3A76A

The crystal structure of lina
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
147
structure length
147
Chain Sequence
MSDLDRLASRAAIQDLYSDKLIAVDKRQEGRLASIWWDDAEWTIEGIGTYKGPEGALDLANNVLWPMFHECIHYGTNLRLEFVSADKVNGIGDVLLLGNLVEGNQSILIAAVFTDEYERRDGVWKFSKRNACTNYFTPLAGIHFAPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Gamma-hexachlorocyclohexane dehydrochlorinase
publication title Crystal structure of g-hexachlorocyclohexane dehydrochlorinase LinA from Sphingobium japonicum UT26
pubmed doi rcsb
source organism Sphingomonas paucimobilis
total genus 43
structure length 147
sequence length 147
chains with identical sequence B, C
ec nomenclature ec 4.5.1.-:
pdb deposition date 2009-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13577 SnoaL_4 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3a76A01
1O7NB 2RGQA 1IDPA 3EN1B 2W2CA 1E3VA 2QIYA 3DUKA 3FLJA 1A2KA 1TUHA 1SJWA 3DM8A 3DXOA 2IMJA 1W01A 1AR0A 2GBXB 4RZMA 2HMMB 5D83A 5AEUB 1OUNA 3NV0A 2YFJB 1VZZA 2GEYA 3KKGA 1W00A 3F7SA 1O7GB 3MSOA 3BB9A 3STDA 3G8ZA 5AIHA 1HKXA 1OH0A 3RGRA 5IF6A 5AEWB 2BMRB 3EN8A 2Z77A 3H3HA 5BXQA 4HVNA 5KP3A 3B4PA 4GB5A 2GBWB 3FF0A 2PZVA 3EJVA 4XB5A 4XBTA 1C7HA 3UJMA 3MYTA 5IG4A 2GEXA 1BUQA 4WYKA 3MG1A 1O7HB 1O7MB 3GZYB 5G2GA 4PEJA 3ROBA 3VGNA 8CHOA 3EF8A 3B7CA 1Z1SA 4R9KA 3VSYA 3JUMA 1QMAA 4HM5B 4FCJA 3NHXA 2BNGA 4U13A 5STDA 2I9WA 5CF2A 1W6YA 4L8OA 4HM8B 2INXA 3OV4A 4XDWA 3G16A 4WYKB 3B4OA 4R9LA 2HMOB 3M8CA 3JUOA 1S5AA 1OGZA 3JUPA 2YFLB 3HZPA 4J8TA 3HX8A 3EX9A 4K1VA 5EVHA 3H51A 1ISKA 5AI1A 3DMCA 4HZ9B 3Q90A 5BVBA 2CHCA 1JB4A 1ASKA 4L7KA 5KP1A 4HM2B 3RGAA 3G0KA 4HM0B 3MKIA 4LGQA 4OVMA 3ECFA 1JB5A 4XBXA 3GWRA 3FH1A 4HJLB 3F8HA 5IG0A 5AIFA 3ER7A 2RFRA 2RCDA 1ULIB 2GXFA 5IENA 1JN5A 4Q53A 1WQLB 1Q40A 3GZXB 4L8PA 1EG9B 1GS3A 1NDOB 2Z7AA 3LYGA 3F40A 3F9SA 5DRVA 4ORLA 4K1UA 1GYBA 2YFIB 3NV0B 3DZLA 3EBYA 4LEHA 4MJDA 3F8XA 1ZO2A 3K0ZA 1UUWB 5CF1A 5DREA 1Q40B 1NWWA 3JUNA 5CLKA 3FF2A 2XSOB 6STDA 3OXAA 1GY5A 1W02A 2CKFB 3FSDA 2XRXB 5D81A 3SOYA 3F7XA 3FGYA 1OCVA 5JPUA 5IERA 5IG5A 3EC9A 3KE7A 3GRDA 3FKAA 1ZX2A 4J9AA 3I0YA 5IEPA 2F99A 1U5OA 2HMJB 4XM4A 3NM2A 1TP6A 2A15A 1O7PB 4I4KA 3CNMA 1DMNA 3HK4A 2OWPA 1Q42A 1GY6A 5KP4A 3EQQB 5CK6A 3K7CA 3MG3A 4HM1B 4HZBB 3A76A 2HMLB 3NBRA 3E99A 3OWYA 1E97A 3IPTA 2Z76A 4X2OA 1ULJB 4FCMA 4KVHA 4N3VA 3GZRA 5FW5A 2HMNB 3JUQA 1K41A 3F14A 3MHEA 3BLZA 3CU3A 3B8LA 4X2HA 3CNXA 1DMQA 2XR8B 4IIAA 3OWUA 1OPYA 4HM4B 1E3RA 3GZBA 4CDLA 2BMQB 1DMMA 4WP5A 1CQSA 1OHOA 5D82A 4H3UA 7STDA 2B1XB 3LZAA 3T8UA 3SEDA 4HM6B 3D9RA 1JN5B 5IG3A 1OF5A 4HM3B 2BMOB 4HM7B 1O7WB 1EA2A 2R4IA 1UUVB 5IEOA 3NUVA 3SOAA 2HMKB 1QJGA 1OGXA 4XBYA 3UNLA 3FZWA 1NU3A 3WMDA 2QGUA 3MG2A 1JKGA 1OHPA 5HGRA 2K54A 2UX0A 3EHCA 4HKVB 3OX9A 3NXJA 3S5CA 3EBTA 2B24B 1OF5B 2JQ5A 1GY7A 5CXOA 5AIGA 1JB2A 2F98A 5AIIA 4R1KA 3T8NA 3OWSA 5JPPA 4OUQA 1STDA 3KSPA 2F86B 4LMIA 4WWUC 3KZTA 5TGNA 1OHSA 1JKGB 4XDVA 4STDA 2XSHB 2STDA 3CPOA
chains in the Genus database with same CATH superfamily
1FGOA 1CYVA 3DGYA 1MWTA 1O7NB 3LTDA 2RGQA 4FMDA 1IDPA 1YI23 3EN1B 2CFKA 3FCSB 1L5GB 3LTBA 1ROAA 2KF6A 1B2XA 1E3VA 2W2CA 1W7CA 3NM7A 5IW9A 2QIYA 1N5PA 3CCV3 1FUTA 2IUJA 1EUIC 4R80A 1RGEA 1UCIA 1BNRA 3DUKA 5AYSC 3FLJA 2R41A 1A2KA 2PNCA 1VQN3 1TUHA 3AGOA 1SJWA 3DM8A 1STFI 3DXOA 1FZUA 1W01A 2IMJA 3HIIA 1AR0A 2H0HA 2SBLA 1OACA 2GBXB 4RZMA 2HMMB 5D83A 5FGOA 1FGTA 4LZIA 2ZA4A 3CD63 2KAAA 1W6GA 2CG1A 5M1AA 5AEUB 4N6TA 4FCZA 1V57A 4BL2A 1IU7A 1OUNA 3PZWA 1NJI4 2KXGA 1VQ83 1BRSA 3FG3A 3NV0A 3NBJA 2YFJB 1VZZA 3DGMA 2GEYA 2CWVA 1FUWA 2C10A 3KKGA 1W00A 1GMRA 1ZS7A 3F7SA 3S67A 5M19A 2QEX3 1UUGB 1B20A 1N8R4 1TTOA 1O7GB 4FMCA 4BU4A 3MSOA 2OTJ3 2CK3H 2GU3A 1D6ZA 2W0QA 3BB9A 3STDA 2ML6A 3G8ZA 2W03A 4N6UA 5AIHA 5BIRA 1IVXA 3CXC2 1A2VA 1HKXA 5ELUA 1OH0A 3RGRA 5IF6A 3N54B 3O8YA 2BMRB 5AEWB 2ZL8A 5HOHA 3EN8A 3Q2PA 3CCS3 2Z77A 4CCVA 1LQGC 3WA3A 1DVDA 1SIIA 3H3HA 1I2GA 2CW9A 2ZHXB 1W4NA 3WOEB 1IQYA 5BXQA 2V1LA 1RMSA 2XF3A 3S27A 1RKYA 4JF8A 4HVNA 5KP3A 3B4PA 4GB5A 1VQM3 2GBWB 3BU4A 3S29A 4AKZA 3CC73 1TRPA 2SARA 3FF0A 1IVUA 1I0XA 1RJOA 2PZVA 3EJVA 4XB5A 3RDEA 2L1SA 4XBTA 2CWTA 1C7HA 3UJMA 3Q3FA 4DKIA 3EE1A 1UI8A 2F4YA 3MYTA 3PGBA 4EC6A 2CX0A 5IG4A 1RTUA 2IUKA 2GEXA 1BUQA 4NPBA 4WYKA 4AEQA 4KT3B 3MG1A 1GMPA 3MWZA 1O7HB 3LMLA 1IT8A 1O7MB 3GZYB 5G2GA 3GSPA 1YHQ3 1FGMA 3X40A 4BTWA 4PEJA 3ROBA 1IVVA 1VQQA 3VGNA 4AKYA 3KSED 8CHOA 3EF8A 1AVKA 1BRNL 3B7CA 1UI7A 2P0MA 1NNVA 1Z1SA 1N9JA 1X1UA 4R9KA 5EQLA 3VSYA 5BU4A 3RNTA 4ILFA 1JV2B 3G713 2C4BA 2IYJA 3JUMA 1QMAA 4HM5B 4FCJA 1RGKA 3K9MC 3NHXA 4FR9A 3BNBA 2BNGA 1UCKA 4EXRA 3SXXA 1MNLA 2D1WA 4EV2A 3ALAA 4U13A 1M904 1K9M4 5STDA 2I9WA 4RBNA 5CF2A 1I2EA 2E2VA 4GHOA 4OK0A 1BSAA 1Y4KA 1W6YA 5G1KA 3I563 1BVIA 1LOWA 4L8OA 1UCLA 1AVLA 4H61A 2IY2A 2FNQA 1W2B2 4HM8B 2INXA 3OV4A 4XDWA 3IJEB 3G16A 1UGHI 1N8QA 4WYKB 1BGSA 3B4OA 4R9LA 2HMOB 3M8CA 3JUOA 1S5AA 1OGZA 2AAEA 3JUPA 3KCHA 1BOXA 1WMNA 3K63A 2XGLA 2YFLB 3HZPA 1T5YA 4J8TA 2BIRA 4KFEA 7RNTA 3HX8A 1BNGA 3EX9A 4J5KA 3LH4A 4K1VA 4EW5A 5EVHA 1TRQA 1PYLA 5LC7A 1B2MA 3H51A 3UB1A 1YJ93 1ISKA 2JDIH 1W6CA 3I553 5AI1A 1D6YA 2O9UX 3DMCA 4HZ9B 5AYRB 1WTHA 3AGNA 3KFQC 3Q90A 5BVBA 3LTCA 2CHCA 1JB4A 2J8XB 1ASKA 1ROVA 1BRJA 2GU1A 2CFWA 1BNEA 4L7KA 1KQS2 1I2FA 5KP1A 2E2UA 1PY3A 2W9PA 4IT7A 3DH2A 4HM2B 3RGAA 1GSPA 1F8NA 3WODG 3G0KA 4HM0B 2LQVA 3MKIA 1BSBA 4LGQA 3ECFA 1JB5A 4K61A 4OVMA 1BU4A 4XBXA 5G1LA 1YVBI 3G6E3 3LOYA 1MGRA 1R4YA 1GD3A 2LYXA 2UGIA 3FH1A 2W04A 3GWRA 3S28A 4HJLB 3F8HA 2KCDA 5IG0A 2RSXA 6GSPA 1EQKA 1V58A 1D6UA 1IQXA 1I3FA 1BAOA 2KF5A 3D3LA 5AIFA 1YJW3 1JZOA 3ER7A 2CH9A 1LOYA 5GSPA 2BO9B 3ZG0A 3X3YA 1Q9EA 2RFRA 1GD4A 1QAFA 2RCDA 1RDSA 1JNQA 2XFTA 4KZ1A 1B27A 1KD14 1LOVA 1QALA 1KC84 1ULIB 2OOVC 4HOHA 1YIJ3 1BNFA 1US1A 2GXFA 2W9QA 2P09A 1RGFA 5IENA 3SYUA 3CCE3 3D79A 1RGAA 1JN5A 1K28A 1RSNA 1VQ93 1PU4A 1Q864 1NO3A 2OCTA 4Q53A 4FMBA 3PXMA 1W2ZA 1RGHA 1WQLB 1JJ22 1Q40A 3GZXB 1CYUA 4L8PA 2BT3A 3CMA3 1FA3A 1EG9B 1QAKA 1M1K4 1C54A 2W56A 1UCJA 3GAXA 3BNDA 3D4AA 4BL3A 1GS3A 1TIJA 1JBSA 2CFGA 1NDOB 4IPBA 2Z7AA 1UDII 3LYGA 1RNTA 1FUSA 3F40A 4O3VA 2CFDA 1G96A 3PS8A 3F9SA 4O8SA 5ELJA 3CC23 5DRVA 2XGNA 4KFFA 2H0GA 4ORLA 4K1UA 1GYBA 1Q814 1LNIA 2IA7A 1IQ8A 2YFIB 1RN1A 3NV0B 4NHFA 3DZLA 4BIRA 5A0OB 1VQL3 1RRLA 1PFPA 1AQZA 2YX9A 1WMPA 1BNIA 3EBYA 4EV5A 4LEHA 2RBIA 4MJDA 2OQEC 3F8XA 4WFOA 3CCR3 1ZO2A 4RNZA 2M7OA 2OTL3 1RHLA 3K0ZA 2L4VA 1UUWB 5CF1A 5DREA 3CCQ3 1DVCA 1FGRA 1GOYA 1Q40B 1NWWA 3JUNA 2ML5A 5CLKA 5EEOA 3FF2A 2XSOB 1BIRA 3OXAA 1GY5A 1CH0A 3IMAB 3Q1CA 6STDA 4HBRA 1BNJA 2W56B 1W02A 1RN4A 1S723 2CKFB 3FSDA 2XRXB 1A2PA 3CCJ3 5D81A 1G0TA 1MGWA 3SOYA 3DGOA 3EB8A 3F7XA 3FGYA 1IT7A 4LYLB 1OCVA 5JPUA 2BHMA 4FMAA 2Q07A 5IERA 1HZ1A 2FGTA 3EC9A 5IG5A 3KE7A 1BRIA 3T0UA 3GRDA 3FKAA 3V98A 1ZX2A 4J9AA 3ZFZA 3NX0A 1M9GA 4O2HA 3I0YA 5IEPA 1Q7Y4 1VQ63 3FG4A 1B3SA 3JVCA 1MWUA 1U5OA 2F99A 1GMQA 2HMJB 4XM4A 3WDGB 1Q824 3NM2A 3URPA 2BU4A 1BSDA 1RGLA 2CX1A 1RCKA 3X3XA 1TP6A 1YNVX 2A15A 1G02A 1K8A4 2MC8A 3MPHA 1O7PB 2XFSA 4TX4A 4I4KA 2AADA 1QVG2 3LTAA 2CWUA 5M18A 3CNMA 1DMNA 3HK4A 2OWPA 4G1MB 1Q42A 1QVF2 1JBTA 1GY6A 3UL6A 3N8BA 1JZDA 3PCSA 5KP4A 1A67A 1RGGA 3EQQB 1X1YA 5CK6A 3X41A 3K7CA 3MG3A 1RN7A 3LT9A 2P05A 4HM1B 4HZBB 4HAAA 3A76A 2OQEA 4ZM8A 2HMLB 3NBRA 1AV4A 1WNHA 2Y74A 1ZGXA 1AY7A 3E99A 1E97A 3OWYA 4CPKA 3IPTA 1I70A 2Z76A 2F56A 1W5ZA 4X2OA 2HOHA 3CC43 1ULJB 1FYSA 4I5QA 3CPW2 3CCM3 1T2HA 4GL6A 4FCMA 1SQWA 3NQYA 4KVHA 4N3VA 3WR2A 3GZRA 5FW5A 4EYCA 2HMNB 3JUQA 3ZG5A 5RNTA 3LT8A 1K41A 3BNEA 1DYUA 3F14A 4KFDA 3WA2X 1VQ53 1VQK3 1N5HA 3MHEA 1IV7A 3BLZA 3BNCA 6RNTA 3CU3A 5LC6A 4RNYA 3QK9A 3AHWA 3B8LA 4X2HA 1YJN3 3SLUA 1U8CB 4GSPA 1RLSA 3K5TA 3CNXA 1LVNA 1DMQA 3WHOA 1RRHA 1BUJA 1KSIA 2XR8B 4IIAA 1JRQA 9RNTA 2KF4A 3OWUA 2RNTA 3NBBA 1LRAA 1LOXA 2WOFA 1BRGA 1N9EA 1B2SA 1OPYA 4HM4B 1SIHA 3AMOA 5JBSA 1RGCA 1SARA 3CCU3 1E3RA 3GZBA 3L0RA 4JRFA 3AHSA 3U97A 3V99A 4CDLA 2BMQB 2E2TA 1DMMA 3KIIA 4WP5A 1CQSA 5I97A 1VQO3 1OHOA 2CG0A 1BNSA 5D82A 4H3UA 3OW22 2CIUA 7STDA 2B1XB 3LZAA 3KN4A 3T8UA 3SEDA 1X1XA 1YGWA 3FG1A 4HM6B 4BTYA 1KWIA 1RCLA 3D9RA 1YGEA 3LXUX 1B2ZA 2WOHA 1GOUA 7GSPA 1UGIA 1TJDA 2WGOA 4QWTA 1EEJA 1JBRA 1YVSA 1JN5B 1X1WA 5IG3A 1DE3A 1IYYA 1TFKA 1BSEA 3HOHA 1RNBA 1OF5A 1VQP3 1NB5I 4HM3B 2BMOB 1IK3A 1SPUA 2GSPA 2H0IA 4HM7B 4CJNA 1A90A 1O7WB 4LSOA 1I0VA 3D5IA 4N6V0 1UW1A 4N6OB 1YIT3 1EA2A 2R4IA 1UUVB 3AMOB 5IEOA 1BSCA 1MOLA 3V92A 4N6NB 3NUVA 4MMZB 3SOAA 1IVWA 3SVAA 4J5GA 2K3DA 2F5MA 2UUGC 4MMYB 1K734 2HMKB 1QJGA 1OGXA 4K90B 1GOVA 3DGNA 1FGQA 4XBYA 3UNLA 3X42A 1I3IA 2KRTA 4EBGA 1B21A 1HYFA 2OOVA 2O3OA 1TU5A 2QA43 2WO0A 3FZWA 1V74A 1EKMA 1BANA 1NU3A 3WMDA 1I8VA 2QGUA 3N9HA 1MWRA 1T2IA 1B2UA 3MG2A 1JKGA 3UL5A 8RNTA 1MWSA 1OHPA 5HGRA 2Z6BA 2K54A 2UX0A 1M1XB 3EHCA 4HKVB 3U1WA 3D5GA 1J2BA 3OX9A 2K0MA 3NXJA 3EBTA 3DY5A 3S5CA 1LQMB 2KF3A 1LNHA 2B24B 1OF5B 2JQ5A 1GY7A 5CXOA 1HU9A 5AIGA 1JB2A 3A5EA 4HYZA 4NREA 2F98A 5AIIA 4N6MA 2C11A 2CC3A 4R1KA 4RNTA 3J7Yd 4WHAA 3T8NA 1NB3I 1VQ73 2Y73A 3PYJA 3SX1A 3X3ZA 3OWSA 3VF1A 4MMXB 1R4CA 2F5WA 2W6JH 3CPOA 3WOFB 5JPPA 1T3BA 1BRHA 1TFOA 4OUQA 3CCL3 3NQZA 1STDA 2ZDJA 3KSPA 3TDGA 2F86B 4MEIA 2P38A 1VQ43 4LMIA 3DGLA 3G4S3 2FXTA 4WWUC 1WMOA 3KZTA 3CME3 2P0XA 2CFLA 2XEPA 3HIGA 5TGNA 1BRKA 2MF7A 2D42A 1FW7A 1DETA 1OHSA 3PCRA 3QRDA 4N6LA 1JKGB 4O02B 4XDVA 1Q7HA 2XH9A 4BTXA 3HI7A 4STDA 1LXEA 2WGQA 2XSHB 3BIRA 4R4KA 1CEWI 2STDA 1IV9A
chains in the Genus database with same CATH topology
1FGOA 1CYVA 1O7NB 3LTDA 2RGQA 4FMDA 1IDPA 1YI23 3EN1B 2CFKA 3FCSB 1L5GB 3LTBA 1ROAA 2W2CA 1E3VA 3NM7A 1W7CA 5IW9A 2QIYA 1N5PA 3CCV3 2IUJA 4R80A 3DUKA 5AYSC 3FLJA 1A2KA 2PNCA 1VQN3 1TUHA 1SJWA 3DM8A 1STFI 3DXOA 2IMJA 1W01A 3HIIA 1AR0A 2SBLA 1OACA 2GBXB 4RZMA 2HMMB 5D83A 5FGOA 1FGTA 4LZIA 3CD63 1W6GA 2CG1A 5AEUB 4N6TA 4FCZA 1IU7A 1OUNA 3PZWA 1NJI4 2KXGA 1VQ83 3FG3A 3NV0A 3NBJA 2YFJB 1VZZA 3DGMA 2GEYA 2CWVA 1FUWA 2C10A 3KKGA 1W00A 3S67A 3F7SA 2QEX3 1N8R4 1O7GB 4FMCA 3MSOA 2OTJ3 2CK3H 2GU3A 1D6ZA 2W0QA 3BB9A 3STDA 2ML6A 3G8ZA 2W03A 4N6UA 5AIHA 1IVXA 3CXC2 1A2VA 1HKXA 5ELUA 1OH0A 3RGRA 5IF6A 3N54B 3O8YA 2BMRB 5AEWB 2ZL8A 3CCS3 3EN8A 3Q2PA 2Z77A 4CCVA 3WA3A 1DVDA 1SIIA 3H3HA 2CW9A 1W4NA 3WOEB 1IQYA 5BXQA 2V1LA 2XF3A 3S27A 1RKYA 4JF8A 4HVNA 5KP3A 3B4PA 4GB5A 1VQM3 2GBWB 4AKZA 3S29A 3CC73 3FF0A 1IVUA 1RJOA 2PZVA 3EJVA 4XB5A 3RDEA 4XBTA 2CWTA 1C7HA 3UJMA 3EE1A 1UI8A 3MYTA 3PGBA 4EC6A 5IG4A 2IUKA 2GEXA 1BUQA 4WYKA 4AEQA 3MG1A 3MWZA 1O7HB 3LMLA 1IT8A 1O7MB 3GZYB 5G2GA 1YHQ3 1FGMA 3X40A 4BTWA 4PEJA 3ROBA 1IVVA 3VGNA 4AKYA 3KSED 8CHOA 3EF8A 1AVKA 3B7CA 1UI7A 2P0MA 1Z1SA 1N9JA 5EQLA 4R9KA 3VSYA 1JV2B 3G713 3JUMA 1QMAA 4HM5B 4FCJA 3K9MC 3NHXA 4FR9A 3BNBA 2BNGA 4EXRA 3SXXA 1MNLA 2D1WA 4EV2A 3ALAA 4U13A 1M904 1K9M4 5STDA 2I9WA 4RBNA 5CF2A 2E2VA 4OK0A 1Y4KA 1W6YA 3I563 4L8OA 1AVLA 4H61A 2FNQA 1W2B2 4HM8B 2INXA 3OV4A 4XDWA 3IJEB 3G16A 1N8QA 4WYKB 3B4OA 4R9LA 2HMOB 3M8CA 3JUOA 1S5AA 1OGZA 3JUPA 1WMNA 3K63A 2XGLA 2YFLB 3HZPA 1T5YA 4J8TA 4KFEA 3I553 3HX8A 3EX9A 4K1VA 3LH4A 5EVHA 5LC7A 3H51A 3UB1A 1YJ93 1ISKA 2JDIH 1W6CA 5AI1A 1D6YA 2O9UX 3DMCA 4HZ9B 5AYRB 1WTHA 3KFQC 3Q90A 5BVBA 3LTCA 2CHCA 1JB4A 1ASKA 1ROVA 2GU1A 2CFWA 4L7KA 1KQS2 5KP1A 2E2UA 2W9PA 4IT7A 4HM2B 3RGAA 1F8NA 3WODG 3G0KA 4HM0B 2LQVA 3MKIA 4LGQA 4OVMA 3ECFA 1JB5A 4K61A 4XBXA 1YVBI 3G6E3 3LOYA 2LYXA 1GD3A 3GWRA 3FH1A 2W04A 3S28A 4HJLB 3F8HA 2KCDA 5IG0A 2RSXA 1EQKA 1D6UA 1IQXA 1YJW3 3D3LA 5AIFA 3ER7A 2CH9A 2BO9B 3X3YA 2RFRA 1GD4A 1QAFA 2RCDA 2XFTA 1JNQA 4KZ1A 1KD14 1KC84 1QALA 1ULIB 2OOVC 1YIJ3 1US1A 2GXFA 2W9QA 2P09A 5IENA 3CCE3 1JN5A 1K28A 1VQ93 1PU4A 1Q864 1NO3A 2OCTA 4Q53A 4FMBA 3PXMA 1W2ZA 1WQLB 1JJ22 1Q40A 3GZXB 1CYUA 4L8PA 2BT3A 3CMA3 1FA3A 1EG9B 1QAKA 1M1K4 2W56A 3GAXA 3BNDA 1GS3A 1TIJA 2CFGA 1NDOB 4IPBA 2Z7AA 3LYGA 3F40A 4O3VA 2CFDA 1G96A 3PS8A 3F9SA 4O8SA 5ELJA 3CC23 5DRVA 2XGNA 4KFFA 4ORLA 4K1UA 1GYBA 1Q814 2IA7A 1IQ8A 2YFIB 4NHFA 3NV0B 5A0OB 3DZLA 1VQL3 1RRLA 1PFPA 2YX9A 1WMPA 3EBYA 4EV5A 4LEHA 4MJDA 2OQEC 3F8XA 4WFOA 3CCR3 1ZO2A 4RNZA 2M7OA 2OTL3 3K0ZA 2L4VA 1UUWB 5CF1A 5DREA 3CCQ3 1DVCA 1FGRA 1Q40B 1NWWA 3JUNA 2ML5A 5CLKA 5EEOA 3FF2A 2XSOB 6STDA 3OXAA 1GY5A 3IMAB 3Q1CA 4HBRA 2W56B 1W02A 1S723 2CKFB 3FSDA 2XRXB 3CCJ3 5D81A 3SOYA 3DGOA 3EB8A 3F7XA 3FGYA 1IT7A 1OCVA 5JPUA 2BHMA 4FMAA 2Q07A 5IERA 2FGTA 3EC9A 5IG5A 3KE7A 3T0UA 3GRDA 3FKAA 3V98A 1ZX2A 4J9AA 3NX0A 1M9GA 4O2HA 3I0YA 5IEPA 1Q7Y4 1VQ63 3FG4A 3JVCA 2F99A 1U5OA 2HMJB 4XM4A 3WDGB 1Q824 3NM2A 3X3XA 1TP6A 2A15A 1K8A4 2MC8A 3MPHA 1O7PB 2XFSA 4TX4A 4I4KA 1QVG2 3LTAA 2CWUA 3CNMA 1DMNA 3HK4A 2OWPA 4G1MB 1Q42A 1QVF2 1GY6A 3UL6A 3N8BA 3PCSA 5KP4A 1A67A 3EQQB 5CK6A 3X41A 3K7CA 3MG3A 1RN7A 3LT9A 2P05A 4HM1B 4HZBB 3A76A 2OQEA 4ZM8A 2HMLB 3NBRA 1AV4A 1WNHA 2Y74A 3E99A 3OWYA 1E97A 3IPTA 2Z76A 1W5ZA 4X2OA 3CC43 1ULJB 3CPW2 3CCM3 4GL6A 4FCMA 1SQWA 3NQYA 4KVHA 4N3VA 3GZRA 5FW5A 4EYCA 2HMNB 3JUQA 3LT8A 1K41A 3BNEA 1DYUA 3F14A 4KFDA 3WA2X 1VQ53 1VQK3 1N5HA 3MHEA 1IV7A 3BLZA 3BNCA 3CU3A 5LC6A 4RNYA 3QK9A 3B8LA 4X2HA 1YJN3 3SLUA 1U8CB 3K5TA 3CNXA 1LVNA 1DMQA 1RRHA 1KSIA 2XR8B 4IIAA 1JRQA 3OWUA 3NBBA 1LOXA 2WOFA 1N9EA 1OPYA 4HM4B 5JBSA 1SIHA 3AMOA 3CCU3 1E3RA 3GZBA 3L0RA 4JRFA 3U97A 3V99A 4CDLA 2BMQB 2E2TA 1DMMA 3KIIA 4WP5A 1CQSA 5I97A 1VQO3 1OHOA 2CG0A 5D82A 4H3UA 3OW22 2CIUA 7STDA 2B1XB 3LZAA 3KN4A 3T8UA 3SEDA 4BTYA 3FG1A 4HM6B 1KWIA 3D9RA 1YGEA 3LXUX 2WOHA 2WGOA 4QWTA 1JN5B 5IG3A 1TFKA 1OF5A 1VQP3 1NB5I 4HM3B 2BMOB 1IK3A 1SPUA 4HM7B 1A90A 1O7WB 4LSOA 4N6V0 1UW1A 4N6OB 1YIT3 1EA2A 2R4IA 1UUVB 3AMOB 5IEOA 1MOLA 3V92A 4N6NB 3NUVA 4MMZB 3SOAA 1IVWA 3SVAA 1K734 4MMYB 2HMKB 1QJGA 1OGXA 4K90B 3DGNA 4XBYA 1FGQA 3UNLA 3X42A 2KRTA 4EBGA 2OOVA 2O3OA 1TU5A 2QA43 2WO0A 3FZWA 1V74A 1EKMA 1NU3A 3WMDA 2QGUA 3N9HA 3MG2A 1JKGA 3UL5A 1OHPA 5HGRA 2Z6BA 2K54A 2UX0A 1M1XB 3EHCA 4HKVB 3U1WA 1J2BA 3OX9A 2K0MA 3NXJA 3EBTA 3DY5A 3S5CA 1LNHA 2B24B 1OF5B 2JQ5A 1GY7A 5CXOA 1HU9A 5AIGA 1JB2A 4HYZA 4NREA 2F98A 5AIIA 4N6MA 2C11A 2CC3A 4R1KA 3J7Yd 4WHAA 3T8NA 1NB3I 1VQ73 2Y73A 3PYJA 3SX1A 3X3ZA 3OWSA 3VF1A 4MMXB 1R4CA 2W6JH 3CPOA 3WOFB 5JPPA 1TFOA 4OUQA 3CCL3 3NQZA 1STDA 2ZDJA 3KSPA 3TDGA 2F86B 4MEIA 2P38A 1VQ43 4LMIA 3DGLA 3G4S3 2FXTA 4WWUC 1WMOA 3KZTA 3CME3 2P0XA 2CFLA 2XEPA 3HIGA 5TGNA 2MF7A 2D42A 1OHSA 3PCRA 3QRDA 4N6LA 1JKGB 4O02B 4XDVA 2XH9A 4BTXA 3HI7A 4STDA 1LXEA 2WGQA 2XSHB 4R4KA 1CEWI 2STDA 1IV9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O7N B;  2RGQ A;  1IDP A;  3EN1 B;  2W2C A;  1E3V A;  2QIY A;  3DUK A;  3FLJ A;  1A2K A;  1TUH A;  1SJW A;  3DM8 A;  3DXO A;  2IMJ A;  1W01 A;  1AR0 A;  2GBX B;  4RZM A;  2HMM B;  5D83 A;  5AEU B;  1OUN A;  3NV0 A;  2YFJ B;  1VZZ A;  2GEY A;  3KKG A;  1W00 A;  3F7S A;  1O7G B;  3MSO A;  3BB9 A;  3STD A;  3G8Z A;  5AIH A;  1HKX A;  1OH0 A;  3RGR A;  5IF6 A;  5AEW B;  2BMR B;  3EN8 A;  2Z77 A;  3H3H A;  5BXQ A;  4HVN A;  5KP3 A;  3B4P A;  4GB5 A;  2GBW B;  3FF0 A;  2PZV A;  3EJV A;  4XB5 A;  4XBT A;  1C7H A;  3UJM A;  3MYT A;  5IG4 A;  2GEX A;  1BUQ A;  4WYK A;  3MG1 A;  1O7H B;  1O7M B;  3GZY B;  5G2G A;  4PEJ A;  3ROB A;  3VGN A;  8CHO A;  3EF8 A;  3B7C A;  1Z1S A;  4R9K A;  3VSY A;  3JUM A;  1QMA A;  4HM5 B;  4FCJ A;  3NHX A;  2BNG A;  4U13 A;  5STD A;  2I9W A;  5CF2 A;  1W6Y A;  4L8O A;  4HM8 B;  2INX A;  3OV4 A;  4XDW A;  3G16 A;  4WYK B;  3B4O A;  4R9L A;  2HMO B;  3M8C A;  3JUO A;  1S5A A;  1OGZ A;  3JUP A;  2YFL B;  3HZP A;  4J8T A;  3HX8 A;  3EX9 A;  4K1V A;  5EVH A;  3H51 A;  1ISK A;  5AI1 A;  3DMC A;  4HZ9 B;  3Q90 A;  5BVB A;  2CHC A;  1JB4 A;  1ASK A;  4L7K A;  5KP1 A;  4HM2 B;  3RGA A;  3G0K A;  4HM0 B;  3MKI A;  4LGQ A;  4OVM A;  3ECF A;  1JB5 A;  4XBX A;  3GWR A;  3FH1 A;  4HJL B;  3F8H A;  5IG0 A;  5AIF A;  3ER7 A;  2RFR A;  2RCD A;  1ULI B;  2GXF A;  5IEN A;  1JN5 A;  4Q53 A;  1WQL B;  1Q40 A;  3GZX B;  4L8P A;  1EG9 B;  1GS3 A;  1NDO B;  2Z7A A;  3LYG A;  3F40 A;  3F9S A;  5DRV A;  4ORL A;  4K1U A;  1GYB A;  2YFI B;  3NV0 B;  3DZL A;  3EBY A;  4LEH A;  4MJD A;  3F8X A;  1ZO2 A;  3K0Z A;  1UUW B;  5CF1 A;  5DRE A;  1Q40 B;  1NWW A;  3JUN A;  5CLK A;  3FF2 A;  2XSO B;  6STD A;  3OXA A;  1GY5 A;  1W02 A;  2CKF B;  3FSD A;  2XRX B;  5D81 A;  3SOY A;  3F7X A;  3FGY A;  1OCV A;  5JPU A;  5IER A;  5IG5 A;  3EC9 A;  3KE7 A;  3GRD A;  3FKA A;  1ZX2 A;  4J9A A;  3I0Y A;  5IEP A;  2F99 A;  1U5O A;  2HMJ B;  4XM4 A;  3NM2 A;  1TP6 A;  2A15 A;  1O7P B;  4I4K A;  3CNM A;  1DMN A;  3HK4 A;  2OWP A;  1Q42 A;  1GY6 A;  5KP4 A;  3EQQ B;  5CK6 A;  3K7C A;  3MG3 A;  4HM1 B;  4HZB B;  3A76 A;  2HML B;  3NBR A;  3E99 A;  3OWY A;  1E97 A;  3IPT A;  2Z76 A;  4X2O A;  1ULJ B;  4FCM A;  4KVH A;  4N3V A;  3GZR A;  5FW5 A;  2HMN B;  3JUQ A;  1K41 A;  3F14 A;  3MHE A;  3BLZ A;  3CU3 A;  3B8L A;  4X2H A;  3CNX A;  1DMQ A;  2XR8 B;  4IIA A;  3OWU A;  1OPY A;  4HM4 B;  1E3R A;  3GZB A;  4CDL A;  2BMQ B;  1DMM A;  4WP5 A;  1CQS A;  1OHO A;  5D82 A;  4H3U A;  7STD A;  2B1X B;  3LZA A;  3T8U A;  3SED A;  4HM6 B;  3D9R A;  1JN5 B;  5IG3 A;  1OF5 A;  4HM3 B;  2BMO B;  4HM7 B;  1O7W B;  1EA2 A;  2R4I A;  1UUV B;  5IEO A;  3NUV A;  3SOA A;  2HMK B;  1QJG A;  1OGX A;  4XBY A;  3UNL A;  3FZW A;  1NU3 A;  3WMD A;  2QGU A;  3MG2 A;  1JKG A;  1OHP A;  5HGR A;  2K54 A;  2UX0 A;  3EHC A;  4HKV B;  3OX9 A;  3NXJ A;  3S5C A;  3EBT A;  2B24 B;  1OF5 B;  2JQ5 A;  1GY7 A;  5CXO A;  5AIG A;  1JB2 A;  2F98 A;  5AII A;  4R1K A;  3T8N A;  3OWS A;  5JPP A;  4OUQ A;  1STD A;  3KSP A;  2F86 B;  4LMI A;  4WWU C;  3KZT A;  5TGN A;  1OHS A;  1JKG B;  4XDV A;  4STD A;  2XSH B;  2STD A;  3CPO A; 
#chains in the Genus database with same CATH topology
 1FGO A;  1CYV A;  3DGY A;  1MWT A;  1O7N B;  3LTD A;  2RGQ A;  4FMD A;  1IDP A;  1YI2 3;  3EN1 B;  2CFK A;  3FCS B;  1L5G B;  3LTB A;  1ROA A;  2KF6 A;  1B2X A;  1E3V A;  2W2C A;  1W7C A;  3NM7 A;  5IW9 A;  2QIY A;  1N5P A;  3CCV 3;  1FUT A;  2IUJ A;  1EUI C;  4R80 A;  1RGE A;  1UCI A;  1BNR A;  3DUK A;  5AYS C;  3FLJ A;  2R41 A;  1A2K A;  2PNC A;  1VQN 3;  1TUH A;  3AGO A;  1SJW A;  3DM8 A;  1STF I;  3DXO A;  1FZU A;  1W01 A;  2IMJ A;  3HII A;  1AR0 A;  2H0H A;  2SBL A;  1OAC A;  2GBX B;  4RZM A;  2HMM B;  5D83 A;  5FGO A;  1FGT A;  4LZI A;  2ZA4 A;  3CD6 3;  2KAA A;  1W6G A;  2CG1 A;  5M1A A;  5AEU B;  4N6T A;  4FCZ A;  1V57 A;  4BL2 A;  1IU7 A;  1OUN A;  3PZW A;  1NJI 4;  2KXG A;  1VQ8 3;  1BRS A;  3FG3 A;  3NV0 A;  3NBJ A;  2YFJ B;  1VZZ A;  3DGM A;  2GEY A;  2CWV A;  1FUW A;  2C10 A;  3KKG A;  1W00 A;  1GMR A;  1ZS7 A;  3F7S A;  3S67 A;  5M19 A;  2QEX 3;  1UUG B;  1B20 A;  1N8R 4;  1TTO A;  1O7G B;  4FMC A;  4BU4 A;  3MSO A;  2OTJ 3;  2CK3 H;  2GU3 A;  1D6Z A;  2W0Q A;  3BB9 A;  3STD A;  2ML6 A;  3G8Z A;  2W03 A;  4N6U A;  5AIH A;  5BIR A;  1IVX A;  3CXC 2;  1A2V A;  1HKX A;  5ELU A;  1OH0 A;  3RGR A;  5IF6 A;  3N54 B;  3O8Y A;  2BMR B;  5AEW B;  2ZL8 A;  5HOH A;  3EN8 A;  3Q2P A;  3CCS 3;  2Z77 A;  4CCV A;  1LQG C;  3WA3 A;  1DVD A;  1SII A;  3H3H A;  1I2G A;  2CW9 A;  2ZHX B;  1W4N A;  3WOE B;  1IQY A;  5BXQ A;  2V1L A;  1RMS A;  2XF3 A;  3S27 A;  1RKY A;  4JF8 A;  4HVN A;  5KP3 A;  3B4P A;  4GB5 A;  1VQM 3;  2GBW B;  3BU4 A;  3S29 A;  4AKZ A;  3CC7 3;  1TRP A;  2SAR A;  3FF0 A;  1IVU A;  1I0X A;  1RJO A;  2PZV A;  3EJV A;  4XB5 A;  3RDE A;  2L1S A;  4XBT A;  2CWT A;  1C7H A;  3UJM A;  3Q3F A;  4DKI A;  3EE1 A;  1UI8 A;  2F4Y A;  3MYT A;  3PGB A;  4EC6 A;  2CX0 A;  5IG4 A;  1RTU A;  2IUK A;  2GEX A;  1BUQ A;  4NPB A;  4WYK A;  4AEQ A;  4KT3 B;  3MG1 A;  1GMP A;  3MWZ A;  1O7H B;  3LML A;  1IT8 A;  1O7M B;  3GZY B;  5G2G A;  3GSP A;  1YHQ 3;  1FGM A;  3X40 A;  4BTW A;  4PEJ A;  3ROB A;  1IVV A;  1VQQ A;  3VGN A;  4AKY A;  3KSE D;  8CHO A;  3EF8 A;  1AVK A;  1BRN L;  3B7C A;  1UI7 A;  2P0M A;  1NNV A;  1Z1S A;  1N9J A;  1X1U A;  4R9K A;  5EQL A;  3VSY A;  5BU4 A;  3RNT A;  4ILF A;  1JV2 B;  3G71 3;  2C4B A;  2IYJ A;  3JUM A;  1QMA A;  4HM5 B;  4FCJ A;  1RGK A;  3K9M C;  3NHX A;  4FR9 A;  3BNB A;  2BNG A;  1UCK A;  4EXR A;  3SXX A;  1MNL A;  2D1W A;  4EV2 A;  3ALA A;  4U13 A;  1M90 4;  1K9M 4;  5STD A;  2I9W A;  4RBN A;  5CF2 A;  1I2E A;  2E2V A;  4GHO A;  4OK0 A;  1BSA A;  1Y4K A;  1W6Y A;  5G1K A;  3I56 3;  1BVI A;  1LOW A;  4L8O A;  1UCL A;  1AVL A;  4H61 A;  2IY2 A;  2FNQ A;  1W2B 2;  4HM8 B;  2INX A;  3OV4 A;  4XDW A;  3IJE B;  3G16 A;  1UGH I;  1N8Q A;  4WYK B;  1BGS A;  3B4O A;  4R9L A;  2HMO B;  3M8C A;  3JUO A;  1S5A A;  1OGZ A;  2AAE A;  3JUP A;  3KCH A;  1BOX A;  1WMN A;  3K63 A;  2XGL A;  2YFL B;  3HZP A;  1T5Y A;  4J8T A;  2BIR A;  4KFE A;  7RNT A;  3HX8 A;  1BNG A;  3EX9 A;  4J5K A;  3LH4 A;  4K1V A;  4EW5 A;  5EVH A;  1TRQ A;  1PYL A;  5LC7 A;  1B2M A;  3H51 A;  3UB1 A;  1YJ9 3;  1ISK A;  2JDI H;  1W6C A;  3I55 3;  5AI1 A;  1D6Y A;  2O9U X;  3DMC A;  4HZ9 B;  5AYR B;  1WTH A;  3AGN A;  3KFQ C;  3Q90 A;  5BVB A;  3LTC A;  2CHC A;  1JB4 A;  2J8X B;  1ASK A;  1ROV A;  1BRJ A;  2GU1 A;  2CFW A;  1BNE A;  4L7K A;  1KQS 2;  1I2F A;  5KP1 A;  2E2U A;  1PY3 A;  2W9P A;  4IT7 A;  3DH2 A;  4HM2 B;  3RGA A;  1GSP A;  1F8N A;  3WOD G;  3G0K A;  4HM0 B;  2LQV A;  3MKI A;  1BSB A;  4LGQ A;  3ECF A;  1JB5 A;  4K61 A;  4OVM A;  1BU4 A;  4XBX A;  5G1L A;  1YVB I;  3G6E 3;  3LOY A;  1MGR A;  1R4Y A;  1GD3 A;  2LYX A;  2UGI A;  3FH1 A;  2W04 A;  3GWR A;  3S28 A;  4HJL B;  3F8H A;  2KCD A;  5IG0 A;  2RSX A;  6GSP A;  1EQK A;  1V58 A;  1D6U A;  1IQX A;  1I3F A;  1BAO A;  2KF5 A;  3D3L A;  5AIF A;  1YJW 3;  1JZO A;  3ER7 A;  2CH9 A;  1LOY A;  5GSP A;  2BO9 B;  3ZG0 A;  3X3Y A;  1Q9E A;  2RFR A;  1GD4 A;  1QAF A;  2RCD A;  1RDS A;  1JNQ A;  2XFT A;  4KZ1 A;  1B27 A;  1KD1 4;  1LOV A;  1QAL A;  1KC8 4;  1ULI B;  2OOV C;  4HOH A;  1YIJ 3;  1BNF A;  1US1 A;  2GXF A;  2W9Q A;  2P09 A;  1RGF A;  5IEN A;  3SYU A;  3CCE 3;  3D79 A;  1RGA A;  1JN5 A;  1K28 A;  1RSN A;  1VQ9 3;  1PU4 A;  1Q86 4;  1NO3 A;  2OCT A;  4Q53 A;  4FMB A;  3PXM A;  1W2Z A;  1RGH A;  1WQL B;  1JJ2 2;  1Q40 A;  3GZX B;  1CYU A;  4L8P A;  2BT3 A;  3CMA 3;  1FA3 A;  1EG9 B;  1QAK A;  1M1K 4;  1C54 A;  2W56 A;  1UCJ A;  3GAX A;  3BND A;  3D4A A;  4BL3 A;  1GS3 A;  1TIJ A;  1JBS A;  2CFG A;  1NDO B;  4IPB A;  2Z7A A;  1UDI I;  3LYG A;  1RNT A;  1FUS A;  3F40 A;  4O3V A;  2CFD A;  1G96 A;  3PS8 A;  3F9S A;  4O8S A;  5ELJ A;  3CC2 3;  5DRV A;  2XGN A;  4KFF A;  2H0G A;  4ORL A;  4K1U A;  1GYB A;  1Q81 4;  1LNI A;  2IA7 A;  1IQ8 A;  2YFI B;  1RN1 A;  3NV0 B;  4NHF A;  3DZL A;  4BIR A;  5A0O B;  1VQL 3;  1RRL A;  1PFP A;  1AQZ A;  2YX9 A;  1WMP A;  1BNI A;  3EBY A;  4EV5 A;  4LEH A;  2RBI A;  4MJD A;  2OQE C;  3F8X A;  4WFO A;  3CCR 3;  1ZO2 A;  4RNZ A;  2M7O A;  2OTL 3;  1RHL A;  3K0Z A;  2L4V A;  1UUW B;  5CF1 A;  5DRE A;  3CCQ 3;  1DVC A;  1FGR A;  1GOY A;  1Q40 B;  1NWW A;  3JUN A;  2ML5 A;  5CLK A;  5EEO A;  3FF2 A;  2XSO B;  1BIR A;  3OXA A;  1GY5 A;  1CH0 A;  3IMA B;  3Q1C A;  6STD A;  4HBR A;  1BNJ A;  2W56 B;  1W02 A;  1RN4 A;  1S72 3;  2CKF B;  3FSD A;  2XRX B;  1A2P A;  3CCJ 3;  5D81 A;  1G0T A;  1MGW A;  3SOY A;  3DGO A;  3EB8 A;  3F7X A;  3FGY A;  1IT7 A;  4LYL B;  1OCV A;  5JPU A;  2BHM A;  4FMA A;  2Q07 A;  5IER A;  1HZ1 A;  2FGT A;  3EC9 A;  5IG5 A;  3KE7 A;  1BRI A;  3T0U A;  3GRD A;  3FKA A;  3V98 A;  1ZX2 A;  4J9A A;  3ZFZ A;  3NX0 A;  1M9G A;  4O2H A;  3I0Y A;  5IEP A;  1Q7Y 4;  1VQ6 3;  3FG4 A;  1B3S A;  3JVC A;  1MWU A;  1U5O A;  2F99 A;  1GMQ A;  2HMJ B;  4XM4 A;  3WDG B;  1Q82 4;  3NM2 A;  3URP A;  2BU4 A;  1BSD A;  1RGL A;  2CX1 A;  1RCK A;  3X3X A;  1TP6 A;  1YNV X;  2A15 A;  1G02 A;  1K8A 4;  2MC8 A;  3MPH A;  1O7P B;  2XFS A;  4TX4 A;  4I4K A;  2AAD A;  1QVG 2;  3LTA A;  2CWU A;  5M18 A;  3CNM A;  1DMN A;  3HK4 A;  2OWP A;  4G1M B;  1Q42 A;  1QVF 2;  1JBT A;  1GY6 A;  3UL6 A;  3N8B A;  1JZD A;  3PCS A;  5KP4 A;  1A67 A;  1RGG A;  3EQQ B;  1X1Y A;  5CK6 A;  3X41 A;  3K7C A;  3MG3 A;  1RN7 A;  3LT9 A;  2P05 A;  4HM1 B;  4HZB B;  4HAA A;  3A76 A;  2OQE A;  4ZM8 A;  2HML B;  3NBR A;  1AV4 A;  1WNH A;  2Y74 A;  1ZGX A;  1AY7 A;  3E99 A;  1E97 A;  3OWY A;  4CPK A;  3IPT A;  1I70 A;  2Z76 A;  2F56 A;  1W5Z A;  4X2O A;  2HOH A;  3CC4 3;  1ULJ B;  1FYS A;  4I5Q A;  3CPW 2;  3CCM 3;  1T2H A;  4GL6 A;  4FCM A;  1SQW A;  3NQY A;  4KVH A;  4N3V A;  3WR2 A;  3GZR A;  5FW5 A;  4EYC A;  2HMN B;  3JUQ A;  3ZG5 A;  5RNT A;  3LT8 A;  1K41 A;  3BNE A;  1DYU A;  3F14 A;  4KFD A;  3WA2 X;  1VQ5 3;  1VQK 3;  1N5H A;  3MHE A;  1IV7 A;  3BLZ A;  3BNC A;  6RNT A;  3CU3 A;  5LC6 A;  4RNY A;  3QK9 A;  3AHW A;  3B8L A;  4X2H A;  1YJN 3;  3SLU A;  1U8C B;  4GSP A;  1RLS A;  3K5T A;  3CNX A;  1LVN A;  1DMQ A;  3WHO A;  1RRH A;  1BUJ A;  1KSI A;  2XR8 B;  4IIA A;  1JRQ A;  9RNT A;  2KF4 A;  3OWU A;  2RNT A;  3NBB A;  1LRA A;  1LOX A;  2WOF A;  1BRG A;  1N9E A;  1B2S A;  1OPY A;  4HM4 B;  1SIH A;  3AMO A;  5JBS A;  1RGC A;  1SAR A;  3CCU 3;  1E3R A;  3GZB A;  3L0R A;  4JRF A;  3AHS A;  3U97 A;  3V99 A;  4CDL A;  2BMQ B;  2E2T A;  1DMM A;  3KII A;  4WP5 A;  1CQS A;  5I97 A;  1VQO 3;  1OHO A;  2CG0 A;  1BNS A;  5D82 A;  4H3U A;  3OW2 2;  2CIU A;  7STD A;  2B1X B;  3LZA A;  3KN4 A;  3T8U A;  3SED A;  1X1X A;  1YGW A;  3FG1 A;  4HM6 B;  4BTY A;  1KWI A;  1RCL A;  3D9R A;  1YGE A;  3LXU X;  1B2Z A;  2WOH A;  1GOU A;  7GSP A;  1UGI A;  1TJD A;  2WGO A;  4QWT A;  1EEJ A;  1JBR A;  1YVS A;  1JN5 B;  1X1W A;  5IG3 A;  1DE3 A;  1IYY A;  1TFK A;  1BSE A;  3HOH A;  1RNB A;  1OF5 A;  1VQP 3;  1NB5 I;  4HM3 B;  2BMO B;  1IK3 A;  1SPU A;  2GSP A;  2H0I A;  4HM7 B;  4CJN A;  1A90 A;  1O7W B;  4LSO A;  1I0V A;  3D5I A;  4N6V 0;  1UW1 A;  4N6O B;  1YIT 3;  1EA2 A;  2R4I A;  1UUV B;  3AMO B;  5IEO A;  1BSC A;  1MOL A;  3V92 A;  4N6N B;  3NUV A;  4MMZ B;  3SOA A;  1IVW A;  3SVA A;  4J5G A;  2K3D A;  2F5M A;  2UUG C;  4MMY B;  1K73 4;  2HMK B;  1QJG A;  1OGX A;  4K90 B;  1GOV A;  3DGN A;  1FGQ A;  4XBY A;  3UNL A;  3X42 A;  1I3I A;  2KRT A;  4EBG A;  1B21 A;  1HYF A;  2OOV A;  2O3O A;  1TU5 A;  2QA4 3;  2WO0 A;  3FZW A;  1V74 A;  1EKM A;  1BAN A;  1NU3 A;  3WMD A;  1I8V A;  2QGU A;  3N9H A;  1MWR A;  1T2I A;  1B2U A;  3MG2 A;  1JKG A;  3UL5 A;  8RNT A;  1MWS A;  1OHP A;  5HGR A;  2Z6B A;  2K54 A;  2UX0 A;  1M1X B;  3EHC A;  4HKV B;  3U1W A;  3D5G A;  1J2B A;  3OX9 A;  2K0M A;  3NXJ A;  3EBT A;  3DY5 A;  3S5C A;  1LQM B;  2KF3 A;  1LNH A;  2B24 B;  1OF5 B;  2JQ5 A;  1GY7 A;  5CXO A;  1HU9 A;  5AIG A;  1JB2 A;  3A5E A;  4HYZ A;  4NRE A;  2F98 A;  5AII A;  4N6M A;  2C11 A;  2CC3 A;  4R1K A;  4RNT A;  3J7Y d;  4WHA A;  3T8N A;  1NB3 I;  1VQ7 3;  2Y73 A;  3PYJ A;  3SX1 A;  3X3Z A;  3OWS A;  3VF1 A;  4MMX B;  1R4C A;  2F5W A;  2W6J H;  3CPO A;  3WOF B;  5JPP A;  1T3B A;  1BRH A;  1TFO A;  4OUQ A;  3CCL 3;  3NQZ A;  1STD A;  2ZDJ A;  3KSP A;  3TDG A;  2F86 B;  4MEI A;  2P38 A;  1VQ4 3;  4LMI A;  3DGL A;  3G4S 3;  2FXT A;  4WWU C;  1WMO A;  3KZT A;  3CME 3;  2P0X A;  2CFL A;  2XEP A;  3HIG A;  5TGN A;  1BRK A;  2MF7 A;  2D42 A;  1FW7 A;  1DET A;  1OHS A;  3PCR A;  3QRD A;  4N6L A;  1JKG B;  4O02 B;  4XDV A;  1Q7H A;  2XH9 A;  4BTX A;  3HI7 A;  4STD A;  1LXE A;  2WGQ A;  2XSH B;  3BIR A;  4R4K A;  1CEW I;  2STD A;  1IV9 A; 
#chains in the Genus database with same CATH homology
 1FGO A;  1CYV A;  1O7N B;  3LTD A;  2RGQ A;  4FMD A;  1IDP A;  1YI2 3;  3EN1 B;  2CFK A;  3FCS B;  1L5G B;  3LTB A;  1ROA A;  2W2C A;  1E3V A;  3NM7 A;  1W7C A;  5IW9 A;  2QIY A;  1N5P A;  3CCV 3;  2IUJ A;  4R80 A;  3DUK A;  5AYS C;  3FLJ A;  1A2K A;  2PNC A;  1VQN 3;  1TUH A;  1SJW A;  3DM8 A;  1STF I;  3DXO A;  2IMJ A;  1W01 A;  3HII A;  1AR0 A;  2SBL A;  1OAC A;  2GBX B;  4RZM A;  2HMM B;  5D83 A;  5FGO A;  1FGT A;  4LZI A;  3CD6 3;  1W6G A;  2CG1 A;  5AEU B;  4N6T A;  4FCZ A;  1IU7 A;  1OUN A;  3PZW A;  1NJI 4;  2KXG A;  1VQ8 3;  3FG3 A;  3NV0 A;  3NBJ A;  2YFJ B;  1VZZ A;  3DGM A;  2GEY A;  2CWV A;  1FUW A;  2C10 A;  3KKG A;  1W00 A;  3S67 A;  3F7S A;  2QEX 3;  1N8R 4;  1O7G B;  4FMC A;  3MSO A;  2OTJ 3;  2CK3 H;  2GU3 A;  1D6Z A;  2W0Q A;  3BB9 A;  3STD A;  2ML6 A;  3G8Z A;  2W03 A;  4N6U A;  5AIH A;  1IVX A;  3CXC 2;  1A2V A;  1HKX A;  5ELU A;  1OH0 A;  3RGR A;  5IF6 A;  3N54 B;  3O8Y A;  2BMR B;  5AEW B;  2ZL8 A;  3CCS 3;  3EN8 A;  3Q2P A;  2Z77 A;  4CCV A;  3WA3 A;  1DVD A;  1SII A;  3H3H A;  2CW9 A;  1W4N A;  3WOE B;  1IQY A;  5BXQ A;  2V1L A;  2XF3 A;  3S27 A;  1RKY A;  4JF8 A;  4HVN A;  5KP3 A;  3B4P A;  4GB5 A;  1VQM 3;  2GBW B;  4AKZ A;  3S29 A;  3CC7 3;  3FF0 A;  1IVU A;  1RJO A;  2PZV A;  3EJV A;  4XB5 A;  3RDE A;  4XBT A;  2CWT A;  1C7H A;  3UJM A;  3EE1 A;  1UI8 A;  3MYT A;  3PGB A;  4EC6 A;  5IG4 A;  2IUK A;  2GEX A;  1BUQ A;  4WYK A;  4AEQ A;  3MG1 A;  3MWZ A;  1O7H B;  3LML A;  1IT8 A;  1O7M B;  3GZY B;  5G2G A;  1YHQ 3;  1FGM A;  3X40 A;  4BTW A;  4PEJ A;  3ROB A;  1IVV A;  3VGN A;  4AKY A;  3KSE D;  8CHO A;  3EF8 A;  1AVK A;  3B7C A;  1UI7 A;  2P0M A;  1Z1S A;  1N9J A;  5EQL A;  4R9K A;  3VSY A;  1JV2 B;  3G71 3;  3JUM A;  1QMA A;  4HM5 B;  4FCJ A;  3K9M C;  3NHX A;  4FR9 A;  3BNB A;  2BNG A;  4EXR A;  3SXX A;  1MNL A;  2D1W A;  4EV2 A;  3ALA A;  4U13 A;  1M90 4;  1K9M 4;  5STD A;  2I9W A;  4RBN A;  5CF2 A;  2E2V A;  4OK0 A;  1Y4K A;  1W6Y A;  3I56 3;  4L8O A;  1AVL A;  4H61 A;  2FNQ A;  1W2B 2;  4HM8 B;  2INX A;  3OV4 A;  4XDW A;  3IJE B;  3G16 A;  1N8Q A;  4WYK B;  3B4O A;  4R9L A;  2HMO B;  3M8C A;  3JUO A;  1S5A A;  1OGZ A;  3JUP A;  1WMN A;  3K63 A;  2XGL A;  2YFL B;  3HZP A;  1T5Y A;  4J8T A;  4KFE A;  3I55 3;  3HX8 A;  3EX9 A;  4K1V A;  3LH4 A;  5EVH A;  5LC7 A;  3H51 A;  3UB1 A;  1YJ9 3;  1ISK A;  2JDI H;  1W6C A;  5AI1 A;  1D6Y A;  2O9U X;  3DMC A;  4HZ9 B;  5AYR B;  1WTH A;  3KFQ C;  3Q90 A;  5BVB A;  3LTC A;  2CHC A;  1JB4 A;  1ASK A;  1ROV A;  2GU1 A;  2CFW A;  4L7K A;  1KQS 2;  5KP1 A;  2E2U A;  2W9P A;  4IT7 A;  4HM2 B;  3RGA A;  1F8N A;  3WOD G;  3G0K A;  4HM0 B;  2LQV A;  3MKI A;  4LGQ A;  4OVM A;  3ECF A;  1JB5 A;  4K61 A;  4XBX A;  1YVB I;  3G6E 3;  3LOY A;  2LYX A;  1GD3 A;  3GWR A;  3FH1 A;  2W04 A;  3S28 A;  4HJL B;  3F8H A;  2KCD A;  5IG0 A;  2RSX A;  1EQK A;  1D6U A;  1IQX A;  1YJW 3;  3D3L A;  5AIF A;  3ER7 A;  2CH9 A;  2BO9 B;  3X3Y A;  2RFR A;  1GD4 A;  1QAF A;  2RCD A;  2XFT A;  1JNQ A;  4KZ1 A;  1KD1 4;  1KC8 4;  1QAL A;  1ULI B;  2OOV C;  1YIJ 3;  1US1 A;  2GXF A;  2W9Q A;  2P09 A;  5IEN A;  3CCE 3;  1JN5 A;  1K28 A;  1VQ9 3;  1PU4 A;  1Q86 4;  1NO3 A;  2OCT A;  4Q53 A;  4FMB A;  3PXM A;  1W2Z A;  1WQL B;  1JJ2 2;  1Q40 A;  3GZX B;  1CYU A;  4L8P A;  2BT3 A;  3CMA 3;  1FA3 A;  1EG9 B;  1QAK A;  1M1K 4;  2W56 A;  3GAX A;  3BND A;  1GS3 A;  1TIJ A;  2CFG A;  1NDO B;  4IPB A;  2Z7A A;  3LYG A;  3F40 A;  4O3V A;  2CFD A;  1G96 A;  3PS8 A;  3F9S A;  4O8S A;  5ELJ A;  3CC2 3;  5DRV A;  2XGN A;  4KFF A;  4ORL A;  4K1U A;  1GYB A;  1Q81 4;  2IA7 A;  1IQ8 A;  2YFI B;  4NHF A;  3NV0 B;  5A0O B;  3DZL A;  1VQL 3;  1RRL A;  1PFP A;  2YX9 A;  1WMP A;  3EBY A;  4EV5 A;  4LEH A;  4MJD A;  2OQE C;  3F8X A;  4WFO A;  3CCR 3;  1ZO2 A;  4RNZ A;  2M7O A;  2OTL 3;  3K0Z A;  2L4V A;  1UUW B;  5CF1 A;  5DRE A;  3CCQ 3;  1DVC A;  1FGR A;  1Q40 B;  1NWW A;  3JUN A;  2ML5 A;  5CLK A;  5EEO A;  3FF2 A;  2XSO B;  6STD A;  3OXA A;  1GY5 A;  3IMA B;  3Q1C A;  4HBR A;  2W56 B;  1W02 A;  1S72 3;  2CKF B;  3FSD A;  2XRX B;  3CCJ 3;  5D81 A;  3SOY A;  3DGO A;  3EB8 A;  3F7X A;  3FGY A;  1IT7 A;  1OCV A;  5JPU A;  2BHM A;  4FMA A;  2Q07 A;  5IER A;  2FGT A;  3EC9 A;  5IG5 A;  3KE7 A;  3T0U A;  3GRD A;  3FKA A;  3V98 A;  1ZX2 A;  4J9A A;  3NX0 A;  1M9G A;  4O2H A;  3I0Y A;  5IEP A;  1Q7Y 4;  1VQ6 3;  3FG4 A;  3JVC A;  2F99 A;  1U5O A;  2HMJ B;  4XM4 A;  3WDG B;  1Q82 4;  3NM2 A;  3X3X A;  1TP6 A;  2A15 A;  1K8A 4;  2MC8 A;  3MPH A;  1O7P B;  2XFS A;  4TX4 A;  4I4K A;  1QVG 2;  3LTA A;  2CWU A;  3CNM A;  1DMN A;  3HK4 A;  2OWP A;  4G1M B;  1Q42 A;  1QVF 2;  1GY6 A;  3UL6 A;  3N8B A;  3PCS A;  5KP4 A;  1A67 A;  3EQQ B;  5CK6 A;  3X41 A;  3K7C A;  3MG3 A;  1RN7 A;  3LT9 A;  2P05 A;  4HM1 B;  4HZB B;  3A76 A;  2OQE A;  4ZM8 A;  2HML B;  3NBR A;  1AV4 A;  1WNH A;  2Y74 A;  3E99 A;  3OWY A;  1E97 A;  3IPT A;  2Z76 A;  1W5Z A;  4X2O A;  3CC4 3;  1ULJ B;  3CPW 2;  3CCM 3;  4GL6 A;  4FCM A;  1SQW A;  3NQY A;  4KVH A;  4N3V A;  3GZR A;  5FW5 A;  4EYC A;  2HMN B;  3JUQ A;  3LT8 A;  1K41 A;  3BNE A;  1DYU A;  3F14 A;  4KFD A;  3WA2 X;  1VQ5 3;  1VQK 3;  1N5H A;  3MHE A;  1IV7 A;  3BLZ A;  3BNC A;  3CU3 A;  5LC6 A;  4RNY A;  3QK9 A;  3B8L A;  4X2H A;  1YJN 3;  3SLU A;  1U8C B;  3K5T A;  3CNX A;  1LVN A;  1DMQ A;  1RRH A;  1KSI A;  2XR8 B;  4IIA A;  1JRQ A;  3OWU A;  3NBB A;  1LOX A;  2WOF A;  1N9E A;  1OPY A;  4HM4 B;  5JBS A;  1SIH A;  3AMO A;  3CCU 3;  1E3R A;  3GZB A;  3L0R A;  4JRF A;  3U97 A;  3V99 A;  4CDL A;  2BMQ B;  2E2T A;  1DMM A;  3KII A;  4WP5 A;  1CQS A;  5I97 A;  1VQO 3;  1OHO A;  2CG0 A;  5D82 A;  4H3U A;  3OW2 2;  2CIU A;  7STD A;  2B1X B;  3LZA A;  3KN4 A;  3T8U A;  3SED A;  4BTY A;  3FG1 A;  4HM6 B;  1KWI A;  3D9R A;  1YGE A;  3LXU X;  2WOH A;  2WGO A;  4QWT A;  1JN5 B;  5IG3 A;  1TFK A;  1OF5 A;  1VQP 3;  1NB5 I;  4HM3 B;  2BMO B;  1IK3 A;  1SPU A;  4HM7 B;  1A90 A;  1O7W B;  4LSO A;  4N6V 0;  1UW1 A;  4N6O B;  1YIT 3;  1EA2 A;  2R4I A;  1UUV B;  3AMO B;  5IEO A;  1MOL A;  3V92 A;  4N6N B;  3NUV A;  4MMZ B;  3SOA A;  1IVW A;  3SVA A;  1K73 4;  4MMY B;  2HMK B;  1QJG A;  1OGX A;  4K90 B;  3DGN A;  4XBY A;  1FGQ A;  3UNL A;  3X42 A;  2KRT A;  4EBG A;  2OOV A;  2O3O A;  1TU5 A;  2QA4 3;  2WO0 A;  3FZW A;  1V74 A;  1EKM A;  1NU3 A;  3WMD A;  2QGU A;  3N9H A;  3MG2 A;  1JKG A;  3UL5 A;  1OHP A;  5HGR A;  2Z6B A;  2K54 A;  2UX0 A;  1M1X B;  3EHC A;  4HKV B;  3U1W A;  1J2B A;  3OX9 A;  2K0M A;  3NXJ A;  3EBT A;  3DY5 A;  3S5C A;  1LNH A;  2B24 B;  1OF5 B;  2JQ5 A;  1GY7 A;  5CXO A;  1HU9 A;  5AIG A;  1JB2 A;  4HYZ A;  4NRE A;  2F98 A;  5AII A;  4N6M A;  2C11 A;  2CC3 A;  4R1K A;  3J7Y d;  4WHA A;  3T8N A;  1NB3 I;  1VQ7 3;  2Y73 A;  3PYJ A;  3SX1 A;  3X3Z A;  3OWS A;  3VF1 A;  4MMX B;  1R4C A;  2W6J H;  3CPO A;  3WOF B;  5JPP A;  1TFO A;  4OUQ A;  3CCL 3;  3NQZ A;  1STD A;  2ZDJ A;  3KSP A;  3TDG A;  2F86 B;  4MEI A;  2P38 A;  1VQ4 3;  4LMI A;  3DGL A;  3G4S 3;  2FXT A;  4WWU C;  1WMO A;  3KZT A;  3CME 3;  2P0X A;  2CFL A;  2XEP A;  3HIG A;  5TGN A;  2MF7 A;  2D42 A;  1OHS A;  3PCR A;  3QRD A;  4N6L A;  1JKG B;  4O02 B;  4XDV A;  2XH9 A;  4BTX A;  3HI7 A;  4STD A;  1LXE A;  2WGQ A;  2XSH B;  4R4K A;  1CEW I;  2STD A;  1IV9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...