1GMPA

Complex of ribonuclease from streptomyces aureofaciens with 2'-gmp at 1.7 angstroms resolution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
96
structure length
96
Chain Sequence
DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIICGEATQEDYYTGDHYATFSLIDQTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complex of ribonuclease from Streptomyces aureofaciens with 2'-GMP at 1.7 A resolution.
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase(guanyloribonuclease)
molecule keywords RIBONUCLEASE SA
total genus 26
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1992-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1gmpA00
1I8VA 6RNTA 1T2HA 1RGGA 1FW7A 1RCKA 1FUTA 1BNEA 5HOHA 1RHLA 1B2MA 3BU4A 3WR2A 1AQZA 2AADA 2BU4A 1RTUA 1A2PA 1BRHA 1ZGXA 1RCLA 1RGLA 4RNTA 2KF4A 1GMQA 1UCLA 1Q9EA 1I2FA 1RSNA 6GSPA 4HAAA 2RBIA 1I2EA 2C4BA 2F5MA 2KAAA 1BRKA 1CH0A 1RGKA 1JBRA 1RDSA 1BSAA 1FUSA 1RNTA 4GSPA 1X1XA 1BRGA 1I0VA 2F5WA 1B2ZA 1HYFA 1RGEA 3KCHA 4BIRA 5RNTA 2HOHA 1DE3A 1RGFA 1BUJA 1AY7A 1X1WA 3SYUA 1BRSA 1RGCA 1TTOA 5GSPA 1I3IA 1B3SA 3AGOA 2AAEA 2GSPA 1RN4A 1GSPA 4BU4A 1BNRA 1GOUA 1PY3A 1RGAA 3GSPA 1HZ1A 1B2SA 7RNTA 3AHWA 1BOXA 1X1YA 3BIRA 1I0XA 1RGHA 3HOHA 1GOYA 3AHSA 1JBTA 3D4AA 7GSPA 1PYLA 2BIRA 1LNIA 1B2UA 1BAOA 1RLSA 1I3FA 1BU4A 1RNBA 5BIRA 3WHOA 1BSEA 1TRQA 1GOVA 1LOVA 3AGNA 4J5KA 2KF5A 1FZUA 3RNTA 1B21A 2ZA4A 1BRNL 1UCKA 1I70A 1RN1A 1BRJA 5BU4A 1BNJA 1YGWA 8RNTA 2F56A 1BNSA 1BSDA 1UCJA 3A5EA 1B2XA 1LOWA 1SARA 3D5IA 4GHOA 1B27A 3Q3FA 1B20A 3D5GA 1GMPA 1BNFA 1DETA 1X1UA 1BGSA 1TRPA 1BVIA 1GMRA 1MGRA 1G02A 2SARA 2RNTA 1LOYA 1YVSA 1FYSA 1BANA 1JBSA 3DGYA 3URPA 1BRIA 3DH2A 1R4YA 1RMSA 1BSCA 1IYYA 1BNIA 1C54A 2F4YA 1I2GA 2KF6A 9RNTA 1BNGA 4J5GA 2KF3A 1UCIA 1BIRA 1BSBA 1LRAA 4HOHA 1YNVX 1T2IA 1MGWA
chains in the Genus database with same CATH superfamily
5IG4A 3UL5A 1E3RA 4N6V0 5TGNA 6RNTA 3NBBA 5M19A 3G4S3 3LTDA 3NQZA 3CCR3 1EUIC 1TP6A 2XSOB 3H51A 2LYXA 1RHLA 1B2MA 2WO0A 3BU4A 4HBRA 3SVAA 2YFJB 2CHCA 3GRDA 1YIT3 1RTUA 1T5YA 3GZBA 3EE1A 3FCSB 1RCLA 4ZM8A 1RGLA 1IV7A 1UCLA 3EC9A 1Q9EA 5M1AA 3WOEB 1OHSA 1WMNA 4NREA 3X42A 3EF8A 3LZAA 5AEUB 1W2ZA 1LVNA 8CHOA 2OTJ3 2XFTA 2C4BA 2FGTA 4ILFA 3X3XA 1VQ93 3DZLA 5BXQA 1T3BA 2KAAA 2BMRB 1BRKA 2W0QA 4Q53A 2FXTA 1JBRA 1NJI4 1BSAA 3NXJA 3ALAA 1U8CB 1AVKA 5FW5A 1X1XA 2WOHA 1NU3A 3CU3A 4FCJA 2JQ5A 4KFFA 1S5AA 2Q07A 1HYFA 4N6MA 1RGEA 5RNTA 5I97A 4HM4B 1M904 2IY2A 2BT3A 5AYSC 1FGQA 2K3DA 2CH9A 1BUJA 1Q864 1AY7A 4U13A 3SYUA 2D1WA 1GD4A 4BL2A 3Q90A 2CIUA 1TTOA 1A67A 1CYVA 4HYZA 1B3SA 1KWIA 4N6TA 3JVCA 3IPTA 3X40A 3T0UA 2Z77A 3EN8A 1IVUA 3NQYA 3ZG0A 1JZOA 3PXMA 5G1LA 1SIHA 3LYGA 4L8PA 1RGAA 2A15A 1W7CA 3FG4A 1HZ1A 3GSPA 1HKXA 3QK9A 3PCSA 1EQKA 4N6OB 2YX9A 1UGHI 3UNLA 3V99A 3CC43 1RGHA 3LTBA 1SJWA 1VZZA 2CWVA 2HMJB 2Z76A 5STDA 5LC6A 4XM4A 1JBTA 1TFKA 2BIRA 3SEDA 1I3FA 2RGQA 4MJDA 1RNBA 1SQWA 3PCRA 1TRQA 2CFKA 1DVDA 5AIHA 4PEJA 1ASKA 1MWSA 3FGYA 1BRNL 3S67A 2YFIB 3D3LA 1UCKA 3BB9A 4O3VA 2Z6BA 2P09A 3F40A 3OWYA 1BRJA 1O7HB 4L8OA 3MHEA 2WGQA 3JUOA 4XDWA 1YJW3 4L7KA 1YJN3 2SBLA 3Q2PA 1Q42A 1V58A 4J8TA 3ZG5A 3HI7A 3WDGB 1O7MB 5IG5A 5KP4A 1N8R4 3Q3FA 1B20A 4AKYA 1X1UA 4LMIA 1BGSA 1YVBI 1BVIA 1W5ZA 2XGLA 3MG2A 1Q40B 2SARA 3KFQC 3PS8A 3MYTA 3LTCA 2OWPA 4EYCA 2BHMA 2RNTA 4R4KA 1V74A 2OOVA 2CG1A 3EB8A 1GY7A 1FYSA 1BANA 2W04A 2OOVC 1JZDA 1OH0A 1JKGB 3O8YA 1RMSA 5IEOA 1JKGA 1DMMA 1JB5A 3SXXA 2W2CA 4QWTA 1DVCA 1TFOA 2ZL8A 2ZHXB 1UCIA 3EJVA 1YNVX 4HM1B 1O7WB 4HM6B 2XH9A 1I8VA 1UI7A 1R4CA 1VQM3 3G16A 4N3VA 1T2HA 1RGGA 3DM8A 1BNEA 3ZFZA 3IJEB 4OK0A 3WR2A 4MMXB 1GY5A 2AADA 2W56A 2W9PA 3F7SA 5G2GA 2BU4A 3X3ZA 1A2PA 2KXGA 4FMDA 3VGNA 5IG3A 2CWTA 2KF4A 3K0ZA 5EQLA 1F8NA 3FKAA 2GBWB 1RSNA 1O7PB 2QGUA 2YFLB 3V98A 2RBIA 4HKVB 4BL3A 4KZ1A 1Y4KA 2V1LA 3T8NA 1OHPA 2GEXA 1OCVA 2C11A 3LT9A 1RDSA 1RNTA 1FUSA 1QJGA 3H3HA 4K90B 4GSPA 4RNYA 5A0OB 4STDA 2H0IA 2XSHB 2XEPA 4BIRA 3GZXB 1FA3A 1NB3I 5D83A 3NV0B 2W56B 1DE3A 3FH1A 4RZMA 3S28A 1RGCA 2CFWA 2P38A 5GSPA 4AEQA 1ULJB 4EV2A 3MWZA 3AGOA 3CD63 3ECFA 2XGNA 4FCMA 2AAEA 2BNGA 5BIRA 1GSPA 3FF2A 1BNRA 4AKZA 1US1A 3WMDA 4CJNA 2IMJA 3PGBA 4EBGA 1KD14 2MC8A 4GL6A 1NB5I 3LTAA 1LQMB 1QMAA 3AHWA 1W6GA 3BIRA 1CEWI 5DREA 3WA2X 1WQLB 3WA3A 1ROVA 2UUGC 3HOHA 4WWUC 4XBYA 1QAFA 3I553 3BNDA 1G0TA 5IW9A 4N6NB 7GSPA 1TIJA 4BTXA 2GU1A 1LNIA 3F8HA 5AI1A 3I0YA 1BU4A 4HVNA 1IU7A 2HMLB 3WHOA 5HGRA 3GZYB 4R1KA 4MEIA 1GYBA 3A76A 3GZRA 3OW22 3AGNA 3G8ZA 2KF5A 1AVLA 3N8BA 1FZUA 3FF0A 5IEPA 1D6UA 1U5OA 5AYRB 5IG0A 3CCQ3 4KT3B 3DUKA 1MWUA 4R9LA 3NV0A 3CPOA 3K9MC 1YIJ3 1ULIB 2F98A 2R4IA 3F7XA 4WYKB 5IENA 1BSDA 3DMCA 3F9SA 5D82A 4XBTA 2CX1A 1UUGB 4GHOA 3I563 4WFOA 3BNEA 1B27A 1HU9A 3E99A 5ELJA 1IK3A 4I5QA 1NWWA 1GMPA 3CNMA 1DETA 3GAXA 4MMZB 3SOYA 1TRPA 4H61A 1GMRA 1IVWA 1G02A 2FNQA 4EXRA 1J2BA 1VQO3 5CK6A 4OUQA 1K734 3CPW2 3AMOB 3OV4A 4FMAA 4RNZA 1STDA 1LOYA 1A2KA 3URPA 1BRIA 3JUQA 3NM2A 3NBJA 2OCTA 4N6UA 4O02B 1N5PA 1BSCA 3FG1A 4BTYA 1M1XB 1TJDA 3KN4A 1SPUA 1IQXA 4HM0B 5CLKA 4O2HA 1OPYA 4KFEA 1YGEA 3EHCA 2KF3A 1OF5B 5KP1A 5G1KA 3LMLA 1MWRA 2B24B 3OWUA 4HM7B 4O8SA 3CCS3 4OVMA 1Q7HA 5JPUA 1IVVA 1MGWA 2P0MA 2KRTA 5AIFA 4KFDA 5AIGA 1N9EA 1AR0A 1QALA 1DMQA 2CFLA 3MG1A 1FW7A 1YI23 1FUTA 5HOHA 3NBRA 3UJMA 2MF7A 1N8QA 3DGOA 2D42A 1RRHA 1CYUA 1DYUA 1KC84 1BRHA 1O7GB 1ZGXA 1VQK3 1QAKA 1UI8A 4RNTA 1GMQA 2RCDA 1JJ22 1N5HA 3FG3A 2L1SA 3SX1A 5LC7A 4LSOA 3S5CA 4XB5A 3JUMA 4EC6A 4NHFA 3OWSA 1MNLA 4HAAA 3K63A 1I2EA 3HZPA 1E97A 1ROAA 3TDGA 2UGIA 3PYJA 2XR8B 4X2HA 5AIIA 4K61A 5FGOA 3RGAA 5AEWB 2OTL3 1O7NB 1CH0A 1VQ43 1RGKA 3T8UA 1IDPA 4LZIA 2CKFB 3JUPA 1BRGA 2P0XA 1MWTA 1FGTA 2XFSA 2Y73A 3U97A 1D6YA 3KIIA 4FCZA 5EVHA 1W6YA 1VQQA 2BMOB 1RGFA 3CCV3 1BRSA 1Q7Y4 3DGMA 1I3IA 5JPPA 5IERA 5EEOA 2O9UX 4RBNA 3LH4A 1JRQA 1EEJA 2B1XB 1UW1A 2IUJA 1RN4A 1VQ53 2CK3H 1A90A 2BMQB 1AV4A 5CF1A 4LYLB 1UDII 1UUWB 2RFRA 1Q824 7STDA 3LOYA 1B2SA 2IUKA 1RN7A 3IMAB 3F14A 7RNTA 1OUNA 1X1YA 1LQGC 1L5GB 4BTWA 3D79A 2CWUA 1GOYA 3Q1CA 3AHSA 4X2OA 5BVBA 4G1MB 2P05A 4NPBA 3EBYA 5D81A 1B2UA 1RLSA 2BO9B 2LQVA 3ER7A 4GB5A 4CDLA 4R80A 3MSOA 1OACA 1E3VA 1C7HA 1EG9B 2C10A 3NX0A 4K1VA 3S29A 3CXC2 1LOVA 3CC23 4HZBB 3CCM3 1YHQ3 4J5KA 1NDOB 1DMNA 3RNTA 1GD3A 1B21A 2W6JH 2W03A 4HM8B 1I70A 2F99A 1RN1A 1FGRA 2Z7AA 4IIAA 4WP5A 2OQEC 4FMCA 4H3UA 5KP3A 2QA43 3U1WA 3KE7A 1BNJA 3CC73 1TUHA 1YGWA 3EN1B 1MOLA 3CNXA 2F56A 3LXUX 2OQEA 1W02A 3L0RA 3A5EA 2GBXB 1B2XA 4KVHA 1UGIA 4N6LA 1SARA 3D5IA 3CME3 1QVG2 2PNCA 3KKGA 1IT8A 2QEX3 3NUVA 1K8A4 1G96A 3KZTA 4XBXA 3VSYA 3D5GA 1BNFA 1Q40A 2K54A 3K7CA 5DRVA 1RKYA 4J9AA 5CXOA 1ZO2A 1VQ63 4WHAA 2CC3A 1YVSA 3X41A 1JBSA 1GY6A 3DGYA 3GWRA 1R4YA 1UUVB 3D9RA 3VF1A 2RSXA 1IYYA 3KSED 1JB2A 1BNGA 3NHXA 3K5TA 4FMBA 1BSBA 1JN5B 1T2IA 4FR9A 3FLJA 3HIGA 3MKIA 1N9JA 1GS3A 3G713 1RCKA 1KQS2 1NNVA 1AQZA 1TU5A 1M1K4 4WYKA 1K9M4 1FUWA 2XRXB 1VQ83 2GEYA 1BUQA 1RRLA 1I2FA 1PFPA 2HMMB 1VQN3 1RJOA 3M8CA 6GSPA 3BNBA 2F5MA 3B4PA 5CF2A 1YJ93 4LEHA 1VQP3 1ZX2A 3BNCA 3EQQB 3HIIA 2Y74A 5ELUA 3DY5A 3OXAA 1I0VA 1NO3A 3CCE3 2F5WA 1B2ZA 4HJLB 4HZ9B 1IT7A 3B8LA 2H0GA 3KCHA 1Q814 3F8XA 3UB1A 2HOHA 1OGZA 2STDA 3JUNA 1K28A 4JF8A 2M7OA 1IVXA 3N54B 4K1UA 1X1WA 1D6ZA 2HMOB 1IQYA 3HX8A 4HM3B 3UL6A 1W2B2 3S27A 3ROBA 3CCJ3 3PZWA 5IF6A 3LT8A 2GSPA 1W00A 4DKIA 4BU4A 1GOUA 1PY3A 2I9WA 2IA7A 1FGMA 2O3OA 2IYJA 3FSDA 3QRDA 3RGRA 3G6E3 1PU4A 1WNHA 3RDEA 2ML5A 4CCVA 3OX9A 1VQ73 2WGOA 1WTHA 1BOXA 2F86B 2XF3A 1I0XA 4EW5A 1SIIA 1EA2A 4R9KA 3SOAA 3NM7A 6STDA 3D4AA 1LOXA 1PYLA 3B7CA 1BAOA 1JNQA 1JB4A 2CFDA 1S723 4IT7A 3AMOA 1M9GA 3B4OA 3V92A 1BSEA 1WMPA 1GOVA 2H0HA 2ML6A 3WOFB 3J7Yd 4MMYB 3EBTA 2GXFA 1W6CA 1ZS7A 1LNHA 2E2UA 4HM2B 3HK4A 2HMNB 2W9QA 2ZA4A 4HM5B 3WODG 3X3YA 4CPKA 4EV5A 3KSPA 3MG3A 2WOFA 2CG0A 1W01A 3N9HA 5BU4A 8RNTA 1EKMA 1LXEA 1BNSA 1KSIA 1UCJA 2ZDJA 1Z1SA 1LOWA 1WMOA 4XDVA 5JBSA 2CX0A 3EX9A 1IV9A 2CFGA 1W4NA 2CW9A 2INXA 2KCDA 1ISKA 2R41A 4LGQA 1MGRA 1STFI 1OHOA 1V57A 2UX0A 4TX4A 1QVF2 2K0MA 1CQSA 1OF5A 1OGXA 4I4KA 3CCU3 2E2VA 1K41A 1JV2B 4IPBA 3CCL3 3DGNA 2E2TA 2HMKB 3DGLA 3DH2A 1FGOA 2JDIH 1VQL3 3G0KA 4ORLA 1BNIA 3BLZA 1C54A 2F4YA 1I2GA 3MPHA 2KF6A 2GU3A 3STDA 9RNTA 5M18A 2J8XB 4J5GA 2PZVA 3SLUA 1BIRA 3CMA3 1LRAA 1A2VA 1JN5A 2QIYA 3DXOA 3FZWA 2L4VA 4HOHA 4JRFA 1IQ8A
chains in the Genus database with same CATH topology
1I8VA 6RNTA 1T2HA 1RGGA 1FW7A 1RCKA 1FUTA 1BNEA 5HOHA 1RHLA 1B2MA 3BU4A 3WR2A 1AQZA 2AADA 2BU4A 1RTUA 1A2PA 1BRHA 1ZGXA 1RCLA 1RGLA 4RNTA 2KF4A 1GMQA 1UCLA 1Q9EA 1I2FA 1RSNA 6GSPA 4HAAA 2RBIA 1I2EA 2C4BA 2F5MA 2KAAA 1BRKA 1CH0A 1RGKA 1JBRA 1RDSA 1BSAA 1FUSA 1RNTA 4GSPA 1X1XA 1BRGA 1I0VA 2F5WA 1B2ZA 1HYFA 1RGEA 3KCHA 4BIRA 5RNTA 2HOHA 1DE3A 1RGFA 1BUJA 1AY7A 1X1WA 3SYUA 1BRSA 1RGCA 1TTOA 5GSPA 1I3IA 1B3SA 3AGOA 2AAEA 2GSPA 1RN4A 1GSPA 4BU4A 1BNRA 1GOUA 1PY3A 1RGAA 3GSPA 1HZ1A 1B2SA 7RNTA 3AHWA 1BOXA 1X1YA 3BIRA 1I0XA 1RGHA 3HOHA 1GOYA 3AHSA 1JBTA 3D4AA 7GSPA 1PYLA 2BIRA 1LNIA 1B2UA 1BAOA 1RLSA 1I3FA 1BU4A 1RNBA 5BIRA 3WHOA 1BSEA 1TRQA 1GOVA 1LOVA 3AGNA 4J5KA 2KF5A 1FZUA 3RNTA 1B21A 2ZA4A 1BRNL 1UCKA 1I70A 1RN1A 1BRJA 5BU4A 1BNJA 1YGWA 8RNTA 2F56A 1BNSA 1BSDA 1UCJA 3A5EA 1B2XA 1LOWA 1SARA 3D5IA 4GHOA 1B27A 3Q3FA 1B20A 3D5GA 1GMPA 1BNFA 1DETA 1X1UA 1BGSA 1TRPA 1BVIA 1GMRA 1MGRA 1G02A 2SARA 2RNTA 1LOYA 1YVSA 1FYSA 1BANA 1JBSA 3DGYA 3URPA 1BRIA 3DH2A 1R4YA 1RMSA 1BSCA 1IYYA 1BNIA 1C54A 2F4YA 1I2GA 2KF6A 9RNTA 1BNGA 4J5GA 2KF3A 1UCIA 1BIRA 1BSBA 1LRAA 4HOHA 1YNVX 1T2IA 1MGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I8V A;  6RNT A;  1T2H A;  1RGG A;  1FW7 A;  1RCK A;  1FUT A;  1BNE A;  5HOH A;  1RHL A;  1B2M A;  3BU4 A;  3WR2 A;  1AQZ A;  2AAD A;  2BU4 A;  1RTU A;  1A2P A;  1BRH A;  1ZGX A;  1RCL A;  1RGL A;  4RNT A;  2KF4 A;  1GMQ A;  1UCL A;  1Q9E A;  1I2F A;  1RSN A;  6GSP A;  4HAA A;  2RBI A;  1I2E A;  2C4B A;  2F5M A;  2KAA A;  1BRK A;  1CH0 A;  1RGK A;  1JBR A;  1RDS A;  1BSA A;  1FUS A;  1RNT A;  4GSP A;  1X1X A;  1BRG A;  1I0V A;  2F5W A;  1B2Z A;  1HYF A;  1RGE A;  3KCH A;  4BIR A;  5RNT A;  2HOH A;  1DE3 A;  1RGF A;  1BUJ A;  1AY7 A;  1X1W A;  3SYU A;  1BRS A;  1RGC A;  1TTO A;  5GSP A;  1I3I A;  1B3S A;  3AGO A;  2AAE A;  2GSP A;  1RN4 A;  1GSP A;  4BU4 A;  1BNR A;  1GOU A;  1PY3 A;  1RGA A;  3GSP A;  1HZ1 A;  1B2S A;  7RNT A;  3AHW A;  1BOX A;  1X1Y A;  3BIR A;  1I0X A;  1RGH A;  3HOH A;  1GOY A;  3AHS A;  1JBT A;  3D4A A;  7GSP A;  1PYL A;  2BIR A;  1LNI A;  1B2U A;  1BAO A;  1RLS A;  1I3F A;  1BU4 A;  1RNB A;  5BIR A;  3WHO A;  1BSE A;  1TRQ A;  1GOV A;  1LOV A;  3AGN A;  4J5K A;  2KF5 A;  1FZU A;  3RNT A;  1B21 A;  2ZA4 A;  1BRN L;  1UCK A;  1I70 A;  1RN1 A;  1BRJ A;  5BU4 A;  1BNJ A;  1YGW A;  8RNT A;  2F56 A;  1BNS A;  1BSD A;  1UCJ A;  3A5E A;  1B2X A;  1LOW A;  1SAR A;  3D5I A;  4GHO A;  1B27 A;  3Q3F A;  1B20 A;  3D5G A;  1GMP A;  1BNF A;  1DET A;  1X1U A;  1BGS A;  1TRP A;  1BVI A;  1GMR A;  1MGR A;  1G02 A;  2SAR A;  2RNT A;  1LOY A;  1YVS A;  1FYS A;  1BAN A;  1JBS A;  3DGY A;  3URP A;  1BRI A;  3DH2 A;  1R4Y A;  1RMS A;  1BSC A;  1IYY A;  1BNI A;  1C54 A;  2F4Y A;  1I2G A;  2KF6 A;  9RNT A;  1BNG A;  4J5G A;  2KF3 A;  1UCI A;  1BIR A;  1BSB A;  1LRA A;  4HOH A;  1YNV X;  1T2I A;  1MGW A; 
#chains in the Genus database with same CATH topology
 5IG4 A;  3UL5 A;  1E3R A;  4N6V 0;  5TGN A;  6RNT A;  3NBB A;  5M19 A;  3G4S 3;  3LTD A;  3NQZ A;  3CCR 3;  1EUI C;  1TP6 A;  2XSO B;  3H51 A;  2LYX A;  1RHL A;  1B2M A;  2WO0 A;  3BU4 A;  4HBR A;  3SVA A;  2YFJ B;  2CHC A;  3GRD A;  1YIT 3;  1RTU A;  1T5Y A;  3GZB A;  3EE1 A;  3FCS B;  1RCL A;  4ZM8 A;  1RGL A;  1IV7 A;  1UCL A;  3EC9 A;  1Q9E A;  5M1A A;  3WOE B;  1OHS A;  1WMN A;  4NRE A;  3X42 A;  3EF8 A;  3LZA A;  5AEU B;  1W2Z A;  1LVN A;  8CHO A;  2OTJ 3;  2XFT A;  2C4B A;  2FGT A;  4ILF A;  3X3X A;  1VQ9 3;  3DZL A;  5BXQ A;  1T3B A;  2KAA A;  2BMR B;  1BRK A;  2W0Q A;  4Q53 A;  2FXT A;  1JBR A;  1NJI 4;  1BSA A;  3NXJ A;  3ALA A;  1U8C B;  1AVK A;  5FW5 A;  1X1X A;  2WOH A;  1NU3 A;  3CU3 A;  4FCJ A;  2JQ5 A;  4KFF A;  1S5A A;  2Q07 A;  1HYF A;  4N6M A;  1RGE A;  5RNT A;  5I97 A;  4HM4 B;  1M90 4;  2IY2 A;  2BT3 A;  5AYS C;  1FGQ A;  2K3D A;  2CH9 A;  1BUJ A;  1Q86 4;  1AY7 A;  4U13 A;  3SYU A;  2D1W A;  1GD4 A;  4BL2 A;  3Q90 A;  2CIU A;  1TTO A;  1A67 A;  1CYV A;  4HYZ A;  1B3S A;  1KWI A;  4N6T A;  3JVC A;  3IPT A;  3X40 A;  3T0U A;  2Z77 A;  3EN8 A;  1IVU A;  3NQY A;  3ZG0 A;  1JZO A;  3PXM A;  5G1L A;  1SIH A;  3LYG A;  4L8P A;  1RGA A;  2A15 A;  1W7C A;  3FG4 A;  1HZ1 A;  3GSP A;  1HKX A;  3QK9 A;  3PCS A;  1EQK A;  4N6O B;  2YX9 A;  1UGH I;  3UNL A;  3V99 A;  3CC4 3;  1RGH A;  3LTB A;  1SJW A;  1VZZ A;  2CWV A;  2HMJ B;  2Z76 A;  5STD A;  5LC6 A;  4XM4 A;  1JBT A;  1TFK A;  2BIR A;  3SED A;  1I3F A;  2RGQ A;  4MJD A;  1RNB A;  1SQW A;  3PCR A;  1TRQ A;  2CFK A;  1DVD A;  5AIH A;  4PEJ A;  1ASK A;  1MWS A;  3FGY A;  1BRN L;  3S67 A;  2YFI B;  3D3L A;  1UCK A;  3BB9 A;  4O3V A;  2Z6B A;  2P09 A;  3F40 A;  3OWY A;  1BRJ A;  1O7H B;  4L8O A;  3MHE A;  2WGQ A;  3JUO A;  4XDW A;  1YJW 3;  4L7K A;  1YJN 3;  2SBL A;  3Q2P A;  1Q42 A;  1V58 A;  4J8T A;  3ZG5 A;  3HI7 A;  3WDG B;  1O7M B;  5IG5 A;  5KP4 A;  1N8R 4;  3Q3F A;  1B20 A;  4AKY A;  1X1U A;  4LMI A;  1BGS A;  1YVB I;  1BVI A;  1W5Z A;  2XGL A;  3MG2 A;  1Q40 B;  2SAR A;  3KFQ C;  3PS8 A;  3MYT A;  3LTC A;  2OWP A;  4EYC A;  2BHM A;  2RNT A;  4R4K A;  1V74 A;  2OOV A;  2CG1 A;  3EB8 A;  1GY7 A;  1FYS A;  1BAN A;  2W04 A;  2OOV C;  1JZD A;  1OH0 A;  1JKG B;  3O8Y A;  1RMS A;  5IEO A;  1JKG A;  1DMM A;  1JB5 A;  3SXX A;  2W2C A;  4QWT A;  1DVC A;  1TFO A;  2ZL8 A;  2ZHX B;  1UCI A;  3EJV A;  1YNV X;  4HM1 B;  1O7W B;  4HM6 B;  2XH9 A;  1I8V A;  1UI7 A;  1R4C A;  1VQM 3;  3G16 A;  4N3V A;  1T2H A;  1RGG A;  3DM8 A;  1BNE A;  3ZFZ A;  3IJE B;  4OK0 A;  3WR2 A;  4MMX B;  1GY5 A;  2AAD A;  2W56 A;  2W9P A;  3F7S A;  5G2G A;  2BU4 A;  3X3Z A;  1A2P A;  2KXG A;  4FMD A;  3VGN A;  5IG3 A;  2CWT A;  2KF4 A;  3K0Z A;  5EQL A;  1F8N A;  3FKA A;  2GBW B;  1RSN A;  1O7P B;  2QGU A;  2YFL B;  3V98 A;  2RBI A;  4HKV B;  4BL3 A;  4KZ1 A;  1Y4K A;  2V1L A;  3T8N A;  1OHP A;  2GEX A;  1OCV A;  2C11 A;  3LT9 A;  1RDS A;  1RNT A;  1FUS A;  1QJG A;  3H3H A;  4K90 B;  4GSP A;  4RNY A;  5A0O B;  4STD A;  2H0I A;  2XSH B;  2XEP A;  4BIR A;  3GZX B;  1FA3 A;  1NB3 I;  5D83 A;  3NV0 B;  2W56 B;  1DE3 A;  3FH1 A;  4RZM A;  3S28 A;  1RGC A;  2CFW A;  2P38 A;  5GSP A;  4AEQ A;  1ULJ B;  4EV2 A;  3MWZ A;  3AGO A;  3CD6 3;  3ECF A;  2XGN A;  4FCM A;  2AAE A;  2BNG A;  5BIR A;  1GSP A;  3FF2 A;  1BNR A;  4AKZ A;  1US1 A;  3WMD A;  4CJN A;  2IMJ A;  3PGB A;  4EBG A;  1KD1 4;  2MC8 A;  4GL6 A;  1NB5 I;  3LTA A;  1LQM B;  1QMA A;  3AHW A;  1W6G A;  3BIR A;  1CEW I;  5DRE A;  3WA2 X;  1WQL B;  3WA3 A;  1ROV A;  2UUG C;  3HOH A;  4WWU C;  4XBY A;  1QAF A;  3I55 3;  3BND A;  1G0T A;  5IW9 A;  4N6N B;  7GSP A;  1TIJ A;  4BTX A;  2GU1 A;  1LNI A;  3F8H A;  5AI1 A;  3I0Y A;  1BU4 A;  4HVN A;  1IU7 A;  2HML B;  3WHO A;  5HGR A;  3GZY B;  4R1K A;  4MEI A;  1GYB A;  3A76 A;  3GZR A;  3OW2 2;  3AGN A;  3G8Z A;  2KF5 A;  1AVL A;  3N8B A;  1FZU A;  3FF0 A;  5IEP A;  1D6U A;  1U5O A;  5AYR B;  5IG0 A;  3CCQ 3;  4KT3 B;  3DUK A;  1MWU A;  4R9L A;  3NV0 A;  3CPO A;  3K9M C;  1YIJ 3;  1ULI B;  2F98 A;  2R4I A;  3F7X A;  4WYK B;  5IEN A;  1BSD A;  3DMC A;  3F9S A;  5D82 A;  4XBT A;  2CX1 A;  1UUG B;  4GHO A;  3I56 3;  4WFO A;  3BNE A;  1B27 A;  1HU9 A;  3E99 A;  5ELJ A;  1IK3 A;  4I5Q A;  1NWW A;  1GMP A;  3CNM A;  1DET A;  3GAX A;  4MMZ B;  3SOY A;  1TRP A;  4H61 A;  1GMR A;  1IVW A;  1G02 A;  2FNQ A;  4EXR A;  1J2B A;  1VQO 3;  5CK6 A;  4OUQ A;  1K73 4;  3CPW 2;  3AMO B;  3OV4 A;  4FMA A;  4RNZ A;  1STD A;  1LOY A;  1A2K A;  3URP A;  1BRI A;  3JUQ A;  3NM2 A;  3NBJ A;  2OCT A;  4N6U A;  4O02 B;  1N5P A;  1BSC A;  3FG1 A;  4BTY A;  1M1X B;  1TJD A;  3KN4 A;  1SPU A;  1IQX A;  4HM0 B;  5CLK A;  4O2H A;  1OPY A;  4KFE A;  1YGE A;  3EHC A;  2KF3 A;  1OF5 B;  5KP1 A;  5G1K A;  3LML A;  1MWR A;  2B24 B;  3OWU A;  4HM7 B;  4O8S A;  3CCS 3;  4OVM A;  1Q7H A;  5JPU A;  1IVV A;  1MGW A;  2P0M A;  2KRT A;  5AIF A;  4KFD A;  5AIG A;  1N9E A;  1AR0 A;  1QAL A;  1DMQ A;  2CFL A;  3MG1 A;  1FW7 A;  1YI2 3;  1FUT A;  5HOH A;  3NBR A;  3UJM A;  2MF7 A;  1N8Q A;  3DGO A;  2D42 A;  1RRH A;  1CYU A;  1DYU A;  1KC8 4;  1BRH A;  1O7G B;  1ZGX A;  1VQK 3;  1QAK A;  1UI8 A;  4RNT A;  1GMQ A;  2RCD A;  1JJ2 2;  1N5H A;  3FG3 A;  2L1S A;  3SX1 A;  5LC7 A;  4LSO A;  3S5C A;  4XB5 A;  3JUM A;  4EC6 A;  4NHF A;  3OWS A;  1MNL A;  4HAA A;  3K63 A;  1I2E A;  3HZP A;  1E97 A;  1ROA A;  3TDG A;  2UGI A;  3PYJ A;  2XR8 B;  4X2H A;  5AII A;  4K61 A;  5FGO A;  3RGA A;  5AEW B;  2OTL 3;  1O7N B;  1CH0 A;  1VQ4 3;  1RGK A;  3T8U A;  1IDP A;  4LZI A;  2CKF B;  3JUP A;  1BRG A;  2P0X A;  1MWT A;  1FGT A;  2XFS A;  2Y73 A;  3U97 A;  1D6Y A;  3KII A;  4FCZ A;  5EVH A;  1W6Y A;  1VQQ A;  2BMO B;  1RGF A;  3CCV 3;  1BRS A;  1Q7Y 4;  3DGM A;  1I3I A;  5JPP A;  5IER A;  5EEO A;  2O9U X;  4RBN A;  3LH4 A;  1JRQ A;  1EEJ A;  2B1X B;  1UW1 A;  2IUJ A;  1RN4 A;  1VQ5 3;  2CK3 H;  1A90 A;  2BMQ B;  1AV4 A;  5CF1 A;  4LYL B;  1UDI I;  1UUW B;  2RFR A;  1Q82 4;  7STD A;  3LOY A;  1B2S A;  2IUK A;  1RN7 A;  3IMA B;  3F14 A;  7RNT A;  1OUN A;  1X1Y A;  1LQG C;  1L5G B;  4BTW A;  3D79 A;  2CWU A;  1GOY A;  3Q1C A;  3AHS A;  4X2O A;  5BVB A;  4G1M B;  2P05 A;  4NPB A;  3EBY A;  5D81 A;  1B2U A;  1RLS A;  2BO9 B;  2LQV A;  3ER7 A;  4GB5 A;  4CDL A;  4R80 A;  3MSO A;  1OAC A;  1E3V A;  1C7H A;  1EG9 B;  2C10 A;  3NX0 A;  4K1V A;  3S29 A;  3CXC 2;  1LOV A;  3CC2 3;  4HZB B;  3CCM 3;  1YHQ 3;  4J5K A;  1NDO B;  1DMN A;  3RNT A;  1GD3 A;  1B21 A;  2W6J H;  2W03 A;  4HM8 B;  1I70 A;  2F99 A;  1RN1 A;  1FGR A;  2Z7A A;  4IIA A;  4WP5 A;  2OQE C;  4FMC A;  4H3U A;  5KP3 A;  2QA4 3;  3U1W A;  3KE7 A;  1BNJ A;  3CC7 3;  1TUH A;  1YGW A;  3EN1 B;  1MOL A;  3CNX A;  2F56 A;  3LXU X;  2OQE A;  1W02 A;  3L0R A;  3A5E A;  2GBX B;  1B2X A;  4KVH A;  1UGI A;  4N6L A;  1SAR A;  3D5I A;  3CME 3;  1QVG 2;  2PNC A;  3KKG A;  1IT8 A;  2QEX 3;  3NUV A;  1K8A 4;  1G96 A;  3KZT A;  4XBX A;  3VSY A;  3D5G A;  1BNF A;  1Q40 A;  2K54 A;  3K7C A;  5DRV A;  1RKY A;  4J9A A;  5CXO A;  1ZO2 A;  1VQ6 3;  4WHA A;  2CC3 A;  1YVS A;  3X41 A;  1JBS A;  1GY6 A;  3DGY A;  3GWR A;  1R4Y A;  1UUV B;  3D9R A;  3VF1 A;  2RSX A;  1IYY A;  3KSE D;  1JB2 A;  1BNG A;  3NHX A;  3K5T A;  4FMB A;  1BSB A;  1JN5 B;  1T2I A;  4FR9 A;  3FLJ A;  3HIG A;  3MKI A;  1N9J A;  1GS3 A;  3G71 3;  1RCK A;  1KQS 2;  1NNV A;  1AQZ A;  1TU5 A;  1M1K 4;  4WYK A;  1K9M 4;  1FUW A;  2XRX B;  1VQ8 3;  2GEY A;  1BUQ A;  1RRL A;  1I2F A;  1PFP A;  2HMM B;  1VQN 3;  1RJO A;  3M8C A;  6GSP A;  3BNB A;  2F5M A;  3B4P A;  5CF2 A;  1YJ9 3;  4LEH A;  1VQP 3;  1ZX2 A;  3BNC A;  3EQQ B;  3HII A;  2Y74 A;  5ELU A;  3DY5 A;  3OXA A;  1I0V A;  1NO3 A;  3CCE 3;  2F5W A;  1B2Z A;  4HJL B;  4HZ9 B;  1IT7 A;  3B8L A;  2H0G A;  3KCH A;  1Q81 4;  3F8X A;  3UB1 A;  2HOH A;  1OGZ A;  2STD A;  3JUN A;  1K28 A;  4JF8 A;  2M7O A;  1IVX A;  3N54 B;  4K1U A;  1X1W A;  1D6Z A;  2HMO B;  1IQY A;  3HX8 A;  4HM3 B;  3UL6 A;  1W2B 2;  3S27 A;  3ROB A;  3CCJ 3;  3PZW A;  5IF6 A;  3LT8 A;  2GSP A;  1W00 A;  4DKI A;  4BU4 A;  1GOU A;  1PY3 A;  2I9W A;  2IA7 A;  1FGM A;  2O3O A;  2IYJ A;  3FSD A;  3QRD A;  3RGR A;  3G6E 3;  1PU4 A;  1WNH A;  3RDE A;  2ML5 A;  4CCV A;  3OX9 A;  1VQ7 3;  2WGO A;  1WTH A;  1BOX A;  2F86 B;  2XF3 A;  1I0X A;  4EW5 A;  1SII A;  1EA2 A;  4R9K A;  3SOA A;  3NM7 A;  6STD A;  3D4A A;  1LOX A;  1PYL A;  3B7C A;  1BAO A;  1JNQ A;  1JB4 A;  2CFD A;  1S72 3;  4IT7 A;  3AMO A;  1M9G A;  3B4O A;  3V92 A;  1BSE A;  1WMP A;  1GOV A;  2H0H A;  2ML6 A;  3WOF B;  3J7Y d;  4MMY B;  3EBT A;  2GXF A;  1W6C A;  1ZS7 A;  1LNH A;  2E2U A;  4HM2 B;  3HK4 A;  2HMN B;  2W9Q A;  2ZA4 A;  4HM5 B;  3WOD G;  3X3Y A;  4CPK A;  4EV5 A;  3KSP A;  3MG3 A;  2WOF A;  2CG0 A;  1W01 A;  3N9H A;  5BU4 A;  8RNT A;  1EKM A;  1LXE A;  1BNS A;  1KSI A;  1UCJ A;  2ZDJ A;  1Z1S A;  1LOW A;  1WMO A;  4XDV A;  5JBS A;  2CX0 A;  3EX9 A;  1IV9 A;  2CFG A;  1W4N A;  2CW9 A;  2INX A;  2KCD A;  1ISK A;  2R41 A;  4LGQ A;  1MGR A;  1STF I;  1OHO A;  1V57 A;  2UX0 A;  4TX4 A;  1QVF 2;  2K0M A;  1CQS A;  1OF5 A;  1OGX A;  4I4K A;  3CCU 3;  2E2V A;  1K41 A;  1JV2 B;  4IPB A;  3CCL 3;  3DGN A;  2E2T A;  2HMK B;  3DGL A;  3DH2 A;  1FGO A;  2JDI H;  1VQL 3;  3G0K A;  4ORL A;  1BNI A;  3BLZ A;  1C54 A;  2F4Y A;  1I2G A;  3MPH A;  2KF6 A;  2GU3 A;  3STD A;  9RNT A;  5M18 A;  2J8X B;  4J5G A;  2PZV A;  3SLU A;  1BIR A;  3CMA 3;  1LRA A;  1A2V A;  1JN5 A;  2QIY A;  3DXO A;  3FZW A;  2L4V A;  4HOH A;  4JRF A;  1IQ8 A; 
#chains in the Genus database with same CATH homology
 1I8V A;  6RNT A;  1T2H A;  1RGG A;  1FW7 A;  1RCK A;  1FUT A;  1BNE A;  5HOH A;  1RHL A;  1B2M A;  3BU4 A;  3WR2 A;  1AQZ A;  2AAD A;  2BU4 A;  1RTU A;  1A2P A;  1BRH A;  1ZGX A;  1RCL A;  1RGL A;  4RNT A;  2KF4 A;  1GMQ A;  1UCL A;  1Q9E A;  1I2F A;  1RSN A;  6GSP A;  4HAA A;  2RBI A;  1I2E A;  2C4B A;  2F5M A;  2KAA A;  1BRK A;  1CH0 A;  1RGK A;  1JBR A;  1RDS A;  1BSA A;  1FUS A;  1RNT A;  4GSP A;  1X1X A;  1BRG A;  1I0V A;  2F5W A;  1B2Z A;  1HYF A;  1RGE A;  3KCH A;  4BIR A;  5RNT A;  2HOH A;  1DE3 A;  1RGF A;  1BUJ A;  1AY7 A;  1X1W A;  3SYU A;  1BRS A;  1RGC A;  1TTO A;  5GSP A;  1I3I A;  1B3S A;  3AGO A;  2AAE A;  2GSP A;  1RN4 A;  1GSP A;  4BU4 A;  1BNR A;  1GOU A;  1PY3 A;  1RGA A;  3GSP A;  1HZ1 A;  1B2S A;  7RNT A;  3AHW A;  1BOX A;  1X1Y A;  3BIR A;  1I0X A;  1RGH A;  3HOH A;  1GOY A;  3AHS A;  1JBT A;  3D4A A;  7GSP A;  1PYL A;  2BIR A;  1LNI A;  1B2U A;  1BAO A;  1RLS A;  1I3F A;  1BU4 A;  1RNB A;  5BIR A;  3WHO A;  1BSE A;  1TRQ A;  1GOV A;  1LOV A;  3AGN A;  4J5K A;  2KF5 A;  1FZU A;  3RNT A;  1B21 A;  2ZA4 A;  1BRN L;  1UCK A;  1I70 A;  1RN1 A;  1BRJ A;  5BU4 A;  1BNJ A;  1YGW A;  8RNT A;  2F56 A;  1BNS A;  1BSD A;  1UCJ A;  3A5E A;  1B2X A;  1LOW A;  1SAR A;  3D5I A;  4GHO A;  1B27 A;  3Q3F A;  1B20 A;  3D5G A;  1GMP A;  1BNF A;  1DET A;  1X1U A;  1BGS A;  1TRP A;  1BVI A;  1GMR A;  1MGR A;  1G02 A;  2SAR A;  2RNT A;  1LOY A;  1YVS A;  1FYS A;  1BAN A;  1JBS A;  3DGY A;  3URP A;  1BRI A;  3DH2 A;  1R4Y A;  1RMS A;  1BSC A;  1IYY A;  1BNI A;  1C54 A;  2F4Y A;  1I2G A;  2KF6 A;  9RNT A;  1BNG A;  4J5G A;  2KF3 A;  1UCI A;  1BIR A;  1BSB A;  1LRA A;  4HOH A;  1YNV X;  1T2I A;  1MGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...