1GMPA

Complex of ribonuclease from streptomyces aureofaciens with 2'-gmp at 1.7 angstroms resolution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
96
structure length
96
Chain Sequence
b'DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIICGEATQEDYYTGDHYATFSLIDQTC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE SA
publication title Complex of ribonuclease from Streptomyces aureofaciens with 2'-GMP at 1.7 A resolution.
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase(guanyloribonuclease)
total genus 26
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1992-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1gmpA00
1RSNA 1BSAA 1B2UA 1B20A 2F56A 1I0XA 2AADA 1BSBA 2HOHA 2F4YA 1T2HA 3GSPA 1BSEA 1TRPA 1RGAA 1BUJA 1RGEA 1TTOA 5BIRA 1RDSA 1RGKA 1GMRA 3D5IA 1RCLA 3Q3FA 2BU4A 3AHWA 3D5GA 1RHLA 5RNTA 2KAAA 4J5KA 3AHSA 3A5EA 1BRKA 4GSPA 1GOVA 3BIRA 7RNTA 3DH2A 1RCKA 1RLSA 4BIRA 1I3IA 4RNTA 5GSPA 1BSCA 1RTUA 1RGHA 2RNTA 1RN4A 1GOUA 1HZ1A 1B21A 1RNBA 1BOXA 2RBIA 1JBTA 1FW7A 1DE3A 1YVSA 1BIRA 4J5GA 1GMPA 1BRNL 1BNIA 1YNVX 1FUTA 1AY7A 1BRGA 1YGWA 2KF3A 1UCIA 1BNRA 3SYUA 1LOYA 1BNJA 1UCKA 1I2GA 1JBSA 1GSPA 1LRAA 1GMQA 1R4YA 2ZA4A 4HAAA 1RNTA 3URPA 1I8VA 1X1XA 2AAEA 1BANA 1FZUA 1MGWA 7GSPA 2F5MA 1BRIA 2SARA 3KCHA 1AQZA 1PY3A 1FYSA 1RGLA 1C54A 1BNGA 5HOHA 2BIRA 1DETA 1BNFA 1G02A 1I3FA 2C4BA 1BRSA 1BGSA 3AGOA 1X1YA 1B3SA 1SARA 1Q9EA 6RNTA 6GSPA 1LOWA 1I2FA 2KF5A 3AGNA 1X1UA 2KF6A 1I0VA 4BU4A 3DGYA 1BNEA 2F5WA 1RGGA 1BSDA 1HYFA 1B2ZA 1ZGXA 3D4AA 3HOHA 3WHOA 1T2IA 1RN1A 3WR2A 1B2MA 1B2SA 1BU4A 1MGRA 1UCJA 1B2XA 3RNTA 1I70A 3BU4A 1UCLA 8RNTA 1BRJA 1A2PA 1BAOA 1CH0A 1PYLA 1BRHA 1RMSA 4GHOA 1BVIA 1FUSA 9RNTA 1LNIA 1BNSA 1RGFA 1RGCA 1B27A 1I2EA 1JBRA 1IYYA 2KF4A 5BU4A 1GOYA 4HOHA 1TRQA 2GSPA 1X1WA 1LOVA
chains in the Genus database with same CATH superfamily
1ASKA 1K9M4 1IV9A 1ULIB 1B20A 3GRDA 1RRLA 3GZYB 5CF2A 1A67A 1D6UA 1UW1A 3SXXA 2HOHA 2K0MA 1QALA 3WA2X 3GSPA 2WOHA 2Z6BA 5AEUB 1RGAA 3FLJA 1DMQA 2FNQA 4FR9A 2C10A 2CHCA 1EUIC 1BUJA 2F99A 2GXFA 4R1KA 4XM4A 1MWRA 1Y4KA 3T8UA 3GWRA 2L1SA 1WMNA 1KQS2 2OQEC 3D5IA 1RCLA 3BB9A 3AHSA 3N9HA 4WFOA 3X3XA 1E97A 2OOVC 3DXOA 3BIRA 1Q814 4KVHA 5EQLA 2Q07A 3LTBA 5EEOA 4OK0A 4GB5A 1W5ZA 1OGXA 2HMOB 4RNTA 5AIIA 1AVKA 1NNVA 5BXQA 3SLUA 3X41A 1CEWI 5AYSC 1FUWA 2KCDA 3WODG 4FMBA 1JB4A 1GYBA 1FW7A 3RGAA 3X3YA 1DE3A 1YJ93 1BIRA 1BNIA 1UUVB 3JUOA 1WMOA 1NU3A 2MC8A 1BNRA 2HMNB 1RJOA 3NBRA 1UCKA 2BT3A 3DMCA 2RCDA 3LXUX 3O8YA 2MF7A 4I5QA 4EC6A 4RZMA 1O7MB 1JBSA 4IIAA 4HBRA 5A0OB 1LRAA 1GMQA 1R4YA 1J2BA 4HM5B 2CWVA 3NM7A 3FGYA 3ZG0A 2WGOA 1W7CA 3URPA 4X2OA 4STDA 4J8TA 2CWUA 3DM8A 3WOEB 3NX0A 1LNHA 3U1WA 2YFLB 1GY5A 7GSPA 2F5MA 2XF3A 1FGOA 1AQZA 1C54A 2ML5A 2XR8B 2RFRA 3EE1A 3K63A 1O7WB 1BNGA 1DYUA 4K90B 1MOLA 2RSXA 2P05A 3LT9A 1BRSA 4HM4B 3CD63 2CFDA 5IEOA 1R4CA 4CJNA 1JV2B 2GEXA 3OWSA 1AV4A 3EQQB 6RNTA 1GY6A 2IYJA 1FA3A 1LOWA 2CKFB 3D9RA 3E99A 1IQXA 2KF5A 3H51A 3MKIA 5ELUA 1X1UA 3LYGA 3D79A 3BLZA 3JVCA 5EVHA 3EN8A 2E2TA 2KF6A 3NV0B 3V98A 1W00A 1IV7A 2CC3A 2ZL8A 1UDII 3UNLA 2WGQA 3VF1A 1F8NA 3H3HA 5AYRB 4RBNA 1M1K4 4Q53A 4XBXA 1RGGA 1BSDA 3CCS3 2YFJB 1U8CB 1VQO3 2FXTA 1HYFA 3FCSB 2O9UX 3RDEA 2M7OA 4XDWA 2XGLA 4HM0B 1Z1SA 5AIGA 1LVNA 2IUJA 5JPUA 4N3VA 3OX9A 1K734 1K28A 1UGIA 3RNTA 1I70A 3X40A 1UCLA 1BRJA 2B1XB 1W2ZA 1MWUA 1ROAA 1QVF2 2Z76A 4O2HA 1FGRA 1PYLA 4WYKA 1BUQA 3JUNA 1RRHA 2I9WA 2BMOB 1E3RA 1FUSA 1WNHA 3ER7A 3NBBA 3FG3A 9RNTA 2W6JH 3OWYA 5CXOA 3SOAA 1Q7HA 1JBRA 1WTHA 4GL6A 3TDGA 1EG9B 6STDA 4HOHA 1TRQA 3DGNA 1JZOA 3HI7A 1MWTA 1X1WA 3T0UA 1T3BA 2KRTA 3MPHA 3NBJA 2F98A 4IT7A 3EBTA 3EHCA 4R4KA 3M8CA 1JB2A 4FCZA 4HZ9B 4LZIA 4XB5A 1BSBA 1GY7A 1SIHA 2W56A 3PS8A 3BNBA 1CYVA 1W02A 1N8QA 3WMDA 5IG4A 4NHFA 2OCTA 1FGTA 1RGEA 1T5YA 3Q90A 4AKZA 4CCVA 1Q40A 1TTOA 4HM7B 1RGKA 2GU1A 2KXGA 2IUKA 2CX1A 1ZO2A 1QAFA 3I0YA 3F7XA 5IERA 3JUMA 3Q3FA 2CG0A 3D3LA 1W6YA 3B8LA 4J5KA 5D81A 3A5EA 1BRKA 3BNEA 4GSPA 5CF1A 1JN5B 4J9AA 1OH0A 2UGIA 1FGMA 1I3IA 4JRFA 2UUGC 3B7CA 2J8XB 1HZ1A 1ZX2A 1B21A 2RGQA 2RBIA 1RKYA 3CCR3 3CCV3 2P38A 1JBTA 1Q824 3CME3 1IT7A 1GMPA 1BRNL 4EXRA 2CFLA 1BRGA 1FGQA 3IJEB 3K9MC 4K1UA 5KP3A 2WOFA 3FZWA 3GZBA 4XBTA 2R41A 1VQM3 1I2GA 3CC23 3PZWA 2ML6A 4LEHA 4N6LA 2STDA 1DVCA 2BMQB 2GBWB 1PFPA 1LQGC 3X3ZA 2OWPA 1RNTA 1EQKA 3PCRA 1OF5A 2CX0A 1NWWA 3N8BA 4WP5A 1MGWA 5CLKA 5IW9A 1SQWA 5JBSA 4FMCA 1RGLA 2ZDJA 3SEDA 3KFQC 5HOHA 4EV5A 1DETA 1Q42A 4N6OB 4O3VA 3F40A 1BNFA 3JUPA 5G2GA 3CC43 1DMMA 2YFIB 1BGSA 4FCMA 1TFKA 1SARA 1NB3I 1SJWA 3IMAB 3S29A 2CK3H 1A2KA 1UUGB 4FMDA 4O02B 5AEWB 4KZ1A 3VSYA 3CCE3 3SOYA 3J7Yd 4RNYA 7STDA 1OPYA 2V1LA 3WA3A 3B4PA 3MHEA 3DGYA 3FH1A 2A15A 1BNEA 1IQYA 2SBLA 3VGNA 5KP1A 3KE7A 4BTXA 2Y73A 2W9QA 3CCQ3 5HGRA 2FGTA 1ZGXA 3HOHA 1T2IA 1BU4A 2O3OA 4L8PA 3L0RA 1UCJA 1B2XA 3V92A 4HM2B 3BU4A 3HIIA 2LQVA 5FGOA 1A2PA 5IENA 1S5AA 3GZXB 1ROVA 1BAOA 3FG4A 3F14A 5ELJA 2XSHB 1O7GB 1RMSA 3CC73 3AMOA 1M9GA 4QWTA 1UGHI 2CIUA 1VQ53 1BNSA 1HKXA 1B27A 2PNCA 1TP6A 1IYYA 1AR0A 5BU4A 1IK3A 3LOYA 4HM6B 3CNXA 1OUNA 3LH4A 1N8R4 1VZZA 4CPKA 3FF2A 3DZLA 1W01A 1RSNA 2BO9B 1B2UA 3NV0A 4BL3A 3SVAA 1D6YA 1QMAA 2H0HA 3MG3A 1YIJ3 2AADA 2ZHXB 4N6MA 3CNMA 3G8ZA 4LSOA 4MMYB 5TGNA 3U97A 1T2HA 5M1AA 5IG0A 1ISKA 1TRPA 1WMPA 4MEIA 3ROBA 2D1WA 3B4OA 3G16A 1OACA 2CFKA 3KZTA 1TJDA 2JDIH 1VQ63 1RDSA 3Q2PA 4ZM8A 3CPW2 2LYXA 1NO3A 4EV2A 1OHOA 3AHWA 1RHLA 3D5GA 4XBYA 1N9JA 3MWZA 2R4IA 1TFOA 4L8OA 3DGMA 3PGBA 1IVWA 1NDOB 1YGEA 1L5GB 1JB5A 7RNTA 1VQQA 3CXC2 3DH2A 2HMMB 3MG2A 4WYKB 2RNTA 4HM3B 2XSOB 5G1KA 1UI8A 3STDA 3FG1A 1QJGA 1STDA 1KWIA 3F8XA 2K54A 5AI1A 3KN4A 4WHAA 1V58A 4HJLB 1YVSA 1US1A 4J5GA 3DGLA 1FUTA 3ALAA 1W4NA 1JKGB 1IDPA 1UCIA 2CFWA 3NXJA 1LOYA 2IMJA 1EA2A 2P09A 2W2CA 3SYUA 3S27A 1OGZA 4LGQA 4LMIA 1PU4A 1A90A 4H3UA 1VQK3 4H61A 1GSPA 4EW5A 1VQL3 4AKYA 1SPUA 3BNCA 2B24B 3DY5A 3LTAA 5AIHA 2W56B 4HAAA 3V99A 1VQ83 3NUVA 3QRDA 1VQ93 3ECFA 2AAEA 5IG5A 3EN1B 1BANA 1FZUA 5DRVA 3EB8A 3EJVA 3F9SA 3KCHA 3N54B 4OUQA 1PY3A 1FYSA 1GS3A 1Q40B 2HMKB 2Y74A 1WQLB 3G713 2BIRA 2HMJB 4EYCA 3F7SA 1LQMB 2C4BA 3AGOA 1X1YA 1B3SA 4XDVA 2CFGA 1Q9EA 1MWSA 3LTDA 3K0ZA 1IVXA 2INXA 3MSOA 6GSPA 5CK6A 2QEX3 4R80A 1G0TA 2W9PA 3CMA3 5D83A 4MMZB 1CQSA 2C11A 4FMAA 4G1MB 2QA43 1I0VA 1QAKA 4BU4A 4LYLB 4HM1B 2XGNA 4O8SA 2UX0A 4PEJA 1Q864 2GBXB 4MJDA 1ZS7A 4BTYA 2W04A 3OW22 4HVNA 2PZVA 3WR2A 1B2MA 4WWUC 4DKIA 4N6UA 3G0KA 3EC9A 1MGRA 1K8A4 1M904 1EKMA 4KFDA 5IEPA 1E3VA 3G6E3 1CH0A 1STFI 1BVIA 4HZBB 1N5HA 1OF5B 3OWUA 4R9KA 1LNIA 3ZFZA 3HK4A 3K5TA 1RGFA 1TU5A 2KF4A 1DVDA 1GOYA 1W2B2 2GSPA 2E2VA 3WOFB 5BVBA 2XH9A 3CU3A 4KFFA 3PYJA 1LOVA 1N5PA 1YJW3 1K41A 1VQ73 2W03A 3S5CA 3CCM3 1BSAA 3NQYA 1YHQ3 2CWTA 2F56A 1I0XA 1OCVA 1W6CA 4HM8B 1IU7A 1JRQA 3BNDA 2F4YA 1UI7A 1GD4A 1YJN3 1D6ZA 1A2VA 1BSEA 5LC7A 1O7PB 2H0IA 4BL2A 4IPBA 4HKVB 1C7HA 3S28A 4U13A 1VQP3 2XFTA 1IT8A 3I553 3KIIA 4R9LA 5BIRA 4TX4A 1SIIA 3CCU3 3CCL3 1GMRA 1YVBI 1NJI4 2BU4A 1MNLA 3NHXA 5RNTA 2KAAA 1IVUA 1V57A 1W6GA 2OQEA 1GOVA 3KSPA 4I4KA 4BTWA 3EX9A 5JPPA 2K3DA 4BIRA 1RCKA 1RLSA 1VQN3 2OOVA 4X2HA 2QIYA 3KKGA 1HU9A 2OTL3 5GSPA 1BSCA 1RTUA 1RGHA 3HZPA 4KFEA 3AMOB 1O7NB 4RNZA 5IF6A 1RN4A 2BMRB 1O7HB 1GOUA 3X42A 5M18A 1TIJA 1KC84 1JJ22 3OXAA 1BOXA 1V74A 3RGRA 1RNBA 2QGUA 2YX9A 5D82A 1JNQA 3IPTA 1YIT3 3PXMA 1YNVX 1AY7A 1YGWA 1DMNA 2KF3A 2L4VA 2W0QA 3MYTA 5FW5A 2BNGA 3DGOA 1BNJA 4N6V0 4AEQA 3G4S3 4NREA 1JZDA 5AIFA 2Z7AA 5STDA 5KP4A 3FKAA 4HYZA 3FSDA 3WDGB 1KSIA 2XEPA 2ZA4A 3NM2A 3FF0A 1I8VA 1N9EA 3JUQA 1CYUA 3DUKA 1X1XA 2CW9A 3T8NA 3CCJ3 1ULJB 4K61A 3NQZA 2OTJ3 4NPBA 2SARA 1BRIA 1OHSA 4K1VA 1RN7A 1OHPA 1G02A 1I3FA 4FCJA 3GZRA 4N6TA 4CDLA 3EBYA 2IA7A 3UL6A 1KD14 3LTCA 3SX1A 1G96A 4N6NB 5I97A 4OVMA 4JF8A 4ORLA 3F8HA 3KSED 1I2FA 2H0GA 3AGNA 2XRXB 2F86B 4ILFA 1LOXA 2CH9A 3I563 3QK9A 3Q1CA 4EBGA 2IY2A 1JKGA 3OV4A 1EEJA 1QVG2 1NB5I 3CPOA 3PCSA 3EF8A 2F5WA 2JQ5A 2XFSA 1AVLA 1UUWB 2CG1A 3MG1A 1LXEA 1IVVA 5DREA 3GAXA 1B2ZA 1YI23 2E2UA 3D4AA 3WHOA 1RN1A 5IG3A 1TUHA 3LT8A 1Q7Y4 1B2SA 2Z77A 3HIGA 1JN5A 1VQ43 2WO0A 3K7CA 3LZAA 8RNTA 8CHOA 1BRHA 1U5OA 2D42A 2HMLB 4GHOA 4KT3B 5G1LA 2P0MA 3LMLA 2GU3A 1M1XB 1RGCA 5LC6A 3HX8A 1IQ8A 1I2EA 3UB1A 1S723 2P0XA 1GD3A 4L7KA 3S67A 2BHMA 3A76A 3ZG5A 3UJMA 2GEYA 4MMXB 3UL5A 5M19A
chains in the Genus database with same CATH topology
1RSNA 1BSAA 1B2UA 1B20A 2F56A 1I0XA 2AADA 1BSBA 2HOHA 2F4YA 1T2HA 3GSPA 1BSEA 1TRPA 1RGAA 1BUJA 1RGEA 1TTOA 5BIRA 1RDSA 1RGKA 1GMRA 3D5IA 1RCLA 3Q3FA 2BU4A 3AHWA 3D5GA 1RHLA 5RNTA 2KAAA 4J5KA 3AHSA 3A5EA 1BRKA 4GSPA 1GOVA 3BIRA 7RNTA 3DH2A 1RCKA 1RLSA 4BIRA 1I3IA 4RNTA 5GSPA 1BSCA 1RTUA 1RGHA 2RNTA 1RN4A 1GOUA 1HZ1A 1B21A 1RNBA 1BOXA 2RBIA 1JBTA 1FW7A 1DE3A 1YVSA 1BIRA 4J5GA 1GMPA 1BRNL 1BNIA 1YNVX 1FUTA 1AY7A 1BRGA 1YGWA 2KF3A 1UCIA 1BNRA 3SYUA 1LOYA 1BNJA 1UCKA 1I2GA 1JBSA 1GSPA 1LRAA 1GMQA 1R4YA 2ZA4A 4HAAA 1RNTA 3URPA 1I8VA 1X1XA 2AAEA 1BANA 1FZUA 1MGWA 7GSPA 2F5MA 1BRIA 2SARA 3KCHA 1AQZA 1PY3A 1FYSA 1RGLA 1C54A 1BNGA 5HOHA 2BIRA 1DETA 1BNFA 1G02A 1I3FA 2C4BA 1BRSA 1BGSA 3AGOA 1X1YA 1B3SA 1SARA 1Q9EA 6RNTA 6GSPA 1LOWA 1I2FA 2KF5A 3AGNA 1X1UA 2KF6A 1I0VA 4BU4A 3DGYA 1BNEA 2F5WA 1RGGA 1BSDA 1HYFA 1B2ZA 1ZGXA 3D4AA 3HOHA 3WHOA 1T2IA 1RN1A 3WR2A 1B2MA 1B2SA 1BU4A 1MGRA 1UCJA 1B2XA 3RNTA 1I70A 3BU4A 1UCLA 8RNTA 1BRJA 1A2PA 1BAOA 1CH0A 1PYLA 1BRHA 1RMSA 4GHOA 1BVIA 1FUSA 9RNTA 1LNIA 1BNSA 1RGFA 1RGCA 1B27A 1I2EA 1JBRA 1IYYA 2KF4A 5BU4A 1GOYA 4HOHA 1TRQA 2GSPA 1X1WA 1LOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RSN A;  1BSA A;  1B2U A;  1B20 A;  2F56 A;  1I0X A;  2AAD A;  1BSB A;  2HOH A;  2F4Y A;  1T2H A;  3GSP A;  1BSE A;  1TRP A;  1RGA A;  1BUJ A;  1RGE A;  1TTO A;  5BIR A;  1RDS A;  1RGK A;  1GMR A;  3D5I A;  1RCL A;  3Q3F A;  2BU4 A;  3AHW A;  3D5G A;  1RHL A;  5RNT A;  2KAA A;  4J5K A;  3AHS A;  3A5E A;  1BRK A;  4GSP A;  1GOV A;  3BIR A;  7RNT A;  3DH2 A;  1RCK A;  1RLS A;  4BIR A;  1I3I A;  4RNT A;  5GSP A;  1BSC A;  1RTU A;  1RGH A;  2RNT A;  1RN4 A;  1GOU A;  1HZ1 A;  1B21 A;  1RNB A;  1BOX A;  2RBI A;  1JBT A;  1FW7 A;  1DE3 A;  1YVS A;  1BIR A;  4J5G A;  1GMP A;  1BRN L;  1BNI A;  1YNV X;  1FUT A;  1AY7 A;  1BRG A;  1YGW A;  2KF3 A;  1UCI A;  1BNR A;  3SYU A;  1LOY A;  1BNJ A;  1UCK A;  1I2G A;  1JBS A;  1GSP A;  1LRA A;  1GMQ A;  1R4Y A;  2ZA4 A;  4HAA A;  1RNT A;  3URP A;  1I8V A;  1X1X A;  2AAE A;  1BAN A;  1FZU A;  1MGW A;  7GSP A;  2F5M A;  1BRI A;  2SAR A;  3KCH A;  1AQZ A;  1PY3 A;  1FYS A;  1RGL A;  1C54 A;  1BNG A;  5HOH A;  2BIR A;  1DET A;  1BNF A;  1G02 A;  1I3F A;  2C4B A;  1BRS A;  1BGS A;  3AGO A;  1X1Y A;  1B3S A;  1SAR A;  1Q9E A;  6RNT A;  6GSP A;  1LOW A;  1I2F A;  2KF5 A;  3AGN A;  1X1U A;  2KF6 A;  1I0V A;  4BU4 A;  3DGY A;  1BNE A;  2F5W A;  1RGG A;  1BSD A;  1HYF A;  1B2Z A;  1ZGX A;  3D4A A;  3HOH A;  3WHO A;  1T2I A;  1RN1 A;  3WR2 A;  1B2M A;  1B2S A;  1BU4 A;  1MGR A;  1UCJ A;  1B2X A;  3RNT A;  1I70 A;  3BU4 A;  1UCL A;  8RNT A;  1BRJ A;  1A2P A;  1BAO A;  1CH0 A;  1PYL A;  1BRH A;  1RMS A;  4GHO A;  1BVI A;  1FUS A;  9RNT A;  1LNI A;  1BNS A;  1RGF A;  1RGC A;  1B27 A;  1I2E A;  1JBR A;  1IYY A;  2KF4 A;  5BU4 A;  1GOY A;  4HOH A;  1TRQ A;  2GSP A;  1X1W A;  1LOV A; 
#chains in the Genus database with same CATH topology
 1ASK A;  1K9M 4;  1IV9 A;  1ULI B;  1B20 A;  3GRD A;  1RRL A;  3GZY B;  5CF2 A;  1A67 A;  1D6U A;  1UW1 A;  3SXX A;  2HOH A;  2K0M A;  1QAL A;  3WA2 X;  3GSP A;  2WOH A;  2Z6B A;  5AEU B;  1RGA A;  3FLJ A;  1DMQ A;  2FNQ A;  4FR9 A;  2C10 A;  2CHC A;  1EUI C;  1BUJ A;  2F99 A;  2GXF A;  4R1K A;  4XM4 A;  1MWR A;  1Y4K A;  3T8U A;  3GWR A;  2L1S A;  1WMN A;  1KQS 2;  2OQE C;  3D5I A;  1RCL A;  3BB9 A;  3AHS A;  3N9H A;  4WFO A;  3X3X A;  1E97 A;  2OOV C;  3DXO A;  3BIR A;  1Q81 4;  4KVH A;  5EQL A;  2Q07 A;  3LTB A;  5EEO A;  4OK0 A;  4GB5 A;  1W5Z A;  1OGX A;  2HMO B;  4RNT A;  5AII A;  1AVK A;  1NNV A;  5BXQ A;  3SLU A;  3X41 A;  1CEW I;  5AYS C;  1FUW A;  2KCD A;  3WOD G;  4FMB A;  1JB4 A;  1GYB A;  1FW7 A;  3RGA A;  3X3Y A;  1DE3 A;  1YJ9 3;  1BIR A;  1BNI A;  1UUV B;  3JUO A;  1WMO A;  1NU3 A;  2MC8 A;  1BNR A;  2HMN B;  1RJO A;  3NBR A;  1UCK A;  2BT3 A;  3DMC A;  2RCD A;  3LXU X;  3O8Y A;  2MF7 A;  4I5Q A;  4EC6 A;  4RZM A;  1O7M B;  1JBS A;  4IIA A;  4HBR A;  5A0O B;  1LRA A;  1GMQ A;  1R4Y A;  1J2B A;  4HM5 B;  2CWV A;  3NM7 A;  3FGY A;  3ZG0 A;  2WGO A;  1W7C A;  3URP A;  4X2O A;  4STD A;  4J8T A;  2CWU A;  3DM8 A;  3WOE B;  3NX0 A;  1LNH A;  3U1W A;  2YFL B;  1GY5 A;  7GSP A;  2F5M A;  2XF3 A;  1FGO A;  1AQZ A;  1C54 A;  2ML5 A;  2XR8 B;  2RFR A;  3EE1 A;  3K63 A;  1O7W B;  1BNG A;  1DYU A;  4K90 B;  1MOL A;  2RSX A;  2P05 A;  3LT9 A;  1BRS A;  4HM4 B;  3CD6 3;  2CFD A;  5IEO A;  1R4C A;  4CJN A;  1JV2 B;  2GEX A;  3OWS A;  1AV4 A;  3EQQ B;  6RNT A;  1GY6 A;  2IYJ A;  1FA3 A;  1LOW A;  2CKF B;  3D9R A;  3E99 A;  1IQX A;  2KF5 A;  3H51 A;  3MKI A;  5ELU A;  1X1U A;  3LYG A;  3D79 A;  3BLZ A;  3JVC A;  5EVH A;  3EN8 A;  2E2T A;  2KF6 A;  3NV0 B;  3V98 A;  1W00 A;  1IV7 A;  2CC3 A;  2ZL8 A;  1UDI I;  3UNL A;  2WGQ A;  3VF1 A;  1F8N A;  3H3H A;  5AYR B;  4RBN A;  1M1K 4;  4Q53 A;  4XBX A;  1RGG A;  1BSD A;  3CCS 3;  2YFJ B;  1U8C B;  1VQO 3;  2FXT A;  1HYF A;  3FCS B;  2O9U X;  3RDE A;  2M7O A;  4XDW A;  2XGL A;  4HM0 B;  1Z1S A;  5AIG A;  1LVN A;  2IUJ A;  5JPU A;  4N3V A;  3OX9 A;  1K73 4;  1K28 A;  1UGI A;  3RNT A;  1I70 A;  3X40 A;  1UCL A;  1BRJ A;  2B1X B;  1W2Z A;  1MWU A;  1ROA A;  1QVF 2;  2Z76 A;  4O2H A;  1FGR A;  1PYL A;  4WYK A;  1BUQ A;  3JUN A;  1RRH A;  2I9W A;  2BMO B;  1E3R A;  1FUS A;  1WNH A;  3ER7 A;  3NBB A;  3FG3 A;  9RNT A;  2W6J H;  3OWY A;  5CXO A;  3SOA A;  1Q7H A;  1JBR A;  1WTH A;  4GL6 A;  3TDG A;  1EG9 B;  6STD A;  4HOH A;  1TRQ A;  3DGN A;  1JZO A;  3HI7 A;  1MWT A;  1X1W A;  3T0U A;  1T3B A;  2KRT A;  3MPH A;  3NBJ A;  2F98 A;  4IT7 A;  3EBT A;  3EHC A;  4R4K A;  3M8C A;  1JB2 A;  4FCZ A;  4HZ9 B;  4LZI A;  4XB5 A;  1BSB A;  1GY7 A;  1SIH A;  2W56 A;  3PS8 A;  3BNB A;  1CYV A;  1W02 A;  1N8Q A;  3WMD A;  5IG4 A;  4NHF A;  2OCT A;  1FGT A;  1RGE A;  1T5Y A;  3Q90 A;  4AKZ A;  4CCV A;  1Q40 A;  1TTO A;  4HM7 B;  1RGK A;  2GU1 A;  2KXG A;  2IUK A;  2CX1 A;  1ZO2 A;  1QAF A;  3I0Y A;  3F7X A;  5IER A;  3JUM A;  3Q3F A;  2CG0 A;  3D3L A;  1W6Y A;  3B8L A;  4J5K A;  5D81 A;  3A5E A;  1BRK A;  3BNE A;  4GSP A;  5CF1 A;  1JN5 B;  4J9A A;  1OH0 A;  2UGI A;  1FGM A;  1I3I A;  4JRF A;  2UUG C;  3B7C A;  2J8X B;  1HZ1 A;  1ZX2 A;  1B21 A;  2RGQ A;  2RBI A;  1RKY A;  3CCR 3;  3CCV 3;  2P38 A;  1JBT A;  1Q82 4;  3CME 3;  1IT7 A;  1GMP A;  1BRN L;  4EXR A;  2CFL A;  1BRG A;  1FGQ A;  3IJE B;  3K9M C;  4K1U A;  5KP3 A;  2WOF A;  3FZW A;  3GZB A;  4XBT A;  2R41 A;  1VQM 3;  1I2G A;  3CC2 3;  3PZW A;  2ML6 A;  4LEH A;  4N6L A;  2STD A;  1DVC A;  2BMQ B;  2GBW B;  1PFP A;  1LQG C;  3X3Z A;  2OWP A;  1RNT A;  1EQK A;  3PCR A;  1OF5 A;  2CX0 A;  1NWW A;  3N8B A;  4WP5 A;  1MGW A;  5CLK A;  5IW9 A;  1SQW A;  5JBS A;  4FMC A;  1RGL A;  2ZDJ A;  3SED A;  3KFQ C;  5HOH A;  4EV5 A;  1DET A;  1Q42 A;  4N6O B;  4O3V A;  3F40 A;  1BNF A;  3JUP A;  5G2G A;  3CC4 3;  1DMM A;  2YFI B;  1BGS A;  4FCM A;  1TFK A;  1SAR A;  1NB3 I;  1SJW A;  3IMA B;  3S29 A;  2CK3 H;  1A2K A;  1UUG B;  4FMD A;  4O02 B;  5AEW B;  4KZ1 A;  3VSY A;  3CCE 3;  3SOY A;  3J7Y d;  4RNY A;  7STD A;  1OPY A;  2V1L A;  3WA3 A;  3B4P A;  3MHE A;  3DGY A;  3FH1 A;  2A15 A;  1BNE A;  1IQY A;  2SBL A;  3VGN A;  5KP1 A;  3KE7 A;  4BTX A;  2Y73 A;  2W9Q A;  3CCQ 3;  5HGR A;  2FGT A;  1ZGX A;  3HOH A;  1T2I A;  1BU4 A;  2O3O A;  4L8P A;  3L0R A;  1UCJ A;  1B2X A;  3V92 A;  4HM2 B;  3BU4 A;  3HII A;  2LQV A;  5FGO A;  1A2P A;  5IEN A;  1S5A A;  3GZX B;  1ROV A;  1BAO A;  3FG4 A;  3F14 A;  5ELJ A;  2XSH B;  1O7G B;  1RMS A;  3CC7 3;  3AMO A;  1M9G A;  4QWT A;  1UGH I;  2CIU A;  1VQ5 3;  1BNS A;  1HKX A;  1B27 A;  2PNC A;  1TP6 A;  1IYY A;  1AR0 A;  5BU4 A;  1IK3 A;  3LOY A;  4HM6 B;  3CNX A;  1OUN A;  3LH4 A;  1N8R 4;  1VZZ A;  4CPK A;  3FF2 A;  3DZL A;  1W01 A;  1RSN A;  2BO9 B;  1B2U A;  3NV0 A;  4BL3 A;  3SVA A;  1D6Y A;  1QMA A;  2H0H A;  3MG3 A;  1YIJ 3;  2AAD A;  2ZHX B;  4N6M A;  3CNM A;  3G8Z A;  4LSO A;  4MMY B;  5TGN A;  3U97 A;  1T2H A;  5M1A A;  5IG0 A;  1ISK A;  1TRP A;  1WMP A;  4MEI A;  3ROB A;  2D1W A;  3B4O A;  3G16 A;  1OAC A;  2CFK A;  3KZT A;  1TJD A;  2JDI H;  1VQ6 3;  1RDS A;  3Q2P A;  4ZM8 A;  3CPW 2;  2LYX A;  1NO3 A;  4EV2 A;  1OHO A;  3AHW A;  1RHL A;  3D5G A;  4XBY A;  1N9J A;  3MWZ A;  2R4I A;  1TFO A;  4L8O A;  3DGM A;  3PGB A;  1IVW A;  1NDO B;  1YGE A;  1L5G B;  1JB5 A;  7RNT A;  1VQQ A;  3CXC 2;  3DH2 A;  2HMM B;  3MG2 A;  4WYK B;  2RNT A;  4HM3 B;  2XSO B;  5G1K A;  1UI8 A;  3STD A;  3FG1 A;  1QJG A;  1STD A;  1KWI A;  3F8X A;  2K54 A;  5AI1 A;  3KN4 A;  4WHA A;  1V58 A;  4HJL B;  1YVS A;  1US1 A;  4J5G A;  3DGL A;  1FUT A;  3ALA A;  1W4N A;  1JKG B;  1IDP A;  1UCI A;  2CFW A;  3NXJ A;  1LOY A;  2IMJ A;  1EA2 A;  2P09 A;  2W2C A;  3SYU A;  3S27 A;  1OGZ A;  4LGQ A;  4LMI A;  1PU4 A;  1A90 A;  4H3U A;  1VQK 3;  4H61 A;  1GSP A;  4EW5 A;  1VQL 3;  4AKY A;  1SPU A;  3BNC A;  2B24 B;  3DY5 A;  3LTA A;  5AIH A;  2W56 B;  4HAA A;  3V99 A;  1VQ8 3;  3NUV A;  3QRD A;  1VQ9 3;  3ECF A;  2AAE A;  5IG5 A;  3EN1 B;  1BAN A;  1FZU A;  5DRV A;  3EB8 A;  3EJV A;  3F9S A;  3KCH A;  3N54 B;  4OUQ A;  1PY3 A;  1FYS A;  1GS3 A;  1Q40 B;  2HMK B;  2Y74 A;  1WQL B;  3G71 3;  2BIR A;  2HMJ B;  4EYC A;  3F7S A;  1LQM B;  2C4B A;  3AGO A;  1X1Y A;  1B3S A;  4XDV A;  2CFG A;  1Q9E A;  1MWS A;  3LTD A;  3K0Z A;  1IVX A;  2INX A;  3MSO A;  6GSP A;  5CK6 A;  2QEX 3;  4R80 A;  1G0T A;  2W9P A;  3CMA 3;  5D83 A;  4MMZ B;  1CQS A;  2C11 A;  4FMA A;  4G1M B;  2QA4 3;  1I0V A;  1QAK A;  4BU4 A;  4LYL B;  4HM1 B;  2XGN A;  4O8S A;  2UX0 A;  4PEJ A;  1Q86 4;  2GBX B;  4MJD A;  1ZS7 A;  4BTY A;  2W04 A;  3OW2 2;  4HVN A;  2PZV A;  3WR2 A;  1B2M A;  4WWU C;  4DKI A;  4N6U A;  3G0K A;  3EC9 A;  1MGR A;  1K8A 4;  1M90 4;  1EKM A;  4KFD A;  5IEP A;  1E3V A;  3G6E 3;  1CH0 A;  1STF I;  1BVI A;  4HZB B;  1N5H A;  1OF5 B;  3OWU A;  4R9K A;  1LNI A;  3ZFZ A;  3HK4 A;  3K5T A;  1RGF A;  1TU5 A;  2KF4 A;  1DVD A;  1GOY A;  1W2B 2;  2GSP A;  2E2V A;  3WOF B;  5BVB A;  2XH9 A;  3CU3 A;  4KFF A;  3PYJ A;  1LOV A;  1N5P A;  1YJW 3;  1K41 A;  1VQ7 3;  2W03 A;  3S5C A;  3CCM 3;  1BSA A;  3NQY A;  1YHQ 3;  2CWT A;  2F56 A;  1I0X A;  1OCV A;  1W6C A;  4HM8 B;  1IU7 A;  1JRQ A;  3BND A;  2F4Y A;  1UI7 A;  1GD4 A;  1YJN 3;  1D6Z A;  1A2V A;  1BSE A;  5LC7 A;  1O7P B;  2H0I A;  4BL2 A;  4IPB A;  4HKV B;  1C7H A;  3S28 A;  4U13 A;  1VQP 3;  2XFT A;  1IT8 A;  3I55 3;  3KII A;  4R9L A;  5BIR A;  4TX4 A;  1SII A;  3CCU 3;  3CCL 3;  1GMR A;  1YVB I;  1NJI 4;  2BU4 A;  1MNL A;  3NHX A;  5RNT A;  2KAA A;  1IVU A;  1V57 A;  1W6G A;  2OQE A;  1GOV A;  3KSP A;  4I4K A;  4BTW A;  3EX9 A;  5JPP A;  2K3D A;  4BIR A;  1RCK A;  1RLS A;  1VQN 3;  2OOV A;  4X2H A;  2QIY A;  3KKG A;  1HU9 A;  2OTL 3;  5GSP A;  1BSC A;  1RTU A;  1RGH A;  3HZP A;  4KFE A;  3AMO B;  1O7N B;  4RNZ A;  5IF6 A;  1RN4 A;  2BMR B;  1O7H B;  1GOU A;  3X42 A;  5M18 A;  1TIJ A;  1KC8 4;  1JJ2 2;  3OXA A;  1BOX A;  1V74 A;  3RGR A;  1RNB A;  2QGU A;  2YX9 A;  5D82 A;  1JNQ A;  3IPT A;  1YIT 3;  3PXM A;  1YNV X;  1AY7 A;  1YGW A;  1DMN A;  2KF3 A;  2L4V A;  2W0Q A;  3MYT A;  5FW5 A;  2BNG A;  3DGO A;  1BNJ A;  4N6V 0;  4AEQ A;  3G4S 3;  4NRE A;  1JZD A;  5AIF A;  2Z7A A;  5STD A;  5KP4 A;  3FKA A;  4HYZ A;  3FSD A;  3WDG B;  1KSI A;  2XEP A;  2ZA4 A;  3NM2 A;  3FF0 A;  1I8V A;  1N9E A;  3JUQ A;  1CYU A;  3DUK A;  1X1X A;  2CW9 A;  3T8N A;  3CCJ 3;  1ULJ B;  4K61 A;  3NQZ A;  2OTJ 3;  4NPB A;  2SAR A;  1BRI A;  1OHS A;  4K1V A;  1RN7 A;  1OHP A;  1G02 A;  1I3F A;  4FCJ A;  3GZR A;  4N6T A;  4CDL A;  3EBY A;  2IA7 A;  3UL6 A;  1KD1 4;  3LTC A;  3SX1 A;  1G96 A;  4N6N B;  5I97 A;  4OVM A;  4JF8 A;  4ORL A;  3F8H A;  3KSE D;  1I2F A;  2H0G A;  3AGN A;  2XRX B;  2F86 B;  4ILF A;  1LOX A;  2CH9 A;  3I56 3;  3QK9 A;  3Q1C A;  4EBG A;  2IY2 A;  1JKG A;  3OV4 A;  1EEJ A;  1QVG 2;  1NB5 I;  3CPO A;  3PCS A;  3EF8 A;  2F5W A;  2JQ5 A;  2XFS A;  1AVL A;  1UUW B;  2CG1 A;  3MG1 A;  1LXE A;  1IVV A;  5DRE A;  3GAX A;  1B2Z A;  1YI2 3;  2E2U A;  3D4A A;  3WHO A;  1RN1 A;  5IG3 A;  1TUH A;  3LT8 A;  1Q7Y 4;  1B2S A;  2Z77 A;  3HIG A;  1JN5 A;  1VQ4 3;  2WO0 A;  3K7C A;  3LZA A;  8RNT A;  8CHO A;  1BRH A;  1U5O A;  2D42 A;  2HML B;  4GHO A;  4KT3 B;  5G1L A;  2P0M A;  3LML A;  2GU3 A;  1M1X B;  1RGC A;  5LC6 A;  3HX8 A;  1IQ8 A;  1I2E A;  3UB1 A;  1S72 3;  2P0X A;  1GD3 A;  4L7K A;  3S67 A;  2BHM A;  3A76 A;  3ZG5 A;  3UJM A;  2GEY A;  4MMX B;  3UL5 A;  5M19 A; 
#chains in the Genus database with same CATH homology
 1RSN A;  1BSA A;  1B2U A;  1B20 A;  2F56 A;  1I0X A;  2AAD A;  1BSB A;  2HOH A;  2F4Y A;  1T2H A;  3GSP A;  1BSE A;  1TRP A;  1RGA A;  1BUJ A;  1RGE A;  1TTO A;  5BIR A;  1RDS A;  1RGK A;  1GMR A;  3D5I A;  1RCL A;  3Q3F A;  2BU4 A;  3AHW A;  3D5G A;  1RHL A;  5RNT A;  2KAA A;  4J5K A;  3AHS A;  3A5E A;  1BRK A;  4GSP A;  1GOV A;  3BIR A;  7RNT A;  3DH2 A;  1RCK A;  1RLS A;  4BIR A;  1I3I A;  4RNT A;  5GSP A;  1BSC A;  1RTU A;  1RGH A;  2RNT A;  1RN4 A;  1GOU A;  1HZ1 A;  1B21 A;  1RNB A;  1BOX A;  2RBI A;  1JBT A;  1FW7 A;  1DE3 A;  1YVS A;  1BIR A;  4J5G A;  1GMP A;  1BRN L;  1BNI A;  1YNV X;  1FUT A;  1AY7 A;  1BRG A;  1YGW A;  2KF3 A;  1UCI A;  1BNR A;  3SYU A;  1LOY A;  1BNJ A;  1UCK A;  1I2G A;  1JBS A;  1GSP A;  1LRA A;  1GMQ A;  1R4Y A;  2ZA4 A;  4HAA A;  1RNT A;  3URP A;  1I8V A;  1X1X A;  2AAE A;  1BAN A;  1FZU A;  1MGW A;  7GSP A;  2F5M A;  1BRI A;  2SAR A;  3KCH A;  1AQZ A;  1PY3 A;  1FYS A;  1RGL A;  1C54 A;  1BNG A;  5HOH A;  2BIR A;  1DET A;  1BNF A;  1G02 A;  1I3F A;  2C4B A;  1BRS A;  1BGS A;  3AGO A;  1X1Y A;  1B3S A;  1SAR A;  1Q9E A;  6RNT A;  6GSP A;  1LOW A;  1I2F A;  2KF5 A;  3AGN A;  1X1U A;  2KF6 A;  1I0V A;  4BU4 A;  3DGY A;  1BNE A;  2F5W A;  1RGG A;  1BSD A;  1HYF A;  1B2Z A;  1ZGX A;  3D4A A;  3HOH A;  3WHO A;  1T2I A;  1RN1 A;  3WR2 A;  1B2M A;  1B2S A;  1BU4 A;  1MGR A;  1UCJ A;  1B2X A;  3RNT A;  1I70 A;  3BU4 A;  1UCL A;  8RNT A;  1BRJ A;  1A2P A;  1BAO A;  1CH0 A;  1PYL A;  1BRH A;  1RMS A;  4GHO A;  1BVI A;  1FUS A;  9RNT A;  1LNI A;  1BNS A;  1RGF A;  1RGC A;  1B27 A;  1I2E A;  1JBR A;  1IYY A;  2KF4 A;  5BU4 A;  1GOY A;  4HOH A;  1TRQ A;  2GSP A;  1X1W A;  1LOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...