1GMPA

Complex of ribonuclease from streptomyces aureofaciens with 2'-gmp at 1.7 angstroms resolution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
96
structure length
96
Chain Sequence
DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIICGEATQEDYYTGDHYATFSLIDQTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(guanyloribonuclease)
molecule keywords RIBONUCLEASE SA
publication title Complex of ribonuclease from Streptomyces aureofaciens with 2'-GMP at 1.7 A resolution.
pubmed doi rcsb
source organism Streptomyces aureofaciens
total genus 26
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1992-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1gmpA00
3Q3FA 1BRKA 2F5MA 1RDSA 3AGOA 3D5IA 1RGKA 1C54A 1RGGA 1TRPA 1PYLA 1UCJA 1RGLA 9RNTA 1BRNL 1UCKA 3BIRA 1X1YA 1I70A 1B2MA 1PY3A 2KAAA 1BOXA 1BSEA 1HZ1A 3SYUA 1BNSA 2RNTA 1MGWA 1SARA 1B2SA 1BSCA 5RNTA 3DGYA 1RTUA 1BSDA 1JBTA 1MGRA 6RNTA 1BAOA 3GSPA 1BSBA 1R4YA 1GSPA 3A5EA 1I0VA 1B2UA 1RN4A 1YNVX 1G02A 1I3IA 1RN1A 2C4BA 1CH0A 1FW7A 4BIRA 2AADA 2KF6A 1AY7A 1RHLA 1UCLA 2ZA4A 1X1WA 2F56A 1JBRA 1BU4A 1UCIA 1GMPA 7GSPA 1T2HA 1YVSA 1BNIA 1FZUA 1FUTA 1B2XA 1X1XA 3WR2A 4HAAA 1I8VA 8RNTA 5BU4A 1BNGA 4BU4A 1B27A 1BUJA 1LOWA 1RSNA 1BSAA 1BRGA 1RNTA 2F4YA 2GSPA 2SARA 3URPA 1A2PA 2BU4A 2F5WA 1I2GA 1BVIA 1I3FA 1RGHA 2RBIA 5BIRA 2BIRA 1ZGXA 1RLSA 1YGWA 1B2ZA 3RNTA 1RGAA 3D5GA 3DH2A 1B20A 1BGSA 4RNTA 3HOHA 1GOYA 4GSPA 3KCHA 1GMRA 1BNFA 1DE3A 1FUSA 1LOYA 1RNBA 2KF3A 2HOHA 4J5KA 4GHOA 4HOHA 1I2FA 7RNTA 3BU4A 1GMQA 1LRAA 2KF5A 5HOHA 1HYFA 1LOVA 1BNJA 1TRQA 1TTOA 1RMSA 3WHOA 1GOVA 1BRHA 1AQZA 1BRJA 1B21A 1I0XA 1RCKA 1B3SA 1RGFA 3AHSA 3AHWA 1BRIA 1RGEA 6GSPA 1BRSA 1JBSA 4J5GA 1Q9EA 1T2IA 1BANA 1GOUA 1DETA 1RGCA 2AAEA 2KF4A 1IYYA 3AGNA 1X1UA 1BIRA 1LNIA 5GSPA 1RCLA 1BNRA 1I2EA 1FYSA 3D4AA 1BNEA
chains in the Genus database with same CATH superfamily
3Q3FA 3EBTA 5JPUA 2OWPA 1IV9A 3EHCA 3RDEA 1YIT3 1N9JA 3ER7A 2CWTA 3LTAA 2HMKB 1DVCA 1E3VA 2P38A 3KFQC 2W0QA 3CCV3 2W04A 1VQ93 1BRNL 5IW9A 1JZDA 1IQYA 3QK9A 3GRDA 2D42A 5JPPA 2GBWB 3CMA3 1IT7A 3NV0B 3MSOA 2KAAA 1HZ1A 3SYUA 2A15A 2E2TA 2RNTA 1W00A 1SARA 2BT3A 3IMAB 4NPBA 3N9HA 4BL2A 4EXRA 1RKYA 1Q864 1N8R4 2Y73A 1NB5I 2W6JH 4RNYA 3FG4A 5IG5A 3F9SA 2ML6A 1MOLA 1RJOA 1TP6A 3NV0A 6RNTA 1BAOA 2HMMB 1VQP3 1BSBA 2Z76A 1NWWA 1ULJB 2RSXA 1JKGB 1G02A 1I3IA 3ALAA 1RN1A 1VQ53 2CW9A 2FXTA 3X3XA 5KP1A 3K7CA 7STDA 5AYSC 2F56A 1QVF2 3MG2A 1N5HA 3FGYA 3GZBA 3BLZA 4KFFA 5TGNA 1YVSA 3B4OA 5G2GA 4AKZA 5AIFA 8CHOA 5M19A 1B2XA 3F7XA 1LXEA 1X1XA 1GYBA 2Y74A 3HIIA 4FMCA 3G8ZA 2STDA 1W6CA 5STDA 3MWZA 3GAXA 4R9KA 4L7KA 2CK3H 1BUJA 3B4PA 3D79A 3EJVA 5AIIA 2ZHXB 4ILFA 4BTYA 3DGOA 4HM7B 1IVXA 2W9PA 3F8HA 4HM0B 2IY2A 5IG0A 1I3FA 1O7MB 3B8LA 4L8OA 1E3RA 1W4NA 5EVHA 1JV2B 1JN5B 2BMRB 1RGAA 1M9GA 2XSOB 3OX9A 1B20A 1PFPA 3PGBA 4J9AA 4RNTA 3OXAA 1VQK3 3NXJA 5ELJA 3KCHA 1U5OA 1ASKA 3LTBA 1GD3A 3I563 5D83A 1YIJ3 4OUQA 5D82A 1T3BA 2H0GA 2WOHA 2CX1A 3CU3A 1OHPA 3E99A 1JN5A 1JZOA 2CHCA 1WMNA 1Q42A 3I0YA 4ZM8A 1VQN3 2ML5A 1FUWA 1I2FA 4EC6A 1G96A 1TJDA 4EV5A 2CFDA 5CF2A 2I9WA 4AEQA 3LXUX 1FGMA 2HMOB 2K3DA 5HOHA 1OH0A 1TU5A 2WGQA 3DGNA 1LOVA 1QMAA 1FGQA 1TRQA 3JUNA 3KIIA 4LGQA 1RMSA 3SLUA 1BRHA 1SJWA 2YFLB 2B24B 4CDLA 1B21A 1I0XA 1IU7A 3HIGA 1LQMB 2L4VA 1RGEA 3DGLA 3FSDA 3NBRA 2SBLA 1V57A 1BRSA 2GEXA 3GZRA 2P0XA 3UNLA 1T2IA 2OOVA 4WYKB 3LTDA 1CEWI 1JB4A 1JB5A 3NX0A 1TIJA 3NUVA 4RZMA 2BMOB 1DVDA 1LNIA 3SOYA 3QRDA 1BNRA 3CCJ3 1MWTA 1O7NB 3CCQ3 1S723 1UI8A 4R4KA 1IQXA 4HM4B 1IT8A 2J8XB 2XSHB 3G0KA 3O8YA 1O7PB 1OACA 4CPKA 4HM3B 1Q7Y4 4HM5B 1RGKA 4XBXA 2MC8A 2OTL3 1PYLA 2GEYA 4N6MA 3KN4A 3MG1A 4GB5A 1RGLA 5CLKA 1D6UA 3KE7A 9RNTA 2QGUA 4STDA 1IDPA 1W02A 1PU4A 2MF7A 3EN8A 4O8SA 1O7GB 1T5YA 2LQVA 1B2MA 1PY3A 1BNSA 1MGWA 3NQYA 4XM4A 1FA3A 1VZZA 3PCRA 1OF5B 5RNTA 1IVWA 1RTUA 1KD14 1C7HA 1MGRA 4XB5A 3BNEA 3ECFA 3X3YA 3L0RA 1J2BA 2BHMA 1NU3A 1CQSA 1GSPA 1R4YA 5LC7A 3UL6A 1B2UA 1LNHA 1RN4A 4XDWA 4L8PA 1OF5A 3A76A 1D6YA 4NHFA 1V74A 4BIRA 1UGIA 2W9QA 2PNCA 2O9UX 3UB1A 3ZG0A 2JDIH 1X1WA 4HKVB 4JRFA 1GS3A 4K1UA 1JBRA 4Q53A 1TUHA 3H3HA 2BMQB 4HZ9B 7GSPA 1KQS2 4KT3B 4LMIA 1IV7A 1BNIA 1FZUA 2CKFB 3EB8A 2IA7A 2M7OA 3NBJA 3J7Yd 1YVBI 1Z1SA 1RN7A 1UI7A 2FNQA 3ROBA 1N5PA 1OHOA 3KKGA 4HAAA 2QIYA 4HM6B 4N3VA 8RNTA 2UUGC 5BU4A 1JB2A 1A90A 3U1WA 2CWUA 1SIHA 3CC43 3KSED 3K5TA 3KSPA 4XBTA 2C10A 3VSYA 5IG3A 2OQEA 2P05A 2F4YA 2GSPA 1N9EA 3X40A 1W2B2 1OGZA 2BU4A 1OGXA 1LVNA 1BVIA 2F5WA 2XGNA 1KSIA 5BXQA 2RBIA 1SIIA 3LYGA 4KFEA 2IUJA 5BIRA 1YGWA 3DH2A 3WOFB 3AMOA 1DMQA 3D3LA 1L5GB 1RRLA 3HOHA 1GOYA 4GSPA 4KFDA 1M1K4 1GMRA 2ZL8A 1WTHA 1FUSA 4HJLB 2K0MA 4J5KA 3Q90A 1M904 3D9RA 3EN1B 7RNTA 1U8CB 1KC84 1YJN3 3U97A 1IQ8A 2QEX3 1EUIC 1LRAA 3OWUA 1W5ZA 1V58A 2CFGA 3F40A 5IEOA 2IUKA 3Q1CA 1HYFA 2IMJA 1LQGC 1UUVB 1K41A 2QA43 1WMOA 1AQZA 4IT7A 1BRJA 1RCKA 3N54B 4LSOA 4O2HA 4HBRA 1RGFA 4N6TA 3DZLA 3AHWA 1BRIA 3FF0A 1IYYA 1O7WB 3K0ZA 4N6NB 3S29A 5IF6A 1BANA 3BNDA 5CXOA 1K9M4 3IJEB 1W6YA 5G1KA 3EQQB 3AGNA 3SEDA 4FMAA 4WHAA 1RCLA 2GXFA 1O7HB 4OK0A 3GZXB 1I2EA 3F14A 3D4AA 3OV4A 2GU3A 5HGRA 5IENA 4NREA 1BRKA 4BL3A 3CME3 1TFKA 5AI1A 4N6LA 4EV2A 3LMLA 5CK6A 3AGOA 3NQZA 2RFRA 4LZIA 4U13A 4EW5A 1A2KA 3SOAA 1SPUA 2F98A 2W03A 3BNCA 4EBGA 3T8UA 1IVUA 3MKIA 1W7CA 1Q824 3SX1A 3B7CA 3UL5A 1UCKA 4K61A 1UW1A 3BB9A 3HI7A 1NO3A 1BOXA 3S28A 2CH9A 3SVAA 3WA2X 2D1WA 2F99A 1FGRA 2XFSA 1B2SA 1OUNA 3DY5A 3FG1A 3JUMA 3T0UA 6STDA 3RGRA 1SQWA 4RBNA 1JBTA 2KRTA 4RNZA 1DMNA 2XF3A 3FF2A 1VQ73 1D6ZA 2CFLA 1I0VA 1VQQA 1N8QA 1YNVX 4QWTA 1UUWB 2UGIA 2C4BA 1CH0A 1VQO3 2PZVA 5JBSA 2AADA 1RHLA 3NM7A 1ROAA 1MWRA 4K90B 3LH4A 5BVBA 1BU4A 1UCIA 1GMPA 2GBXB 3BNBA 1DYUA 2H0HA 4MJDA 1T2HA 3CNMA 3K63A 4KZ1A 1Y4KA 2R4IA 1AVLA 2RCDA 4MMYB 1Q814 4K1VA 3CPOA 1AV4A 1US1A 1GY5A 3WDGB 5AYRB 1MWUA 4HZBB 5DREA 3WR2A 1WMPA 1JRQA 3N8BA 1BNGA 4WP5A 3CXC2 5IG4A 1RSNA 4FMBA 3S67A 2YX9A 1BSAA 3JUOA 4R9LA 3M8CA 4WWUC 2CX0A 4TX4A 2CFKA 2XFTA 2SARA 3X41A 3UJMA 3URPA 5M18A 3PCSA 4GL6A 3MYTA 2E2UA 4I4KA 2Z77A 3NBBA 2BIRA 2WO0A 3WODG 4XBYA 3TDGA 5DRVA 1FGTA 3D5GA 3FLJA 1BGSA 3PZWA 3CC73 1QAFA 2KCDA 5IEPA 2CG0A 2OCTA 3PXMA 2XRXB 3G4S3 3KZTA 1HKXA 1LOYA 4EYCA 1R4CA 4LEHA 1JJ22 1BUQA 1Q7HA 1LOXA 2HOHA 3NM2A 1ZS7A 3LOYA 3CCL3 4N6V0 5A0OB 1IK3A 4HM2B 4HOHA 3BU4A 3EC9A 1UGHI 1GMQA 3JUQA 2L1SA 3SXXA 2KF5A 4CCVA 1QJGA 1DMMA 3T8NA 3AMOB 3WOEB 3G713 1BNJA 1K28A 3CCU3 3EE1A 3MG3A 2HMJB 4HM8B 2XEPA 4IIAA 4N6UA 2E2VA 2KXGA 1STDA 2HMLB 3FG3A 1WNHA 1OCVA 2P0MA 1B3SA 1EQKA 3AHSA 4HM1B 2P09A 3EX9A 2C11A 2OOVC 3EBYA 3STDA 5I97A 3DGMA 3F8XA 3MPHA 1Q9EA 5IERA 1JBSA 3GZYB 1DETA 1RGCA 4DKIA 1RRHA 2B1XB 2KF4A 5AEWB 5EEOA 1YJ93 5FW5A 3RGAA 2Q07A 3LTCA 2HMNB 1W2ZA 4XDVA 1ZO2A 1UDII 4FR9A 3G16A 1BNEA 2Z6BA 4MMZB 1YJW3 4ORLA 2F5MA 1QALA 3FCSB 4CJNA 2ZDJA 2WOFA 1RDSA 1VQ63 5FGOA 2H0IA 3D5IA 3X3ZA 1C54A 1RGGA 1TRPA 3VGNA 3V99A 1K8A4 1M1XB 1OHSA 3F7SA 1UCJA 4O02B 4KVHA 4FMDA 2RGQA 3I553 3BIRA 1X1YA 1JKGA 1NJI4 2FGTA 1I70A 4HVNA 4BTXA 1BSEA 2W2CA 2BNGA 2INXA 5LC6A 2UX0A 3V92A 3ZFZA 3OW22 1A67A 3FH1A 1BSCA 2CC3A 3DGYA 4I5QA 2CIUA 3JUPA 3CCM3 1BSDA 4J8TA 3S5CA 1F8NA 1IVVA 3GSPA 3DMCA 3A5EA 3DXOA 5AEUB 1GY7A 1GY6A 1FW7A 3OWYA 2KF6A 1AY7A 1Q40B 1UCLA 1ROVA 2ZA4A 3GWRA 5ELUA 3CCS3 3V98A 3HK4A 1HU9A 1ISKA 1QAKA 3FZWA 3OWSA 2CFWA 5KP3A 5AIHA 1W01A 4N6OB 1FUTA 1VQ83 1YGEA 1MNLA 4X2OA 1MWSA 2YFIB 1Q40A 3S27A 1I8VA 1STFI 1S5AA 1WQLB 1ZX2A 1VQ43 2JQ5A 3LZAA 3DM8A 4H61A 1B27A 4R80A 4BU4A 1LOWA 2IYJA 3WA3A 3G6E3 1BRGA 5D81A 2OQEC 3K9MC 4H3UA 1NDOB 4MMXB 2CG1A 1RNTA 3JVCA 1A2PA 1EG9B 1CYUA 1ULIB 1I2GA 1RGHA 4WFOA 2V1LA 3LT8A 1QVG2 1ZGXA 1RLSA 2K54A 4FCJA 3HZPA 4OVMA 1A2VA 5M1AA 1B2ZA 4G1MB 2GU1A 3RNTA 1VQM3 4MEIA 4O3VA 1AVKA 3FKAA 1NNVA 3PS8A 4IPBA 1UUGB 1BNFA 1DE3A 3ZG5A 2BO9B 5KP4A 3CPW2 3DUKA 1RNBA 4JF8A 2KF3A 2XH9A 1NB3I 4HYZA 2LYXA 3CNXA 3MHEA 4GHOA 2YFJB 4PEJA 1FGOA 1K734 4WYKA 1YHQ3 1CYVA 1EA2A 3X42A 4LYLB 1EEJA 1TFOA 1TTOA 3WHOA 1GOVA 1VQL3 3CCE3 2O3OA 2F86B 4FCZA 5EQLA 1GD4A 2R41A 1YI23 3NHXA 1W6GA 2W56B 3LT9A 6GSPA 1E97A 3H51A 2OTJ3 3HX8A 5G1LA 4J5GA 1GOUA 1KWIA 2AAEA 3VF1A 1G0TA 1OPYA 2XR8B 3Q2PA 4R1KA 1JNQA 4BTWA 3CCR3 4X2HA 1X1UA 1BIRA 3PYJA 5AIGA 5GSPA 5CF1A 3CC23 2W56A 2XGLA 3WMDA 1AR0A 1FYSA 2WGOA 2CWVA 3IPTA 4FCMA 3EF8A 4AKYA 3CD63 1EKMA 2Z7AA
chains in the Genus database with same CATH topology
3Q3FA 1BRKA 2F5MA 1RDSA 3AGOA 3D5IA 1RGKA 1C54A 1RGGA 1TRPA 1PYLA 1UCJA 1RGLA 9RNTA 1BRNL 1UCKA 3BIRA 1X1YA 1I70A 1B2MA 1PY3A 2KAAA 1BOXA 1BSEA 1HZ1A 3SYUA 1BNSA 2RNTA 1MGWA 1SARA 1B2SA 1BSCA 5RNTA 3DGYA 1RTUA 1BSDA 1JBTA 1MGRA 6RNTA 1BAOA 3GSPA 1BSBA 1R4YA 1GSPA 3A5EA 1I0VA 1B2UA 1RN4A 1YNVX 1G02A 1I3IA 1RN1A 2C4BA 1CH0A 1FW7A 4BIRA 2AADA 2KF6A 1AY7A 1RHLA 1UCLA 2ZA4A 1X1WA 2F56A 1JBRA 1BU4A 1UCIA 1GMPA 7GSPA 1T2HA 1YVSA 1BNIA 1FZUA 1FUTA 1B2XA 1X1XA 3WR2A 4HAAA 1I8VA 8RNTA 5BU4A 1BNGA 4BU4A 1B27A 1BUJA 1LOWA 1RSNA 1BSAA 1BRGA 1RNTA 2F4YA 2GSPA 2SARA 3URPA 1A2PA 2BU4A 2F5WA 1I2GA 1BVIA 1I3FA 1RGHA 2RBIA 5BIRA 2BIRA 1ZGXA 1RLSA 1YGWA 1B2ZA 3RNTA 1RGAA 3D5GA 3DH2A 1B20A 1BGSA 4RNTA 3HOHA 1GOYA 4GSPA 3KCHA 1GMRA 1BNFA 1DE3A 1FUSA 1LOYA 1RNBA 2KF3A 2HOHA 4J5KA 4GHOA 4HOHA 1I2FA 7RNTA 3BU4A 1GMQA 1LRAA 2KF5A 5HOHA 1HYFA 1LOVA 1BNJA 1TRQA 1TTOA 1RMSA 3WHOA 1GOVA 1BRHA 1AQZA 1BRJA 1B21A 1I0XA 1RCKA 1B3SA 1RGFA 3AHSA 3AHWA 1BRIA 1RGEA 6GSPA 1BRSA 1JBSA 4J5GA 1Q9EA 1T2IA 1BANA 1GOUA 1DETA 1RGCA 2AAEA 2KF4A 1IYYA 3AGNA 1X1UA 1BIRA 1LNIA 5GSPA 1RCLA 1BNRA 1I2EA 1FYSA 3D4AA 1BNEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q3F A;  1BRK A;  2F5M A;  1RDS A;  3AGO A;  3D5I A;  1RGK A;  1C54 A;  1RGG A;  1TRP A;  1PYL A;  1UCJ A;  1RGL A;  9RNT A;  1BRN L;  1UCK A;  3BIR A;  1X1Y A;  1I70 A;  1B2M A;  1PY3 A;  2KAA A;  1BOX A;  1BSE A;  1HZ1 A;  3SYU A;  1BNS A;  2RNT A;  1MGW A;  1SAR A;  1B2S A;  1BSC A;  5RNT A;  3DGY A;  1RTU A;  1BSD A;  1JBT A;  1MGR A;  6RNT A;  1BAO A;  3GSP A;  1BSB A;  1R4Y A;  1GSP A;  3A5E A;  1I0V A;  1B2U A;  1RN4 A;  1YNV X;  1G02 A;  1I3I A;  1RN1 A;  2C4B A;  1CH0 A;  1FW7 A;  4BIR A;  2AAD A;  2KF6 A;  1AY7 A;  1RHL A;  1UCL A;  2ZA4 A;  1X1W A;  2F56 A;  1JBR A;  1BU4 A;  1UCI A;  1GMP A;  7GSP A;  1T2H A;  1YVS A;  1BNI A;  1FZU A;  1FUT A;  1B2X A;  1X1X A;  3WR2 A;  4HAA A;  1I8V A;  8RNT A;  5BU4 A;  1BNG A;  4BU4 A;  1B27 A;  1BUJ A;  1LOW A;  1RSN A;  1BSA A;  1BRG A;  1RNT A;  2F4Y A;  2GSP A;  2SAR A;  3URP A;  1A2P A;  2BU4 A;  2F5W A;  1I2G A;  1BVI A;  1I3F A;  1RGH A;  2RBI A;  5BIR A;  2BIR A;  1ZGX A;  1RLS A;  1YGW A;  1B2Z A;  3RNT A;  1RGA A;  3D5G A;  3DH2 A;  1B20 A;  1BGS A;  4RNT A;  3HOH A;  1GOY A;  4GSP A;  3KCH A;  1GMR A;  1BNF A;  1DE3 A;  1FUS A;  1LOY A;  1RNB A;  2KF3 A;  2HOH A;  4J5K A;  4GHO A;  4HOH A;  1I2F A;  7RNT A;  3BU4 A;  1GMQ A;  1LRA A;  2KF5 A;  5HOH A;  1HYF A;  1LOV A;  1BNJ A;  1TRQ A;  1TTO A;  1RMS A;  3WHO A;  1GOV A;  1BRH A;  1AQZ A;  1BRJ A;  1B21 A;  1I0X A;  1RCK A;  1B3S A;  1RGF A;  3AHS A;  3AHW A;  1BRI A;  1RGE A;  6GSP A;  1BRS A;  1JBS A;  4J5G A;  1Q9E A;  1T2I A;  1BAN A;  1GOU A;  1DET A;  1RGC A;  2AAE A;  2KF4 A;  1IYY A;  3AGN A;  1X1U A;  1BIR A;  1LNI A;  5GSP A;  1RCL A;  1BNR A;  1I2E A;  1FYS A;  3D4A A;  1BNE A; 
#chains in the Genus database with same CATH topology
 3Q3F A;  3EBT A;  5JPU A;  2OWP A;  1IV9 A;  3EHC A;  3RDE A;  1YIT 3;  1N9J A;  3ER7 A;  2CWT A;  3LTA A;  2HMK B;  1DVC A;  1E3V A;  2P38 A;  3KFQ C;  2W0Q A;  3CCV 3;  2W04 A;  1VQ9 3;  1BRN L;  5IW9 A;  1JZD A;  1IQY A;  3QK9 A;  3GRD A;  2D42 A;  5JPP A;  2GBW B;  3CMA 3;  1IT7 A;  3NV0 B;  3MSO A;  2KAA A;  1HZ1 A;  3SYU A;  2A15 A;  2E2T A;  2RNT A;  1W00 A;  1SAR A;  2BT3 A;  3IMA B;  4NPB A;  3N9H A;  4BL2 A;  4EXR A;  1RKY A;  1Q86 4;  1N8R 4;  2Y73 A;  1NB5 I;  2W6J H;  4RNY A;  3FG4 A;  5IG5 A;  3F9S A;  2ML6 A;  1MOL A;  1RJO A;  1TP6 A;  3NV0 A;  6RNT A;  1BAO A;  2HMM B;  1VQP 3;  1BSB A;  2Z76 A;  1NWW A;  1ULJ B;  2RSX A;  1JKG B;  1G02 A;  1I3I A;  3ALA A;  1RN1 A;  1VQ5 3;  2CW9 A;  2FXT A;  3X3X A;  5KP1 A;  3K7C A;  7STD A;  5AYS C;  2F56 A;  1QVF 2;  3MG2 A;  1N5H A;  3FGY A;  3GZB A;  3BLZ A;  4KFF A;  5TGN A;  1YVS A;  3B4O A;  5G2G A;  4AKZ A;  5AIF A;  8CHO A;  5M19 A;  1B2X A;  3F7X A;  1LXE A;  1X1X A;  1GYB A;  2Y74 A;  3HII A;  4FMC A;  3G8Z A;  2STD A;  1W6C A;  5STD A;  3MWZ A;  3GAX A;  4R9K A;  4L7K A;  2CK3 H;  1BUJ A;  3B4P A;  3D79 A;  3EJV A;  5AII A;  2ZHX B;  4ILF A;  4BTY A;  3DGO A;  4HM7 B;  1IVX A;  2W9P A;  3F8H A;  4HM0 B;  2IY2 A;  5IG0 A;  1I3F A;  1O7M B;  3B8L A;  4L8O A;  1E3R A;  1W4N A;  5EVH A;  1JV2 B;  1JN5 B;  2BMR B;  1RGA A;  1M9G A;  2XSO B;  3OX9 A;  1B20 A;  1PFP A;  3PGB A;  4J9A A;  4RNT A;  3OXA A;  1VQK 3;  3NXJ A;  5ELJ A;  3KCH A;  1U5O A;  1ASK A;  3LTB A;  1GD3 A;  3I56 3;  5D83 A;  1YIJ 3;  4OUQ A;  5D82 A;  1T3B A;  2H0G A;  2WOH A;  2CX1 A;  3CU3 A;  1OHP A;  3E99 A;  1JN5 A;  1JZO A;  2CHC A;  1WMN A;  1Q42 A;  3I0Y A;  4ZM8 A;  1VQN 3;  2ML5 A;  1FUW A;  1I2F A;  4EC6 A;  1G96 A;  1TJD A;  4EV5 A;  2CFD A;  5CF2 A;  2I9W A;  4AEQ A;  3LXU X;  1FGM A;  2HMO B;  2K3D A;  5HOH A;  1OH0 A;  1TU5 A;  2WGQ A;  3DGN A;  1LOV A;  1QMA A;  1FGQ A;  1TRQ A;  3JUN A;  3KII A;  4LGQ A;  1RMS A;  3SLU A;  1BRH A;  1SJW A;  2YFL B;  2B24 B;  4CDL A;  1B21 A;  1I0X A;  1IU7 A;  3HIG A;  1LQM B;  2L4V A;  1RGE A;  3DGL A;  3FSD A;  3NBR A;  2SBL A;  1V57 A;  1BRS A;  2GEX A;  3GZR A;  2P0X A;  3UNL A;  1T2I A;  2OOV A;  4WYK B;  3LTD A;  1CEW I;  1JB4 A;  1JB5 A;  3NX0 A;  1TIJ A;  3NUV A;  4RZM A;  2BMO B;  1DVD A;  1LNI A;  3SOY A;  3QRD A;  1BNR A;  3CCJ 3;  1MWT A;  1O7N B;  3CCQ 3;  1S72 3;  1UI8 A;  4R4K A;  1IQX A;  4HM4 B;  1IT8 A;  2J8X B;  2XSH B;  3G0K A;  3O8Y A;  1O7P B;  1OAC A;  4CPK A;  4HM3 B;  1Q7Y 4;  4HM5 B;  1RGK A;  4XBX A;  2MC8 A;  2OTL 3;  1PYL A;  2GEY A;  4N6M A;  3KN4 A;  3MG1 A;  4GB5 A;  1RGL A;  5CLK A;  1D6U A;  3KE7 A;  9RNT A;  2QGU A;  4STD A;  1IDP A;  1W02 A;  1PU4 A;  2MF7 A;  3EN8 A;  4O8S A;  1O7G B;  1T5Y A;  2LQV A;  1B2M A;  1PY3 A;  1BNS A;  1MGW A;  3NQY A;  4XM4 A;  1FA3 A;  1VZZ A;  3PCR A;  1OF5 B;  5RNT A;  1IVW A;  1RTU A;  1KD1 4;  1C7H A;  1MGR A;  4XB5 A;  3BNE A;  3ECF A;  3X3Y A;  3L0R A;  1J2B A;  2BHM A;  1NU3 A;  1CQS A;  1GSP A;  1R4Y A;  5LC7 A;  3UL6 A;  1B2U A;  1LNH A;  1RN4 A;  4XDW A;  4L8P A;  1OF5 A;  3A76 A;  1D6Y A;  4NHF A;  1V74 A;  4BIR A;  1UGI A;  2W9Q A;  2PNC A;  2O9U X;  3UB1 A;  3ZG0 A;  2JDI H;  1X1W A;  4HKV B;  4JRF A;  1GS3 A;  4K1U A;  1JBR A;  4Q53 A;  1TUH A;  3H3H A;  2BMQ B;  4HZ9 B;  7GSP A;  1KQS 2;  4KT3 B;  4LMI A;  1IV7 A;  1BNI A;  1FZU A;  2CKF B;  3EB8 A;  2IA7 A;  2M7O A;  3NBJ A;  3J7Y d;  1YVB I;  1Z1S A;  1RN7 A;  1UI7 A;  2FNQ A;  3ROB A;  1N5P A;  1OHO A;  3KKG A;  4HAA A;  2QIY A;  4HM6 B;  4N3V A;  8RNT A;  2UUG C;  5BU4 A;  1JB2 A;  1A90 A;  3U1W A;  2CWU A;  1SIH A;  3CC4 3;  3KSE D;  3K5T A;  3KSP A;  4XBT A;  2C10 A;  3VSY A;  5IG3 A;  2OQE A;  2P05 A;  2F4Y A;  2GSP A;  1N9E A;  3X40 A;  1W2B 2;  1OGZ A;  2BU4 A;  1OGX A;  1LVN A;  1BVI A;  2F5W A;  2XGN A;  1KSI A;  5BXQ A;  2RBI A;  1SII A;  3LYG A;  4KFE A;  2IUJ A;  5BIR A;  1YGW A;  3DH2 A;  3WOF B;  3AMO A;  1DMQ A;  3D3L A;  1L5G B;  1RRL A;  3HOH A;  1GOY A;  4GSP A;  4KFD A;  1M1K 4;  1GMR A;  2ZL8 A;  1WTH A;  1FUS A;  4HJL B;  2K0M A;  4J5K A;  3Q90 A;  1M90 4;  3D9R A;  3EN1 B;  7RNT A;  1U8C B;  1KC8 4;  1YJN 3;  3U97 A;  1IQ8 A;  2QEX 3;  1EUI C;  1LRA A;  3OWU A;  1W5Z A;  1V58 A;  2CFG A;  3F40 A;  5IEO A;  2IUK A;  3Q1C A;  1HYF A;  2IMJ A;  1LQG C;  1UUV B;  1K41 A;  2QA4 3;  1WMO A;  1AQZ A;  4IT7 A;  1BRJ A;  1RCK A;  3N54 B;  4LSO A;  4O2H A;  4HBR A;  1RGF A;  4N6T A;  3DZL A;  3AHW A;  1BRI A;  3FF0 A;  1IYY A;  1O7W B;  3K0Z A;  4N6N B;  3S29 A;  5IF6 A;  1BAN A;  3BND A;  5CXO A;  1K9M 4;  3IJE B;  1W6Y A;  5G1K A;  3EQQ B;  3AGN A;  3SED A;  4FMA A;  4WHA A;  1RCL A;  2GXF A;  1O7H B;  4OK0 A;  3GZX B;  1I2E A;  3F14 A;  3D4A A;  3OV4 A;  2GU3 A;  5HGR A;  5IEN A;  4NRE A;  1BRK A;  4BL3 A;  3CME 3;  1TFK A;  5AI1 A;  4N6L A;  4EV2 A;  3LML A;  5CK6 A;  3AGO A;  3NQZ A;  2RFR A;  4LZI A;  4U13 A;  4EW5 A;  1A2K A;  3SOA A;  1SPU A;  2F98 A;  2W03 A;  3BNC A;  4EBG A;  3T8U A;  1IVU A;  3MKI A;  1W7C A;  1Q82 4;  3SX1 A;  3B7C A;  3UL5 A;  1UCK A;  4K61 A;  1UW1 A;  3BB9 A;  3HI7 A;  1NO3 A;  1BOX A;  3S28 A;  2CH9 A;  3SVA A;  3WA2 X;  2D1W A;  2F99 A;  1FGR A;  2XFS A;  1B2S A;  1OUN A;  3DY5 A;  3FG1 A;  3JUM A;  3T0U A;  6STD A;  3RGR A;  1SQW A;  4RBN A;  1JBT A;  2KRT A;  4RNZ A;  1DMN A;  2XF3 A;  3FF2 A;  1VQ7 3;  1D6Z A;  2CFL A;  1I0V A;  1VQQ A;  1N8Q A;  1YNV X;  4QWT A;  1UUW B;  2UGI A;  2C4B A;  1CH0 A;  1VQO 3;  2PZV A;  5JBS A;  2AAD A;  1RHL A;  3NM7 A;  1ROA A;  1MWR A;  4K90 B;  3LH4 A;  5BVB A;  1BU4 A;  1UCI A;  1GMP A;  2GBX B;  3BNB A;  1DYU A;  2H0H A;  4MJD A;  1T2H A;  3CNM A;  3K63 A;  4KZ1 A;  1Y4K A;  2R4I A;  1AVL A;  2RCD A;  4MMY B;  1Q81 4;  4K1V A;  3CPO A;  1AV4 A;  1US1 A;  1GY5 A;  3WDG B;  5AYR B;  1MWU A;  4HZB B;  5DRE A;  3WR2 A;  1WMP A;  1JRQ A;  3N8B A;  1BNG A;  4WP5 A;  3CXC 2;  5IG4 A;  1RSN A;  4FMB A;  3S67 A;  2YX9 A;  1BSA A;  3JUO A;  4R9L A;  3M8C A;  4WWU C;  2CX0 A;  4TX4 A;  2CFK A;  2XFT A;  2SAR A;  3X41 A;  3UJM A;  3URP A;  5M18 A;  3PCS A;  4GL6 A;  3MYT A;  2E2U A;  4I4K A;  2Z77 A;  3NBB A;  2BIR A;  2WO0 A;  3WOD G;  4XBY A;  3TDG A;  5DRV A;  1FGT A;  3D5G A;  3FLJ A;  1BGS A;  3PZW A;  3CC7 3;  1QAF A;  2KCD A;  5IEP A;  2CG0 A;  2OCT A;  3PXM A;  2XRX B;  3G4S 3;  3KZT A;  1HKX A;  1LOY A;  4EYC A;  1R4C A;  4LEH A;  1JJ2 2;  1BUQ A;  1Q7H A;  1LOX A;  2HOH A;  3NM2 A;  1ZS7 A;  3LOY A;  3CCL 3;  4N6V 0;  5A0O B;  1IK3 A;  4HM2 B;  4HOH A;  3BU4 A;  3EC9 A;  1UGH I;  1GMQ A;  3JUQ A;  2L1S A;  3SXX A;  2KF5 A;  4CCV A;  1QJG A;  1DMM A;  3T8N A;  3AMO B;  3WOE B;  3G71 3;  1BNJ A;  1K28 A;  3CCU 3;  3EE1 A;  3MG3 A;  2HMJ B;  4HM8 B;  2XEP A;  4IIA A;  4N6U A;  2E2V A;  2KXG A;  1STD A;  2HML B;  3FG3 A;  1WNH A;  1OCV A;  2P0M A;  1B3S A;  1EQK A;  3AHS A;  4HM1 B;  2P09 A;  3EX9 A;  2C11 A;  2OOV C;  3EBY A;  3STD A;  5I97 A;  3DGM A;  3F8X A;  3MPH A;  1Q9E A;  5IER A;  1JBS A;  3GZY B;  1DET A;  1RGC A;  4DKI A;  1RRH A;  2B1X B;  2KF4 A;  5AEW B;  5EEO A;  1YJ9 3;  5FW5 A;  3RGA A;  2Q07 A;  3LTC A;  2HMN B;  1W2Z A;  4XDV A;  1ZO2 A;  1UDI I;  4FR9 A;  3G16 A;  1BNE A;  2Z6B A;  4MMZ B;  1YJW 3;  4ORL A;  2F5M A;  1QAL A;  3FCS B;  4CJN A;  2ZDJ A;  2WOF A;  1RDS A;  1VQ6 3;  5FGO A;  2H0I A;  3D5I A;  3X3Z A;  1C54 A;  1RGG A;  1TRP A;  3VGN A;  3V99 A;  1K8A 4;  1M1X B;  1OHS A;  3F7S A;  1UCJ A;  4O02 B;  4KVH A;  4FMD A;  2RGQ A;  3I55 3;  3BIR A;  1X1Y A;  1JKG A;  1NJI 4;  2FGT A;  1I70 A;  4HVN A;  4BTX A;  1BSE A;  2W2C A;  2BNG A;  2INX A;  5LC6 A;  2UX0 A;  3V92 A;  3ZFZ A;  3OW2 2;  1A67 A;  3FH1 A;  1BSC A;  2CC3 A;  3DGY A;  4I5Q A;  2CIU A;  3JUP A;  3CCM 3;  1BSD A;  4J8T A;  3S5C A;  1F8N A;  1IVV A;  3GSP A;  3DMC A;  3A5E A;  3DXO A;  5AEU B;  1GY7 A;  1GY6 A;  1FW7 A;  3OWY A;  2KF6 A;  1AY7 A;  1Q40 B;  1UCL A;  1ROV A;  2ZA4 A;  3GWR A;  5ELU A;  3CCS 3;  3V98 A;  3HK4 A;  1HU9 A;  1ISK A;  1QAK A;  3FZW A;  3OWS A;  2CFW A;  5KP3 A;  5AIH A;  1W01 A;  4N6O B;  1FUT A;  1VQ8 3;  1YGE A;  1MNL A;  4X2O A;  1MWS A;  2YFI B;  1Q40 A;  3S27 A;  1I8V A;  1STF I;  1S5A A;  1WQL B;  1ZX2 A;  1VQ4 3;  2JQ5 A;  3LZA A;  3DM8 A;  4H61 A;  1B27 A;  4R80 A;  4BU4 A;  1LOW A;  2IYJ A;  3WA3 A;  3G6E 3;  1BRG A;  5D81 A;  2OQE C;  3K9M C;  4H3U A;  1NDO B;  4MMX B;  2CG1 A;  1RNT A;  3JVC A;  1A2P A;  1EG9 B;  1CYU A;  1ULI B;  1I2G A;  1RGH A;  4WFO A;  2V1L A;  3LT8 A;  1QVG 2;  1ZGX A;  1RLS A;  2K54 A;  4FCJ A;  3HZP A;  4OVM A;  1A2V A;  5M1A A;  1B2Z A;  4G1M B;  2GU1 A;  3RNT A;  1VQM 3;  4MEI A;  4O3V A;  1AVK A;  3FKA A;  1NNV A;  3PS8 A;  4IPB A;  1UUG B;  1BNF A;  1DE3 A;  3ZG5 A;  2BO9 B;  5KP4 A;  3CPW 2;  3DUK A;  1RNB A;  4JF8 A;  2KF3 A;  2XH9 A;  1NB3 I;  4HYZ A;  2LYX A;  3CNX A;  3MHE A;  4GHO A;  2YFJ B;  4PEJ A;  1FGO A;  1K73 4;  4WYK A;  1YHQ 3;  1CYV A;  1EA2 A;  3X42 A;  4LYL B;  1EEJ A;  1TFO A;  1TTO A;  3WHO A;  1GOV A;  1VQL 3;  3CCE 3;  2O3O A;  2F86 B;  4FCZ A;  5EQL A;  1GD4 A;  2R41 A;  1YI2 3;  3NHX A;  1W6G A;  2W56 B;  3LT9 A;  6GSP A;  1E97 A;  3H51 A;  2OTJ 3;  3HX8 A;  5G1L A;  4J5G A;  1GOU A;  1KWI A;  2AAE A;  3VF1 A;  1G0T A;  1OPY A;  2XR8 B;  3Q2P A;  4R1K A;  1JNQ A;  4BTW A;  3CCR 3;  4X2H A;  1X1U A;  1BIR A;  3PYJ A;  5AIG A;  5GSP A;  5CF1 A;  3CC2 3;  2W56 A;  2XGL A;  3WMD A;  1AR0 A;  1FYS A;  2WGO A;  2CWV A;  3IPT A;  4FCM A;  3EF8 A;  4AKY A;  3CD6 3;  1EKM A;  2Z7A A; 
#chains in the Genus database with same CATH homology
 3Q3F A;  1BRK A;  2F5M A;  1RDS A;  3AGO A;  3D5I A;  1RGK A;  1C54 A;  1RGG A;  1TRP A;  1PYL A;  1UCJ A;  1RGL A;  9RNT A;  1BRN L;  1UCK A;  3BIR A;  1X1Y A;  1I70 A;  1B2M A;  1PY3 A;  2KAA A;  1BOX A;  1BSE A;  1HZ1 A;  3SYU A;  1BNS A;  2RNT A;  1MGW A;  1SAR A;  1B2S A;  1BSC A;  5RNT A;  3DGY A;  1RTU A;  1BSD A;  1JBT A;  1MGR A;  6RNT A;  1BAO A;  3GSP A;  1BSB A;  1R4Y A;  1GSP A;  3A5E A;  1I0V A;  1B2U A;  1RN4 A;  1YNV X;  1G02 A;  1I3I A;  1RN1 A;  2C4B A;  1CH0 A;  1FW7 A;  4BIR A;  2AAD A;  2KF6 A;  1AY7 A;  1RHL A;  1UCL A;  2ZA4 A;  1X1W A;  2F56 A;  1JBR A;  1BU4 A;  1UCI A;  1GMP A;  7GSP A;  1T2H A;  1YVS A;  1BNI A;  1FZU A;  1FUT A;  1B2X A;  1X1X A;  3WR2 A;  4HAA A;  1I8V A;  8RNT A;  5BU4 A;  1BNG A;  4BU4 A;  1B27 A;  1BUJ A;  1LOW A;  1RSN A;  1BSA A;  1BRG A;  1RNT A;  2F4Y A;  2GSP A;  2SAR A;  3URP A;  1A2P A;  2BU4 A;  2F5W A;  1I2G A;  1BVI A;  1I3F A;  1RGH A;  2RBI A;  5BIR A;  2BIR A;  1ZGX A;  1RLS A;  1YGW A;  1B2Z A;  3RNT A;  1RGA A;  3D5G A;  3DH2 A;  1B20 A;  1BGS A;  4RNT A;  3HOH A;  1GOY A;  4GSP A;  3KCH A;  1GMR A;  1BNF A;  1DE3 A;  1FUS A;  1LOY A;  1RNB A;  2KF3 A;  2HOH A;  4J5K A;  4GHO A;  4HOH A;  1I2F A;  7RNT A;  3BU4 A;  1GMQ A;  1LRA A;  2KF5 A;  5HOH A;  1HYF A;  1LOV A;  1BNJ A;  1TRQ A;  1TTO A;  1RMS A;  3WHO A;  1GOV A;  1BRH A;  1AQZ A;  1BRJ A;  1B21 A;  1I0X A;  1RCK A;  1B3S A;  1RGF A;  3AHS A;  3AHW A;  1BRI A;  1RGE A;  6GSP A;  1BRS A;  1JBS A;  4J5G A;  1Q9E A;  1T2I A;  1BAN A;  1GOU A;  1DET A;  1RGC A;  2AAE A;  2KF4 A;  1IYY A;  3AGN A;  1X1U A;  1BIR A;  1LNI A;  5GSP A;  1RCL A;  1BNR A;  1I2E A;  1FYS A;  3D4A A;  1BNE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...