1GMPA

Complex of ribonuclease from streptomyces aureofaciens with 2'-gmp at 1.7 angstroms resolution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
96
structure length
96
Chain Sequence
DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIICGEATQEDYYTGDHYATFSLIDQTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE SA
publication title Complex of ribonuclease from Streptomyces aureofaciens with 2'-GMP at 1.7 A resolution.
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase(guanyloribonuclease)
total genus 26
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1992-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1gmpA00
1BSEA 1BAOA 8RNTA 2KF3A 1I70A 1FUSA 1SARA 6RNTA 1BNIA 1G02A 1BRGA 1R4YA 1FW7A 1BNRA 1I8VA 1BRIA 1GOYA 9RNTA 1HZ1A 1FUTA 1RCKA 3SYUA 1GSPA 2AAEA 1BUJA 1TTOA 1B21A 3BIRA 2HOHA 1GMQA 5RNTA 1UCJA 1RGCA 1UCLA 1HYFA 7RNTA 1C54A 1RGFA 1B27A 2F5WA 3DGYA 1BRSA 1RTUA 2F5MA 1BNSA 1TRQA 3AHWA 1BU4A 1MGRA 1BNFA 1BGSA 1X1XA 3WHOA 1BSBA 5BIRA 2RNTA 1BSCA 1BRKA 1B2SA 1B2MA 4J5KA 1IYYA 1B2XA 1BRHA 1RLSA 1FYSA 1ZGXA 1DE3A 1RGLA 3D5GA 1X1WA 1T2HA 3AGNA 1X1YA 1RMSA 5HOHA 2F4YA 1JBSA 3D4AA 2BU4A 1RNTA 1Q9EA 1YGWA 3HOHA 1RGKA 1B20A 1DETA 1MGWA 1AY7A 1RGAA 2SARA 1PY3A 3WR2A 3AHSA 1RCLA 1BOXA 1JBRA 2ZA4A 4RNTA 4HAAA 3AGOA 1BIRA 1BSAA 1I0VA 1YNVX 1BVIA 2RBIA 1GOUA 1GOVA 1BNJA 1RHLA 1UCKA 1A2PA 1JBTA 1LRAA 2F56A 3URPA 1BRJA 2AADA 2KF6A 1BSDA 1LOWA 1BANA 1RDSA 1YVSA 1LOVA 2KF5A 1I3FA 1T2IA 1B2ZA 1PYLA 1BNGA 5GSPA 1CH0A 1UCIA 3DH2A 1LOYA 1LNIA 1TRPA 2GSPA 1RGEA 3RNTA 1I2FA 4GSPA 7GSPA 1I2GA 1AQZA 1X1UA 4GHOA 1B3SA 4BIRA 3Q3FA 1BNEA 1RGGA 1I2EA 5BU4A 3BU4A 1I0XA 2C4BA 2KF4A 3D5IA 1RN1A 3KCHA 6GSPA 4BU4A 1RGHA 1RNBA 1I3IA 1B2UA 3GSPA 1FZUA 2KAAA 1BRNL 1RSNA 1GMPA 4HOHA 1GMRA 4J5GA 2BIRA 1RN4A 3A5EA
chains in the Genus database with same CATH superfamily
5KP4A 1BSEA 3DGOA 3WA2X 1JN5B 3GWRA 1IDPA 1JKGB 3LOYA 1IVVA 3I553 3V92A 2CFWA 3WOEB 1FW7A 1AV4A 3N9HA 3FG4A 1IT8A 1BNRA 4FCZA 2QIYA 9RNTA 3S67A 3ALAA 4K90B 2OQEA 3ECFA 4LZIA 5D83A 4HZBB 1RCKA 1PFPA 2AAEA 3CD63 1TTOA 3NBBA 1N9EA 3WODG 2HMMB 3CCE3 1C7HA 3IPTA 1RGCA 2CK3H 3ER7A 4HBRA 3CNXA 1SPUA 4J9AA 1N5HA 2IMJA 3CPOA 3CCV3 3CME3 3DGYA 1D6YA 2F98A 4WFOA 1K9M4 5HGRA 3PXMA 1UUWB 1OF5B 1BNSA 4FR9A 3NX0A 1SIIA 2IYJA 1ZO2A 3JUQA 3MG2A 2YFIB 1EG9B 3V98A 3DM8A 4EW5A 1V74A 3K0ZA 3KSED 2CHCA 1BSBA 1BUQA 1O7GB 1V58A 1BSCA 2HMKB 2E2UA 3K7CA 1B2SA 1OHSA 2IA7A 2OQEC 3GAXA 1IQ8A 1GY6A 1J2BA 2HMJB 2IUJA 1BRHA 1RLSA 2ZL8A 3NQYA 3NM2A 1IYYA 1DE3A 2CFKA 1MWTA 4R9LA 4XDVA 3JUNA 1M1K4 1RMSA 2GXFA 3F8XA 2F4YA 3EHCA 3V99A 1JBSA 3LTBA 3CC23 3D4AA 2F99A 4TX4A 2CIUA 1Q9EA 3HOHA 2RCDA 1K8A4 1O7WB 2SBLA 4KFDA 1MGWA 2UX0A 3NXJA 4L8PA 1QVF2 2K0MA 3GZXB 2W6JH 4H61A 1EKMA 2SARA 2J8XB 3GRDA 3HIGA 2O9UX 1IK3A 2BNGA 1O7MB 3OW22 2ZA4A 2BMQB 1HU9A 4JF8A 4RNTA 1BSAA 1ZX2A 8CHOA 1ULJB 2XSHB 3CCJ3 3PS8A 3K63A 4LYLB 3SVAA 1UCKA 1A2PA 3T0UA 1LRAA 2FGTA 3F8HA 2F56A 4OUQA 4Q53A 1MOLA 1BRJA 5JBSA 1LOWA 3GZBA 3L0RA 1D6UA 4FMAA 2PZVA 1I3FA 1T2IA 3F7XA 3U1WA 4X2OA 1W6CA 1IT7A 1BNGA 2QA43 3EF8A 4HM2B 4LSOA 1TRPA 2GSPA 2ML5A 3NBRA 1KQS2 4GSPA 4JRFA 4HM3B 1RRHA 4HM4B 3X40A 5KP1A 5CK6A 1S5AA 3Q1CA 4XB5A 4RBNA 3Q3FA 5EVHA 3N8BA 2CH9A 3B7CA 5BU4A 1VQN3 1I0XA 3SXXA 2C4BA 2CFGA 2KF4A 2OCTA 6GSPA 4U13A 2IY2A 5KP3A 4HM7B 1RGHA 4IPBA 4KVHA 1RNBA 4LMIA 1I3IA 4BTYA 1B2UA 1OCVA 1ROVA 2XR8B 2XSOB 4HYZA 4MEIA 1DVDA 4AEQA 3BB9A 1FGMA 1A67A 2A15A 3X3YA 1UUVB 2KF5A 5IW9A 1TFOA 1BAOA 1DVCA 2CG0A 3F40A 2OOVC 4L8OA 1I70A 1STDA 5EEOA 2D42A 1SARA 2HMOB 3CPW2 2W2CA 5ELJA 1Q824 3DGMA 1YHQ3 3LT9A 3BNDA 4HM5B 3CMA3 1I8VA 1GOYA 3PGBA 4NHFA 5G1KA 2Y73A 4J8TA 3RGAA 3VSYA 1KD14 1AVKA 3Q90A 2OTL3 3F7SA 5IERA 3NV0A 5ELUA 1GSPA 2I9WA 2Z7AA 2RGQA 3T8UA 2HOHA 1GMQA 4MMYB 3HI7A 1WMOA 1UCJA 3FLJA 1GD4A 3EX9A 2W0QA 4RNYA 1Q814 1K28A 2CX1A 5M1AA 2XGNA 1QAKA 1OH0A 1HYFA 1UCLA 3CNMA 3LXUX 1VQQA 2E2VA 2XH9A 4HM6B 1EA2A 1EUIC 1QALA 2P38A 2F5WA 1BRSA 1ZS7A 1UGIA 2B24B 1JN5A 1JJ22 3UL6A 1JKGA 4O3VA 1MGRA 4HM1B 3EQQB 1BGSA 1V57A 3DGNA 4N6OB 4WP5A 1IU7A 1GYBA 1CYVA 2KCDA 5AEUB 1B2MA 4J5KA 3RDEA 3G4S3 1MNLA 3BNCA 3AMOB 1VQ83 1IV7A 5AIHA 4FCMA 2H0IA 4I5QA 5HOHA 1X1YA 3WA3A 2H0GA 4BTXA 2W04A 1LOXA 1DMNA 1UDII 1Q40B 1AR0A 4EC6A 1Q864 4QWTA 1W2ZA 1SJWA 2CWUA 1VQ43 3VGNA 1OF5A 1YJ93 1WNHA 2M7OA 2QEX3 1WQLB 2WGQA 2PNCA 3DUKA 1VQO3 1JBRA 1UW1A 1US1A 2P09A 3AGOA 3UB1A 3B4PA 5IF6A 3FKAA 1BVIA 3CC43 1GOUA 3S27A 1OHOA 1YIT3 1RHLA 3OWYA 1ULIB 2GBWB 1TIJA 3PCRA 2CFDA 1RJOA 1BANA 1YVSA 3LH4A 1O7PB 1OPYA 1B2ZA 3WDGB 1F8NA 3PCSA 1W01A 3CC73 1A90A 2GU1A 4N6V0 1LNIA 1M904 2CC3A 4R9KA 5EQLA 4WHAA 4CDLA 3U97A 1CEWI 1G96A 1QVG2 2GEYA 2BHMA 3FSDA 4MMXB 1IVUA 2GU3A 3OV4A 1I2GA 2CKFB 4GHOA 3HK4A 3CCU3 1OGZA 5AIGA 1BNEA 2BO9B 1VQ63 2B1XB 3NBJA 2WGOA 3D5IA 2ZDJA 2W9QA 3JUMA 5JPUA 1QAFA 2XGLA 4CPKA 1OHPA 3CCL3 4N6TA 5STDA 3FG1A 1FZUA 4LEHA 2KAAA 1VQ53 1GMPA 2C10A 3S5CA 1W5ZA 4XBYA 1NB3I 2BIRA 1U8CB 3JVCA 3STDA 1E3VA 4BL2A 8RNTA 2KF3A 3DXOA 3SEDA 4IT7A 1FUSA 6RNTA 1R4YA 3OX9A 3MPHA 2QGUA 2YX9A 1JV2B 4STDA 2GBXB 3J7Yd 2BMRB 1HZ1A 4KFFA 3ZFZA 1FUTA 5AEWB 2W9PA 3KIIA 3O8YA 3SYUA 4HKVB 3N54B 3F14A 1BUJA 3BIRA 3MSOA 3B4OA 1K734 4MMZB 3ZG0A 3FF0A 1D6ZA 2CFLA 3X41A 1NO3A 4LGQA 1C54A 3ROBA 2CWVA 2P05A 3FGYA 1IQYA 2CX0A 3G8ZA 4O2HA 1GS3A 1YVBI 5FGOA 2UGIA 4BL3A 1T3BA 2ZHXB 1QJGA 1VZZA 3KE7A 3MKIA 3PZWA 1KSIA 3T8NA 4BTWA 2F5MA 1DMQA 3WOFB 5BVBA 3AHWA 3LTCA 3SX1A 3X3XA 1X1XA 1DYUA 3F9SA 2Z77A 3FG3A 1W4NA 3EJVA 3LT8A 3A76A 1Q7Y4 1YJN3 1S723 4XBTA 1LVNA 1ZGXA 4FMBA 3WMDA 2E2TA 3HX8A 1RGLA 7STDA 3D5GA 4KT3B 1W6YA 4NREA 1N8R4 1VQK3 2BU4A 2RSXA 4CJNA 1YGWA 1G0TA 1RGKA 1B20A 4OK0A 5AYRB 2XFTA 5IG5A 3LMLA 4L7KA 4ORLA 3GZRA 4R1KA 4EXRA 1PY3A 3KFQC 3KZTA 1JNQA 1LXEA 3AHSA 1E3RA 2JQ5A 2OWPA 1WMPA 3NQZA 3H3HA 3MYTA 4HZ9B 2P0MA 1KC84 5A0OB 1LQGC 1OACA 2HMNB 4N3VA 1BIRA 3JUPA 3X3ZA 4GB5A 2H0HA 1YNVX 1I0VA 1UUGB 1WMNA 1TU5A 2RBIA 1GOVA 2ML6A 3AMOA 4WYKB 3URPA 4FMCA 3E99A 2R41A 2KF6A 4O02B 3BLZA 1JB2A 3G6E3 1RDSA 1CQSA 1DMMA 1LOVA 2W56B 3B8LA 1YIJ3 4N6MA 5IEOA 5LC6A 1Z1SA 1LNHA 1PYLA 3BNEA 1Q40A 5GSPA 2OTJ3 1CH0A 1UCIA 1ROAA 2RFRA 4NPBA 2JDIH 1Q7HA 1OUNA 3RNTA 1I2FA 2C11A 1K41A 3KSPA 1E97A 1NU3A 5JPPA 1FA3A 1WTHA 2Z76A 1X1UA 1SIHA 5AI1A 1B3SA 1NNVA 3X42A 4BIRA 2INXA 4N6NB 2Q07A 1RGGA 1I2EA 4XDWA 1W00A 3BU4A 3LZAA 1N8QA 4EV5A 1QMAA 3KCHA 1W7CA 2F86B 1N9JA 3NUVA 3FCSB 1JZOA 4BU4A 1M9GA 3FF2A 4IIAA 3GSPA 3SOAA 1MWRA 3QK9A 2L1SA 1TJDA 1RSNA 1VQM3 1BRNL 1NDOB 2O3OA 4HOHA 1GMRA 4J5GA 1RN4A 1GD3A 2WOFA 3A5EA 4G1MB 1ISKA 1UGHI 5CLKA 5AIFA 4X2HA 2IUKA 2YFLB 5D81A 2FXTA 5DRVA 1TP6A 2XF3A 4CCVA 1BNIA 3H51A 1G02A 1YJW3 1BRGA 3GZYB 5G1LA 2XFSA 1TFKA 1BRIA 2D1WA 1IV9A 4DKIA 4WWUC 3CCS3 1NB5I 1IVXA 6STDA 4ILFA 5TGNA 2R4IA 1KWIA 4MJDA 5M18A 3G713 1B21A 3Q2PA 5I97A 3LYGA 5RNTA 3BNBA 1EQKA 1W6GA 3HZPA 3IJEB 5G2GA 4HM8B 7RNTA 1Y4KA 2XEPA 3TDGA 1JB4A 5FW5A 4HVNA 3DMCA 1RGFA 4OVMA 1VQL3 1GY7A 1B27A 1JRQA 3DY5A 4ZM8A 3HIIA 2XRXB 5IENA 3EC9A 1RTUA 3EN1B 3NM7A 5CXOA 4GL6A 4EV2A 5IG3A 2P0XA 3PYJA 5DREA 3I0YA 1A2VA 1TRQA 5BXQA 1W02A 1L5GB 2LQVA 1BU4A 5CF2A 1NWWA 1VQP3 1BNFA 3FZWA 3WHOA 5BIRA 2RNTA 3CCM3 1BRKA 1T5YA 4I4KA 3EBYA 1VQ93 4AKYA 1B2XA 1OGXA 1FYSA 2MF7A 4FMDA 1W2B2 3SLUA 3D3LA 3DGLA 1X1WA 1T2HA 3AGNA 1VQ73 3S28A 3RGRA 1FGQA 4EYCA 3CCR3 5IG0A 1SQWA 3NHXA 3K9MC 2HMLB 1NJI4 1RNTA 1RRLA 4HJLB 1PU4A 3D9RA 2OOVA 1DETA 2KXGA 1AY7A 2FNQA 1RGAA 1YGEA 4RZMA 1IQXA 3LTAA 3CCQ3 1STFI 3WR2A 3G16A 1RCLA 1RN7A 1BOXA 3OWUA 1YI23 2WOHA 4EBGA 4HAAA 5LC7A 1FGOA 4N6LA 1O7NB 4AKZA 2LYXA 1UI8A 4K1VA 3EN8A 1BNJA 1JBTA 2Y74A 3OWSA 4R4KA 4KZ1A 3KN4A 5AYSC 1IVWA 1FGTA 1UI7A 2AADA 2L4VA 1BSDA 4K61A 2BMOB 3MWZA 3MG1A 3EB8A 3S29A 1M1XB 4R80A 4K1UA 3OXAA 1MWUA 2K54A 2Z6BA 4N6UA 2CW9A 1LQMB 4FCJA 3DH2A 1CYUA 1LOYA 2W03A 1RGEA 3K5TA 2CWTA 3MHEA 2KRTA 3QRDA 4KFEA 4XBXA 2WO0A 3SOYA 7GSPA 1N5PA 3UL5A 3DZLA 1MWSA 3FH1A 3LTDA 3EBTA 1AQZA 2MC8A 3UJMA 1R4CA 3ZG5A 2CG1A 1ASKA 1Q42A 1JZDA 3EE1A 1JB5A 3G0KA 3M8CA 3JUOA 3I563 3NV0B 3IMAB 4HM0B 1FUWA 2V1LA 5IEPA 1RN1A 2UUGC 1TUHA 4H3UA 5IG4A 4WYKA 2STDA 2GEXA 3UNLA 1U5OA 3KKGA 4O8SA 2YFJB 4RNZA 4XM4A 1HKXA 1EEJA 5D82A 5CF1A 1RKYA 3D79A 3CXC2 5AIIA 2W56A 3MG3A 5M19A 3CU3A 2K3DA 1FGRA 4PEJA 1GY5A 1A2KA 1AVLA 1O7HB 3VF1A 2BT3A
chains in the Genus database with same CATH topology
1BSEA 1BAOA 8RNTA 2KF3A 1I70A 1FUSA 1SARA 6RNTA 1BNIA 1G02A 1BRGA 1R4YA 1FW7A 1BNRA 1I8VA 1BRIA 1GOYA 9RNTA 1HZ1A 1FUTA 1RCKA 3SYUA 1GSPA 2AAEA 1BUJA 1TTOA 1B21A 3BIRA 2HOHA 1GMQA 5RNTA 1UCJA 1RGCA 1UCLA 1HYFA 7RNTA 1C54A 1RGFA 1B27A 2F5WA 3DGYA 1BRSA 1RTUA 2F5MA 1BNSA 1TRQA 3AHWA 1BU4A 1MGRA 1BNFA 1BGSA 1X1XA 3WHOA 1BSBA 5BIRA 2RNTA 1BSCA 1BRKA 1B2SA 1B2MA 4J5KA 1IYYA 1B2XA 1BRHA 1RLSA 1FYSA 1ZGXA 1DE3A 1RGLA 3D5GA 1X1WA 1T2HA 3AGNA 1X1YA 1RMSA 5HOHA 2F4YA 1JBSA 3D4AA 2BU4A 1RNTA 1Q9EA 1YGWA 3HOHA 1RGKA 1B20A 1DETA 1MGWA 1AY7A 1RGAA 2SARA 1PY3A 3WR2A 3AHSA 1RCLA 1BOXA 1JBRA 2ZA4A 4RNTA 4HAAA 3AGOA 1BIRA 1BSAA 1I0VA 1YNVX 1BVIA 2RBIA 1GOUA 1GOVA 1BNJA 1RHLA 1UCKA 1A2PA 1JBTA 1LRAA 2F56A 3URPA 1BRJA 2AADA 2KF6A 1BSDA 1LOWA 1BANA 1RDSA 1YVSA 1LOVA 2KF5A 1I3FA 1T2IA 1B2ZA 1PYLA 1BNGA 5GSPA 1CH0A 1UCIA 3DH2A 1LOYA 1LNIA 1TRPA 2GSPA 1RGEA 3RNTA 1I2FA 4GSPA 7GSPA 1I2GA 1AQZA 1X1UA 4GHOA 1B3SA 4BIRA 3Q3FA 1BNEA 1RGGA 1I2EA 5BU4A 3BU4A 1I0XA 2C4BA 2KF4A 3D5IA 1RN1A 3KCHA 6GSPA 4BU4A 1RGHA 1RNBA 1I3IA 1B2UA 3GSPA 1FZUA 2KAAA 1BRNL 1RSNA 1GMPA 4HOHA 1GMRA 4J5GA 2BIRA 1RN4A 3A5EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BSE A;  1BAO A;  8RNT A;  2KF3 A;  1I70 A;  1FUS A;  1SAR A;  6RNT A;  1BNI A;  1G02 A;  1BRG A;  1R4Y A;  1FW7 A;  1BNR A;  1I8V A;  1BRI A;  1GOY A;  9RNT A;  1HZ1 A;  1FUT A;  1RCK A;  3SYU A;  1GSP A;  2AAE A;  1BUJ A;  1TTO A;  1B21 A;  3BIR A;  2HOH A;  1GMQ A;  5RNT A;  1UCJ A;  1RGC A;  1UCL A;  1HYF A;  7RNT A;  1C54 A;  1RGF A;  1B27 A;  2F5W A;  3DGY A;  1BRS A;  1RTU A;  2F5M A;  1BNS A;  1TRQ A;  3AHW A;  1BU4 A;  1MGR A;  1BNF A;  1BGS A;  1X1X A;  3WHO A;  1BSB A;  5BIR A;  2RNT A;  1BSC A;  1BRK A;  1B2S A;  1B2M A;  4J5K A;  1IYY A;  1B2X A;  1BRH A;  1RLS A;  1FYS A;  1ZGX A;  1DE3 A;  1RGL A;  3D5G A;  1X1W A;  1T2H A;  3AGN A;  1X1Y A;  1RMS A;  5HOH A;  2F4Y A;  1JBS A;  3D4A A;  2BU4 A;  1RNT A;  1Q9E A;  1YGW A;  3HOH A;  1RGK A;  1B20 A;  1DET A;  1MGW A;  1AY7 A;  1RGA A;  2SAR A;  1PY3 A;  3WR2 A;  3AHS A;  1RCL A;  1BOX A;  1JBR A;  2ZA4 A;  4RNT A;  4HAA A;  3AGO A;  1BIR A;  1BSA A;  1I0V A;  1YNV X;  1BVI A;  2RBI A;  1GOU A;  1GOV A;  1BNJ A;  1RHL A;  1UCK A;  1A2P A;  1JBT A;  1LRA A;  2F56 A;  3URP A;  1BRJ A;  2AAD A;  2KF6 A;  1BSD A;  1LOW A;  1BAN A;  1RDS A;  1YVS A;  1LOV A;  2KF5 A;  1I3F A;  1T2I A;  1B2Z A;  1PYL A;  1BNG A;  5GSP A;  1CH0 A;  1UCI A;  3DH2 A;  1LOY A;  1LNI A;  1TRP A;  2GSP A;  1RGE A;  3RNT A;  1I2F A;  4GSP A;  7GSP A;  1I2G A;  1AQZ A;  1X1U A;  4GHO A;  1B3S A;  4BIR A;  3Q3F A;  1BNE A;  1RGG A;  1I2E A;  5BU4 A;  3BU4 A;  1I0X A;  2C4B A;  2KF4 A;  3D5I A;  1RN1 A;  3KCH A;  6GSP A;  4BU4 A;  1RGH A;  1RNB A;  1I3I A;  1B2U A;  3GSP A;  1FZU A;  2KAA A;  1BRN L;  1RSN A;  1GMP A;  4HOH A;  1GMR A;  4J5G A;  2BIR A;  1RN4 A;  3A5E A; 
#chains in the Genus database with same CATH topology
 5KP4 A;  1BSE A;  3DGO A;  3WA2 X;  1JN5 B;  3GWR A;  1IDP A;  1JKG B;  3LOY A;  1IVV A;  3I55 3;  3V92 A;  2CFW A;  3WOE B;  1FW7 A;  1AV4 A;  3N9H A;  3FG4 A;  1IT8 A;  1BNR A;  4FCZ A;  2QIY A;  9RNT A;  3S67 A;  3ALA A;  4K90 B;  2OQE A;  3ECF A;  4LZI A;  5D83 A;  4HZB B;  1RCK A;  1PFP A;  2AAE A;  3CD6 3;  1TTO A;  3NBB A;  1N9E A;  3WOD G;  2HMM B;  3CCE 3;  1C7H A;  3IPT A;  1RGC A;  2CK3 H;  3ER7 A;  4HBR A;  3CNX A;  1SPU A;  4J9A A;  1N5H A;  2IMJ A;  3CPO A;  3CCV 3;  3CME 3;  3DGY A;  1D6Y A;  2F98 A;  4WFO A;  1K9M 4;  5HGR A;  3PXM A;  1UUW B;  1OF5 B;  1BNS A;  4FR9 A;  3NX0 A;  1SII A;  2IYJ A;  1ZO2 A;  3JUQ A;  3MG2 A;  2YFI B;  1EG9 B;  3V98 A;  3DM8 A;  4EW5 A;  1V74 A;  3K0Z A;  3KSE D;  2CHC A;  1BSB A;  1BUQ A;  1O7G B;  1V58 A;  1BSC A;  2HMK B;  2E2U A;  3K7C A;  1B2S A;  1OHS A;  2IA7 A;  2OQE C;  3GAX A;  1IQ8 A;  1GY6 A;  1J2B A;  2HMJ B;  2IUJ A;  1BRH A;  1RLS A;  2ZL8 A;  3NQY A;  3NM2 A;  1IYY A;  1DE3 A;  2CFK A;  1MWT A;  4R9L A;  4XDV A;  3JUN A;  1M1K 4;  1RMS A;  2GXF A;  3F8X A;  2F4Y A;  3EHC A;  3V99 A;  1JBS A;  3LTB A;  3CC2 3;  3D4A A;  2F99 A;  4TX4 A;  2CIU A;  1Q9E A;  3HOH A;  2RCD A;  1K8A 4;  1O7W B;  2SBL A;  4KFD A;  1MGW A;  2UX0 A;  3NXJ A;  4L8P A;  1QVF 2;  2K0M A;  3GZX B;  2W6J H;  4H61 A;  1EKM A;  2SAR A;  2J8X B;  3GRD A;  3HIG A;  2O9U X;  1IK3 A;  2BNG A;  1O7M B;  3OW2 2;  2ZA4 A;  2BMQ B;  1HU9 A;  4JF8 A;  4RNT A;  1BSA A;  1ZX2 A;  8CHO A;  1ULJ B;  2XSH B;  3CCJ 3;  3PS8 A;  3K63 A;  4LYL B;  3SVA A;  1UCK A;  1A2P A;  3T0U A;  1LRA A;  2FGT A;  3F8H A;  2F56 A;  4OUQ A;  4Q53 A;  1MOL A;  1BRJ A;  5JBS A;  1LOW A;  3GZB A;  3L0R A;  1D6U A;  4FMA A;  2PZV A;  1I3F A;  1T2I A;  3F7X A;  3U1W A;  4X2O A;  1W6C A;  1IT7 A;  1BNG A;  2QA4 3;  3EF8 A;  4HM2 B;  4LSO A;  1TRP A;  2GSP A;  2ML5 A;  3NBR A;  1KQS 2;  4GSP A;  4JRF A;  4HM3 B;  1RRH A;  4HM4 B;  3X40 A;  5KP1 A;  5CK6 A;  1S5A A;  3Q1C A;  4XB5 A;  4RBN A;  3Q3F A;  5EVH A;  3N8B A;  2CH9 A;  3B7C A;  5BU4 A;  1VQN 3;  1I0X A;  3SXX A;  2C4B A;  2CFG A;  2KF4 A;  2OCT A;  6GSP A;  4U13 A;  2IY2 A;  5KP3 A;  4HM7 B;  1RGH A;  4IPB A;  4KVH A;  1RNB A;  4LMI A;  1I3I A;  4BTY A;  1B2U A;  1OCV A;  1ROV A;  2XR8 B;  2XSO B;  4HYZ A;  4MEI A;  1DVD A;  4AEQ A;  3BB9 A;  1FGM A;  1A67 A;  2A15 A;  3X3Y A;  1UUV B;  2KF5 A;  5IW9 A;  1TFO A;  1BAO A;  1DVC A;  2CG0 A;  3F40 A;  2OOV C;  4L8O A;  1I70 A;  1STD A;  5EEO A;  2D42 A;  1SAR A;  2HMO B;  3CPW 2;  2W2C A;  5ELJ A;  1Q82 4;  3DGM A;  1YHQ 3;  3LT9 A;  3BND A;  4HM5 B;  3CMA 3;  1I8V A;  1GOY A;  3PGB A;  4NHF A;  5G1K A;  2Y73 A;  4J8T A;  3RGA A;  3VSY A;  1KD1 4;  1AVK A;  3Q90 A;  2OTL 3;  3F7S A;  5IER A;  3NV0 A;  5ELU A;  1GSP A;  2I9W A;  2Z7A A;  2RGQ A;  3T8U A;  2HOH A;  1GMQ A;  4MMY B;  3HI7 A;  1WMO A;  1UCJ A;  3FLJ A;  1GD4 A;  3EX9 A;  2W0Q A;  4RNY A;  1Q81 4;  1K28 A;  2CX1 A;  5M1A A;  2XGN A;  1QAK A;  1OH0 A;  1HYF A;  1UCL A;  3CNM A;  3LXU X;  1VQQ A;  2E2V A;  2XH9 A;  4HM6 B;  1EA2 A;  1EUI C;  1QAL A;  2P38 A;  2F5W A;  1BRS A;  1ZS7 A;  1UGI A;  2B24 B;  1JN5 A;  1JJ2 2;  3UL6 A;  1JKG A;  4O3V A;  1MGR A;  4HM1 B;  3EQQ B;  1BGS A;  1V57 A;  3DGN A;  4N6O B;  4WP5 A;  1IU7 A;  1GYB A;  1CYV A;  2KCD A;  5AEU B;  1B2M A;  4J5K A;  3RDE A;  3G4S 3;  1MNL A;  3BNC A;  3AMO B;  1VQ8 3;  1IV7 A;  5AIH A;  4FCM A;  2H0I A;  4I5Q A;  5HOH A;  1X1Y A;  3WA3 A;  2H0G A;  4BTX A;  2W04 A;  1LOX A;  1DMN A;  1UDI I;  1Q40 B;  1AR0 A;  4EC6 A;  1Q86 4;  4QWT A;  1W2Z A;  1SJW A;  2CWU A;  1VQ4 3;  3VGN A;  1OF5 A;  1YJ9 3;  1WNH A;  2M7O A;  2QEX 3;  1WQL B;  2WGQ A;  2PNC A;  3DUK A;  1VQO 3;  1JBR A;  1UW1 A;  1US1 A;  2P09 A;  3AGO A;  3UB1 A;  3B4P A;  5IF6 A;  3FKA A;  1BVI A;  3CC4 3;  1GOU A;  3S27 A;  1OHO A;  1YIT 3;  1RHL A;  3OWY A;  1ULI B;  2GBW B;  1TIJ A;  3PCR A;  2CFD A;  1RJO A;  1BAN A;  1YVS A;  3LH4 A;  1O7P B;  1OPY A;  1B2Z A;  3WDG B;  1F8N A;  3PCS A;  1W01 A;  3CC7 3;  1A90 A;  2GU1 A;  4N6V 0;  1LNI A;  1M90 4;  2CC3 A;  4R9K A;  5EQL A;  4WHA A;  4CDL A;  3U97 A;  1CEW I;  1G96 A;  1QVG 2;  2GEY A;  2BHM A;  3FSD A;  4MMX B;  1IVU A;  2GU3 A;  3OV4 A;  1I2G A;  2CKF B;  4GHO A;  3HK4 A;  3CCU 3;  1OGZ A;  5AIG A;  1BNE A;  2BO9 B;  1VQ6 3;  2B1X B;  3NBJ A;  2WGO A;  3D5I A;  2ZDJ A;  2W9Q A;  3JUM A;  5JPU A;  1QAF A;  2XGL A;  4CPK A;  1OHP A;  3CCL 3;  4N6T A;  5STD A;  3FG1 A;  1FZU A;  4LEH A;  2KAA A;  1VQ5 3;  1GMP A;  2C10 A;  3S5C A;  1W5Z A;  4XBY A;  1NB3 I;  2BIR A;  1U8C B;  3JVC A;  3STD A;  1E3V A;  4BL2 A;  8RNT A;  2KF3 A;  3DXO A;  3SED A;  4IT7 A;  1FUS A;  6RNT A;  1R4Y A;  3OX9 A;  3MPH A;  2QGU A;  2YX9 A;  1JV2 B;  4STD A;  2GBX B;  3J7Y d;  2BMR B;  1HZ1 A;  4KFF A;  3ZFZ A;  1FUT A;  5AEW B;  2W9P A;  3KII A;  3O8Y A;  3SYU A;  4HKV B;  3N54 B;  3F14 A;  1BUJ A;  3BIR A;  3MSO A;  3B4O A;  1K73 4;  4MMZ B;  3ZG0 A;  3FF0 A;  1D6Z A;  2CFL A;  3X41 A;  1NO3 A;  4LGQ A;  1C54 A;  3ROB A;  2CWV A;  2P05 A;  3FGY A;  1IQY A;  2CX0 A;  3G8Z A;  4O2H A;  1GS3 A;  1YVB I;  5FGO A;  2UGI A;  4BL3 A;  1T3B A;  2ZHX B;  1QJG A;  1VZZ A;  3KE7 A;  3MKI A;  3PZW A;  1KSI A;  3T8N A;  4BTW A;  2F5M A;  1DMQ A;  3WOF B;  5BVB A;  3AHW A;  3LTC A;  3SX1 A;  3X3X A;  1X1X A;  1DYU A;  3F9S A;  2Z77 A;  3FG3 A;  1W4N A;  3EJV A;  3LT8 A;  3A76 A;  1Q7Y 4;  1YJN 3;  1S72 3;  4XBT A;  1LVN A;  1ZGX A;  4FMB A;  3WMD A;  2E2T A;  3HX8 A;  1RGL A;  7STD A;  3D5G A;  4KT3 B;  1W6Y A;  4NRE A;  1N8R 4;  1VQK 3;  2BU4 A;  2RSX A;  4CJN A;  1YGW A;  1G0T A;  1RGK A;  1B20 A;  4OK0 A;  5AYR B;  2XFT A;  5IG5 A;  3LML A;  4L7K A;  4ORL A;  3GZR A;  4R1K A;  4EXR A;  1PY3 A;  3KFQ C;  3KZT A;  1JNQ A;  1LXE A;  3AHS A;  1E3R A;  2JQ5 A;  2OWP A;  1WMP A;  3NQZ A;  3H3H A;  3MYT A;  4HZ9 B;  2P0M A;  1KC8 4;  5A0O B;  1LQG C;  1OAC A;  2HMN B;  4N3V A;  1BIR A;  3JUP A;  3X3Z A;  4GB5 A;  2H0H A;  1YNV X;  1I0V A;  1UUG B;  1WMN A;  1TU5 A;  2RBI A;  1GOV A;  2ML6 A;  3AMO A;  4WYK B;  3URP A;  4FMC A;  3E99 A;  2R41 A;  2KF6 A;  4O02 B;  3BLZ A;  1JB2 A;  3G6E 3;  1RDS A;  1CQS A;  1DMM A;  1LOV A;  2W56 B;  3B8L A;  1YIJ 3;  4N6M A;  5IEO A;  5LC6 A;  1Z1S A;  1LNH A;  1PYL A;  3BNE A;  1Q40 A;  5GSP A;  2OTJ 3;  1CH0 A;  1UCI A;  1ROA A;  2RFR A;  4NPB A;  2JDI H;  1Q7H A;  1OUN A;  3RNT A;  1I2F A;  2C11 A;  1K41 A;  3KSP A;  1E97 A;  1NU3 A;  5JPP A;  1FA3 A;  1WTH A;  2Z76 A;  1X1U A;  1SIH A;  5AI1 A;  1B3S A;  1NNV A;  3X42 A;  4BIR A;  2INX A;  4N6N B;  2Q07 A;  1RGG A;  1I2E A;  4XDW A;  1W00 A;  3BU4 A;  3LZA A;  1N8Q A;  4EV5 A;  1QMA A;  3KCH A;  1W7C A;  2F86 B;  1N9J A;  3NUV A;  3FCS B;  1JZO A;  4BU4 A;  1M9G A;  3FF2 A;  4IIA A;  3GSP A;  3SOA A;  1MWR A;  3QK9 A;  2L1S A;  1TJD A;  1RSN A;  1VQM 3;  1BRN L;  1NDO B;  2O3O A;  4HOH A;  1GMR A;  4J5G A;  1RN4 A;  1GD3 A;  2WOF A;  3A5E A;  4G1M B;  1ISK A;  1UGH I;  5CLK A;  5AIF A;  4X2H A;  2IUK A;  2YFL B;  5D81 A;  2FXT A;  5DRV A;  1TP6 A;  2XF3 A;  4CCV A;  1BNI A;  3H51 A;  1G02 A;  1YJW 3;  1BRG A;  3GZY B;  5G1L A;  2XFS A;  1TFK A;  1BRI A;  2D1W A;  1IV9 A;  4DKI A;  4WWU C;  3CCS 3;  1NB5 I;  1IVX A;  6STD A;  4ILF A;  5TGN A;  2R4I A;  1KWI A;  4MJD A;  5M18 A;  3G71 3;  1B21 A;  3Q2P A;  5I97 A;  3LYG A;  5RNT A;  3BNB A;  1EQK A;  1W6G A;  3HZP A;  3IJE B;  5G2G A;  4HM8 B;  7RNT A;  1Y4K A;  2XEP A;  3TDG A;  1JB4 A;  5FW5 A;  4HVN A;  3DMC A;  1RGF A;  4OVM A;  1VQL 3;  1GY7 A;  1B27 A;  1JRQ A;  3DY5 A;  4ZM8 A;  3HII A;  2XRX B;  5IEN A;  3EC9 A;  1RTU A;  3EN1 B;  3NM7 A;  5CXO A;  4GL6 A;  4EV2 A;  5IG3 A;  2P0X A;  3PYJ A;  5DRE A;  3I0Y A;  1A2V A;  1TRQ A;  5BXQ A;  1W02 A;  1L5G B;  2LQV A;  1BU4 A;  5CF2 A;  1NWW A;  1VQP 3;  1BNF A;  3FZW A;  3WHO A;  5BIR A;  2RNT A;  3CCM 3;  1BRK A;  1T5Y A;  4I4K A;  3EBY A;  1VQ9 3;  4AKY A;  1B2X A;  1OGX A;  1FYS A;  2MF7 A;  4FMD A;  1W2B 2;  3SLU A;  3D3L A;  3DGL A;  1X1W A;  1T2H A;  3AGN A;  1VQ7 3;  3S28 A;  3RGR A;  1FGQ A;  4EYC A;  3CCR 3;  5IG0 A;  1SQW A;  3NHX A;  3K9M C;  2HML B;  1NJI 4;  1RNT A;  1RRL A;  4HJL B;  1PU4 A;  3D9R A;  2OOV A;  1DET A;  2KXG A;  1AY7 A;  2FNQ A;  1RGA A;  1YGE A;  4RZM A;  1IQX A;  3LTA A;  3CCQ 3;  1STF I;  3WR2 A;  3G16 A;  1RCL A;  1RN7 A;  1BOX A;  3OWU A;  1YI2 3;  2WOH A;  4EBG A;  4HAA A;  5LC7 A;  1FGO A;  4N6L A;  1O7N B;  4AKZ A;  2LYX A;  1UI8 A;  4K1V A;  3EN8 A;  1BNJ A;  1JBT A;  2Y74 A;  3OWS A;  4R4K A;  4KZ1 A;  3KN4 A;  5AYS C;  1IVW A;  1FGT A;  1UI7 A;  2AAD A;  2L4V A;  1BSD A;  4K61 A;  2BMO B;  3MWZ A;  3MG1 A;  3EB8 A;  3S29 A;  1M1X B;  4R80 A;  4K1U A;  3OXA A;  1MWU A;  2K54 A;  2Z6B A;  4N6U A;  2CW9 A;  1LQM B;  4FCJ A;  3DH2 A;  1CYU A;  1LOY A;  2W03 A;  1RGE A;  3K5T A;  2CWT A;  3MHE A;  2KRT A;  3QRD A;  4KFE A;  4XBX A;  2WO0 A;  3SOY A;  7GSP A;  1N5P A;  3UL5 A;  3DZL A;  1MWS A;  3FH1 A;  3LTD A;  3EBT A;  1AQZ A;  2MC8 A;  3UJM A;  1R4C A;  3ZG5 A;  2CG1 A;  1ASK A;  1Q42 A;  1JZD A;  3EE1 A;  1JB5 A;  3G0K A;  3M8C A;  3JUO A;  3I56 3;  3NV0 B;  3IMA B;  4HM0 B;  1FUW A;  2V1L A;  5IEP A;  1RN1 A;  2UUG C;  1TUH A;  4H3U A;  5IG4 A;  4WYK A;  2STD A;  2GEX A;  3UNL A;  1U5O A;  3KKG A;  4O8S A;  2YFJ B;  4RNZ A;  4XM4 A;  1HKX A;  1EEJ A;  5D82 A;  5CF1 A;  1RKY A;  3D79 A;  3CXC 2;  5AII A;  2W56 A;  3MG3 A;  5M19 A;  3CU3 A;  2K3D A;  1FGR A;  4PEJ A;  1GY5 A;  1A2K A;  1AVL A;  1O7H B;  3VF1 A;  2BT3 A; 
#chains in the Genus database with same CATH homology
 1BSE A;  1BAO A;  8RNT A;  2KF3 A;  1I70 A;  1FUS A;  1SAR A;  6RNT A;  1BNI A;  1G02 A;  1BRG A;  1R4Y A;  1FW7 A;  1BNR A;  1I8V A;  1BRI A;  1GOY A;  9RNT A;  1HZ1 A;  1FUT A;  1RCK A;  3SYU A;  1GSP A;  2AAE A;  1BUJ A;  1TTO A;  1B21 A;  3BIR A;  2HOH A;  1GMQ A;  5RNT A;  1UCJ A;  1RGC A;  1UCL A;  1HYF A;  7RNT A;  1C54 A;  1RGF A;  1B27 A;  2F5W A;  3DGY A;  1BRS A;  1RTU A;  2F5M A;  1BNS A;  1TRQ A;  3AHW A;  1BU4 A;  1MGR A;  1BNF A;  1BGS A;  1X1X A;  3WHO A;  1BSB A;  5BIR A;  2RNT A;  1BSC A;  1BRK A;  1B2S A;  1B2M A;  4J5K A;  1IYY A;  1B2X A;  1BRH A;  1RLS A;  1FYS A;  1ZGX A;  1DE3 A;  1RGL A;  3D5G A;  1X1W A;  1T2H A;  3AGN A;  1X1Y A;  1RMS A;  5HOH A;  2F4Y A;  1JBS A;  3D4A A;  2BU4 A;  1RNT A;  1Q9E A;  1YGW A;  3HOH A;  1RGK A;  1B20 A;  1DET A;  1MGW A;  1AY7 A;  1RGA A;  2SAR A;  1PY3 A;  3WR2 A;  3AHS A;  1RCL A;  1BOX A;  1JBR A;  2ZA4 A;  4RNT A;  4HAA A;  3AGO A;  1BIR A;  1BSA A;  1I0V A;  1YNV X;  1BVI A;  2RBI A;  1GOU A;  1GOV A;  1BNJ A;  1RHL A;  1UCK A;  1A2P A;  1JBT A;  1LRA A;  2F56 A;  3URP A;  1BRJ A;  2AAD A;  2KF6 A;  1BSD A;  1LOW A;  1BAN A;  1RDS A;  1YVS A;  1LOV A;  2KF5 A;  1I3F A;  1T2I A;  1B2Z A;  1PYL A;  1BNG A;  5GSP A;  1CH0 A;  1UCI A;  3DH2 A;  1LOY A;  1LNI A;  1TRP A;  2GSP A;  1RGE A;  3RNT A;  1I2F A;  4GSP A;  7GSP A;  1I2G A;  1AQZ A;  1X1U A;  4GHO A;  1B3S A;  4BIR A;  3Q3F A;  1BNE A;  1RGG A;  1I2E A;  5BU4 A;  3BU4 A;  1I0X A;  2C4B A;  2KF4 A;  3D5I A;  1RN1 A;  3KCH A;  6GSP A;  4BU4 A;  1RGH A;  1RNB A;  1I3I A;  1B2U A;  3GSP A;  1FZU A;  2KAA A;  1BRN L;  1RSN A;  1GMP A;  4HOH A;  1GMR A;  4J5G A;  2BIR A;  1RN4 A;  3A5E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...