ML5 A;  2BU4 A;  2ZHX B;  2RGQ A;  1BNG A;  2KAA A;  1YVB I;  1GSP A;  3MHE A;  1RGA A;  3BLZ A;  3S28 A;  1U5O A;  5ELU A;  2CG1 A;  1M1K 4;  2P0X A;  2E2U A;  1TIJ A;  2OWP A;  1BAO A;  2D1W A;  3PGB A;  3HOH A;  1AV4 A;  1VQK 3;  1BNR A;  3ZG0 A;  1STD A;  1W6Y A;  5D81 A;  3SED A;  3I55 3;  3NQZ A;  1YGE A;  3CCQ 3;  5G1K A;  2B24 B;  1BIR A;  2OOV A;  1RNB A;  3ZFZ A;  1W6G A;  1VQO 3;  2SBL A;  4FR9 A;  2XSH B;  1FW7 A;  1DYU A;  1NWW A;  2W9Q A;  1FGR A;  3NM7 A;  4O3V A;  3WOD G;  1TP6 A;  3JUP A;  1RGK A;  1D6Z A;  3IJE B;  3CXC 2;  2PNC A;  3LOY A;  3JVC A;  2FXT A;  1VQ5 3;  2H0G A;  2KF4 A;  1UCL A;  4LGQ A;  5IG3 A;  1ISK A;  3NM2 A;  1EEJ A;  3FG4 A;  1BAN A;  1RSN A;  1LOY A;  2K0M A;  1FZU A;  2UUG C;  3AGO A;  4EV2 A;  1JKG B;  1T2I A;  3GWR A;  1GMP A;  5IF6 A;  1HYF A;  3DGM A;  4J9A A;  1SQW A;  1JBS A;  3H51 A;  1AQZ A;  3HII A;  1QAF A;  1K28 A;  1SPU A;  2LQV A;  5BXQ A;  1BSA A;  3SXX A;  4FMB A;  4DKI A;  4WP5 A;  1Q7H A;  3DZL A;  3SLU A;  1LOX A;  3Q90 A;  2BHM A;  1RRH A;  1F8N A;  1OHO A;  4STD A;  1S72 3;  3SOA A;  3VF1 A;  3DUK A;  3OWS A;  2HML B;  3X40 A;  1GY7 A;  3OWU A;  2F86 B;  3NX0 A;  5IER A;  3MSO A;  3AHS A;  4BTY A;  1X1W A;  4R9L A;  3GRD A;  1S5A A;  3CPW 2;  1MWU A;  1I2E A;  5AYS C;  2HMJ B;  2XH9 A;  3V92 A;  1BSE A;  4HAA A;  3D9R A;  1RGH A;  3GSP A;  4ILF A;  3BIR A;  3BNB A;  3X42 A;  3GZY B;  2OTJ 3;  2Y73 A;  1WQL B;  5AIG A;  4HM3 B;  2CK3 H;  5BIR A;  1B27 A;  1GD4 A;  4JRF A;  3UJM A;  1K9M 4;  1BRK A;  1HZ1 A;  1WTH A;  1GMR A;  1OCV A;  1B20 A;  3IPT A;  3WOE B;  1BNE A;  2K3D A;  2HMK B;  1ULJ B;  1UDI I;  1L5G B;  1ASK A;  4GB5 A;  3MWZ A;  1Q81 4;  3OXA A;  1VQQ A;  1YJN 3;  1V57 A;  2PZV A;  3VGN A;  3DGO A;  3WR2 A;  3CU3 A;  1RNT A;  1N9E A;  4X2H A;  3UL5 A;  2UGI A;  3PS8 A;  4FMA A;  4KFF A;  4L7K A;  1FGM A;  1LQG C;  4EC6 A;  5G2G A;  1NO3 A;  4FCZ A;  3JUO A;  3SOY A;  2GXF A;  4K1V A;  3RNT A;  3J7Y d;  1NDO B;  1WMP A;  3LTD A;  1RTU A;  1AR0 A;  1QAK A;  3G8Z A;  1GYB A;  1N5H A;  1N9J A;  1LOV A;  3FG1 A;  6STD A;  1B21 A;  1LOW A;  1X1U A;  1BSB A;  2W56 B;  3EX9 A;  3LML A;  1BRG A;  1T3B A;  1VZZ A;  1HU9 A;  3KCH A;  3GZR A;  2CFW A;  2F98 A;  4NHF A;  3PXM A;  1G02 A;  1SIH A;  4KT3 B;  2V1L A;  1TU5 A;  1BNS A;  3BU4 A;  2GU3 A;  4N6U A;  2JQ5 A;  5CK6 A;  3MKI A;  3G71 3;  1FUS A;  3Q1C A;  1KSI A;  1BNJ A;  3OX9 A;  2BMO B;  2GBW B;  3GZB A;  3F7S A;  4RNY A;  1D6Y A;  4BIR A;  5RNT A;  4I4K A;  2STD A;  2ZDJ A;  3UNL A;  3FLJ A;  1VQ7 3;  4XBY A;  2WO0 A;  1WNH A;  2CX1 A;  1O7W B;  1BUJ A;  3NV0 B;  5CF2 A;  1MWS A;  4MMY B;  3WMD A;  1Q40 A;  5BVB A;  4KZ1 A;  5KP3 A;  4GL6 A;  3KII A;  3FF0 A;  2W56 A;  1EKM A;  5AIH A;  5EEO A;  4R4K A;  1O7M B;  1UI7 A;  3U97 A;  3CCE 3;  1AVK A;  7STD A;  3NXJ A;  1QVF 2;  4TX4 A;  2WGO A;  3BNC A;  1GOU A;  3FF2 A;  1BU4 A;  3CCL 3;  4PEJ A;  2W6J H;  3V99 A;  3HI7 A;  4X2O A;  3PCS A;  2OQE C;  4HYZ A;  3N8B A;  4FMC A;  4NPB A;  5AYR B;  1TUH A;  2BMR B;  1BRN L;  1DVD A;  2HMM B;  3CC7 3;  1JN5 B;  1PY3 A;  1QMA A;  1TTO A;  4HM5 B;  5STD A;  1I3F A;  1EA2 A;  3WDG B;  3B7C A;  4RNT A;  4LZI A;  1BRJ A;  1IU7 A;  3BB9 A;  1UGH I;  4U13 A;  1LQM B;  4J5K A;  2AAE A;  2ML6 A;  3DGN A;  3KSP A;  3CCM 3;  5IEN A;  2BO9 B;  1OH0 A;  1JRQ A;  3HK4 A;  3EE1 A;  4H61 A;  1RGG A; 
#chains in the Genus database with same CATH homology
 4EYC A;  3G0K A;  1IT8 A;  1K41 A;  5KP4 A;  3B4P A;  1D6U A;  4CCV A;  3RDE A;  5AEU B;  5LC7 A;  4HJL B;  4IIA A;  1JB2 A;  2BMQ B;  2WOF A;  3IMA B;  3K5T A;  3RGA A;  3Q2P A;  5A0O B;  2OTL 3;  4WWU C;  1ZO2 A;  3K0Z A;  2RCD A;  3G6E 3;  3T8N A;  2D42 A;  3KE7 A;  1V74 A;  5ELJ A;  1FGO A;  2CW9 A;  3S67 A;  4J8T A;  4HKV B;  1M90 4;  1IV9 A;  1FA3 A;  1OF5 A;  3L0R A;  4ZM8 A;  3F9S A;  2IA7 A;  3FCS B;  3CNX A;  4O8S A;  1RKY A;  1QVG 2;  4HM6 B;  4AKY A;  3LT8 A;  1JN5 A;  2XSO B;  3I56 3;  3B4O A;  3VSY A;  3NQY A;  1T5Y A;  1VQ6 3;  1OHS A;  1OHP A;  3LT9 A;  3NV0 A;  3UL6 A;  3SVA A;  1FUW A;  5EQL A;  3FZW A;  3U1W A;  4H3U A;  1VQL 3;  5DRE A;  3CNM A;  1W5Z A;  3BNE A;  3M8C A;  3EF8 A;  1IVU A;  2OQE A;  1ROA A;  1W2B 2;  1DVC A;  1RRL A;  1KWI A;  4RZM A;  1JNQ A;  2IUJ A;  2CWU A;  3S5C A;  1GY5 A;  3G16 A;  1O7N B;  1O7P B;  1IDP A;  2FGT A;  1BUQ A;  1GY6 A;  1NB5 I;  1JV2 B;  4FCJ A;  2C11 A;  3MG3 A;  4N6L A;  4IPB A;  4FMD A;  3LTC A;  1YJW 3;  4HVN A;  3F14 A;  1KD1 4;  1Q42 A;  1IQ8 A;  1JB4 A;  4N6V 0;  3EBT A;  1US1 A;  3KKG A;  3PCR A;  4G1M B;  4N6T A;  3RGR A;  4CDL A;  3STD A;  2XRX B;  4BTX A;  1DMQ A;  2P38 A;  2UX0 A;  4K1U A;  4BTW A;  5IEO A;  3TDG A;  4QWT A;  2GEX A;  5KP1 A;  1J2B A;  1GD3 A;  1W00 A;  3LTB A;  1IQY A;  2XGN A;  1W4N A;  1VQN 3;  1IVX A;  4OUQ A;  3MG2 A;  3DGL A;  2QIY A;  4EXR A;  3LYG A;  3NHX A;  3I0Y A;  1M9G A;  3FG3 A;  3QK9 A;  4OK0 A;  3PYJ A;  1STF I;  5LC6 A;  3X3Z A;  1N5P A;  4RBN A;  4N6M A;  2Q07 A;  3HZP A;  1LNH A;  2CFG A;  1E3R A;  2CC3 A;  1YIJ 3;  1PFP A;  3K7C A;  3X3X A;  4ORL A;  3OW2 2;  5I97 A;  4KVH A;  3KFQ C;  4KFD A;  4R9K A;  1VQ4 3;  3LTA A;  1UUW B;  1WMN A;  2XGL A;  3EB8 A;  3H3H A;  4HM4 B;  1KQS 2;  3F8X A;  4L8P A;  3FH1 A;  1E97 A;  1TFO A;  1NB3 I;  2CFK A;  2YX9 A;  2I9W A;  3F40 A;  2WGQ A;  3JUQ A;  5FW5 A;  3SXX A;  1R4C A;  4HM0 B;  3D3L A;  2CIU A;  1VQ8 3;  2C10 A;  2GEY A;  2Y74 A;  4JF8 A;  2A15 A;  3ECF A;  1A2V A;  4L8O A;  1Q40 B;  1JB5 A;  2LYX A;  4XBT A;  4FCM A;  1OGZ A;  2RFR A;  5IW9 A;  3BND A;  3LH4 A;  3GZX B;  1OUN A;  3NUV A;  2E2V A;  2Z76 A;  1UW1 A;  1K73 4;  4XDW A;  4XM4 A;  2QEX 3;  2MF7 A;  3EBY A;  3CCR 3;  3HIG A;  5CXO A;  1Z1S A;  1A2K A;  1OF5 B;  1Y4K A;  3CD6 3;  2ZL8 A;  5IEP A;  3MG1 A;  3EJV A;  4N6O B;  4XBX A;  1LXE A;  2CWV A;  3F7X A;  3F8H A;  3K9M C;  1M1X B;  3CME 3;  1NU3 A;  5TGN A;  1PU4 A;  1CQS A;  1RN7 A;  2P05 A;  2P0M A;  2CHC A;  1YJ9 3;  4O2H A;  2Z7A A;  1CEW I;  2W2C A;  4HZB B;  4WYK B;  3FKA A;  1FGT A;  1YI2 3;  1MOL A;  1W02 A;  3ALA A;  5JPP A;  1IK3 A;  1DMN A;  4WFO A;  5FGO A;  2INX A;  4R1K A;  3CCU 3;  2OOV C;  3QRD A;  2K54 A;  2KRT A;  2OCT A;  4WHA A;  3KN4 A;  1SII A;  3DY5 A;  3E99 A;  2CKF B;  2MC8 A;  1G96 A;  1W6C A;  1UUV B;  1IVV A;  3KZT A;  3S29 A;  3AMO B;  1ULI B;  4AEQ A;  2YFI B;  4K90 B;  2YFL B;  3B8L A;  3N54 B;  1HKX A;  1Q86 4;  3MPH A;  3MYT A;  4OVM A;  2XEP A;  2M7O A;  3CMA 3;  3DM8 A;  3NBR A;  1EQK A;  2KXG A;  2XFS A;  1N8R 4;  3ER7 A;  1SJW A;  4MMZ B;  3LXU X;  2RSX A;  4K61 A;  2GU1 A;  1IVW A;  4HM7 B;  1O7H B;  1E3V A;  2BNG A;  1FGQ A;  1NJI 4;  1W2Z A;  3NBB A;  3EHC A;  2XFT A;  1A90 A;  3FSD A;  4XB5 A;  1DMM A;  3JUM A;  3K63 A;  4KFE A;  3X41 A;  3CCJ 3;  5AEW B;  3A76 A;  5AIF A;  4XDV A;  5JBS A;  5IG5 A;  3V98 A;  1IQX A;  2CG0 A;  2P09 A;  3DXO A;  3CC2 3;  1K8A 4;  1VQ9 3;  3S27 A;  3WA3 A;  2CFD A;  4EV5 A;  5DRV A;  4MEI A;  4Q53 A;  5AII A;  3O8Y A;  3AMO A;  3X3Y A;  1RJO A;  3N9H A;  1Q82 4;  1EG9 B;  3WA2 X;  3KSE D;  3JUN A;  4IT7 A;  4N3V A;  1TFK A;  4HM8 B;  1CYU A;  4LEH A;  1OGX A;  3CPO A;  2XF3 A;  2GBX B;  3DMC A;  1U8C B;  4LMI A;  3FGY A;  4R80 A;  3GAX A;  1O7G B;  2IUK A;  1YIT 3;  3OWY A;  3CCS 3;  3EC9 A;  1OAC A;  2XR8 B;  4LSO A;  3CCV 3;  5HGR A;  4HM1 B;  3T8U A;  1JKG A;  2WOH A;  2YFJ B;  1UI8 A;  1Q7Y 4;  4AKZ A;  2L4V A;  2R4I A;  2CWT A;  5CLK A;  1MNL A;  3EN1 B;  1WMO A;  1CYV A;  2O3O A;  2W04 A;  8CHO A;  1C7H A;  1VQM 3;  1KC8 4;  3OV4 A;  2KCD A;  3ROB A;  3UB1 A;  3SX1 A;  4NRE A;  4MMX B;  1GS3 A;  1A67 A;  4WYK A;  2HMN B;  2Z6B A;  3EN8 A;  2W03 A;  2HMO B;  1AVL A;  2Z77 A;  5EVH A;  1IV7 A;  1ROV A;  1IT7 A;  2FNQ A;  1VQP 3;  2CFL A;  1QJG A;  4O02 B;  7STD A;  1QVF 2;  1LVN A;  2BT3 A;  2CH9 A;  2F99 A;  4HZ9 B;  5AI1 A;  3G4S 3;  5D82 A;  1W7C A;  2IMJ A;  3EQQ B;  1ZX2 A;  3PZW A;  2B1X B;  3NBJ A;  4N6N B;  1QAL A;  5IG4 A;  1W01 A;  1OPY A;  4HBR A;  3WOF B;  5IG0 A;  5CF1 A;  3T0U A;  1JJ2 2;  3HX8 A;  2E2T A;  2W0Q A;  5JPU A;  2QGU A;  5D83 A;  4HM2 B;  4EBG A;  1YHQ 3;  2JDI H;  2O9U X;  2W9P A;  3LZA A;  4MJD A;  1N8Q A;  4RNZ A;  3CC4 3;  2QA4 3;  2ML5 A;  2RGQ A;  1YVB I;  3MHE A;  3BLZ A;  3S28 A;  1U5O A;  5ELU A;  2CG1 A;  1M1K 4;  2P0X A;  2E2U A;  1TIJ A;  2OWP A;  2D1W A;  3PGB A;  1AV4 A;  1VQK 3;  1STD A;  1W6Y A;  5D81 A;  3SED A;  3I55 3;  3NQZ A;  1YGE A;  3CCQ 3;  2B24 B;  2OOV A;  1W6G A;  1VQO 3;  2SBL A;  4FR9 A;  2XSH B;  1DYU A;  1NWW A;  2W9Q A;  1FGR A;  3NM7 A;  4O3V A;  3WOD G;  1TP6 A;  3JUP A;  1D6Z A;  3IJE B;  3CXC 2;  2PNC A;  3LOY A;  3JVC A;  2FXT A;  1VQ5 3;  5IG3 A;  4LGQ A;  1ISK A;  3NM2 A;  3FG4 A;  2K0M A;  4EV2 A;  1JKG B;  3GWR A;  5IF6 A;  3DGM A;  4J9A A;  1SQW A;  3H51 A;  3HII A;  1QAF A;  1K28 A;  1SPU A;  2LQV A;  5BXQ A;  4FMB A;  4WP5 A;  3SLU A;  3DZL A;  1LOX A;  3Q90 A;  2BHM A;  1RRH A;  1F8N A;  1OHO A;  4STD A;  1S72 3;  3SOA A;  3VF1 A;  3DUK A;  3OWS A;  2HML B;  3X40 A;  1GY7 A;  3OWU A;  2F86 B;  3NX0 A;  5IER A;  3MSO A;  4BTY A;  4R9L A;  3GRD A;  1S5A A;  3CPW 2;  5AYS C;  3V92 A;  2HMJ B;  2XH9 A;  3D9R A;  3BNB A;  3X42 A;  3GZY B;  2OTJ 3;  2Y73 A;  1WQL B;  5AIG A;  4HM3 B;  2CK3 H;  1GD4 A;  4JRF A;  3UJM A;  1K9M 4;  1WTH A;  3WOE B;  1OCV A;  3IPT A;  2HMK B;  1ULJ B;  1L5G B;  1ASK A;  4GB5 A;  3MWZ A;  1Q81 4;  3OXA A;  1YJN 3;  2PZV A;  3VGN A;  3DGO A;  3CU3 A;  4X2H A;  1N9E A;  3UL5 A;  3PS8 A;  4FMA A;  4KFF A;  4L7K A;  1FGM A;  4EC6 A;  5G2G A;  1NO3 A;  4FCZ A;  3JUO A;  3SOY A;  2GXF A;  4K1V A;  3J7Y d;  1NDO B;  1WMP A;  3LTD A;  1AR0 A;  1QAK A;  3G8Z A;  1GYB A;  1N5H A;  1N9J A;  3FG1 A;  6STD A;  3LML A;  2W56 B;  3EX9 A;  1VZZ A;  1HU9 A;  3GZR A;  2CFW A;  2F98 A;  4NHF A;  3PXM A;  1SIH A;  2V1L A;  1TU5 A;  2GU3 A;  4N6U A;  2JQ5 A;  5CK6 A;  3MKI A;  3G71 3;  3Q1C A;  1KSI A;  3OX9 A;  2BMO B;  2GBW B;  3GZB A;  3F7S A;  4RNY A;  1D6Y A;  4I4K A;  2STD A;  2ZDJ A;  3UNL A;  3FLJ A;  1VQ7 3;  4XBY A;  2WO0 A;  1WNH A;  1O7W B;  3NV0 B;  5CF2 A;  3WMD A;  4MMY B;  1Q40 A;  5BVB A;  4KZ1 A;  5KP3 A;  4GL6 A;  3KII A;  3FF0 A;  2W56 A;  1EKM A;  5AIH A;  5EEO A;  4R4K A;  1O7M B;  1UI7 A;  3U97 A;  3CCE 3;  1AVK A;  3NXJ A;  4TX4 A;  2WGO A;  3BNC A;  3FF2 A;  3CCL 3;  4PEJ A;  2W6J H;  3V99 A;  3HI7 A;  4X2O A;  3PCS A;  2OQE C;  4HYZ A;  3N8B A;  4FMC A;  5AYR B;  1TUH A;  2BMR B;  1DVD A;  2HMM B;  3CC7 3;  1JN5 B;  1QMA A;  4HM5 B;  5STD A;  3WDG B;  1EA2 A;  3B7C A;  4LZI A;  3BB9 A;  1IU7 A;  4U13 A;  2ML6 A;  3DGN A;  3KSP A;  3CCM 3;  5IEN A;  2BO9 B;  1OH0 A;  1JRQ A;  3HK4 A;  3EE1 A;  4H61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...