3A76A

The crystal structure of lina
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
147
structure length
147
Chain Sequence
MSDLDRLASRAAIQDLYSDKLIAVDKRQEGRLASIWWDDAEWTIEGIGTYKGPEGALDLANNVLWPMFHECIHYGTNLRLEFVSADKVNGIGDVLLLGNLVEGNQSILIAAVFTDEYERRDGVWKFSKRNACTNYFTPLAGIHFAPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gamma-hexachlorocyclohexane dehydrochlorinase
publication title Crystal structure of g-hexachlorocyclohexane dehydrochlorinase LinA from Sphingobium japonicum UT26
pubmed doi rcsb
source organism Sphingomonas paucimobilis
molecule tags Lyase
total genus 43
structure length 147
sequence length 147
chains with identical sequence B, C
ec nomenclature ec 4.5.1.-:
pdb deposition date 2009-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13577 SnoaL_4 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3a76A01
1DMQA 5BXQA 4WYKA 3MYTA 2UX0A 1ZX2A 1STDA 5IF6A 5IG0A 3K0ZA 3M8CA 4HM1B 3OWYA 5AI1A 4HM5B 1OUNA 5KP4A 2RFRA 4HVNA 4Q53A 2GBXB 1QJGA 3EJVA 1JB5A 2RGQA 1VZZA 2A15A 2HMNB 1QMAA 5KP3A 3NV0B 1S5AA 1JN5A 3GZRA 2B24B 4LMIA 1EG9B 3BLZA 3GZYB 1W02A 4IIAA 3JUNA 3FGYA 3T8UA 4U13A 1ULJB 2K54A 1GS3A 1ISKA 3F8HA 2HMOB 4HM7B 3F8XA 1W6YA 3KZTA 2GEXA 5IG4A 3F9SA 5IG5A 4OVMA 5AIIA 5IENA 4XBTA 1E97A 3H3HA 2F99A 4MJDA 2F86B 4R9LA 3DMCA 2RCDA 3UJMA 1GY7A 1GYBA 2BMRB 2HMKB 5CK6A 3OV4A 2GEYA 3FF0A 3CNXA 5D81A 1JKGB 3MSOA 1EA2A 4K1UA 2W2CA 3F40A 4J8TA 3NV0A 2YFIB 1U5OA 5IG3A 3EC9A 5CF2A 2JQ5A 8CHOA 1WQLB 2BMOB 3SOYA 4HM4B 1TUHA 4HZBB 3I0YA 2CHCA 2XSOB 1ASKA 1ZO2A 4HM3B 2R4IA 3WMDA 1Q40B 4L8PA 1CQSA 3FH1A 4H3UA 2HMLB 1W00A 2QIYA 1GY5A 5TGNA 1JB4A 3JUOA 1OHSA 3G16A 5CXOA 2QGUA 3IPTA 3NBRA 2YFLB 2XRXB 1JKGA 3MG2A 3F7SA 3OWUA 3B4OA 4HZ9B 3ECFA 4RZMA 3FSDA 5FW5A 3F7XA 4CDLA 5D82A 5BVBA 4STDA 2STDA 3KKGA 3UNLA 3NXJA 5EVHA 3OX9A 1O7WB 6STDA 3EN8A 4J9AA 3NHXA 1ULIB 5AIGA 1C7HA 3BB9A 4KVHA 5DREA 5AIFA 2F98A 3FLJA 4HM6B 1DMMA 1NDOB 3JUPA 4WP5A 1Q42A 1Q40A 2INXA 1NWWA 2YFJB 3H51A 3SEDA 1OPYA 4LGQA 3EF8A 4K1VA 3F14A 3KSPA 3CNMA 2BNGA 4HM0B 1A2KA 3LYGA 1OCVA 4GB5A 4LEHA 3EX9A 5HGRA 4R9KA 7STDA 3K7CA 3FZWA 3CU3A 5CLKA 2BMQB 3HZPA 1IDPA 5G2GA 3EHCA 3EBYA 5DRVA 1UUWB 1Z1SA 1JB2A 3RGRA 3DM8A 3JUMA 4OUQA 3DUKA 3EN1B 1GY6A 2OWPA 1SJWA 3HX8A 2HMJB 3NM2A 4L8OA 3STDA 4XB5A 1NU3A 4XDWA 3A76A 1O7HB 1HKXA 2PZVA 4XBYA 4HM2B 3G0KA 2IMJA 4ORLA 2GBWB 4R1KA 1DMNA 3OWSA 4X2OA 5JPPA 1K41A 5KP1A 3GRDA 1E3RA 4X2HA 1O7MB 4I4KA 5IEPA 5CF1A 2XSHB 5AIHA 3MHEA 3T8NA 4PEJA 1TP6A 3ROBA 3MG1A 1OF5B 3GWRA 4XM4A 1OHPA 2CKFB 5IEOA 4N3VA 2HMMB 3EQQB 3S5CA 4HKVB 3MKIA 3DXOA 1O7PB 3E99A 3B4PA 3LZAA 3VSYA 3RGAA 4WYKB 4WWUC 3EBTA 1OH0A 3FKAA 2I9WA 5IERA 5JPUA 5STDA 5AEWB 1OGZA 1W01A 2XR8B 3HK4A 3VGNA 3JUQA 3NUVA 3MG3A 1O7GB 3GZXB 3D9RA 2Z77A 1BUQA 1OHOA 4FCJA 1OGXA 3KE7A 3B7CA 2Z76A 1AR0A 3SOAA 5AEUB 1JN5B 4XBXA 5D83A 4HJLB 3B8LA 4XDVA 3GZBA 1E3VA 4HM8B 1OF5A 3CPOA 3Q90A 3DZLA 2B1XB 3ER7A 3G8ZA 1UUVB 3FF2A 4L7KA 4FCMA 2Z7AA 3OXAA 1O7NB 2GXFA
chains in the Genus database with same CATH superfamily
1L5GB 1R4CA 3U97A 1BRNL 1DMQA 1FW7A 3FCSB 1WMOA 1LXEA 5BXQA 3CCJ3 4LSOA 4WYKA 3D3LA 3BNCA 3MYTA 2W56B 4KT3B 2UX0A 2W9PA 3EE1A 1BVIA 1BRJA 4EC6A 1B20A 1ROVA 1VQ93 1ZX2A 3QRDA 1STDA 3UL5A 1BAOA 1F8NA 1PU4A 3CCQ3 5IF6A 4JF8A 1LQMB 1BSDA 1RSNA 1BNEA 5IG0A 5A0OB 3N8BA 2SARA 4K90B 1G0TA 3DY5A 3K0ZA 3M8CA 4HM1B 1SPUA 3CC43 3OWYA 5AI1A 1D6ZA 1YIT3 4HM5B 4ILFA 2FXTA 1QVG2 1OUNA 2BIRA 5KP4A 1RMSA 2L1SA 1GSPA 2RFRA 1BIRA 4HVNA 4Q53A 2GBXB 1RRHA 1FZUA 2BO9B 1QJGA 1JZDA 4FCZA 3EJVA 1IVWA 4O3VA 1JB5A 3ALAA 1VQ53 1I2EA 3SVAA 1FYSA 1GMQA 1MWUA 1KD14 2RGQA 1VZZA 2LYXA 2A15A 2HMNB 3Q2PA 3PCRA 3CCS3 1QMAA 2ML6A 5KP3A 2IUKA 3NV0B 1S5AA 1JN5A 4KFDA 3GZRA 1FGMA 4HOHA 2IYJA 6GSPA 2B24B 1B2MA 1RGHA 3BNBA 4LMIA 1W4NA 2F4YA 2RNTA 2OOVC 2WGQA 1EG9B 4EV5A 5FGOA 2FGTA 3BLZA 3GZYB 3CPW2 2QEX3 1W02A 3NBJA 2OQEA 4J5KA 4IIAA 3JUNA 1TFOA 1B2XA 3FGYA 3T8UA 3I563 2W9QA 3L0RA 2SBLA 1M9GA 1ULJB 2K54A 1GS3A 4U13A 1VQ73 1WMPA 1VQN3 1ISKA 3F8HA 2GU3A 1ZS7A 2HMOB 1YI23 4HM7B 3DGLA 5I97A 3AGNA 1BRGA 3RNTA 3WA3A 1PY3A 3F8XA 3I553 1GOYA 1RN1A 1V58A 2GU1A 1WNHA 4MMYB 5RNTA 1IQYA 2Y74A 3FG3A 1W6YA 3KZTA 2GEXA 2D1WA 1W7CA 2RSXA 4G1MB 2JDIH 5IG4A 2O9UX 3F9SA 5IG5A 4OVMA 4KZ1A 2W56A 1GMRA 1Q824 1VQL3 5AIIA 4NPBA 1MGWA 3S28A 5IENA 1BNIA 1UUGB 4XBTA 1E97A 3H3HA 2CFKA 1K28A 1UI8A 2F99A 1VQQA 1QVF2 4MJDA 4EXRA 2KAAA 1DVDA 1N9EA 1IQ8A 2F86B 3CD63 3S27A 1UCKA 4R9LA 2WOFA 2RCDA 1RHLA 3DMCA 2AADA 1RTUA 2CW9A 3UJMA 3HIIA 2E2VA 3N54B 1GY7A 1GYBA 2BMRB 2HMKB 2KF4A 1EEJA 1BGSA 1IYYA 1CYVA 5CK6A 3OV4A 2GEYA 4AEQA 3FF0A 3G713 3CNXA 1JKGB 2CFWA 1BRIA 5D81A 2XGNA 3WA2X 1JRQA 3AMOB 1GMPA 3MSOA 1EA2A 4K1UA 2W2CA 2K3DA 3LH4A 4CPKA 2ZDJA 1FUSA 2Q07A 1AY7A 3F40A 4J8TA 2F56A 1DE3A 4IT7A 5G1KA 2CX0A 3NV0A 4EW5A 2P05A 2XF3A 1IK3A 3CC73 1K8A4 1RLSA 2UUGC 2YFIB 1U5OA 3IMAB 1K734 3K9MC 3WDGB 1BOXA 5ELUA 5IG3A 3EC9A 4R4KA 1MWRA 1AQZA 2JQ5A 5CF2A 2LQVA 1RGGA 8CHOA 1RCKA 1WQLB 1A90A 2BMOB 1RRLA 3LT8A 3S67A 1LOWA 2KCDA 1U8CB 1W2ZA 3SOYA 1A2PA 2WOHA 4HM4B 1TUHA 1KC84 2RBIA 4HZBB 3I0YA 1JBTA 5LC6A 2CHCA 3WHOA 2XSOB 1MGRA 1CH0A 3LTAA 1IT7A 1I3IA 1ASKA 4MMXB 1YNVX 5BU4A 3PGBA 4QWTA 1ZO2A 3CCE3 4HM3B 2R4IA 3WMDA 1Q40B 4MMZB 1STFI 4L8PA 5EEOA 2OOVA 1CQSA 1NJI4 1DETA 2J8XB 3LMLA 3FH1A 1SARA 5M19A 3Q3FA 5JBSA 4H3UA 1W6CA 3SLUA 1LVNA 1YHQ3 1R4YA 1T3BA 2HMLB 1W6GA 1BUJA 3SX1A 1W00A 2QIYA 4R80A 4DKIA 1GY5A 3WOEB 3UL6A 3AHWA 5ELJA 3X41A 3A5EA 4O8SA 5TGNA 1JB4A 4WFOA 3JUOA 4HAAA 2KF3A 4KFEA 1OHSA 1JNQA 4FMBA 2PNCA 3S29A 1N5HA 3G16A 5CXOA 1BSAA 2W03A 4RBNA 7RNTA 1M904 2Z6BA 1DVCA 1T2HA 1BU4A 1LQGC 2QGUA 3IPTA 1C54A 3CCL3 3MWZA 2XEPA 3NBRA 2YFLB 2XRXB 1IV9A 1JKGA 3MG2A 2CWUA 3PYJA 1J2BA 3DGYA 1BSCA 3F7SA 2CFLA 3OWUA 2XH9A 3B4OA 4NREA 4HZ9B 1BRKA 3ECFA 1V57A 3BNDA 3GAXA 1MWTA 4RZMA 2L4VA 5IW9A 3FSDA 5FW5A 3F7XA 3X3ZA 6RNTA 1BNSA 4CDLA 1JBRA 2CC3A 1IT8A 5D82A 5BVBA 4STDA 4RNYA 2STDA 2IA7A 4FR9A 1NNVA 3HI7A 1LNHA 3KKGA 3NXJA 3UNLA 5EVHA 3KN4A 3LTBA 3OX9A 1O7WB 3PXMA 4BU4A 1RKYA 1BRSA 3LTCA 1IVVA 1N8QA 2ML5A 6STDA 1X1YA 3EN8A 4CCVA 1GD3A 4J9AA 4EYCA 1CYUA 1UDII 3NHXA 1GOVA 3LXUX 2KF6A 1ULIB 2HOHA 5AIGA 4I5QA 1FGQA 4O2HA 1C7HA 3BB9A 4KVHA 5DREA 1BSBA 5AIFA 1B2ZA 2F98A 3K5TA 1VQK3 2KRTA 3FLJA 1I0VA 3TDGA 4HM6B 1DMMA 1NDOB 3JUPA 5AYRB 1BSEA 4WP5A 1Q42A 2V1LA 3DGOA 1Q40A 3U1WA 1JV2B 2INXA 2UGIA 1Y4KA 1NWWA 2YFJB 2F5MA 3H51A 1V74A 3SEDA 1OPYA 1Q864 1RNBA 3T0UA 4LGQA 1BANA 3CXC2 1Q9EA 2CX1A 3EF8A 3LT9A 2R41A 4K1VA 3G4S3 4BTWA 3F14A 1YVSA 2CFGA 2KF5A 3IJEB 3KSPA 3CNMA 1RGLA 2H0HA 2OCTA 1A67A 2BNGA 1CEWI 4HM0B 4ZM8A 1D6YA 4BL3A 1A2KA 4HBRA 1AVKA 2F5WA 3LYGA 1OCVA 1UI7A 1FGOA 3GSPA 3KSED 3UB1A 1A2VA 4GB5A 1BNGA 4LEHA 4CJNA 1TU5A 1VQO3 2CWTA 1TIJA 2CFDA 3EX9A 4KFFA 4NHFA 3NBBA 1FGTA 2WGOA 5HGRA 4R9KA 7STDA 3K7CA 5GSPA 3FZWA 4IPBA 3CU3A 5CLKA 1HYFA 1FUWA 1VQP3 1TRQA 1DYUA 1LOXA 2BMQB 3HZPA 1IDPA 2IUJA 1JJ22 1PYLA 1VQ43 4N6UA 5G2GA 3ZFZA 1IQXA 2QA43 3NQYA 3EHCA 3EBYA 4H61A 3ZG5A 4BL2A 3PZWA 5DRVA 1UUWB 3NQZA 1RNTA 1Z1SA 1JB2A 1AV4A 3D79A 3RGRA 1YVBI 1IVUA 3AGOA 3D4AA 3DM8A 3JUMA 4OUQA 3DUKA 3SYUA 3EN1B 1LRAA 1UGIA 1FA3A 5HOHA 1GY6A 2OWPA 1SJWA 3HX8A 5G1LA 1KSIA 2HMJB 3NM2A 3G6E3 3V98A 4N6LA 4L8OA 4GL6A 3NM7A 3RDEA 4RNZA 5AYSC 1B3SA 1BNJA 1EKMA 3V99A 1T5YA 3STDA 4XB5A 1TJDA 1MNLA 1NO3A 4N6V0 2D42A 4GHOA 1NU3A 4XDWA 3A76A 1O7HB 1D6UA 2MF7A 2CH9A 1YJW3 1HKXA 4N6OB 1RN7A 2PZVA 4XBYA 1GOUA 4HM2B 3G0KA 2OTL3 2GSPA 3PS8A 4BTXA 2IMJA 4LYLB 1IV7A 3NX0A 4ORLA 2E2UA 1K9M4 1OACA 2GBWB 1RGEA 1N9JA 1DMNA 4R1KA 1BNRA 3OWSA 2K0MA 4X2OA 5JPPA 1I8VA 3Q1CA 1K41A 3KFQC 3O8YA 2BU4A 3CCV3 1RCLA 1LOVA 4BTYA 5KP1A 4K61A 3CCR3 1JZOA 1TRPA 3GRDA 1QAFA 1E3RA 2WO0A 4GSPA 5EQLA 1LOYA 1O7MB 4X2HA 1W5ZA 3VF1A 1X1WA 4I4KA 5IEPA 2CK3H 4FMDA 1N5PA 1RGAA 3WR2A 5CF1A 2XSHB 1KQS2 1UGHI 1LNIA 4OK0A 5AIHA 1FUTA 3D5GA 3MHEA 1YJN3 3AMOA 3T8NA 5LC7A 1SQWA 3X3YA 3DGNA 3K63A 2BT3A 4PEJA 2CG1A 1B21A 1GD4A 3EB8A 4TX4A 1M1XB 1WTHA 1HU9A 1MOLA 3KIIA 2IY2A 1EUIC 1TP6A 1KWIA 2CG0A 3DGMA 3MG1A 3ROBA 3V92A 3CC23 1OF5B 3GWRA 4XM4A 1N8R4 3KCHA 2M7OA 1T2IA 1IVXA 3X3XA 1QAKA 1OHPA 2CKFB 1RJOA 1UCIA 5IEOA 4N3VA 4AKZA 4BIRA 2HMMB 3EQQB 2ZA4A 3S5CA 2XFTA 3CMA3 1I3FA 4HKVB 4J5GA 1NB5I 3MKIA 3WOFB 2ZL8A 9RNTA 3DH2A 3DXOA 1YJ93 3X40A 1O7PB 3OW22 3E99A 3URPA 1TFKA 1UCJA 1I0XA 1ZGXA 1PFPA 2W04A 1B2UA 3B4PA 3LZAA 1MWSA 3VSYA 3RGAA 4RNTA 2P38A 1G96A 3X42A 4WYKB 1YIJ3 2FNQA 4WWUC 3FG4A 4WHAA 3EBTA 1VQ83 3BIRA 4EBGA 1W2B2 1ROAA 1OH0A 5BIRA 1Q814 2CWVA 3CME3 4AKYA 3FKAA 4FMAA 2O3OA 2I9WA 1VQM3 3SXXA 1S723 3FG1A 5IERA 1UW1A 2YX9A 3MPHA 5JPUA 1RDSA 5STDA 4N6MA 5AEWB 1OGZA 1SIHA 3BNEA 7GSPA 1RN4A 1W01A 1G02A 2P0MA 1VQ63 1Q7Y4 4LZIA 4O02B 2XR8B 3HK4A 3VGNA 4N6NB 3JUQA 2XFSA 3JVCA 3MG3A 3NUVA 3BU4A 1O7GB 3GZXB 3D9RA 2XGLA 2OQEC 2Z77A 1BNFA 4N6TA 1BUQA 1OHOA 4FCJA 2KXGA 1EQKA 2MC8A 1OGXA 3KE7A 1B27A 3B7CA 1I2FA 1QALA 3PCSA 2Z76A 1RGKA 2ZHXB 1AR0A 1M1K4 4MEIA 2W0QA 3SOAA 5AEUB 1B2SA 3WODG 2C4BA 1JN5B 1X1XA 2H0IA 4XBXA 5M18A 1US1A 5D83A 4HJLB 3B8LA 4XDVA 3GZBA 1X1UA 1RGCA 3HIGA 3QK9A 1E3VA 4JRFA 4HM8B 1SIIA 1UCLA 4EV2A 1TTOA 2P0XA 3J7Yd 1YGWA 2OTJ3 2BHMA 1OF5A 3LTDA 3CPOA 2C11A 2E2TA 4FMCA 8RNTA 2C10A 1JBSA 3Q90A 1IU7A 3CCU3 1Q7HA 3DZLA 3D5IA 2Y73A 3CCM3 1FGRA 1AVLA 2B1XB 2CIUA 3ER7A 3G8ZA 1YGEA 1RGFA 1UUVB 1HZ1A 2AAEA 3FF2A 3HOHA 4L7KA 3N9HA 4FCMA 2Z7AA 3AHSA 2W6JH 2H0GA 1BRHA 2P09A 3OXAA 5M1AA 3LOYA 1WMNA 1NB3I 1O7NB 2GXFA 3ZG0A 1I2GA 1I70A 4HYZA
chains in the Genus database with same CATH topology
1L5GB 1R4CA 3U97A 1DMQA 3FCSB 1WMOA 1LXEA 5BXQA 3CCJ3 4LSOA 4WYKA 3D3LA 3BNCA 3MYTA 2W56B 2UX0A 2W9PA 3EE1A 4EC6A 1ROVA 1VQ93 1ZX2A 3QRDA 1STDA 3UL5A 1F8NA 1PU4A 3CCQ3 5IF6A 4JF8A 5IG0A 5A0OB 3N8BA 4K90B 3DY5A 3K0ZA 3M8CA 4HM1B 1SPUA 3CC43 3OWYA 5AI1A 1D6ZA 1YIT3 4HM5B 2FXTA 1QVG2 1OUNA 5KP4A 2RFRA 4HVNA 4Q53A 2GBXB 1RRHA 2BO9B 1QJGA 4FCZA 3EJVA 1IVWA 4O3VA 1JB5A 3ALAA 1VQ53 3SVAA 1KD14 2RGQA 1VZZA 2LYXA 2A15A 2HMNB 3Q2PA 3PCRA 3CCS3 1QMAA 2ML6A 5KP3A 2IUKA 3NV0B 1S5AA 1JN5A 4KFDA 3GZRA 1FGMA 2B24B 3BNBA 4LMIA 1W4NA 2OOVC 2WGQA 1EG9B 4EV5A 5FGOA 2FGTA 3BLZA 3GZYB 3CPW2 2QEX3 1W02A 3NBJA 2OQEA 4IIAA 3JUNA 1TFOA 3FGYA 3T8UA 3I563 2W9QA 3L0RA 2SBLA 1M9GA 1ULJB 2K54A 1GS3A 4U13A 1VQ73 1WMPA 1VQN3 1ISKA 3F8HA 2GU3A 2HMOB 1YI23 4HM7B 3DGLA 5I97A 3WA3A 3F8XA 3I553 2GU1A 1WNHA 4MMYB 1IQYA 2Y74A 3FG3A 1W6YA 3KZTA 2GEXA 2D1WA 1W7CA 2RSXA 4G1MB 2JDIH 5IG4A 2O9UX 3F9SA 5IG5A 4OVMA 4KZ1A 2W56A 1Q824 1VQL3 5AIIA 5IENA 3S28A 4XBTA 1E97A 3H3HA 2CFKA 1K28A 1UI8A 2F99A 1QVF2 4MJDA 4EXRA 1DVDA 1N9EA 1IQ8A 2F86B 3CD63 3S27A 4R9LA 2WOFA 2RCDA 3DMCA 2CW9A 3UJMA 3HIIA 2E2VA 3N54B 1GY7A 1GYBA 2BMRB 2HMKB 1CYVA 5CK6A 3OV4A 2GEYA 4AEQA 3FF0A 3G713 3CNXA 2CFWA 1JKGB 5D81A 2XGNA 3WA2X 1JRQA 3AMOB 3MSOA 1EA2A 4K1UA 2W2CA 3LH4A 2ZDJA 3F40A 2Q07A 4J8TA 4IT7A 3NV0A 2P05A 2XF3A 1IK3A 3CC73 1K8A4 2YFIB 1U5OA 3IMAB 1K734 3K9MC 3WDGB 5ELUA 5IG3A 3EC9A 4R4KA 5CF2A 2JQ5A 8CHOA 2LQVA 1WQLB 1A90A 2BMOB 1RRLA 3LT8A 3S67A 2KCDA 1U8CB 1W2ZA 3SOYA 2WOHA 4HM4B 1TUHA 1KC84 4HZBB 3I0YA 5LC6A 2CHCA 2XSOB 3LTAA 1IT7A 1ASKA 4MMXB 3PGBA 4QWTA 1ZO2A 3CCE3 4HM3B 2R4IA 3WMDA 1Q40B 4MMZB 1STFI 4L8PA 5EEOA 2OOVA 1CQSA 1NJI4 3LMLA 3FH1A 5JBSA 4H3UA 1W6CA 3SLUA 1LVNA 1YHQ3 2HMLB 1W6GA 3SX1A 1W00A 2QIYA 4R80A 1GY5A 3WOEB 3UL6A 5ELJA 3X41A 4O8SA 5TGNA 1JB4A 4WFOA 3JUOA 4KFEA 1OHSA 1JNQA 4FMBA 2PNCA 3S29A 1N5HA 3G16A 5CXOA 2W03A 4RBNA 1M904 2Z6BA 1DVCA 2QGUA 3IPTA 3CCL3 3MWZA 2XEPA 3NBRA 2YFLB 2XRXB 1IV9A 1JKGA 3MG2A 2CWUA 3PYJA 1J2BA 3F7SA 2CFLA 3OWUA 2XH9A 3B4OA 4NREA 4HZ9B 3GAXA 3ECFA 3BNDA 5IW9A 4RZMA 2L4VA 3FSDA 5FW5A 3F7XA 3X3ZA 4CDLA 2CC3A 1IT8A 5D82A 5BVBA 4STDA 4RNYA 2STDA 2IA7A 4FR9A 3HI7A 1LNHA 3KKGA 3NXJA 3UNLA 5EVHA 3KN4A 3LTBA 3OX9A 1O7WB 3PXMA 1RKYA 6STDA 3LTCA 1IVVA 1N8QA 2ML5A 3EN8A 4CCVA 4EYCA 1GD3A 4J9AA 1CYUA 3NHXA 3LXUX 1ULIB 5AIGA 1FGQA 4O2HA 1C7HA 3BB9A 4KVHA 5DREA 5AIFA 3K5TA 2F98A 1VQK3 2KRTA 3FLJA 3TDGA 4HM6B 1DMMA 1NDOB 3JUPA 5AYRB 4WP5A 1Q42A 2V1LA 3DGOA 1Q40A 3U1WA 1JV2B 2INXA 1Y4KA 1NWWA 2YFJB 3H51A 1V74A 3SEDA 1OPYA 1Q864 3T0UA 4LGQA 3CXC2 3EF8A 3LT9A 4K1VA 3G4S3 4BTWA 3F14A 2CFGA 3IJEB 3KSPA 3CNMA 2OCTA 1A67A 2BNGA 1CEWI 4HM0B 4ZM8A 1D6YA 1A2KA 4HBRA 1AVKA 3LYGA 1OCVA 1UI7A 1FGOA 3KSED 3UB1A 1A2VA 4GB5A 4LEHA 1TU5A 1VQO3 2CWTA 1TIJA 2CFDA 3EX9A 4KFFA 4NHFA 3NBBA 1FGTA 2WGOA 5HGRA 4R9KA 7STDA 3K7CA 3FZWA 4IPBA 3CU3A 5CLKA 1FUWA 1VQP3 1DYUA 1LOXA 2BMQB 3HZPA 1IDPA 2IUJA 1JJ22 1VQ43 4N6UA 5G2GA 1IQXA 2QA43 3NQYA 3EHCA 3EBYA 4H61A 3PZWA 5DRVA 1UUWB 3NQZA 1Z1SA 1JB2A 1AV4A 3RGRA 1YVBI 1IVUA 3DM8A 3JUMA 4OUQA 3DUKA 3EN1B 1FA3A 1GY6A 2OWPA 1SJWA 3HX8A 1KSIA 2HMJB 3NM2A 3G6E3 3V98A 4N6LA 4L8OA 4GL6A 3NM7A 3RDEA 4RNZA 5AYSC 1EKMA 3V99A 1T5YA 3STDA 4XB5A 4N6V0 1MNLA 1NO3A 2D42A 1NU3A 4XDWA 3A76A 1O7HB 1D6UA 2MF7A 2CH9A 1YJW3 1HKXA 4N6OB 1RN7A 2PZVA 4XBYA 4HM2B 3G0KA 2OTL3 3PS8A 4BTXA 2IMJA 1IV7A 3NX0A 4ORLA 2E2UA 1K9M4 1OACA 2GBWB 4R1KA 1N9JA 1DMNA 3OWSA 2K0MA 4X2OA 5JPPA 3Q1CA 1K41A 3KFQC 3O8YA 3CCV3 4BTYA 3CCR3 5KP1A 4K61A 3GRDA 1QAFA 1E3RA 2WO0A 5EQLA 4X2HA 1O7MB 1W5ZA 3VF1A 4I4KA 5IEPA 2CK3H 4FMDA 1N5PA 5CF1A 1KQS2 2XSHB 5AIHA 4OK0A 3MHEA 1YJN3 3AMOA 3T8NA 5LC7A 1SQWA 3X3YA 3DGNA 3K63A 2BT3A 4PEJA 2CG1A 1GD4A 3EB8A 4TX4A 1M1XB 1WTHA 1HU9A 1MOLA 3KIIA 3V92A 1TP6A 3DGMA 1KWIA 2CG0A 3MG1A 3ROBA 3CC23 1OF5B 3GWRA 4XM4A 1N8R4 2M7OA 3X3XA 1IVXA 1QAKA 1OHPA 2CKFB 1RJOA 5IEOA 4N3VA 4AKZA 2HMMB 3EQQB 3S5CA 2XFTA 3CMA3 4HKVB 1NB5I 3MKIA 3WOFB 2ZL8A 3DXOA 1YJ93 3X40A 1O7PB 3OW22 3E99A 1TFKA 1PFPA 2W04A 3B4PA 3LZAA 3VSYA 3RGAA 2P38A 1G96A 3X42A 4WYKB 1YIJ3 2FNQA 4WWUC 3FG4A 4WHAA 3EBTA 1VQ83 4EBGA 1W2B2 1ROAA 1OH0A 1Q814 2CWVA 3CME3 4AKYA 3FKAA 4FMAA 2O3OA 2I9WA 1VQM3 3SXXA 1S723 3FG1A 5IERA 1UW1A 2YX9A 3MPHA 5JPUA 5STDA 4N6MA 5AEWB 1OGZA 1SIHA 3BNEA 1VQ63 1W01A 2P0MA 1Q7Y4 4LZIA 4O02B 2XR8B 3HK4A 3VGNA 4N6NB 3JUQA 2XFSA 3JVCA 3MG3A 3NUVA 1O7GB 3GZXB 3D9RA 2XGLA 2OQEC 2Z77A 4N6TA 1BUQA 1OHOA 4FCJA 2KXGA 1EQKA 2MC8A 1OGXA 3KE7A 3B7CA 1QALA 3PCSA 2Z76A 1AR0A 1M1K4 4MEIA 2W0QA 3SOAA 5AEUB 3WODG 1JN5B 4XBXA 1US1A 5D83A 4HJLB 3B8LA 4XDVA 3GZBA 3HIGA 3QK9A 1E3VA 4JRFA 4HM8B 1SIIA 4EV2A 3J7Yd 2P0XA 2OTJ3 2BHMA 1OF5A 3LTDA 3CPOA 2C11A 2E2TA 4FMCA 2C10A 3Q90A 1IU7A 3CCU3 3DZLA 2Y73A 3CCM3 1FGRA 1AVLA 2B1XB 2CIUA 3ER7A 3G8ZA 1UUVB 1YGEA 3FF2A 4L7KA 3N9HA 4FCMA 2Z7AA 2W6JH 2P09A 3OXAA 3LOYA 1WMNA 1NB3I 1O7NB 2GXFA 4HYZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DMQ A;  5BXQ A;  4WYK A;  3MYT A;  2UX0 A;  1ZX2 A;  1STD A;  5IF6 A;  5IG0 A;  3K0Z A;  3M8C A;  4HM1 B;  3OWY A;  5AI1 A;  4HM5 B;  1OUN A;  5KP4 A;  2RFR A;  4HVN A;  4Q53 A;  2GBX B;  1QJG A;  3EJV A;  1JB5 A;  2RGQ A;  1VZZ A;  2A15 A;  2HMN B;  1QMA A;  5KP3 A;  3NV0 B;  1S5A A;  1JN5 A;  3GZR A;  2B24 B;  4LMI A;  1EG9 B;  3BLZ A;  3GZY B;  1W02 A;  4IIA A;  3JUN A;  3FGY A;  3T8U A;  4U13 A;  1ULJ B;  2K54 A;  1GS3 A;  1ISK A;  3F8H A;  2HMO B;  4HM7 B;  3F8X A;  1W6Y A;  3KZT A;  2GEX A;  5IG4 A;  3F9S A;  5IG5 A;  4OVM A;  5AII A;  5IEN A;  4XBT A;  1E97 A;  3H3H A;  2F99 A;  4MJD A;  2F86 B;  4R9L A;  3DMC A;  2RCD A;  3UJM A;  1GY7 A;  1GYB A;  2BMR B;  2HMK B;  5CK6 A;  3OV4 A;  2GEY A;  3FF0 A;  3CNX A;  5D81 A;  1JKG B;  3MSO A;  1EA2 A;  4K1U A;  2W2C A;  3F40 A;  4J8T A;  3NV0 A;  2YFI B;  1U5O A;  5IG3 A;  3EC9 A;  5CF2 A;  2JQ5 A;  8CHO A;  1WQL B;  2BMO B;  3SOY A;  4HM4 B;  1TUH A;  4HZB B;  3I0Y A;  2CHC A;  2XSO B;  1ASK A;  1ZO2 A;  4HM3 B;  2R4I A;  3WMD A;  1Q40 B;  4L8P A;  1CQS A;  3FH1 A;  4H3U A;  2HML B;  1W00 A;  2QIY A;  1GY5 A;  5TGN A;  1JB4 A;  3JUO A;  1OHS A;  3G16 A;  5CXO A;  2QGU A;  3IPT A;  3NBR A;  2YFL B;  2XRX B;  1JKG A;  3MG2 A;  3F7S A;  3OWU A;  3B4O A;  4HZ9 B;  3ECF A;  4RZM A;  3FSD A;  5FW5 A;  3F7X A;  4CDL A;  5D82 A;  5BVB A;  4STD A;  2STD A;  3KKG A;  3UNL A;  3NXJ A;  5EVH A;  3OX9 A;  1O7W B;  6STD A;  3EN8 A;  4J9A A;  3NHX A;  1ULI B;  5AIG A;  1C7H A;  3BB9 A;  4KVH A;  5DRE A;  5AIF A;  2F98 A;  3FLJ A;  4HM6 B;  1DMM A;  1NDO B;  3JUP A;  4WP5 A;  1Q42 A;  1Q40 A;  2INX A;  1NWW A;  2YFJ B;  3H51 A;  3SED A;  1OPY A;  4LGQ A;  3EF8 A;  4K1V A;  3F14 A;  3KSP A;  3CNM A;  2BNG A;  4HM0 B;  1A2K A;  3LYG A;  1OCV A;  4GB5 A;  4LEH A;  3EX9 A;  5HGR A;  4R9K A;  7STD A;  3K7C A;  3FZW A;  3CU3 A;  5CLK A;  2BMQ B;  3HZP A;  1IDP A;  5G2G A;  3EHC A;  3EBY A;  5DRV A;  1UUW B;  1Z1S A;  1JB2 A;  3RGR A;  3DM8 A;  3JUM A;  4OUQ A;  3DUK A;  3EN1 B;  1GY6 A;  2OWP A;  1SJW A;  3HX8 A;  2HMJ B;  3NM2 A;  4L8O A;  3STD A;  4XB5 A;  1NU3 A;  4XDW A;  3A76 A;  1O7H B;  1HKX A;  2PZV A;  4XBY A;  4HM2 B;  3G0K A;  2IMJ A;  4ORL A;  2GBW B;  4R1K A;  1DMN A;  3OWS A;  4X2O A;  5JPP A;  1K41 A;  5KP1 A;  3GRD A;  1E3R A;  4X2H A;  1O7M B;  4I4K A;  5IEP A;  5CF1 A;  2XSH B;  5AIH A;  3MHE A;  3T8N A;  4PEJ A;  1TP6 A;  3ROB A;  3MG1 A;  1OF5 B;  3GWR A;  4XM4 A;  1OHP A;  2CKF B;  5IEO A;  4N3V A;  2HMM B;  3EQQ B;  3S5C A;  4HKV B;  3MKI A;  3DXO A;  1O7P B;  3E99 A;  3B4P A;  3LZA A;  3VSY A;  3RGA A;  4WYK B;  4WWU C;  3EBT A;  1OH0 A;  3FKA A;  2I9W A;  5IER A;  5JPU A;  5STD A;  5AEW B;  1OGZ A;  1W01 A;  2XR8 B;  3HK4 A;  3VGN A;  3JUQ A;  3NUV A;  3MG3 A;  1O7G B;  3GZX B;  3D9R A;  2Z77 A;  1BUQ A;  1OHO A;  4FCJ A;  1OGX A;  3KE7 A;  3B7C A;  2Z76 A;  1AR0 A;  3SOA A;  5AEU B;  1JN5 B;  4XBX A;  5D83 A;  4HJL B;  3B8L A;  4XDV A;  3GZB A;  1E3V A;  4HM8 B;  1OF5 A;  3CPO A;  3Q90 A;  3DZL A;  2B1X B;  3ER7 A;  3G8Z A;  1UUV B;  3FF2 A;  4L7K A;  4FCM A;  2Z7A A;  3OXA A;  1O7N B;  2GXF A; 
#chains in the Genus database with same CATH topology
 1L5G B;  1R4C A;  3U97 A;  1BRN L;  1DMQ A;  1FW7 A;  3FCS B;  1WMO A;  1LXE A;  5BXQ A;  3CCJ 3;  4LSO A;  4WYK A;  3D3L A;  3BNC A;  3MYT A;  2W56 B;  4KT3 B;  2UX0 A;  2W9P A;  3EE1 A;  1BVI A;  1BRJ A;  4EC6 A;  1B20 A;  1ROV A;  1VQ9 3;  1ZX2 A;  3QRD A;  1STD A;  3UL5 A;  1BAO A;  1F8N A;  1PU4 A;  3CCQ 3;  5IF6 A;  4JF8 A;  1LQM B;  1BSD A;  1RSN A;  1BNE A;  5IG0 A;  5A0O B;  3N8B A;  2SAR A;  4K90 B;  1G0T A;  3DY5 A;  3K0Z A;  3M8C A;  4HM1 B;  1SPU A;  3CC4 3;  3OWY A;  5AI1 A;  1D6Z A;  1YIT 3;  4HM5 B;  4ILF A;  2FXT A;  1QVG 2;  1OUN A;  2BIR A;  5KP4 A;  1RMS A;  2L1S A;  1GSP A;  2RFR A;  1BIR A;  4HVN A;  4Q53 A;  2GBX B;  1RRH A;  1FZU A;  2BO9 B;  1QJG A;  1JZD A;  4FCZ A;  3EJV A;  1IVW A;  4O3V A;  1JB5 A;  3ALA A;  1VQ5 3;  1I2E A;  3SVA A;  1FYS A;  1GMQ A;  1MWU A;  1KD1 4;  2RGQ A;  1VZZ A;  2LYX A;  2A15 A;  2HMN B;  3Q2P A;  3PCR A;  3CCS 3;  1QMA A;  2ML6 A;  5KP3 A;  2IUK A;  3NV0 B;  1S5A A;  1JN5 A;  4KFD A;  3GZR A;  1FGM A;  4HOH A;  2IYJ A;  6GSP A;  2B24 B;  1B2M A;  1RGH A;  3BNB A;  4LMI A;  1W4N A;  2F4Y A;  2RNT A;  2OOV C;  2WGQ A;  1EG9 B;  4EV5 A;  5FGO A;  2FGT A;  3BLZ A;  3GZY B;  3CPW 2;  2QEX 3;  1W02 A;  3NBJ A;  2OQE A;  4J5K A;  4IIA A;  3JUN A;  1TFO A;  1B2X A;  3FGY A;  3T8U A;  3I56 3;  2W9Q A;  3L0R A;  2SBL A;  1M9G A;  1ULJ B;  2K54 A;  1GS3 A;  4U13 A;  1VQ7 3;  1WMP A;  1VQN 3;  1ISK A;  3F8H A;  2GU3 A;  1ZS7 A;  2HMO B;  1YI2 3;  4HM7 B;  3DGL A;  5I97 A;  3AGN A;  1BRG A;  3RNT A;  3WA3 A;  1PY3 A;  3F8X A;  3I55 3;  1GOY A;  1RN1 A;  1V58 A;  2GU1 A;  1WNH A;  4MMY B;  5RNT A;  1IQY A;  2Y74 A;  3FG3 A;  1W6Y A;  3KZT A;  2GEX A;  2D1W A;  1W7C A;  2RSX A;  4G1M B;  2JDI H;  5IG4 A;  2O9U X;  3F9S A;  5IG5 A;  4OVM A;  4KZ1 A;  2W56 A;  1GMR A;  1Q82 4;  1VQL 3;  5AII A;  4NPB A;  1MGW A;  3S28 A;  5IEN A;  1BNI A;  1UUG B;  4XBT A;  1E97 A;  3H3H A;  2CFK A;  1K28 A;  1UI8 A;  2F99 A;  1VQQ A;  1QVF 2;  4MJD A;  4EXR A;  2KAA A;  1DVD A;  1N9E A;  1IQ8 A;  2F86 B;  3CD6 3;  3S27 A;  1UCK A;  4R9L A;  2WOF A;  2RCD A;  1RHL A;  3DMC A;  2AAD A;  1RTU A;  2CW9 A;  3UJM A;  3HII A;  2E2V A;  3N54 B;  1GY7 A;  1GYB A;  2BMR B;  2HMK B;  2KF4 A;  1EEJ A;  1BGS A;  1IYY A;  1CYV A;  5CK6 A;  3OV4 A;  2GEY A;  4AEQ A;  3FF0 A;  3G71 3;  3CNX A;  1JKG B;  2CFW A;  1BRI A;  5D81 A;  2XGN A;  3WA2 X;  1JRQ A;  3AMO B;  1GMP A;  3MSO A;  1EA2 A;  4K1U A;  2W2C A;  2K3D A;  3LH4 A;  4CPK A;  2ZDJ A;  1FUS A;  2Q07 A;  1AY7 A;  3F40 A;  4J8T A;  2F56 A;  1DE3 A;  4IT7 A;  5G1K A;  2CX0 A;  3NV0 A;  4EW5 A;  2P05 A;  2XF3 A;  1IK3 A;  3CC7 3;  1K8A 4;  1RLS A;  2UUG C;  2YFI B;  1U5O A;  3IMA B;  1K73 4;  3K9M C;  3WDG B;  1BOX A;  5ELU A;  5IG3 A;  3EC9 A;  4R4K A;  1MWR A;  1AQZ A;  2JQ5 A;  5CF2 A;  2LQV A;  1RGG A;  8CHO A;  1RCK A;  1WQL B;  1A90 A;  2BMO B;  1RRL A;  3LT8 A;  3S67 A;  1LOW A;  2KCD A;  1U8C B;  1W2Z A;  3SOY A;  1A2P A;  2WOH A;  4HM4 B;  1TUH A;  1KC8 4;  2RBI A;  4HZB B;  3I0Y A;  1JBT A;  5LC6 A;  2CHC A;  3WHO A;  2XSO B;  1MGR A;  1CH0 A;  3LTA A;  1IT7 A;  1I3I A;  1ASK A;  4MMX B;  1YNV X;  5BU4 A;  3PGB A;  4QWT A;  1ZO2 A;  3CCE 3;  4HM3 B;  2R4I A;  3WMD A;  1Q40 B;  4MMZ B;  1STF I;  4L8P A;  5EEO A;  2OOV A;  1CQS A;  1NJI 4;  1DET A;  2J8X B;  3LML A;  3FH1 A;  1SAR A;  5M19 A;  3Q3F A;  5JBS A;  4H3U A;  1W6C A;  3SLU A;  1LVN A;  1YHQ 3;  1R4Y A;  1T3B A;  2HML B;  1W6G A;  1BUJ A;  3SX1 A;  1W00 A;  2QIY A;  4R80 A;  4DKI A;  1GY5 A;  3WOE B;  3UL6 A;  3AHW A;  5ELJ A;  3X41 A;  3A5E A;  4O8S A;  5TGN A;  1JB4 A;  4WFO A;  3JUO A;  4HAA A;  2KF3 A;  4KFE A;  1OHS A;  1JNQ A;  4FMB A;  2PNC A;  3S29 A;  1N5H A;  3G16 A;  5CXO A;  1BSA A;  2W03 A;  4RBN A;  7RNT A;  1M90 4;  2Z6B A;  1DVC A;  1T2H A;  1BU4 A;  1LQG C;  2QGU A;  3IPT A;  1C54 A;  3CCL 3;  3MWZ A;  2XEP A;  3NBR A;  2YFL B;  2XRX B;  1IV9 A;  1JKG A;  3MG2 A;  2CWU A;  3PYJ A;  1J2B A;  3DGY A;  1BSC A;  3F7S A;  2CFL A;  3OWU A;  2XH9 A;  3B4O A;  4NRE A;  4HZ9 B;  1BRK A;  3ECF A;  1V57 A;  3BND A;  3GAX A;  1MWT A;  4RZM A;  2L4V A;  5IW9 A;  3FSD A;  5FW5 A;  3F7X A;  3X3Z A;  6RNT A;  1BNS A;  4CDL A;  1JBR A;  2CC3 A;  1IT8 A;  5D82 A;  5BVB A;  4STD A;  4RNY A;  2STD A;  2IA7 A;  4FR9 A;  1NNV A;  3HI7 A;  1LNH A;  3KKG A;  3NXJ A;  3UNL A;  5EVH A;  3KN4 A;  3LTB A;  3OX9 A;  1O7W B;  3PXM A;  4BU4 A;  1RKY A;  1BRS A;  3LTC A;  1IVV A;  1N8Q A;  2ML5 A;  6STD A;  1X1Y A;  3EN8 A;  4CCV A;  1GD3 A;  4J9A A;  4EYC A;  1CYU A;  1UDI I;  3NHX A;  1GOV A;  3LXU X;  2KF6 A;  1ULI B;  2HOH A;  5AIG A;  4I5Q A;  1FGQ A;  4O2H A;  1C7H A;  3BB9 A;  4KVH A;  5DRE A;  1BSB A;  5AIF A;  1B2Z A;  2F98 A;  3K5T A;  1VQK 3;  2KRT A;  3FLJ A;  1I0V A;  3TDG A;  4HM6 B;  1DMM A;  1NDO B;  3JUP A;  5AYR B;  1BSE A;  4WP5 A;  1Q42 A;  2V1L A;  3DGO A;  1Q40 A;  3U1W A;  1JV2 B;  2INX A;  2UGI A;  1Y4K A;  1NWW A;  2YFJ B;  2F5M A;  3H51 A;  1V74 A;  3SED A;  1OPY A;  1Q86 4;  1RNB A;  3T0U A;  4LGQ A;  1BAN A;  3CXC 2;  1Q9E A;  2CX1 A;  3EF8 A;  3LT9 A;  2R41 A;  4K1V A;  3G4S 3;  4BTW A;  3F14 A;  1YVS A;  2CFG A;  2KF5 A;  3IJE B;  3KSP A;  3CNM A;  1RGL A;  2H0H A;  2OCT A;  1A67 A;  2BNG A;  1CEW I;  4HM0 B;  4ZM8 A;  1D6Y A;  4BL3 A;  1A2K A;  4HBR A;  1AVK A;  2F5W A;  3LYG A;  1OCV A;  1UI7 A;  1FGO A;  3GSP A;  3KSE D;  3UB1 A;  1A2V A;  4GB5 A;  1BNG A;  4LEH A;  4CJN A;  1TU5 A;  1VQO 3;  2CWT A;  1TIJ A;  2CFD A;  3EX9 A;  4KFF A;  4NHF A;  3NBB A;  1FGT A;  2WGO A;  5HGR A;  4R9K A;  7STD A;  3K7C A;  5GSP A;  3FZW A;  4IPB A;  3CU3 A;  5CLK A;  1HYF A;  1FUW A;  1VQP 3;  1TRQ A;  1DYU A;  1LOX A;  2BMQ B;  3HZP A;  1IDP A;  2IUJ A;  1JJ2 2;  1PYL A;  1VQ4 3;  4N6U A;  5G2G A;  3ZFZ A;  1IQX A;  2QA4 3;  3NQY A;  3EHC A;  3EBY A;  4H61 A;  3ZG5 A;  4BL2 A;  3PZW A;  5DRV A;  1UUW B;  3NQZ A;  1RNT A;  1Z1S A;  1JB2 A;  1AV4 A;  3D79 A;  3RGR A;  1YVB I;  1IVU A;  3AGO A;  3D4A A;  3DM8 A;  3JUM A;  4OUQ A;  3DUK A;  3SYU A;  3EN1 B;  1LRA A;  1UGI A;  1FA3 A;  5HOH A;  1GY6 A;  2OWP A;  1SJW A;  3HX8 A;  5G1L A;  1KSI A;  2HMJ B;  3NM2 A;  3G6E 3;  3V98 A;  4N6L A;  4L8O A;  4GL6 A;  3NM7 A;  3RDE A;  4RNZ A;  5AYS C;  1B3S A;  1BNJ A;  1EKM A;  3V99 A;  1T5Y A;  3STD A;  4XB5 A;  1TJD A;  1MNL A;  1NO3 A;  4N6V 0;  2D42 A;  4GHO A;  1NU3 A;  4XDW A;  3A76 A;  1O7H B;  1D6U A;  2MF7 A;  2CH9 A;  1YJW 3;  1HKX A;  4N6O B;  1RN7 A;  2PZV A;  4XBY A;  1GOU A;  4HM2 B;  3G0K A;  2OTL 3;  2GSP A;  3PS8 A;  4BTX A;  2IMJ A;  4LYL B;  1IV7 A;  3NX0 A;  4ORL A;  2E2U A;  1K9M 4;  1OAC A;  2GBW B;  1RGE A;  1N9J A;  1DMN A;  4R1K A;  1BNR A;  3OWS A;  2K0M A;  4X2O A;  5JPP A;  1I8V A;  3Q1C A;  1K41 A;  3KFQ C;  3O8Y A;  2BU4 A;  3CCV 3;  1RCL A;  1LOV A;  4BTY A;  5KP1 A;  4K61 A;  3CCR 3;  1JZO A;  1TRP A;  3GRD A;  1QAF A;  1E3R A;  2WO0 A;  4GSP A;  5EQL A;  1LOY A;  1O7M B;  4X2H A;  1W5Z A;  3VF1 A;  1X1W A;  4I4K A;  5IEP A;  2CK3 H;  4FMD A;  1N5P A;  1RGA A;  3WR2 A;  5CF1 A;  2XSH B;  1KQS 2;  1UGH I;  1LNI A;  4OK0 A;  5AIH A;  1FUT A;  3D5G A;  3MHE A;  1YJN 3;  3AMO A;  3T8N A;  5LC7 A;  1SQW A;  3X3Y A;  3DGN A;  3K63 A;  2BT3 A;  4PEJ A;  2CG1 A;  1B21 A;  1GD4 A;  3EB8 A;  4TX4 A;  1M1X B;  1WTH A;  1HU9 A;  1MOL A;  3KII A;  2IY2 A;  1EUI C;  1TP6 A;  1KWI A;  2CG0 A;  3DGM A;  3MG1 A;  3ROB A;  3V92 A;  3CC2 3;  1OF5 B;  3GWR A;  4XM4 A;  1N8R 4;  3KCH A;  2M7O A;  1T2I A;  1IVX A;  3X3X A;  1QAK A;  1OHP A;  2CKF B;  1RJO A;  1UCI A;  5IEO A;  4N3V A;  4AKZ A;  4BIR A;  2HMM B;  3EQQ B;  2ZA4 A;  3S5C A;  2XFT A;  3CMA 3;  1I3F A;  4HKV B;  4J5G A;  1NB5 I;  3MKI A;  3WOF B;  2ZL8 A;  9RNT A;  3DH2 A;  3DXO A;  1YJ9 3;  3X40 A;  1O7P B;  3OW2 2;  3E99 A;  3URP A;  1TFK A;  1UCJ A;  1I0X A;  1ZGX A;  1PFP A;  2W04 A;  1B2U A;  3B4P A;  3LZA A;  1MWS A;  3VSY A;  3RGA A;  4RNT A;  2P38 A;  1G96 A;  3X42 A;  4WYK B;  1YIJ 3;  2FNQ A;  4WWU C;  3FG4 A;  4WHA A;  3EBT A;  1VQ8 3;  3BIR A;  4EBG A;  1W2B 2;  1ROA A;  1OH0 A;  5BIR A;  1Q81 4;  2CWV A;  3CME 3;  4AKY A;  3FKA A;  4FMA A;  2O3O A;  2I9W A;  1VQM 3;  3SXX A;  1S72 3;  3FG1 A;  5IER A;  1UW1 A;  2YX9 A;  3MPH A;  5JPU A;  1RDS A;  5STD A;  4N6M A;  5AEW B;  1OGZ A;  1SIH A;  3BNE A;  7GSP A;  1RN4 A;  1W01 A;  1G02 A;  2P0M A;  1VQ6 3;  1Q7Y 4;  4LZI A;  4O02 B;  2XR8 B;  3HK4 A;  3VGN A;  4N6N B;  3JUQ A;  2XFS A;  3JVC A;  3MG3 A;  3NUV A;  3BU4 A;  1O7G B;  3GZX B;  3D9R A;  2XGL A;  2OQE C;  2Z77 A;  1BNF A;  4N6T A;  1BUQ A;  1OHO A;  4FCJ A;  2KXG A;  1EQK A;  2MC8 A;  1OGX A;  3KE7 A;  1B27 A;  3B7C A;  1I2F A;  1QAL A;  3PCS A;  2Z76 A;  1RGK A;  2ZHX B;  1AR0 A;  1M1K 4;  4MEI A;  2W0Q A;  3SOA A;  5AEU B;  1B2S A;  3WOD G;  2C4B A;  1JN5 B;  1X1X A;  2H0I A;  4XBX A;  5M18 A;  1US1 A;  5D83 A;  4HJL B;  3B8L A;  4XDV A;  3GZB A;  1X1U A;  1RGC A;  3HIG A;  3QK9 A;  1E3V A;  4JRF A;  4HM8 B;  1SII A;  1UCL A;  4EV2 A;  1TTO A;  2P0X A;  3J7Y d;  1YGW A;  2OTJ 3;  2BHM A;  1OF5 A;  3LTD A;  3CPO A;  2C11 A;  2E2T A;  4FMC A;  8RNT A;  2C10 A;  1JBS A;  3Q90 A;  1IU7 A;  3CCU 3;  1Q7H A;  3DZL A;  3D5I A;  2Y73 A;  3CCM 3;  1FGR A;  1AVL A;  2B1X B;  2CIU A;  3ER7 A;  3G8Z A;  1YGE A;  1RGF A;  1UUV B;  1HZ1 A;  2AAE A;  3FF2 A;  3HOH A;  4L7K A;  3N9H A;  4FCM A;  2Z7A A;  3AHS A;  2W6J H;  2H0G A;  1BRH A;  2P09 A;  3OXA A;  5M1A A;  3LOY A;  1WMN A;  1NB3 I;  1O7N B;  2GXF A;  3ZG0 A;  1I2G A;  1I70 A;  4HYZ A; 
#chains in the Genus database with same CATH homology
 1L5G B;  1R4C A;  3U97 A;  1DMQ A;  3FCS B;  1WMO A;  1LXE A;  5BXQ A;  3CCJ 3;  4LSO A;  4WYK A;  3D3L A;  3BNC A;  3MYT A;  2W56 B;  2UX0 A;  2W9P A;  3EE1 A;  4EC6 A;  1ROV A;  1VQ9 3;  1ZX2 A;  3QRD A;  1STD A;  3UL5 A;  1F8N A;  1PU4 A;  3CCQ 3;  5IF6 A;  4JF8 A;  5IG0 A;  5A0O B;  3N8B A;  4K90 B;  3DY5 A;  3K0Z A;  3M8C A;  4HM1 B;  1SPU A;  3CC4 3;  3OWY A;  5AI1 A;  1D6Z A;  1YIT 3;  4HM5 B;  2FXT A;  1QVG 2;  1OUN A;  5KP4 A;  2RFR A;  4HVN A;  4Q53 A;  2GBX B;  1RRH A;  2BO9 B;  1QJG A;  4FCZ A;  3EJV A;  1IVW A;  4O3V A;  1JB5 A;  3ALA A;  1VQ5 3;  3SVA A;  1KD1 4;  2RGQ A;  1VZZ A;  2LYX A;  2A15 A;  2HMN B;  3Q2P A;  3PCR A;  3CCS 3;  1QMA A;  2ML6 A;  5KP3 A;  2IUK A;  3NV0 B;  1S5A A;  1JN5 A;  4KFD A;  3GZR A;  1FGM A;  2B24 B;  3BNB A;  4LMI A;  1W4N A;  2OOV C;  2WGQ A;  1EG9 B;  4EV5 A;  5FGO A;  2FGT A;  3BLZ A;  3GZY B;  3CPW 2;  2QEX 3;  1W02 A;  3NBJ A;  2OQE A;  4IIA A;  3JUN A;  1TFO A;  3FGY A;  3T8U A;  3I56 3;  2W9Q A;  3L0R A;  2SBL A;  1M9G A;  1ULJ B;  2K54 A;  1GS3 A;  4U13 A;  1VQ7 3;  1WMP A;  1VQN 3;  1ISK A;  3F8H A;  2GU3 A;  2HMO B;  1YI2 3;  4HM7 B;  3DGL A;  5I97 A;  3WA3 A;  3F8X A;  3I55 3;  2GU1 A;  1WNH A;  4MMY B;  1IQY A;  2Y74 A;  3FG3 A;  1W6Y A;  3KZT A;  2GEX A;  2D1W A;  1W7C A;  2RSX A;  4G1M B;  2JDI H;  5IG4 A;  2O9U X;  3F9S A;  5IG5 A;  4OVM A;  4KZ1 A;  2W56 A;  1Q82 4;  1VQL 3;  5AII A;  5IEN A;  3S28 A;  4XBT A;  1E97 A;  3H3H A;  2CFK A;  1K28 A;  1UI8 A;  2F99 A;  1QVF 2;  4MJD A;  4EXR A;  1DVD A;  1N9E A;  1IQ8 A;  2F86 B;  3CD6 3;  3S27 A;  4R9L A;  2WOF A;  2RCD A;  3DMC A;  2CW9 A;  3UJM A;  3HII A;  2E2V A;  3N54 B;  1GY7 A;  1GYB A;  2BMR B;  2HMK B;  1CYV A;  5CK6 A;  3OV4 A;  2GEY A;  4AEQ A;  3FF0 A;  3G71 3;  3CNX A;  2CFW A;  1JKG B;  5D81 A;  2XGN A;  3WA2 X;  1JRQ A;  3AMO B;  3MSO A;  1EA2 A;  4K1U A;  2W2C A;  3LH4 A;  2ZDJ A;  3F40 A;  2Q07 A;  4J8T A;  4IT7 A;  3NV0 A;  2P05 A;  2XF3 A;  1IK3 A;  3CC7 3;  1K8A 4;  2YFI B;  1U5O A;  3IMA B;  1K73 4;  3K9M C;  3WDG B;  5ELU A;  5IG3 A;  3EC9 A;  4R4K A;  5CF2 A;  2JQ5 A;  8CHO A;  2LQV A;  1WQL B;  1A90 A;  2BMO B;  1RRL A;  3LT8 A;  3S67 A;  2KCD A;  1U8C B;  1W2Z A;  3SOY A;  2WOH A;  4HM4 B;  1TUH A;  1KC8 4;  4HZB B;  3I0Y A;  5LC6 A;  2CHC A;  2XSO B;  3LTA A;  1IT7 A;  1ASK A;  4MMX B;  3PGB A;  4QWT A;  1ZO2 A;  3CCE 3;  4HM3 B;  2R4I A;  3WMD A;  1Q40 B;  4MMZ B;  1STF I;  4L8P A;  5EEO A;  2OOV A;  1CQS A;  1NJI 4;  3LML A;  3FH1 A;  5JBS A;  4H3U A;  1W6C A;  3SLU A;  1LVN A;  1YHQ 3;  2HML B;  1W6G A;  3SX1 A;  1W00 A;  2QIY A;  4R80 A;  1GY5 A;  3WOE B;  3UL6 A;  5ELJ A;  3X41 A;  4O8S A;  5TGN A;  1JB4 A;  4WFO A;  3JUO A;  4KFE A;  1OHS A;  1JNQ A;  4FMB A;  2PNC A;  3S29 A;  1N5H A;  3G16 A;  5CXO A;  2W03 A;  4RBN A;  1M90 4;  2Z6B A;  1DVC A;  2QGU A;  3IPT A;  3CCL 3;  3MWZ A;  2XEP A;  3NBR A;  2YFL B;  2XRX B;  1IV9 A;  1JKG A;  3MG2 A;  2CWU A;  3PYJ A;  1J2B A;  3F7S A;  2CFL A;  3OWU A;  2XH9 A;  3B4O A;  4NRE A;  4HZ9 B;  3GAX A;  3ECF A;  3BND A;  5IW9 A;  4RZM A;  2L4V A;  3FSD A;  5FW5 A;  3F7X A;  3X3Z A;  4CDL A;  2CC3 A;  1IT8 A;  5D82 A;  5BVB A;  4STD A;  4RNY A;  2STD A;  2IA7 A;  4FR9 A;  3HI7 A;  1LNH A;  3KKG A;  3NXJ A;  3UNL A;  5EVH A;  3KN4 A;  3LTB A;  3OX9 A;  1O7W B;  3PXM A;  1RKY A;  6STD A;  3LTC A;  1IVV A;  1N8Q A;  2ML5 A;  3EN8 A;  4CCV A;  4EYC A;  1GD3 A;  4J9A A;  1CYU A;  3NHX A;  3LXU X;  1ULI B;  5AIG A;  1FGQ A;  4O2H A;  1C7H A;  3BB9 A;  4KVH A;  5DRE A;  5AIF A;  3K5T A;  2F98 A;  1VQK 3;  2KRT A;  3FLJ A;  3TDG A;  4HM6 B;  1DMM A;  1NDO B;  3JUP A;  5AYR B;  4WP5 A;  1Q42 A;  2V1L A;  3DGO A;  1Q40 A;  3U1W A;  1JV2 B;  2INX A;  1Y4K A;  1NWW A;  2YFJ B;  3H51 A;  1V74 A;  3SED A;  1OPY A;  1Q86 4;  3T0U A;  4LGQ A;  3CXC 2;  3EF8 A;  3LT9 A;  4K1V A;  3G4S 3;  4BTW A;  3F14 A;  2CFG A;  3IJE B;  3KSP A;  3CNM A;  2OCT A;  1A67 A;  2BNG A;  1CEW I;  4HM0 B;  4ZM8 A;  1D6Y A;  1A2K A;  4HBR A;  1AVK A;  3LYG A;  1OCV A;  1UI7 A;  1FGO A;  3KSE D;  3UB1 A;  1A2V A;  4GB5 A;  4LEH A;  1TU5 A;  1VQO 3;  2CWT A;  1TIJ A;  2CFD A;  3EX9 A;  4KFF A;  4NHF A;  3NBB A;  1FGT A;  2WGO A;  5HGR A;  4R9K A;  7STD A;  3K7C A;  3FZW A;  4IPB A;  3CU3 A;  5CLK A;  1FUW A;  1VQP 3;  1DYU A;  1LOX A;  2BMQ B;  3HZP A;  1IDP A;  2IUJ A;  1JJ2 2;  1VQ4 3;  4N6U A;  5G2G A;  1IQX A;  2QA4 3;  3NQY A;  3EHC A;  3EBY A;  4H61 A;  3PZW A;  5DRV A;  1UUW B;  3NQZ A;  1Z1S A;  1JB2 A;  1AV4 A;  3RGR A;  1YVB I;  1IVU A;  3DM8 A;  3JUM A;  4OUQ A;  3DUK A;  3EN1 B;  1FA3 A;  1GY6 A;  2OWP A;  1SJW A;  3HX8 A;  1KSI A;  2HMJ B;  3NM2 A;  3G6E 3;  3V98 A;  4N6L A;  4L8O A;  4GL6 A;  3NM7 A;  3RDE A;  4RNZ A;  5AYS C;  1EKM A;  3V99 A;  1T5Y A;  3STD A;  4XB5 A;  4N6V 0;  1MNL A;  1NO3 A;  2D42 A;  1NU3 A;  4XDW A;  3A76 A;  1O7H B;  1D6U A;  2MF7 A;  2CH9 A;  1YJW 3;  1HKX A;  4N6O B;  1RN7 A;  2PZV A;  4XBY A;  4HM2 B;  3G0K A;  2OTL 3;  3PS8 A;  4BTX A;  2IMJ A;  1IV7 A;  3NX0 A;  4ORL A;  2E2U A;  1K9M 4;  1OAC A;  2GBW B;  4R1K A;  1N9J A;  1DMN A;  3OWS A;  2K0M A;  4X2O A;  5JPP A;  3Q1C A;  1K41 A;  3KFQ C;  3O8Y A;  3CCV 3;  4BTY A;  3CCR 3;  5KP1 A;  4K61 A;  3GRD A;  1QAF A;  1E3R A;  2WO0 A;  5EQL A;  4X2H A;  1O7M B;  1W5Z A;  3VF1 A;  4I4K A;  5IEP A;  2CK3 H;  4FMD A;  1N5P A;  5CF1 A;  1KQS 2;  2XSH B;  5AIH A;  4OK0 A;  3MHE A;  1YJN 3;  3AMO A;  3T8N A;  5LC7 A;  1SQW A;  3X3Y A;  3DGN A;  3K63 A;  2BT3 A;  4PEJ A;  2CG1 A;  1GD4 A;  3EB8 A;  4TX4 A;  1M1X B;  1WTH A;  1HU9 A;  1MOL A;  3KII A;  3V92 A;  1TP6 A;  3DGM A;  1KWI A;  2CG0 A;  3MG1 A;  3ROB A;  3CC2 3;  1OF5 B;  3GWR A;  4XM4 A;  1N8R 4;  2M7O A;  3X3X A;  1IVX A;  1QAK A;  1OHP A;  2CKF B;  1RJO A;  5IEO A;  4N3V A;  4AKZ A;  2HMM B;  3EQQ B;  3S5C A;  2XFT A;  3CMA 3;  4HKV B;  1NB5 I;  3MKI A;  3WOF B;  2ZL8 A;  3DXO A;  1YJ9 3;  3X40 A;  1O7P B;  3OW2 2;  3E99 A;  1TFK A;  1PFP A;  2W04 A;  3B4P A;  3LZA A;  3VSY A;  3RGA A;  2P38 A;  1G96 A;  3X42 A;  4WYK B;  1YIJ 3;  2FNQ A;  4WWU C;  3FG4 A;  4WHA A;  3EBT A;  1VQ8 3;  4EBG A;  1W2B 2;  1ROA A;  1OH0 A;  1Q81 4;  2CWV A;  3CME 3;  4AKY A;  3FKA A;  4FMA A;  2O3O A;  2I9W A;  1VQM 3;  3SXX A;  1S72 3;  3FG1 A;  5IER A;  1UW1 A;  2YX9 A;  3MPH A;  5JPU A;  5STD A;  4N6M A;  5AEW B;  1OGZ A;  1SIH A;  3BNE A;  1VQ6 3;  1W01 A;  2P0M A;  1Q7Y 4;  4LZI A;  4O02 B;  2XR8 B;  3HK4 A;  3VGN A;  4N6N B;  3JUQ A;  2XFS A;  3JVC A;  3MG3 A;  3NUV A;  1O7G B;  3GZX B;  3D9R A;  2XGL A;  2OQE C;  2Z77 A;  4N6T A;  1BUQ A;  1OHO A;  4FCJ A;  2KXG A;  1EQK A;  2MC8 A;  1OGX A;  3KE7 A;  3B7C A;  1QAL A;  3PCS A;  2Z76 A;  1AR0 A;  1M1K 4;  4MEI A;  2W0Q A;  3SOA A;  5AEU B;  3WOD G;  1JN5 B;  4XBX A;  1US1 A;  5D83 A;  4HJL B;  3B8L A;  4XDV A;  3GZB A;  3HIG A;  3QK9 A;  1E3V A;  4JRF A;  4HM8 B;  1SII A;  4EV2 A;  3J7Y d;  2P0X A;  2OTJ 3;  2BHM A;  1OF5 A;  3LTD A;  3CPO A;  2C11 A;  2E2T A;  4FMC A;  2C10 A;  3Q90 A;  1IU7 A;  3CCU 3;  3DZL A;  2Y73 A;  3CCM 3;  1FGR A;  1AVL A;  2B1X B;  2CIU A;  3ER7 A;  3G8Z A;  1UUV B;  1YGE A;  3FF2 A;  4L7K A;  3N9H A;  4FCM A;  2Z7A A;  2W6J H;  2P09 A;  3OXA A;  3LOY A;  1WMN A;  1NB3 I;  1O7N B;  2GXF A;  4HYZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...