1GMPA

Complex of ribonuclease from streptomyces aureofaciens with 2'-gmp at 1.7 angstroms resolution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
96
structure length
96
Chain Sequence
DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIICGEATQEDYYTGDHYATFSLIDQTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complex of ribonuclease from Streptomyces aureofaciens with 2'-GMP at 1.7 A resolution.
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase(guanyloribonuclease)
molecule keywords RIBONUCLEASE SA
total genus 26
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1992-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1gmpA00
1G02A 5RNTA 6RNTA 1JBTA 2BU4A 3D5IA 1FUSA 3WHOA 1I0XA 1HZ1A 1RTUA 1TRPA 2C4BA 1GMRA 1HYFA 1RDSA 1RN1A 1GOYA 1BSBA 2HOHA 1BRHA 3BIRA 3AGOA 2RBIA 2KF5A 1LOVA 1GMQA 1RGFA 1BNSA 3WR2A 1GOUA 1BIRA 3GSPA 1B2MA 3URPA 1BUJA 1RNBA 1Q9EA 1BNJA 2ZA4A 3D4AA 4RNTA 1BNIA 1RGAA 1BNFA 1RGHA 1RGKA 1BRIA 1RGEA 3BU4A 1RN4A 1BU4A 1B2XA 1UCLA 1B27A 1BRKA 1BSDA 5BIRA 1JBSA 1BRGA 2KF4A 1LNIA 1PYLA 1MGRA 2KF6A 1CH0A 1R4YA 9RNTA 1TTOA 1T2HA 1LOWA 4GHOA 1IYYA 4J5KA 3AGNA 1B20A 1GOVA 1YNVX 2F5MA 1I0VA 1TRQA 2RNTA 1BRSA 3SYUA 3AHSA 3RNTA 2BIRA 1X1YA 1B2UA 1GSPA 3HOHA 1YVSA 1BRJA 1X1WA 1BSCA 8RNTA 1B2SA 1DETA 1I3FA 2KF3A 1BGSA 1BANA 1BAOA 1FZUA 1LRAA 1I2FA 5HOHA 1RLSA 1BNGA 1UCIA 2F4YA 3KCHA 4J5GA 2AAEA 1BSEA 1AY7A 4BIRA 1RCKA 2KAAA 1FW7A 5BU4A 2AADA 1B3SA 1RHLA 1JBRA 6GSPA 1T2IA 4GSPA 2F5WA 1RGLA 1UCKA 1FYSA 1BOXA 3D5GA 1X1UA 3A5EA 1FUTA 3DH2A 1I8VA 1B2ZA 1I70A 1BVIA 2SARA 3DGYA 3Q3FA 1RSNA 4HOHA 1B21A 1BNEA 1UCJA 1I3IA 1X1XA 1ZGXA 1BSAA 1RGCA 1YGWA 1GMPA 7RNTA 1DE3A 5GSPA 1C54A 1BNRA 3AHWA 1AQZA 1LOYA 1A2PA 4BU4A 1RMSA 1I2EA 2GSPA 1I2GA 1SARA 1PY3A 1RCLA 4HAAA 1RNTA 2F56A 1MGWA 7GSPA 1BRNL 1RGGA
chains in the Genus database with same CATH superfamily
2CFGA 5RNTA 4N6NB 6RNTA 1JBTA 1US1A 1WMPA 3OV4A 3L0RA 5IERA 1W02A 4O2HA 1G0TA 3NBRA 3BNBA 1I0XA 5DREA 3PXMA 2OCTA 3SVAA 1W6YA 2GEXA 2FXTA 5KP1A 3CXC2 1DYUA 3MSOA 3WDGB 5ELUA 2CIUA 5A0OB 1GYBA 1BSBA 3HIIA 4WYKB 2SBLA 1KSIA 3CCE3 2HMOB 3K9MC 5AIIA 3BIRA 1MNLA 5G2GA 1ASKA 4WWUC 4L8PA 1AVLA 2Y74A 1WNHA 3HI7A 3PS8A 1BIRA 1VQ83 5G1LA 3PZWA 5M18A 3URPA 3CC73 2ML5A 1BUJA 3FZWA 1IQYA 2CW9A 1BNJA 3MYTA 2ZA4A 3D4AA 3I0YA 1BNIA 1FGQA 4QWTA 5IEPA 1CYVA 1O7HB 4IT7A 3EE1A 5M1AA 2XFTA 4FCJA 5EEOA 1RGKA 2Z77A 3G713 1RN4A 1UCLA 1ULJB 1B27A 1E3VA 2CC3A 2XEPA 3JUMA 3CC23 4MMXB 1BRGA 2KF4A 3X3YA 3V92A 4MMYB 3BNDA 2P09A 3H51A 1T5YA 4R9LA 4EC6A 3FCSB 3UB1A 3B4PA 2ZL8A 4N6V0 2CWVA 1IYYA 4J5KA 3AGNA 3DGNA 1Q42A 1IQ8A 1VZZA 1OGZA 3CME3 1YIT3 2O3OA 1SPUA 3LTAA 1BRSA 3JUNA 1JN5B 2V1LA 3X42A 3CCQ3 3HOHA 5CXOA 1RRHA 2WOFA 1OF5A 1YJW3 1AR0A 2IUKA 1IVXA 4O8SA 5AI1A 3BB9A 1FZUA 3CD63 1FA3A 2P05A 1E97A 2W04A 1I2FA 1UI7A 1HU9A 2BMOB 1RLSA 1BNGA 2WOHA 3KCHA 3LYGA 4KT3B 3LTDA 1UGHI 3AMOB 3BNCA 2GU1A 2H0HA 1RCKA 3PCRA 4IIAA 5BU4A 2Z7AA 3KSED 1JBRA 3ER7A 1T2IA 3NHXA 1NWWA 1OUNA 3EX9A 1O7GB 3FG3A 3GZBA 5EQLA 1VQM3 1VQL3 1K9M4 3DH2A 3B8LA 1I70A 4KZ1A 1MWSA 3ZG0A 4EV2A 7STDA 1JN5A 3N9HA 1VQN3 1LQGC 4X2HA 1KWIA 1C7HA 1UCJA 4KVHA 1W6CA 4XBTA 1JZOA 3WOFB 4NHFA 5KP4A 2R4IA 2HMNB 2E2UA 1FGRA 3D79A 1RGCA 5AIFA 1NNVA 1MWTA 3K7CA 2W2CA 1DE3A 3H3HA 3RGAA 3DM8A 1AQZA 1MWRA 4U13A 1A90A 4RNYA 1LVNA 4LEHA 1I2EA 2XGLA 1L5GB 3T8UA 4G1MB 3Q90A 3X3ZA 1RCLA 3KSPA 1IQXA 5KP3A 1M9GA 4CPKA 4BL2A 2W56A 1BSDA 2OTL3 1W4NA 2MC8A 3SEDA 3EC9A 4WFOA 2BU4A 3D5IA 5M19A 2O9UX 1Q40B 1FUSA 4MMZB 5JPUA 3SXXA 1HZ1A 2YFLB 4K90B 3UNLA 2ZDJA 1GMRA 3MG2A 1KQS2 4BTYA 4XDVA 3FGYA 2RGQA 2L4VA 1FGTA 1W01A 3CCM3 1STFI 3DXOA 2XF3A 4HVNA 4HJLB 5IG0A 5TGNA 3G4S3 2K54A 3LOYA 1BRHA 1K28A 3FH1A 3LXUX 3MWZA 2RBIA 4PEJA 2KF5A 3CU3A 1VQO3 1LOVA 4H61A 1DVCA 5AEUB 1TU5A 2CKFB 2UX0A 1B2MA 1TFOA 2HMLB 3FLJA 5G1KA 4KFEA 2OTJ3 1PU4A 1Q9EA 1OF5B 3DGMA 5AIHA 1VQ43 4HZBB 1YVBI 4RNTA 1J2BA 4XBYA 1N5HA 3DZLA 4KFDA 3FKAA 4WYKA 4FCMA 1VQP3 2GXFA 3GRDA 3CPOA 1UDII 3NBBA 1ROAA 3OWSA 3S5CA 2E2VA 1Q814 4J9AA 2D42A 1MGRA 2D1WA 3OWUA 2YFIB 1CH0A 1MWUA 1YI23 1RRLA 3IJEB 1WMNA 1SQWA 1LOWA 4FMAA 3NBJA 3ECFA 1Q864 1B20A 2QGUA 3UL5A 4N6LA 2R41A 4HM0B 4AKYA 2XSHB 4NPBA 4AEQA 2L1SA 3EBTA 4KFFA 5FGOA 5IG4A 5IF6A 3AHSA 2BIRA 2YFJB 1GY6A 2CFWA 5AIGA 1IV9A 3OXAA 1YVSA 2QEX3 1QJGA 2BHMA 1BRJA 3MG1A 2ZHXB 1BSCA 3NQYA 5JPPA 1N5PA 4GB5A 1DETA 3AMOA 1IK3A 1QVF2 1T3BA 4HM5B 5AYSC 1I3FA 1NJI4 2UUGC 3D3LA 4R4KA 3KFQC 3S67A 1UGIA 2ML6A 1JRQA 1LRAA 3O8YA 2F4YA 3N54B 3SLUA 4LSOA 1TUHA 4J5GA 2AAEA 3U1WA 4BIRA 1EA2A 1LNHA 5CLKA 2C11A 2KAAA 3Q1CA 3V99A 2I9WA 3HX8A 5BXQA 3SX1A 1Q40A 1RHLA 1N8QA 1UW1A 4I5QA 4GSPA 1STDA 1UCKA 1LOXA 1GY5A 2Y73A 3A5EA 3EB8A 2IYJA 1B2ZA 3DGLA 2P0XA 2SARA 3ALAA 1BNEA 3DUKA 4H3UA 3CCS3 1U5OA 5DRVA 2HMJB 3CNMA 2OQEA 1ISKA 2OOVC 4STDA 1JB5A 1UI8A 1A67A 3DY5A 3LZAA 1OCVA 3UJMA 3AHWA 3VGNA 1A2PA 2CH9A 2KXGA 5ELJA 4EXRA 2GSPA 4HBRA 1YJ93 1VQ53 3QRDA 1SARA 2F56A 4WP5A 4AKZA 4K1UA 4IPBA 2W03A 2XRXB 1PFPA 3RDEA 1JNQA 1JKGB 2JDIH 3JUOA 4R1KA 1GY7A 1S5AA 5LC6A 1M1K4 2WGQA 1O7WB 1RTUA 2C4BA 3RGRA 5BVBA 1HYFA 1RDSA 1W7CA 2GU3A 5AYRB 4RZMA 1OHSA 1VQ73 1W00A 3J7Yd 1EUIC 1D6ZA 1RN1A 4RNZA 4BL3A 1GOYA 3EHCA 4BTXA 3GAXA 2HOHA 2XSOB 3GWRA 3T0UA 5IEOA 1W2B2 3PYJA 3NV0A 2KCDA 3DMCA 1D6UA 1TP6A 2WGOA 3AGOA 4ORLA 1QMAA 2W9PA 3KZTA 2CFKA 3NV0B 1RGFA 3F7XA 3LTBA 1GOUA 1IU7A 3GSPA 3SOAA 1V57A 3U97A 2INXA 4RBNA 3D9RA 1RNBA 1YJN3 5D81A 2OOVA 2CX1A 4XM4A 2J8XB 3G8ZA 1JZDA 4HM3B 1BNFA 3GZYB 2XR8B 3NXJA 3A76A 1GD3A 2M7OA 1CQSA 3WA2X 1IV7A 2W0QA 1RGEA 3UL6A 1R4CA 4O3VA 2CHCA 1B2XA 1LQMB 1NB3I 4TX4A 4ZM8A 1OACA 4LGQA 2C10A 1JBSA 4XB5A 3GZXB 2CG0A 2HMMB 2HMKB 3CCR3 2KF6A 3EJVA 4HM2B 1OHOA 1A2KA 1R4YA 4HM6B 1TTOA 5EVHA 1T2HA 1W2ZA 2CFLA 4OVMA 3X41A 3I563 1YIJ3 4GHOA 2GBXB 3VF1A 5FW5A 1RN7A 2IMJA 3EN8A 3CCV3 3JVCA 1QAKA 3WODG 2QA43 1Q7HA 1M1XB 1TRQA 4JRFA 2RNTA 5STDA 1SIIA 1KD14 3RNTA 1WMOA 1GSPA 1HKXA 2IA7A 1Z1SA 1W5ZA 1G96A 1TIJA 1X1WA 3FF2A 1B2SA 5JBSA 1IT8A 5D83A 5IENA 3LT8A 3LH4A 1IDPA 3V98A 2CFDA 2KF3A 1V58A 1BGSA 4NREA 1BANA 1BAOA 1O7NB 1AVKA 1WQLB 2H0IA 4HYZA 3BNEA 1WTHA 2BO9B 1UCIA 4N3VA 3VSYA 2K0MA 3FG4A 4EYCA 1OGXA 1BSEA 1AY7A 3NQZA 2CK3H 4Q53A 3STDA 2AADA 3HK4A 3KKGA 4MJDA 2CWTA 3NX0A 5IG3A 1NU3A 3K5TA 1CEWI 2XGNA 3G0KA 3HZPA 3M8CA 4BTWA 1RGLA 1BOXA 1IVVA 1FYSA 1JKGA 3CPW2 1BUQA 3E99A 3F40A 3CCU3 1FUTA 4EBGA 4N6MA 2CG1A 2IUJA 3IPTA 4HM4B 3Q3FA 1OH0A 1IT7A 4K61A 1VQ63 4HOHA 1B21A 4CJNA 1N9JA 1A2VA 1GS3A 1I3IA 4FR9A 3CNXA 2FNQA 1W6GA 1BSAA 2GBWB 2IY2A 1YGWA 1JV2B 3PCSA 2OWPA 3N8BA 3I553 1CYUA 2W56B 3F8XA 5GSPA 1EQKA 4N6OB 1BNRA 3CCL3 1K41A 2BMRB 2RSXA 1LOYA 3S28A 2CX0A 1RMSA 4J8TA 1RKYA 4OUQA 1TFKA 3OX9A 3ZFZA 3F7SA 5CF1A 5D82A 4N6TA 3LTCA 1MGWA 4FMDA 4EV5A 2UGIA 4XBXA 3IMAB 3LMLA 1YGEA 1EKMA 1G02A 4FMBA 1K8A4 4FMCA 3GZRA 2GEYA 2P38A 1DMMA 1O7PB 4L8OA 3WHOA 1BRNL 3BLZA 1Q824 1ZO2A 2Z76A 1TRPA 1S723 3WMDA 1NDOB 2H0GA 1VQ93 3ROBA 3F9SA 3MPHA 2F99A 3B4OA 1QALA 3NM7A 4LYLB 8CHOA 5IG5A 2JQ5A 1TJDA 4GL6A 2E2TA 3EBYA 2PZVA 6STDA 1DMQA 4ILFA 3K0ZA 1F8NA 3HIGA 1GMQA 3NUVA 1BNSA 1QAFA 3QK9A 1AV4A 3WR2A 2OQEC 3T8NA 1FGMA 3FG1A 3MG3A 3EF8A 3WOEB 1VQQA 1SIHA 2K3DA 1RGAA 1E3RA 1D6YA 2LQVA 3KN4A 1RGHA 1ULIB 1BRIA 3BU4A 1BU4A 2P0MA 1GD4A 1JJ22 4EW5A 5CF2A 3JUPA 1BRKA 2FGTA 4I4KA 2STDA 4CDLA 5BIRA 1LNIA 1PYLA 4R80A 1DMNA 1VQK3 1O7MB 9RNTA 2BMQB 1UUGB 4HM1B 1SJWA 1IVWA 3FF0A 3KIIA 1ZX2A 3CCJ3 1DVDA 1GOVA 1OHPA 1YNVX 1JB2A 2F5MA 1QVG2 1I0VA 4HKVB 4JF8A 3S27A 2BNGA 3G6E3 1M904 2F86B 1V74A 3S29A 3FSDA 3SYUA 1X1YA 2YX9A 1B2UA 2Z6BA 3JUQA 4MEIA 4XDWA 2RCDA 4R9KA 3X40A 3CC43 3ZG5A 3B7CA 8RNTA 4OK0A 1LXEA 1K734 3OWYA 4HM8B 2B1XB 3EQQB 3OW22 1EEJA 3F14A 1UUWB 1RJOA 1IVUA 3PGBA 2A15A 2WO0A 4WHAA 2W6JH 4N6UA 5HOHA 2LYXA 2KRTA 1Y4KA 3KE7A 5LC7A 4LMIA 4HM7B 1FGOA 3G16A 2PNCA 5IW9A 4DKIA 1OPYA 5I97A 1NB5I 1FW7A 1ZS7A 2W9QA 1B3SA 1N9EA 4FCZA 4X2OA 6GSPA 3X3XA 3TDGA 4L7KA 3MKIA 2F5WA 3WA3A 1JB4A 1MOLA 3CMA3 3D5GA 1X1UA 1I8VA 1KC84 2B24B 5CK6A 1BVIA 1N8R4 2RFRA 3DGYA 3K63A 3Q2PA 1RSNA 1U8CB 1FUWA 2XFSA 1X1XA 1ZGXA 2F98A 3DGOA 4K1VA 4LZIA 4O02B 3SOYA 2MF7A 3NM2A 1GMPA 7RNTA 1NO3A 1C54A 1YHQ3 4CCVA 2CWUA 1Q7Y4 3EN1B 1ROVA 4BU4A 2XH9A 3LT9A 5AEWB 1I2GA 2BT3A 2Q07A 4HZ9B 3MHEA 5HGRA 1PY3A 4HAAA 1RNTA 1EG9B 7GSPA 3F8HA 1RGGA 2QIYA 1UUVB
chains in the Genus database with same CATH topology
1G02A 5RNTA 6RNTA 1JBTA 2BU4A 3D5IA 1FUSA 3WHOA 1I0XA 1HZ1A 1RTUA 1TRPA 2C4BA 1GMRA 1HYFA 1RDSA 1RN1A 1GOYA 1BSBA 2HOHA 1BRHA 3BIRA 3AGOA 2RBIA 2KF5A 1LOVA 1GMQA 1RGFA 1BNSA 3WR2A 1GOUA 1BIRA 3GSPA 1B2MA 3URPA 1BUJA 1RNBA 1Q9EA 1BNJA 2ZA4A 3D4AA 4RNTA 1BNIA 1RGAA 1BNFA 1RGHA 1RGKA 1BRIA 1RGEA 3BU4A 1RN4A 1BU4A 1B2XA 1UCLA 1B27A 1BRKA 1BSDA 5BIRA 1JBSA 1BRGA 2KF4A 1LNIA 1PYLA 1MGRA 2KF6A 1CH0A 1R4YA 9RNTA 1TTOA 1T2HA 1LOWA 4GHOA 1IYYA 4J5KA 3AGNA 1B20A 1GOVA 1YNVX 2F5MA 1I0VA 1TRQA 2RNTA 1BRSA 3SYUA 3AHSA 3RNTA 2BIRA 1X1YA 1B2UA 1GSPA 3HOHA 1YVSA 1BRJA 1X1WA 1BSCA 8RNTA 1B2SA 1DETA 1I3FA 2KF3A 1BGSA 1BANA 1BAOA 1FZUA 1LRAA 1I2FA 5HOHA 1RLSA 1BNGA 1UCIA 2F4YA 3KCHA 4J5GA 2AAEA 1BSEA 1AY7A 4BIRA 1RCKA 2KAAA 1FW7A 5BU4A 2AADA 1B3SA 1RHLA 1JBRA 6GSPA 1T2IA 4GSPA 2F5WA 1RGLA 1UCKA 1FYSA 1BOXA 3D5GA 1X1UA 3A5EA 1FUTA 3DH2A 1I8VA 1B2ZA 1I70A 1BVIA 2SARA 3DGYA 3Q3FA 1RSNA 4HOHA 1B21A 1BNEA 1UCJA 1I3IA 1X1XA 1ZGXA 1BSAA 1RGCA 1YGWA 1GMPA 7RNTA 1DE3A 5GSPA 1C54A 1BNRA 3AHWA 1AQZA 1LOYA 1A2PA 4BU4A 1RMSA 1I2EA 2GSPA 1I2GA 1SARA 1PY3A 1RCLA 4HAAA 1RNTA 2F56A 1MGWA 7GSPA 1BRNL 1RGGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G02 A;  5RNT A;  6RNT A;  1JBT A;  2BU4 A;  3D5I A;  1FUS A;  3WHO A;  1I0X A;  1HZ1 A;  1RTU A;  1TRP A;  2C4B A;  1GMR A;  1HYF A;  1RDS A;  1RN1 A;  1GOY A;  1BSB A;  2HOH A;  1BRH A;  3BIR A;  3AGO A;  2RBI A;  2KF5 A;  1LOV A;  1GMQ A;  1RGF A;  1BNS A;  3WR2 A;  1GOU A;  1BIR A;  3GSP A;  1B2M A;  3URP A;  1BUJ A;  1RNB A;  1Q9E A;  1BNJ A;  2ZA4 A;  3D4A A;  4RNT A;  1BNI A;  1RGA A;  1BNF A;  1RGH A;  1RGK A;  1BRI A;  1RGE A;  3BU4 A;  1RN4 A;  1BU4 A;  1B2X A;  1UCL A;  1B27 A;  1BRK A;  1BSD A;  5BIR A;  1JBS A;  1BRG A;  2KF4 A;  1LNI A;  1PYL A;  1MGR A;  2KF6 A;  1CH0 A;  1R4Y A;  9RNT A;  1TTO A;  1T2H A;  1LOW A;  4GHO A;  1IYY A;  4J5K A;  3AGN A;  1B20 A;  1GOV A;  1YNV X;  2F5M A;  1I0V A;  1TRQ A;  2RNT A;  1BRS A;  3SYU A;  3AHS A;  3RNT A;  2BIR A;  1X1Y A;  1B2U A;  1GSP A;  3HOH A;  1YVS A;  1BRJ A;  1X1W A;  1BSC A;  8RNT A;  1B2S A;  1DET A;  1I3F A;  2KF3 A;  1BGS A;  1BAN A;  1BAO A;  1FZU A;  1LRA A;  1I2F A;  5HOH A;  1RLS A;  1BNG A;  1UCI A;  2F4Y A;  3KCH A;  4J5G A;  2AAE A;  1BSE A;  1AY7 A;  4BIR A;  1RCK A;  2KAA A;  1FW7 A;  5BU4 A;  2AAD A;  1B3S A;  1RHL A;  1JBR A;  6GSP A;  1T2I A;  4GSP A;  2F5W A;  1RGL A;  1UCK A;  1FYS A;  1BOX A;  3D5G A;  1X1U A;  3A5E A;  1FUT A;  3DH2 A;  1I8V A;  1B2Z A;  1I70 A;  1BVI A;  2SAR A;  3DGY A;  3Q3F A;  1RSN A;  4HOH A;  1B21 A;  1BNE A;  1UCJ A;  1I3I A;  1X1X A;  1ZGX A;  1BSA A;  1RGC A;  1YGW A;  1GMP A;  7RNT A;  1DE3 A;  5GSP A;  1C54 A;  1BNR A;  3AHW A;  1AQZ A;  1LOY A;  1A2P A;  4BU4 A;  1RMS A;  1I2E A;  2GSP A;  1I2G A;  1SAR A;  1PY3 A;  1RCL A;  4HAA A;  1RNT A;  2F56 A;  1MGW A;  7GSP A;  1BRN L;  1RGG A; 
#chains in the Genus database with same CATH topology
 2CFG A;  5RNT A;  4N6N B;  6RNT A;  1JBT A;  1US1 A;  1WMP A;  3OV4 A;  3L0R A;  5IER A;  1W02 A;  4O2H A;  1G0T A;  3NBR A;  3BNB A;  1I0X A;  5DRE A;  3PXM A;  2OCT A;  3SVA A;  1W6Y A;  2GEX A;  2FXT A;  5KP1 A;  3CXC 2;  1DYU A;  3MSO A;  3WDG B;  5ELU A;  2CIU A;  5A0O B;  1GYB A;  1BSB A;  3HII A;  4WYK B;  2SBL A;  1KSI A;  3CCE 3;  2HMO B;  3K9M C;  5AII A;  3BIR A;  1MNL A;  5G2G A;  1ASK A;  4WWU C;  4L8P A;  1AVL A;  2Y74 A;  1WNH A;  3HI7 A;  3PS8 A;  1BIR A;  1VQ8 3;  5G1L A;  3PZW A;  5M18 A;  3URP A;  3CC7 3;  2ML5 A;  1BUJ A;  3FZW A;  1IQY A;  2CW9 A;  1BNJ A;  3MYT A;  2ZA4 A;  3D4A A;  3I0Y A;  1BNI A;  1FGQ A;  4QWT A;  5IEP A;  1CYV A;  1O7H B;  4IT7 A;  3EE1 A;  5M1A A;  2XFT A;  4FCJ A;  5EEO A;  1RGK A;  2Z77 A;  3G71 3;  1RN4 A;  1UCL A;  1ULJ B;  1B27 A;  1E3V A;  2CC3 A;  2XEP A;  3JUM A;  3CC2 3;  4MMX B;  1BRG A;  2KF4 A;  3X3Y A;  3V92 A;  4MMY B;  3BND A;  2P09 A;  3H51 A;  1T5Y A;  4R9L A;  4EC6 A;  3FCS B;  3UB1 A;  3B4P A;  2ZL8 A;  4N6V 0;  2CWV A;  1IYY A;  4J5K A;  3AGN A;  3DGN A;  1Q42 A;  1IQ8 A;  1VZZ A;  1OGZ A;  3CME 3;  1YIT 3;  2O3O A;  1SPU A;  3LTA A;  1BRS A;  3JUN A;  1JN5 B;  2V1L A;  3X42 A;  3CCQ 3;  3HOH A;  5CXO A;  1RRH A;  2WOF A;  1OF5 A;  1YJW 3;  1AR0 A;  2IUK A;  1IVX A;  4O8S A;  5AI1 A;  3BB9 A;  1FZU A;  3CD6 3;  1FA3 A;  2P05 A;  1E97 A;  2W04 A;  1I2F A;  1UI7 A;  1HU9 A;  2BMO B;  1RLS A;  1BNG A;  2WOH A;  3KCH A;  3LYG A;  4KT3 B;  3LTD A;  1UGH I;  3AMO B;  3BNC A;  2GU1 A;  2H0H A;  1RCK A;  3PCR A;  4IIA A;  5BU4 A;  2Z7A A;  3KSE D;  1JBR A;  3ER7 A;  1T2I A;  3NHX A;  1NWW A;  1OUN A;  3EX9 A;  1O7G B;  3FG3 A;  3GZB A;  5EQL A;  1VQM 3;  1VQL 3;  1K9M 4;  3DH2 A;  3B8L A;  1I70 A;  4KZ1 A;  1MWS A;  3ZG0 A;  4EV2 A;  7STD A;  1JN5 A;  3N9H A;  1VQN 3;  1LQG C;  4X2H A;  1KWI A;  1C7H A;  1UCJ A;  4KVH A;  1W6C A;  4XBT A;  1JZO A;  3WOF B;  4NHF A;  5KP4 A;  2R4I A;  2HMN B;  2E2U A;  1FGR A;  3D79 A;  1RGC A;  5AIF A;  1NNV A;  1MWT A;  3K7C A;  2W2C A;  1DE3 A;  3H3H A;  3RGA A;  3DM8 A;  1AQZ A;  1MWR A;  4U13 A;  1A90 A;  4RNY A;  1LVN A;  4LEH A;  1I2E A;  2XGL A;  1L5G B;  3T8U A;  4G1M B;  3Q90 A;  3X3Z A;  1RCL A;  3KSP A;  1IQX A;  5KP3 A;  1M9G A;  4CPK A;  4BL2 A;  2W56 A;  1BSD A;  2OTL 3;  1W4N A;  2MC8 A;  3SED A;  3EC9 A;  4WFO A;  2BU4 A;  3D5I A;  5M19 A;  2O9U X;  1Q40 B;  1FUS A;  4MMZ B;  5JPU A;  3SXX A;  1HZ1 A;  2YFL B;  4K90 B;  3UNL A;  2ZDJ A;  1GMR A;  3MG2 A;  1KQS 2;  4BTY A;  4XDV A;  3FGY A;  2RGQ A;  2L4V A;  1FGT A;  1W01 A;  3CCM 3;  1STF I;  3DXO A;  2XF3 A;  4HVN A;  4HJL B;  5IG0 A;  5TGN A;  3G4S 3;  2K54 A;  3LOY A;  1BRH A;  1K28 A;  3FH1 A;  3LXU X;  3MWZ A;  2RBI A;  4PEJ A;  2KF5 A;  3CU3 A;  1VQO 3;  1LOV A;  4H61 A;  1DVC A;  5AEU B;  1TU5 A;  2CKF B;  2UX0 A;  1B2M A;  1TFO A;  2HML B;  3FLJ A;  5G1K A;  4KFE A;  2OTJ 3;  1PU4 A;  1Q9E A;  1OF5 B;  3DGM A;  5AIH A;  1VQ4 3;  4HZB B;  1YVB I;  4RNT A;  1J2B A;  4XBY A;  1N5H A;  3DZL A;  4KFD A;  3FKA A;  4WYK A;  4FCM A;  1VQP 3;  2GXF A;  3GRD A;  3CPO A;  1UDI I;  3NBB A;  1ROA A;  3OWS A;  3S5C A;  2E2V A;  1Q81 4;  4J9A A;  2D42 A;  1MGR A;  2D1W A;  3OWU A;  2YFI B;  1CH0 A;  1MWU A;  1YI2 3;  1RRL A;  3IJE B;  1WMN A;  1SQW A;  1LOW A;  4FMA A;  3NBJ A;  3ECF A;  1Q86 4;  1B20 A;  2QGU A;  3UL5 A;  4N6L A;  2R41 A;  4HM0 B;  4AKY A;  2XSH B;  4NPB A;  4AEQ A;  2L1S A;  3EBT A;  4KFF A;  5FGO A;  5IG4 A;  5IF6 A;  3AHS A;  2BIR A;  2YFJ B;  1GY6 A;  2CFW A;  5AIG A;  1IV9 A;  3OXA A;  1YVS A;  2QEX 3;  1QJG A;  2BHM A;  1BRJ A;  3MG1 A;  2ZHX B;  1BSC A;  3NQY A;  5JPP A;  1N5P A;  4GB5 A;  1DET A;  3AMO A;  1IK3 A;  1QVF 2;  1T3B A;  4HM5 B;  5AYS C;  1I3F A;  1NJI 4;  2UUG C;  3D3L A;  4R4K A;  3KFQ C;  3S67 A;  1UGI A;  2ML6 A;  1JRQ A;  1LRA A;  3O8Y A;  2F4Y A;  3N54 B;  3SLU A;  4LSO A;  1TUH A;  4J5G A;  2AAE A;  3U1W A;  4BIR A;  1EA2 A;  1LNH A;  5CLK A;  2C11 A;  2KAA A;  3Q1C A;  3V99 A;  2I9W A;  3HX8 A;  5BXQ A;  3SX1 A;  1Q40 A;  1RHL A;  1N8Q A;  1UW1 A;  4I5Q A;  4GSP A;  1STD A;  1UCK A;  1LOX A;  1GY5 A;  2Y73 A;  3A5E A;  3EB8 A;  2IYJ A;  1B2Z A;  3DGL A;  2P0X A;  2SAR A;  3ALA A;  1BNE A;  3DUK A;  4H3U A;  3CCS 3;  1U5O A;  5DRV A;  2HMJ B;  3CNM A;  2OQE A;  1ISK A;  2OOV C;  4STD A;  1JB5 A;  1UI8 A;  1A67 A;  3DY5 A;  3LZA A;  1OCV A;  3UJM A;  3AHW A;  3VGN A;  1A2P A;  2CH9 A;  2KXG A;  5ELJ A;  4EXR A;  2GSP A;  4HBR A;  1YJ9 3;  1VQ5 3;  3QRD A;  1SAR A;  2F56 A;  4WP5 A;  4AKZ A;  4K1U A;  4IPB A;  2W03 A;  2XRX B;  1PFP A;  3RDE A;  1JNQ A;  1JKG B;  2JDI H;  3JUO A;  4R1K A;  1GY7 A;  1S5A A;  5LC6 A;  1M1K 4;  2WGQ A;  1O7W B;  1RTU A;  2C4B A;  3RGR A;  5BVB A;  1HYF A;  1RDS A;  1W7C A;  2GU3 A;  5AYR B;  4RZM A;  1OHS A;  1VQ7 3;  1W00 A;  3J7Y d;  1EUI C;  1D6Z A;  1RN1 A;  4RNZ A;  4BL3 A;  1GOY A;  3EHC A;  4BTX A;  3GAX A;  2HOH A;  2XSO B;  3GWR A;  3T0U A;  5IEO A;  1W2B 2;  3PYJ A;  3NV0 A;  2KCD A;  3DMC A;  1D6U A;  1TP6 A;  2WGO A;  3AGO A;  4ORL A;  1QMA A;  2W9P A;  3KZT A;  2CFK A;  3NV0 B;  1RGF A;  3F7X A;  3LTB A;  1GOU A;  1IU7 A;  3GSP A;  3SOA A;  1V57 A;  3U97 A;  2INX A;  4RBN A;  3D9R A;  1RNB A;  1YJN 3;  5D81 A;  2OOV A;  2CX1 A;  4XM4 A;  2J8X B;  3G8Z A;  1JZD A;  4HM3 B;  1BNF A;  3GZY B;  2XR8 B;  3NXJ A;  3A76 A;  1GD3 A;  2M7O A;  1CQS A;  3WA2 X;  1IV7 A;  2W0Q A;  1RGE A;  3UL6 A;  1R4C A;  4O3V A;  2CHC A;  1B2X A;  1LQM B;  1NB3 I;  4TX4 A;  4ZM8 A;  1OAC A;  4LGQ A;  2C10 A;  1JBS A;  4XB5 A;  3GZX B;  2CG0 A;  2HMM B;  2HMK B;  3CCR 3;  2KF6 A;  3EJV A;  4HM2 B;  1OHO A;  1A2K A;  1R4Y A;  4HM6 B;  1TTO A;  5EVH A;  1T2H A;  1W2Z A;  2CFL A;  4OVM A;  3X41 A;  3I56 3;  1YIJ 3;  4GHO A;  2GBX B;  3VF1 A;  5FW5 A;  1RN7 A;  2IMJ A;  3EN8 A;  3CCV 3;  3JVC A;  1QAK A;  3WOD G;  2QA4 3;  1Q7H A;  1M1X B;  1TRQ A;  4JRF A;  2RNT A;  5STD A;  1SII A;  1KD1 4;  3RNT A;  1WMO A;  1GSP A;  1HKX A;  2IA7 A;  1Z1S A;  1W5Z A;  1G96 A;  1TIJ A;  1X1W A;  3FF2 A;  1B2S A;  5JBS A;  1IT8 A;  5D83 A;  5IEN A;  3LT8 A;  3LH4 A;  1IDP A;  3V98 A;  2CFD A;  2KF3 A;  1V58 A;  1BGS A;  4NRE A;  1BAN A;  1BAO A;  1O7N B;  1AVK A;  1WQL B;  2H0I A;  4HYZ A;  3BNE A;  1WTH A;  2BO9 B;  1UCI A;  4N3V A;  3VSY A;  2K0M A;  3FG4 A;  4EYC A;  1OGX A;  1BSE A;  1AY7 A;  3NQZ A;  2CK3 H;  4Q53 A;  3STD A;  2AAD A;  3HK4 A;  3KKG A;  4MJD A;  2CWT A;  3NX0 A;  5IG3 A;  1NU3 A;  3K5T A;  1CEW I;  2XGN A;  3G0K A;  3HZP A;  3M8C A;  4BTW A;  1RGL A;  1BOX A;  1IVV A;  1FYS A;  1JKG A;  3CPW 2;  1BUQ A;  3E99 A;  3F40 A;  3CCU 3;  1FUT A;  4EBG A;  4N6M A;  2CG1 A;  2IUJ A;  3IPT A;  4HM4 B;  3Q3F A;  1OH0 A;  1IT7 A;  4K61 A;  1VQ6 3;  4HOH A;  1B21 A;  4CJN A;  1N9J A;  1A2V A;  1GS3 A;  1I3I A;  4FR9 A;  3CNX A;  2FNQ A;  1W6G A;  1BSA A;  2GBW B;  2IY2 A;  1YGW A;  1JV2 B;  3PCS A;  2OWP A;  3N8B A;  3I55 3;  1CYU A;  2W56 B;  3F8X A;  5GSP A;  1EQK A;  4N6O B;  1BNR A;  3CCL 3;  1K41 A;  2BMR B;  2RSX A;  1LOY A;  3S28 A;  2CX0 A;  1RMS A;  4J8T A;  1RKY A;  4OUQ A;  1TFK A;  3OX9 A;  3ZFZ A;  3F7S A;  5CF1 A;  5D82 A;  4N6T A;  3LTC A;  1MGW A;  4FMD A;  4EV5 A;  2UGI A;  4XBX A;  3IMA B;  3LML A;  1YGE A;  1EKM A;  1G02 A;  4FMB A;  1K8A 4;  4FMC A;  3GZR A;  2GEY A;  2P38 A;  1DMM A;  1O7P B;  4L8O A;  3WHO A;  1BRN L;  3BLZ A;  1Q82 4;  1ZO2 A;  2Z76 A;  1TRP A;  1S72 3;  3WMD A;  1NDO B;  2H0G A;  1VQ9 3;  3ROB A;  3F9S A;  3MPH A;  2F99 A;  3B4O A;  1QAL A;  3NM7 A;  4LYL B;  8CHO A;  5IG5 A;  2JQ5 A;  1TJD A;  4GL6 A;  2E2T A;  3EBY A;  2PZV A;  6STD A;  1DMQ A;  4ILF A;  3K0Z A;  1F8N A;  3HIG A;  1GMQ A;  3NUV A;  1BNS A;  1QAF A;  3QK9 A;  1AV4 A;  3WR2 A;  2OQE C;  3T8N A;  1FGM A;  3FG1 A;  3MG3 A;  3EF8 A;  3WOE B;  1VQQ A;  1SIH A;  2K3D A;  1RGA A;  1E3R A;  1D6Y A;  2LQV A;  3KN4 A;  1RGH A;  1ULI B;  1BRI A;  3BU4 A;  1BU4 A;  2P0M A;  1GD4 A;  1JJ2 2;  4EW5 A;  5CF2 A;  3JUP A;  1BRK A;  2FGT A;  4I4K A;  2STD A;  4CDL A;  5BIR A;  1LNI A;  1PYL A;  4R80 A;  1DMN A;  1VQK 3;  1O7M B;  9RNT A;  2BMQ B;  1UUG B;  4HM1 B;  1SJW A;  1IVW A;  3FF0 A;  3KII A;  1ZX2 A;  3CCJ 3;  1DVD A;  1GOV A;  1OHP A;  1YNV X;  1JB2 A;  2F5M A;  1QVG 2;  1I0V A;  4HKV B;  4JF8 A;  3S27 A;  2BNG A;  3G6E 3;  1M90 4;  2F86 B;  1V74 A;  3S29 A;  3FSD A;  3SYU A;  1X1Y A;  2YX9 A;  1B2U A;  2Z6B A;  3JUQ A;  4MEI A;  4XDW A;  2RCD A;  4R9K A;  3X40 A;  3CC4 3;  3ZG5 A;  3B7C A;  8RNT A;  4OK0 A;  1LXE A;  1K73 4;  3OWY A;  4HM8 B;  2B1X B;  3EQQ B;  3OW2 2;  1EEJ A;  3F14 A;  1UUW B;  1RJO A;  1IVU A;  3PGB A;  2A15 A;  2WO0 A;  4WHA A;  2W6J H;  4N6U A;  5HOH A;  2LYX A;  2KRT A;  1Y4K A;  3KE7 A;  5LC7 A;  4LMI A;  4HM7 B;  1FGO A;  3G16 A;  2PNC A;  5IW9 A;  4DKI A;  1OPY A;  5I97 A;  1NB5 I;  1FW7 A;  1ZS7 A;  2W9Q A;  1B3S A;  1N9E A;  4FCZ A;  4X2O A;  6GSP A;  3X3X A;  3TDG A;  4L7K A;  3MKI A;  2F5W A;  3WA3 A;  1JB4 A;  1MOL A;  3CMA 3;  3D5G A;  1X1U A;  1I8V A;  1KC8 4;  2B24 B;  5CK6 A;  1BVI A;  1N8R 4;  2RFR A;  3DGY A;  3K63 A;  3Q2P A;  1RSN A;  1U8C B;  1FUW A;  2XFS A;  1X1X A;  1ZGX A;  2F98 A;  3DGO A;  4K1V A;  4LZI A;  4O02 B;  3SOY A;  2MF7 A;  3NM2 A;  1GMP A;  7RNT A;  1NO3 A;  1C54 A;  1YHQ 3;  4CCV A;  2CWU A;  1Q7Y 4;  3EN1 B;  1ROV A;  4BU4 A;  2XH9 A;  3LT9 A;  5AEW B;  1I2G A;  2BT3 A;  2Q07 A;  4HZ9 B;  3MHE A;  5HGR A;  1PY3 A;  4HAA A;  1RNT A;  1EG9 B;  7GSP A;  3F8H A;  1RGG A;  2QIY A;  1UUV B; 
#chains in the Genus database with same CATH homology
 1G02 A;  5RNT A;  6RNT A;  1JBT A;  2BU4 A;  3D5I A;  1FUS A;  3WHO A;  1I0X A;  1HZ1 A;  1RTU A;  1TRP A;  2C4B A;  1GMR A;  1HYF A;  1RDS A;  1RN1 A;  1GOY A;  1BSB A;  2HOH A;  1BRH A;  3BIR A;  3AGO A;  2RBI A;  2KF5 A;  1LOV A;  1GMQ A;  1RGF A;  1BNS A;  3WR2 A;  1GOU A;  1BIR A;  3GSP A;  1B2M A;  3URP A;  1BUJ A;  1RNB A;  1Q9E A;  1BNJ A;  2ZA4 A;  3D4A A;  4RNT A;  1BNI A;  1RGA A;  1BNF A;  1RGH A;  1RGK A;  1BRI A;  1RGE A;  3BU4 A;  1RN4 A;  1BU4 A;  1B2X A;  1UCL A;  1B27 A;  1BRK A;  1BSD A;  5BIR A;  1JBS A;  1BRG A;  2KF4 A;  1LNI A;  1PYL A;  1MGR A;  2KF6 A;  1CH0 A;  1R4Y A;  9RNT A;  1TTO A;  1T2H A;  1LOW A;  4GHO A;  1IYY A;  4J5K A;  3AGN A;  1B20 A;  1GOV A;  1YNV X;  2F5M A;  1I0V A;  1TRQ A;  2RNT A;  1BRS A;  3SYU A;  3AHS A;  3RNT A;  2BIR A;  1X1Y A;  1B2U A;  1GSP A;  3HOH A;  1YVS A;  1BRJ A;  1X1W A;  1BSC A;  8RNT A;  1B2S A;  1DET A;  1I3F A;  2KF3 A;  1BGS A;  1BAN A;  1BAO A;  1FZU A;  1LRA A;  1I2F A;  5HOH A;  1RLS A;  1BNG A;  1UCI A;  2F4Y A;  3KCH A;  4J5G A;  2AAE A;  1BSE A;  1AY7 A;  4BIR A;  1RCK A;  2KAA A;  1FW7 A;  5BU4 A;  2AAD A;  1B3S A;  1RHL A;  1JBR A;  6GSP A;  1T2I A;  4GSP A;  2F5W A;  1RGL A;  1UCK A;  1FYS A;  1BOX A;  3D5G A;  1X1U A;  3A5E A;  1FUT A;  3DH2 A;  1I8V A;  1B2Z A;  1I70 A;  1BVI A;  2SAR A;  3DGY A;  3Q3F A;  1RSN A;  4HOH A;  1B21 A;  1BNE A;  1UCJ A;  1I3I A;  1X1X A;  1ZGX A;  1BSA A;  1RGC A;  1YGW A;  1GMP A;  7RNT A;  1DE3 A;  5GSP A;  1C54 A;  1BNR A;  3AHW A;  1AQZ A;  1LOY A;  1A2P A;  4BU4 A;  1RMS A;  1I2E A;  2GSP A;  1I2G A;  1SAR A;  1PY3 A;  1RCL A;  4HAA A;  1RNT A;  2F56 A;  1MGW A;  7GSP A;  1BRN L;  1RGG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...