1GMPA

Complex of ribonuclease from streptomyces aureofaciens with 2'-gmp at 1.7 angstroms resolution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
96
structure length
96
Chain Sequence
DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIICGEATQEDYYTGDHYATFSLIDQTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complex of ribonuclease from Streptomyces aureofaciens with 2'-GMP at 1.7 A resolution.
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase(guanyloribonuclease)
molecule keywords RIBONUCLEASE SA
total genus 26
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1992-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1gmpA00
1BOXA 5GSPA 1LOVA 1BRJA 1B2XA 4BU4A 1FUTA 1I2GA 1BVIA 1GMRA 2F4YA 4HOHA 1BNSA 2ZA4A 3URPA 1RSNA 1BANA 1BRKA 1AQZA 1GOVA 1IYYA 1GOYA 1JBSA 2GSPA 3D5GA 5HOHA 1I3FA 1TRQA 1RMSA 1BSAA 7GSPA 1GMPA 3Q3FA 2KF5A 1B2MA 1B20A 4RNTA 1SARA 1HYFA 2KF6A 1YVSA 1RDSA 1MGWA 1UCIA 1LOWA 5RNTA 1BUJA 1GSPA 1A2PA 1JBRA 1RGEA 4GSPA 4BIRA 6RNTA 1B2SA 1PYLA 1BSCA 1MGRA 1LOYA 3RNTA 1RNBA 1I0XA 1BAOA 2HOHA 1X1YA 3AHWA 2C4BA 1BNEA 1RGHA 1RLSA 1HZ1A 2BIRA 2RNTA 3WR2A 1BNIA 1BSDA 1RGAA 3GSPA 1B3SA 1PY3A 1TRPA 3BU4A 3KCHA 1T2IA 2AADA 1TTOA 3SYUA 8RNTA 3WHOA 4HAAA 1T2HA 2RBIA 1GOUA 1GMQA 1FZUA 4GHOA 1BIRA 9RNTA 1ZGXA 2F5MA 3HOHA 2AAEA 1X1XA 1I2FA 1RCKA 1RN1A 1DETA 1B27A 1LRAA 2SARA 5BIRA 2BU4A 3D5IA 3DH2A 1FW7A 1AY7A 1X1UA 4J5GA 1B2UA 3BIRA 1BRNL 1BGSA 1UCLA 1R4YA 1I2EA 1YGWA 1BNRA 3A5EA 1UCJA 1RGGA 1BNFA 1RCLA 3D4AA 1BRGA 1RHLA 1I0VA 6GSPA 1Q9EA 3DGYA 1RGLA 1YNVX 1CH0A 4J5KA 7RNTA 1RGKA 2KF3A 1UCKA 1BSBA 1RNTA 1RTUA 2F5WA 3AGNA 2KF4A 1X1WA 1I70A 1JBTA 1RGFA 1DE3A 1FYSA 1LNIA 1G02A 5BU4A 1BRHA 1BNGA 1BRSA 1FUSA 3AGOA 1BNJA 1I3IA 1B2ZA 1RGCA 1RN4A 2KAAA 3AHSA 1B21A 1BU4A 1I8VA 1BRIA 2F56A 1C54A 1BSEA
chains in the Genus database with same CATH superfamily
2RSXA 3OWSA 3VF1A 4CCVA 2P05A 1KC84 1VQN3 4I5QA 3SOAA 2CG0A 3WMDA 5AI1A 4J9AA 2CFGA 1JB2A 2UX0A 1B2XA 2B1XB 3E99A 3VSYA 4BU4A 3RGAA 1GMRA 1K8A4 1S723 4Q53A 1BNSA 3DM8A 1WTHA 4MJDA 1RSNA 1A2VA 3DXOA 3BNBA 1GOVA 3X3ZA 2XH9A 1OH0A 2Q07A 2Z6BA 1GOYA 2QEX3 2GSPA 2QIYA 3KN4A 4PEJA 1NB5I 2P38A 1RMSA 1WMPA 3NM2A 3OWUA 2D1WA 5IEOA 3CMA3 1GMPA 1G96A 3Q1CA 1AR0A 1NWWA 2KF5A 2IUJA 1B2MA 4LGQA 1QALA 2KF6A 1TU5A 4FMBA 2OTJ3 5KP1A 3S27A 1MGWA 3SVAA 5RNTA 3CCR3 5FW5A 1A2PA 1LXEA 2K0MA 3B7CA 1YHQ3 4HYZA 1JBRA 3SX1A 1B2SA 1U8CB 1BSCA 3CC43 2HMLB 3EBYA 3EHCA 5EVHA 1A67A 4XDWA 4BTYA 3I0YA 2IA7A 3WOEB 2WGQA 1OGZA 3AHWA 3G0KA 1RLSA 2BIRA 1YVBI 2RNTA 3MG3A 4LYLB 3B4OA 3CU3A 1TUHA 1IVVA 1ZO2A 3BU4A 3NHXA 1FGTA 1UW1A 2K54A 3SYUA 3G6E3 3EX9A 3F9SA 1EG9B 4HAAA 3WHOA 1N5HA 1UUVB 1STDA 1O7HB 5IERA 1GMQA 3SXXA 1GD3A 1MWSA 3ECFA 4GB5A 4GHOA 4R1KA 1VQL3 3TDGA 1YJN3 1M1XB 1QAFA 5M19A 3RGRA 1OF5A 1WQLB 4KZ1A 2FNQA 1MWUA 1NDOB 3KFQC 1GYBA 2AAEA 5JPUA 1K28A 4EXRA 1RN1A 4HZBB 2WOHA 1LRAA 3X40A 2YX9A 1QJGA 2BU4A 2RCDA 4HJLB 4OK0A 2F99A 4EV5A 3OW22 1UUWB 3SOYA 1Q864 4KFDA 1QVG2 1M904 3G713 1E97A 1UCLA 1T3BA 2INXA 1I2EA 4H3UA 1DVDA 5AEUB 2CG1A 1BNRA 2GU1A 3EC9A 4WFOA 1EQKA 1IVXA 2K3DA 4RZMA 2ZL8A 3I553 3NUVA 3GZBA 4BL2A 3V98A 3J7Yd 3G16A 2YFLB 2GXFA 1I0VA 2P0XA 1Q9EA 2Z7AA 3JUMA 2QGUA 3DGYA 1RGLA 1YNVX 4FMAA 3ALAA 3DY5A 3DUKA 5ELUA 1ROAA 3X3YA 3CNMA 4WHAA 1IVUA 3U97A 5FGOA 1W4NA 3NBRA 3LMLA 3KE7A 1IDPA 1I70A 1K41A 4QWTA 1W6GA 2ZDJA 3MWZA 2XRXB 1RJOA 1A90A 1ASKA 1M9GA 1V57A 1L5GB 1TFOA 1W2ZA 1G02A 4R9LA 3CNXA 2BT3A 4AEQA 5D81A 2MC8A 1BNGA 1FUSA 1RGCA 3F7XA 1YJ93 1RN4A 1QVF2 1D6ZA 4FMDA 3NM7A 5TGNA 1UDII 3F7SA 5A0OB 1I8VA 1LOXA 1O7WB 1VQO3 3GAXA 4HVNA 1BSEA 1CQSA 2CWTA 1NJI4 3B8LA 2F86B 1VQQA 1BOXA 1JNQA 5IG3A 4GL6A 4N6OB 2BNGA 2P09A 1OACA 1OPYA 3FLJA 5STDA 1BRJA 2BMOB 4HM0B 3VGNA 1SIIA 4HKVB 1FUTA 1I2GA 1S5AA 1V74A 1EEJA 3NV0A 3S5CA 2Z76A 3FZWA 4H61A 4N3VA 1BANA 1RKYA 2MF7A 1AQZA 1IYYA 1IQ8A 3T0UA 1TRQA 2W03A 3PCRA 3GRDA 1BSAA 4OUQA 5IENA 7GSPA 2CX1A 3CPOA 3LOYA 4K90B 5IEPA 3GZXB 1B20A 1JV2B 4KFEA 3G4S3 2HMNB 2IY2A 3M8CA 3F40A 1FGQA 1V58A 1ULJB 2UUGC 1LVNA 2W6JH 3GZYB 4FCZA 1YIT3 1RRHA 1DMQA 3ZG0A 2XGNA 3WDGB 5JBSA 1SQWA 5IW9A 4L8OA 2E2UA 4TX4A 3Q2PA 3CCM3 3D3LA 1LOYA 2GEXA 4FCMA 3EJVA 1IU7A 2CKFB 3LH4A 2I9WA 1SPUA 1VQ93 2HOHA 3F8XA 1X1YA 1N5PA 5AIGA 4XM4A 2R4IA 3N8BA 4RNZA 3JVCA 1R4CA 3WR2A 1BSDA 1RGAA 1PY3A 3MG1A 2D42A 1W6YA 1Z1SA 5G2GA 1W2B2 4NREA 4ORLA 4DKIA 1Y4KA 4MEIA 4K1VA 2AADA 1TTOA 5KP4A 2E2TA 8RNTA 1T2HA 3PZWA 4WYKB 1KWIA 2W2CA 2Y73A 2RBIA 2XSOB 1GOUA 4HM4B 3LZAA 1OGXA 4LEHA 2BHMA 1FZUA 4NHFA 4BL3A 1BIRA 1W01A 3MYTA 3NV0B 4RBNA 4N6NB 5KP3A 1ZGXA 2ML6A 1CEWI 2F5MA 1KD14 4L8PA 4LSOA 3KZTA 2GBWB 2L4VA 1DETA 1B27A 3NXJA 1DMNA 4R80A 1SJWA 2IMJA 3D5IA 2CFWA 3DH2A 1GY6A 4EBGA 1SIHA 1X1UA 4J8TA 1O7GB 4R9KA 3SEDA 1VQM3 4OVMA 1B2UA 1WMOA 3BIRA 1BRNL 1LQMB 3X41A 3IPTA 1LNHA 5BVBA 1IQXA 3N9HA 3LTDA 1U5OA 3A5EA 1UCJA 3EN8A 2QA43 1C7HA 3K9MC 1FUWA 1RCLA 4XBTA 1ULIB 1HKXA 2UGIA 3OWYA 3JUQA 3ZFZA 1Q7Y4 6GSPA 3CXC2 4BTWA 4AKYA 3NX0A 3CCQ3 4JF8A 1VQ53 1OUNA 1RGKA 2CFDA 5AIIA 3UNLA 1N8R4 1O7MB 1BSBA 1RNTA 3CPW2 1US1A 1RTUA 4LMIA 5IG5A 1JKGA 2W56B 3AMOB 4EC6A 2KF4A 1IVWA 2OCTA 1VQK3 3GWRA 4KFFA 2O3OA 3PXMA 1FYSA 1VQ73 1DYUA 3WODG 1BRHA 1JB4A 2STDA 1Q824 3FH1A 3OXAA 1BNJA 2A15A 3CC23 1I3IA 1B2ZA 3S29A 3CCU3 3FCSB 2RFRA 4IPBA 3H3HA 1B21A 1BU4A 4STDA 2CFKA 1BRIA 2F56A 3L0RA 1C54A 3U1WA 3WA2X 1UI8A 4N6MA 1JZDA 2FGTA 2OTL3 2ML5A 4XDVA 2JDIH 3KKGA 2HMKB 2LQVA 1VQP3 4JRFA 1BVIA 2F4YA 3FKAA 1UI7A 8CHOA 2OOVC 2OWPA 3NQZA 1RN7A 1MNLA 1RRLA 4WYKA 5CF2A 4RNYA 5DRVA 1JBSA 3D5GA 4X2OA 1OHOA 1I3FA 1Q40A 3LTAA 3GZRA 3NQYA 3EE1A 2KCDA 3FG3A 1VQ63 4RNTA 1SARA 1HYFA 1WMNA 2WOFA 5CLKA 4CJNA 1YVSA 3MPHA 3BLZA 1IT8A 3CCE3 1RDSA 4KT3B 1LOWA 3HK4A 1BUJA 2LYXA 2W9PA 3FG1A 1RGEA 3HI7A 4GSPA 1M1K4 3FF0A 4BIRA 4FMCA 6RNTA 4NPBA 1K734 1PYLA 2CFLA 2J8XB 3DZLA 3LXUX 4HM6B 4HZ9B 4R4KA 1O7PB 4O8SA 1JKGB 1NO3A 3AMOA 1IV9A 4WWUC 1RNBA 4N6LA 5M18A 4KVHA 2C10A 3PGBA 4ZM8A 2C4BA 1BNEA 1VQ83 3MSOA 2W56A 1B3SA 3CCL3 5D83A 3HZPA 2CW9A 1K9M4 2M7OA 3KCHA 1T2IA 2C11A 3A76A 1VQ43 1JN5A 3KIIA 1Q7HA 3CCV3 3X3XA 1GY7A 2KXGA 4EW5A 1NNVA 1OHSA 3QK9A 4AKZA 3BNDA 3PYJA 6STDA 2HMJB 2YFJB 3MHEA 4CPKA 5G1LA 9RNTA 1STFI 4O3VA 1HU9A 1KQS2 3UL5A 5AYRB 3HOHA 5AYSC 5G1KA 3K5TA 1MOLA 1FA3A 4HBRA 4EYCA 3QRDA 5AIFA 3BB9A 2SARA 5LC6A 3EB8A 4X2HA 1Q814 1FW7A 2HMOB 2FXTA 4J5GA 2P0MA 5D82A 3D9RA 5IG4A 1BGSA 1R4YA 3EF8A 1N9EA 1IQYA 1YGWA 2GU3A 2OQEC 5I97A 3CME3 4K1UA 1RGGA 2XFSA 4IT7A 1TP6A 1UGHI 1BRGA 3BNEA 4N6TA 3DGOA 1RHLA 3LTCA 4ILFA 2E2VA 3N54B 4LZIA 4J5KA 1CH0A 7RNTA 5CK6A 3H51A 1DMMA 2KF3A 4L7KA 1UCKA 3ER7A 2O9UX 3JUNA 4EV2A 3D79A 3NBJA 2F5WA 3AGNA 3PS8A 2H0HA 1Q42A 1YGEA 1X1WA 3HX8A 4G1MB 1PU4A 1YJW3 1EUIC 1JBTA 1LNIA 1TIJA 2CWUA 1E3VA 1G0TA 1GS3A 3KSPA 4WP5A 1BRSA 1KSIA 1IK3A 1W02A 3AGOA 3LTBA 3OX9A 1BUQA 3O8YA 2KAAA 1CYVA 5ELJA 3BNCA 3T8UA 1TJDA 1TFKA 2XSHB 2Z77A 3SLUA 5AEWB 1IV7A 2B24B 2PNCA 5IG0A 1D6YA 5GSPA 1W00A 1LOVA 1LQGC 3LT8A 2Y74A 3EQQB 3WA3A 1J2BA 4HM2B 4HOHA 2ZA4A 3URPA 2CHCA 1BRKA 3PCSA 4CDLA 1WNHA 3CCJ3 4MMZB 5HOHA 3IMAB 2V1LA 2CIUA 3UL6A 2PZVA 5DREA 3LYGA 3JUPA 2ZHXB 3Q3FA 3UB1A 3F14A 1D6UA 4O02B 1VZZA 2H0GA 1UCIA 1OCVA 3FF2A 4U13A 1GY5A 2XFTA 3IJEB 1GSPA 3MG2A 4HM1B 2CWVA 1W5ZA 1EA2A 1E3RA 1MWTA 1DVCA 3V99A 3CCS3 2YFIB 5HGRA 3HIIA 2XGLA 4HM3B 1ISKA 3CD63 1MGRA 3ROBA 3UJMA 1AVKA 1JN5B 4XBXA 3T8NA 2CX0A 3K7CA 1A2KA 1UGIA 2XF3A 1I0XA 1BAOA 4K61A 3MKIA 3DGNA 2CH9A 1QAKA 2XR8B 2GEYA 4IIAA 5LC7A 2IYJA 3JUOA 5CXOA 1NB3I 1RGHA 3DGMA 1HZ1A 3EN1B 1F8NA 1BNIA 3GSPA 5JPPA 1QMAA 3K0ZA 1TRPA 3G8ZA 1FGRA 4O2HA 1T5YA 3FGYA 1FGMA 2WGOA 3STDA 3FG4A 3K63A 1MWRA 1JB5A 1UUGB 4MMYB 2W04A 4I4KA 1O7NB 1N9JA 2RGQA 2GBXB 3NBBA 3S28A 2WO0A 2CK3H 2R41A 3EBTA 1X1XA 1I2FA 2BO9B 2SBLA 1RCKA 3OV4A 2BMQB 1OHPA 5BIRA 3X42A 3CC73 1Q40B 2W9QA 1FGOA 1CYUA 1AY7A 1EKMA 3KSED 2KRTA 3FSDA 3ZG5A 4BTXA 5BXQA 1AVLA 2XEPA 2F98A 1OF5B 1BNFA 2HMMB 2OOVA 5M1AA 7STDA 4HM7B 1PFPA 2CC3A 4N6V0 3D4AA 2JQ5A 4XBYA 3B4PA 1AV4A 1NU3A 5AIHA 3V92A 3DGLA 3LT9A 3WOFB 4XB5A 3I563 5EEOA 2W0QA 5IF6A 3RDEA 3HIGA 4HM5B 4FCJA 2IUKA 1GD4A 1N8QA 3S67A 2H0IA 4HM8B 3F8HA 2L1SA 3Q90A 1W7CA 1YI23 2OQEA 1YIJ3 1ZX2A 4MMXB 1ZS7A 3RNTA 1DE3A 1RGFA 1JZOA 5EQLA 4N6UA 1W6CA 5BU4A 1JRQA 1JJ22 3DMCA 3AHSA 5CF1A 4FR9A 1ROVA 2BMRB 1IT7A
chains in the Genus database with same CATH topology
1BOXA 5GSPA 1LOVA 1BRJA 1B2XA 4BU4A 1FUTA 1I2GA 1BVIA 1GMRA 2F4YA 4HOHA 1BNSA 2ZA4A 3URPA 1RSNA 1BANA 1BRKA 1AQZA 1GOVA 1IYYA 1GOYA 1JBSA 2GSPA 3D5GA 5HOHA 1I3FA 1TRQA 1RMSA 1BSAA 7GSPA 1GMPA 3Q3FA 2KF5A 1B2MA 1B20A 4RNTA 1SARA 1HYFA 2KF6A 1YVSA 1RDSA 1MGWA 1UCIA 1LOWA 5RNTA 1BUJA 1GSPA 1A2PA 1JBRA 1RGEA 4GSPA 4BIRA 6RNTA 1B2SA 1PYLA 1BSCA 1MGRA 1LOYA 3RNTA 1RNBA 1I0XA 1BAOA 2HOHA 1X1YA 3AHWA 2C4BA 1BNEA 1RGHA 1RLSA 1HZ1A 2BIRA 2RNTA 3WR2A 1BNIA 1BSDA 1RGAA 3GSPA 1B3SA 1PY3A 1TRPA 3BU4A 3KCHA 1T2IA 2AADA 1TTOA 3SYUA 8RNTA 3WHOA 4HAAA 1T2HA 2RBIA 1GOUA 1GMQA 1FZUA 4GHOA 1BIRA 9RNTA 1ZGXA 2F5MA 3HOHA 2AAEA 1X1XA 1I2FA 1RCKA 1RN1A 1DETA 1B27A 1LRAA 2SARA 5BIRA 2BU4A 3D5IA 3DH2A 1FW7A 1AY7A 1X1UA 4J5GA 1B2UA 3BIRA 1BRNL 1BGSA 1UCLA 1R4YA 1I2EA 1YGWA 1BNRA 3A5EA 1UCJA 1RGGA 1BNFA 1RCLA 3D4AA 1BRGA 1RHLA 1I0VA 6GSPA 1Q9EA 3DGYA 1RGLA 1YNVX 1CH0A 4J5KA 7RNTA 1RGKA 2KF3A 1UCKA 1BSBA 1RNTA 1RTUA 2F5WA 3AGNA 2KF4A 1X1WA 1I70A 1JBTA 1RGFA 1DE3A 1FYSA 1LNIA 1G02A 5BU4A 1BRHA 1BNGA 1BRSA 1FUSA 3AGOA 1BNJA 1I3IA 1B2ZA 1RGCA 1RN4A 2KAAA 3AHSA 1B21A 1BU4A 1I8VA 1BRIA 2F56A 1C54A 1BSEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BOX A;  5GSP A;  1LOV A;  1BRJ A;  1B2X A;  4BU4 A;  1FUT A;  1I2G A;  1BVI A;  1GMR A;  2F4Y A;  4HOH A;  1BNS A;  2ZA4 A;  3URP A;  1RSN A;  1BAN A;  1BRK A;  1AQZ A;  1GOV A;  1IYY A;  1GOY A;  1JBS A;  2GSP A;  3D5G A;  5HOH A;  1I3F A;  1TRQ A;  1RMS A;  1BSA A;  7GSP A;  1GMP A;  3Q3F A;  2KF5 A;  1B2M A;  1B20 A;  4RNT A;  1SAR A;  1HYF A;  2KF6 A;  1YVS A;  1RDS A;  1MGW A;  1UCI A;  1LOW A;  5RNT A;  1BUJ A;  1GSP A;  1A2P A;  1JBR A;  1RGE A;  4GSP A;  4BIR A;  6RNT A;  1B2S A;  1PYL A;  1BSC A;  1MGR A;  1LOY A;  3RNT A;  1RNB A;  1I0X A;  1BAO A;  2HOH A;  1X1Y A;  3AHW A;  2C4B A;  1BNE A;  1RGH A;  1RLS A;  1HZ1 A;  2BIR A;  2RNT A;  3WR2 A;  1BNI A;  1BSD A;  1RGA A;  3GSP A;  1B3S A;  1PY3 A;  1TRP A;  3BU4 A;  3KCH A;  1T2I A;  2AAD A;  1TTO A;  3SYU A;  8RNT A;  3WHO A;  4HAA A;  1T2H A;  2RBI A;  1GOU A;  1GMQ A;  1FZU A;  4GHO A;  1BIR A;  9RNT A;  1ZGX A;  2F5M A;  3HOH A;  2AAE A;  1X1X A;  1I2F A;  1RCK A;  1RN1 A;  1DET A;  1B27 A;  1LRA A;  2SAR A;  5BIR A;  2BU4 A;  3D5I A;  3DH2 A;  1FW7 A;  1AY7 A;  1X1U A;  4J5G A;  1B2U A;  3BIR A;  1BRN L;  1BGS A;  1UCL A;  1R4Y A;  1I2E A;  1YGW A;  1BNR A;  3A5E A;  1UCJ A;  1RGG A;  1BNF A;  1RCL A;  3D4A A;  1BRG A;  1RHL A;  1I0V A;  6GSP A;  1Q9E A;  3DGY A;  1RGL A;  1YNV X;  1CH0 A;  4J5K A;  7RNT A;  1RGK A;  2KF3 A;  1UCK A;  1BSB A;  1RNT A;  1RTU A;  2F5W A;  3AGN A;  2KF4 A;  1X1W A;  1I70 A;  1JBT A;  1RGF A;  1DE3 A;  1FYS A;  1LNI A;  1G02 A;  5BU4 A;  1BRH A;  1BNG A;  1BRS A;  1FUS A;  3AGO A;  1BNJ A;  1I3I A;  1B2Z A;  1RGC A;  1RN4 A;  2KAA A;  3AHS A;  1B21 A;  1BU4 A;  1I8V A;  1BRI A;  2F56 A;  1C54 A;  1BSE A; 
#chains in the Genus database with same CATH topology
 2RSX A;  3OWS A;  3VF1 A;  4CCV A;  2P05 A;  1KC8 4;  1VQN 3;  4I5Q A;  3SOA A;  2CG0 A;  3WMD A;  5AI1 A;  4J9A A;  2CFG A;  1JB2 A;  2UX0 A;  1B2X A;  2B1X B;  3E99 A;  3VSY A;  4BU4 A;  3RGA A;  1GMR A;  1K8A 4;  1S72 3;  4Q53 A;  1BNS A;  3DM8 A;  1WTH A;  4MJD A;  1RSN A;  1A2V A;  3DXO A;  3BNB A;  1GOV A;  3X3Z A;  2XH9 A;  1OH0 A;  2Q07 A;  2Z6B A;  1GOY A;  2QEX 3;  2GSP A;  2QIY A;  3KN4 A;  4PEJ A;  1NB5 I;  2P38 A;  1RMS A;  1WMP A;  3NM2 A;  3OWU A;  2D1W A;  5IEO A;  3CMA 3;  1GMP A;  1G96 A;  3Q1C A;  1AR0 A;  1NWW A;  2KF5 A;  2IUJ A;  1B2M A;  4LGQ A;  1QAL A;  2KF6 A;  1TU5 A;  4FMB A;  2OTJ 3;  5KP1 A;  3S27 A;  1MGW A;  3SVA A;  5RNT A;  3CCR 3;  5FW5 A;  1A2P A;  1LXE A;  2K0M A;  3B7C A;  1YHQ 3;  4HYZ A;  1JBR A;  3SX1 A;  1B2S A;  1U8C B;  1BSC A;  3CC4 3;  2HML B;  3EBY A;  3EHC A;  5EVH A;  1A67 A;  4XDW A;  4BTY A;  3I0Y A;  2IA7 A;  3WOE B;  2WGQ A;  1OGZ A;  3AHW A;  3G0K A;  1RLS A;  2BIR A;  1YVB I;  2RNT A;  3MG3 A;  4LYL B;  3B4O A;  3CU3 A;  1TUH A;  1IVV A;  1ZO2 A;  3BU4 A;  3NHX A;  1FGT A;  1UW1 A;  2K54 A;  3SYU A;  3G6E 3;  3EX9 A;  3F9S A;  1EG9 B;  4HAA A;  3WHO A;  1N5H A;  1UUV B;  1STD A;  1O7H B;  5IER A;  1GMQ A;  3SXX A;  1GD3 A;  1MWS A;  3ECF A;  4GB5 A;  4GHO A;  4R1K A;  1VQL 3;  3TDG A;  1YJN 3;  1M1X B;  1QAF A;  5M19 A;  3RGR A;  1OF5 A;  1WQL B;  4KZ1 A;  2FNQ A;  1MWU A;  1NDO B;  3KFQ C;  1GYB A;  2AAE A;  5JPU A;  1K28 A;  4EXR A;  1RN1 A;  4HZB B;  2WOH A;  1LRA A;  3X40 A;  2YX9 A;  1QJG A;  2BU4 A;  2RCD A;  4HJL B;  4OK0 A;  2F99 A;  4EV5 A;  3OW2 2;  1UUW B;  3SOY A;  1Q86 4;  4KFD A;  1QVG 2;  1M90 4;  3G71 3;  1E97 A;  1UCL A;  1T3B A;  2INX A;  1I2E A;  4H3U A;  1DVD A;  5AEU B;  2CG1 A;  1BNR A;  2GU1 A;  3EC9 A;  4WFO A;  1EQK A;  1IVX A;  2K3D A;  4RZM A;  2ZL8 A;  3I55 3;  3NUV A;  3GZB A;  4BL2 A;  3V98 A;  3J7Y d;  3G16 A;  2YFL B;  2GXF A;  1I0V A;  2P0X A;  1Q9E A;  2Z7A A;  3JUM A;  2QGU A;  3DGY A;  1RGL A;  1YNV X;  4FMA A;  3ALA A;  3DY5 A;  3DUK A;  5ELU A;  1ROA A;  3X3Y A;  3CNM A;  4WHA A;  1IVU A;  3U97 A;  5FGO A;  1W4N A;  3NBR A;  3LML A;  3KE7 A;  1IDP A;  1I70 A;  1K41 A;  4QWT A;  1W6G A;  2ZDJ A;  3MWZ A;  2XRX B;  1RJO A;  1A90 A;  1ASK A;  1M9G A;  1V57 A;  1L5G B;  1TFO A;  1W2Z A;  1G02 A;  4R9L A;  3CNX A;  2BT3 A;  4AEQ A;  5D81 A;  2MC8 A;  1BNG A;  1FUS A;  1RGC A;  3F7X A;  1YJ9 3;  1RN4 A;  1QVF 2;  1D6Z A;  4FMD A;  3NM7 A;  5TGN A;  1UDI I;  3F7S A;  5A0O B;  1I8V A;  1LOX A;  1O7W B;  1VQO 3;  3GAX A;  4HVN A;  1BSE A;  1CQS A;  2CWT A;  1NJI 4;  3B8L A;  2F86 B;  1VQQ A;  1BOX A;  1JNQ A;  5IG3 A;  4GL6 A;  4N6O B;  2BNG A;  2P09 A;  1OAC A;  1OPY A;  3FLJ A;  5STD A;  1BRJ A;  2BMO B;  4HM0 B;  3VGN A;  1SII A;  4HKV B;  1FUT A;  1I2G A;  1S5A A;  1V74 A;  1EEJ A;  3NV0 A;  3S5C A;  2Z76 A;  3FZW A;  4H61 A;  4N3V A;  1BAN A;  1RKY A;  2MF7 A;  1AQZ A;  1IYY A;  1IQ8 A;  3T0U A;  1TRQ A;  2W03 A;  3PCR A;  3GRD A;  1BSA A;  4OUQ A;  5IEN A;  7GSP A;  2CX1 A;  3CPO A;  3LOY A;  4K90 B;  5IEP A;  3GZX B;  1B20 A;  1JV2 B;  4KFE A;  3G4S 3;  2HMN B;  2IY2 A;  3M8C A;  3F40 A;  1FGQ A;  1V58 A;  1ULJ B;  2UUG C;  1LVN A;  2W6J H;  3GZY B;  4FCZ A;  1YIT 3;  1RRH A;  1DMQ A;  3ZG0 A;  2XGN A;  3WDG B;  5JBS A;  1SQW A;  5IW9 A;  4L8O A;  2E2U A;  4TX4 A;  3Q2P A;  3CCM 3;  3D3L A;  1LOY A;  2GEX A;  4FCM A;  3EJV A;  1IU7 A;  2CKF B;  3LH4 A;  2I9W A;  1SPU A;  1VQ9 3;  2HOH A;  3F8X A;  1X1Y A;  1N5P A;  5AIG A;  4XM4 A;  2R4I A;  3N8B A;  4RNZ A;  3JVC A;  1R4C A;  3WR2 A;  1BSD A;  1RGA A;  1PY3 A;  3MG1 A;  2D42 A;  1W6Y A;  1Z1S A;  5G2G A;  1W2B 2;  4NRE A;  4ORL A;  4DKI A;  1Y4K A;  4MEI A;  4K1V A;  2AAD A;  1TTO A;  5KP4 A;  2E2T A;  8RNT A;  1T2H A;  3PZW A;  4WYK B;  1KWI A;  2W2C A;  2Y73 A;  2RBI A;  2XSO B;  1GOU A;  4HM4 B;  3LZA A;  1OGX A;  4LEH A;  2BHM A;  1FZU A;  4NHF A;  4BL3 A;  1BIR A;  1W01 A;  3MYT A;  3NV0 B;  4RBN A;  4N6N B;  5KP3 A;  1ZGX A;  2ML6 A;  1CEW I;  2F5M A;  1KD1 4;  4L8P A;  4LSO A;  3KZT A;  2GBW B;  2L4V A;  1DET A;  1B27 A;  3NXJ A;  1DMN A;  4R80 A;  1SJW A;  2IMJ A;  3D5I A;  2CFW A;  3DH2 A;  1GY6 A;  4EBG A;  1SIH A;  1X1U A;  4J8T A;  1O7G B;  4R9K A;  3SED A;  1VQM 3;  4OVM A;  1B2U A;  1WMO A;  3BIR A;  1BRN L;  1LQM B;  3X41 A;  3IPT A;  1LNH A;  5BVB A;  1IQX A;  3N9H A;  3LTD A;  1U5O A;  3A5E A;  1UCJ A;  3EN8 A;  2QA4 3;  1C7H A;  3K9M C;  1FUW A;  1RCL A;  4XBT A;  1ULI B;  1HKX A;  2UGI A;  3OWY A;  3JUQ A;  3ZFZ A;  1Q7Y 4;  6GSP A;  3CXC 2;  4BTW A;  4AKY A;  3NX0 A;  3CCQ 3;  4JF8 A;  1VQ5 3;  1OUN A;  1RGK A;  2CFD A;  5AII A;  3UNL A;  1N8R 4;  1O7M B;  1BSB A;  1RNT A;  3CPW 2;  1US1 A;  1RTU A;  4LMI A;  5IG5 A;  1JKG A;  2W56 B;  3AMO B;  4EC6 A;  2KF4 A;  1IVW A;  2OCT A;  1VQK 3;  3GWR A;  4KFF A;  2O3O A;  3PXM A;  1FYS A;  1VQ7 3;  1DYU A;  3WOD G;  1BRH A;  1JB4 A;  2STD A;  1Q82 4;  3FH1 A;  3OXA A;  1BNJ A;  2A15 A;  3CC2 3;  1I3I A;  1B2Z A;  3S29 A;  3CCU 3;  3FCS B;  2RFR A;  4IPB A;  3H3H A;  1B21 A;  1BU4 A;  4STD A;  2CFK A;  1BRI A;  2F56 A;  3L0R A;  1C54 A;  3U1W A;  3WA2 X;  1UI8 A;  4N6M A;  1JZD A;  2FGT A;  2OTL 3;  2ML5 A;  4XDV A;  2JDI H;  3KKG A;  2HMK B;  2LQV A;  1VQP 3;  4JRF A;  1BVI A;  2F4Y A;  3FKA A;  1UI7 A;  8CHO A;  2OOV C;  2OWP A;  3NQZ A;  1RN7 A;  1MNL A;  1RRL A;  4WYK A;  5CF2 A;  4RNY A;  5DRV A;  1JBS A;  3D5G A;  4X2O A;  1OHO A;  1I3F A;  1Q40 A;  3LTA A;  3GZR A;  3NQY A;  3EE1 A;  2KCD A;  3FG3 A;  1VQ6 3;  4RNT A;  1SAR A;  1HYF A;  1WMN A;  2WOF A;  5CLK A;  4CJN A;  1YVS A;  3MPH A;  3BLZ A;  1IT8 A;  3CCE 3;  1RDS A;  4KT3 B;  1LOW A;  3HK4 A;  1BUJ A;  2LYX A;  2W9P A;  3FG1 A;  1RGE A;  3HI7 A;  4GSP A;  1M1K 4;  3FF0 A;  4BIR A;  4FMC A;  6RNT A;  4NPB A;  1K73 4;  1PYL A;  2CFL A;  2J8X B;  3DZL A;  3LXU X;  4HM6 B;  4HZ9 B;  4R4K A;  1O7P B;  4O8S A;  1JKG B;  1NO3 A;  3AMO A;  1IV9 A;  4WWU C;  1RNB A;  4N6L A;  5M18 A;  4KVH A;  2C10 A;  3PGB A;  4ZM8 A;  2C4B A;  1BNE A;  1VQ8 3;  3MSO A;  2W56 A;  1B3S A;  3CCL 3;  5D83 A;  3HZP A;  2CW9 A;  1K9M 4;  2M7O A;  3KCH A;  1T2I A;  2C11 A;  3A76 A;  1VQ4 3;  1JN5 A;  3KII A;  1Q7H A;  3CCV 3;  3X3X A;  1GY7 A;  2KXG A;  4EW5 A;  1NNV A;  1OHS A;  3QK9 A;  4AKZ A;  3BND A;  3PYJ A;  6STD A;  2HMJ B;  2YFJ B;  3MHE A;  4CPK A;  5G1L A;  9RNT A;  1STF I;  4O3V A;  1HU9 A;  1KQS 2;  3UL5 A;  5AYR B;  3HOH A;  5AYS C;  5G1K A;  3K5T A;  1MOL A;  1FA3 A;  4HBR A;  4EYC A;  3QRD A;  5AIF A;  3BB9 A;  2SAR A;  5LC6 A;  3EB8 A;  4X2H A;  1Q81 4;  1FW7 A;  2HMO B;  2FXT A;  4J5G A;  2P0M A;  5D82 A;  3D9R A;  5IG4 A;  1BGS A;  1R4Y A;  3EF8 A;  1N9E A;  1IQY A;  1YGW A;  2GU3 A;  2OQE C;  5I97 A;  3CME 3;  4K1U A;  1RGG A;  2XFS A;  4IT7 A;  1TP6 A;  1UGH I;  1BRG A;  3BNE A;  4N6T A;  3DGO A;  1RHL A;  3LTC A;  4ILF A;  2E2V A;  3N54 B;  4LZI A;  4J5K A;  1CH0 A;  7RNT A;  5CK6 A;  3H51 A;  1DMM A;  2KF3 A;  4L7K A;  1UCK A;  3ER7 A;  2O9U X;  3JUN A;  4EV2 A;  3D79 A;  3NBJ A;  2F5W A;  3AGN A;  3PS8 A;  2H0H A;  1Q42 A;  1YGE A;  1X1W A;  3HX8 A;  4G1M B;  1PU4 A;  1YJW 3;  1EUI C;  1JBT A;  1LNI A;  1TIJ A;  2CWU A;  1E3V A;  1G0T A;  1GS3 A;  3KSP A;  4WP5 A;  1BRS A;  1KSI A;  1IK3 A;  1W02 A;  3AGO A;  3LTB A;  3OX9 A;  1BUQ A;  3O8Y A;  2KAA A;  1CYV A;  5ELJ A;  3BNC A;  3T8U A;  1TJD A;  1TFK A;  2XSH B;  2Z77 A;  3SLU A;  5AEW B;  1IV7 A;  2B24 B;  2PNC A;  5IG0 A;  1D6Y A;  5GSP A;  1W00 A;  1LOV A;  1LQG C;  3LT8 A;  2Y74 A;  3EQQ B;  3WA3 A;  1J2B A;  4HM2 B;  4HOH A;  2ZA4 A;  3URP A;  2CHC A;  1BRK A;  3PCS A;  4CDL A;  1WNH A;  3CCJ 3;  4MMZ B;  5HOH A;  3IMA B;  2V1L A;  2CIU A;  3UL6 A;  2PZV A;  5DRE A;  3LYG A;  3JUP A;  2ZHX B;  3Q3F A;  3UB1 A;  3F14 A;  1D6U A;  4O02 B;  1VZZ A;  2H0G A;  1UCI A;  1OCV A;  3FF2 A;  4U13 A;  1GY5 A;  2XFT A;  3IJE B;  1GSP A;  3MG2 A;  4HM1 B;  2CWV A;  1W5Z A;  1EA2 A;  1E3R A;  1MWT A;  1DVC A;  3V99 A;  3CCS 3;  2YFI B;  5HGR A;  3HII A;  2XGL A;  4HM3 B;  1ISK A;  3CD6 3;  1MGR A;  3ROB A;  3UJM A;  1AVK A;  1JN5 B;  4XBX A;  3T8N A;  2CX0 A;  3K7C A;  1A2K A;  1UGI A;  2XF3 A;  1I0X A;  1BAO A;  4K61 A;  3MKI A;  3DGN A;  2CH9 A;  1QAK A;  2XR8 B;  2GEY A;  4IIA A;  5LC7 A;  2IYJ A;  3JUO A;  5CXO A;  1NB3 I;  1RGH A;  3DGM A;  1HZ1 A;  3EN1 B;  1F8N A;  1BNI A;  3GSP A;  5JPP A;  1QMA A;  3K0Z A;  1TRP A;  3G8Z A;  1FGR A;  4O2H A;  1T5Y A;  3FGY A;  1FGM A;  2WGO A;  3STD A;  3FG4 A;  3K63 A;  1MWR A;  1JB5 A;  1UUG B;  4MMY B;  2W04 A;  4I4K A;  1O7N B;  1N9J A;  2RGQ A;  2GBX B;  3NBB A;  3S28 A;  2WO0 A;  2CK3 H;  2R41 A;  3EBT A;  1X1X A;  1I2F A;  2BO9 B;  2SBL A;  1RCK A;  3OV4 A;  2BMQ B;  1OHP A;  5BIR A;  3X42 A;  3CC7 3;  1Q40 B;  2W9Q A;  1FGO A;  1CYU A;  1AY7 A;  1EKM A;  3KSE D;  2KRT A;  3FSD A;  3ZG5 A;  4BTX A;  5BXQ A;  1AVL A;  2XEP A;  2F98 A;  1OF5 B;  1BNF A;  2HMM B;  2OOV A;  5M1A A;  7STD A;  4HM7 B;  1PFP A;  2CC3 A;  4N6V 0;  3D4A A;  2JQ5 A;  4XBY A;  3B4P A;  1AV4 A;  1NU3 A;  5AIH A;  3V92 A;  3DGL A;  3LT9 A;  3WOF B;  4XB5 A;  3I56 3;  5EEO A;  2W0Q A;  5IF6 A;  3RDE A;  3HIG A;  4HM5 B;  4FCJ A;  2IUK A;  1GD4 A;  1N8Q A;  3S67 A;  2H0I A;  4HM8 B;  3F8H A;  2L1S A;  3Q90 A;  1W7C A;  1YI2 3;  2OQE A;  1YIJ 3;  1ZX2 A;  4MMX B;  1ZS7 A;  3RNT A;  1DE3 A;  1RGF A;  1JZO A;  5EQL A;  4N6U A;  1W6C A;  5BU4 A;  1JRQ A;  1JJ2 2;  3DMC A;  3AHS A;  5CF1 A;  4FR9 A;  1ROV A;  2BMR B;  1IT7 A; 
#chains in the Genus database with same CATH homology
 1BOX A;  5GSP A;  1LOV A;  1BRJ A;  1B2X A;  4BU4 A;  1FUT A;  1I2G A;  1BVI A;  1GMR A;  2F4Y A;  4HOH A;  1BNS A;  2ZA4 A;  3URP A;  1RSN A;  1BAN A;  1BRK A;  1AQZ A;  1GOV A;  1IYY A;  1GOY A;  1JBS A;  2GSP A;  3D5G A;  5HOH A;  1I3F A;  1TRQ A;  1RMS A;  1BSA A;  7GSP A;  1GMP A;  3Q3F A;  2KF5 A;  1B2M A;  1B20 A;  4RNT A;  1SAR A;  1HYF A;  2KF6 A;  1YVS A;  1RDS A;  1MGW A;  1UCI A;  1LOW A;  5RNT A;  1BUJ A;  1GSP A;  1A2P A;  1JBR A;  1RGE A;  4GSP A;  4BIR A;  6RNT A;  1B2S A;  1PYL A;  1BSC A;  1MGR A;  1LOY A;  3RNT A;  1RNB A;  1I0X A;  1BAO A;  2HOH A;  1X1Y A;  3AHW A;  2C4B A;  1BNE A;  1RGH A;  1RLS A;  1HZ1 A;  2BIR A;  2RNT A;  3WR2 A;  1BNI A;  1BSD A;  1RGA A;  3GSP A;  1B3S A;  1PY3 A;  1TRP A;  3BU4 A;  3KCH A;  1T2I A;  2AAD A;  1TTO A;  3SYU A;  8RNT A;  3WHO A;  4HAA A;  1T2H A;  2RBI A;  1GOU A;  1GMQ A;  1FZU A;  4GHO A;  1BIR A;  9RNT A;  1ZGX A;  2F5M A;  3HOH A;  2AAE A;  1X1X A;  1I2F A;  1RCK A;  1RN1 A;  1DET A;  1B27 A;  1LRA A;  2SAR A;  5BIR A;  2BU4 A;  3D5I A;  3DH2 A;  1FW7 A;  1AY7 A;  1X1U A;  4J5G A;  1B2U A;  3BIR A;  1BRN L;  1BGS A;  1UCL A;  1R4Y A;  1I2E A;  1YGW A;  1BNR A;  3A5E A;  1UCJ A;  1RGG A;  1BNF A;  1RCL A;  3D4A A;  1BRG A;  1RHL A;  1I0V A;  6GSP A;  1Q9E A;  3DGY A;  1RGL A;  1YNV X;  1CH0 A;  4J5K A;  7RNT A;  1RGK A;  2KF3 A;  1UCK A;  1BSB A;  1RNT A;  1RTU A;  2F5W A;  3AGN A;  2KF4 A;  1X1W A;  1I70 A;  1JBT A;  1RGF A;  1DE3 A;  1FYS A;  1LNI A;  1G02 A;  5BU4 A;  1BRH A;  1BNG A;  1BRS A;  1FUS A;  3AGO A;  1BNJ A;  1I3I A;  1B2Z A;  1RGC A;  1RN4 A;  2KAA A;  3AHS A;  1B21 A;  1BU4 A;  1I8V A;  1BRI A;  2F56 A;  1C54 A;  1BSE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...