1GY7A

N77y point mutant of s.cerevisiae ntf2
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
121
structure length
121
Chain Sequence
DFNTLAQNFTQFYYNQFDTDRSQLGNLYRNESMLTFETSQLQGAKDIVEKLVSLPFQKVQHRITTLDAQPASPYGDVLVMITGDLLIDEEQNPQRFSQVFHLIPDGNSYYVFNDIFRLNYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nuclear transport
molecule keywords NUCLEAR TRANSPORT FACTOR 2
publication title Structural Basis for the Interaction between Ntf2 and Nucleoporin Fxfg Repeats
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 31
structure length 121
sequence length 121
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1gy7A00
3B8LA 1ZO2A 3MKIA 1O7GB 5AIFA 2F99A 3WMDA 1SJWA 1TP6A 5D83A 3FZWA 5IG4A 1QMAA 2F98A 2B24B 5BVBA 1JKGA 1JKGB 4HM1B 2F86B 3F9SA 2XRXB 3MHEA 2BMOB 3CNXA 3JUOA 2Z77A 3G8ZA 4U13A 5D81A 1A2KA 3UNLA 1ULJB 4LMIA 5DREA 4FCMA 2HMNB 1EA2A 1OPYA 2PZVA 4XDVA 2GXFA 3GZXB 3B4OA 4J8TA 3EJVA 4X2HA 3FLJA 3JUNA 3EF8A 4PEJA 3GZYB 5JPUA 5IF6A 4RZMA 1WQLB 3M8CA 3S5CA 2B1XB 1C7HA 3DM8A 3BLZA 3ECFA 5KP1A 3OV4A 2HMLB 1E97A 3JUQA 3GZBA 2INXA 2HMMB 4HM3B 4KVHA 4OVMA 3F7SA 5AI1A 1OF5A 1Q42A 2STDA 3JUMA 3GRDA 2UX0A 2Z7AA 3SEDA 4XDWA 4MJDA 4XBXA 1OGXA 2HMKB 2RFRA 2R4IA 1QJGA 5STDA 4H3UA 2GBWB 4HZBB 3EN1B 3UJMA 1ASKA 2IMJA 3EQQB 3EHCA 1JN5A 1O7NB 1JN5B 8CHOA 1Q40A 3NV0A 5TGNA 3NV0B 5IG5A 2YFLB 1W00A 1OHSA 4XM4A 2QIYA 3CPOA 4K1VA 5IG3A 1W6YA 3BB9A 4X2OA 5KP3A 1OHOA 4ORLA 3B7CA 1GY7A 5IG0A 3MSOA 4HM7B 1U5OA 3DMCA 1DMNA 2GBXB 1CQSA 5BXQA 3LYGA 3GWRA 2GEYA 2XSOB 4R1KA 3DXOA 3F40A 1AR0A 1K41A 2HMJB 3FSDA 4XBYA 3FH1A 2XR8B 3F8HA 3GZRA 3NHXA 3NUVA 4LEHA 3OWUA 4HM2B 5G2GA 1E3RA 3MYTA 3SOAA 5AIHA 4HM4B 3SOYA 5IENA 2CKFB 3RGRA 1OHPA 4WP5A 2W2CA 1OF5B 3H3HA 2K54A 4L8OA 3MG1A 3Q90A 4R9LA 3G16A 2YFJB 5CXOA 2A15A 3NXJA 3OWYA 4L7KA 1E3VA 5FW5A 1DMQA 2HMOB 1O7HB 3DUKA 4HKVB 3DZLA 1NDOB 3LZAA 1GY5A 3KKGA 3FF0A 4HM5B 1O7WB 3H51A 1TUHA 1GS3A 3NM2A 1Q40B 3CU3A 1JB2A 1HKXA 1NU3A 1W01A 3E99A 3ROBA 1UUVB 3I0YA 3A76A 3VSYA 6STDA 3FF2A 3D9RA 4WYKA 5HGRA 5IERA 4R9KA 4WYKB 2RCDA 3EBYA 3F8XA 5CK6A 3HZPA 3NBRA 1O7MB 4N3VA 7STDA 1UUWB 1GY6A 4IIAA 3T8UA 4HVNA 3MG3A 2GEXA 1ISKA 4CDLA 4HM6B 3VGNA 2BNGA 5DRVA 3HK4A 3MG2A 1JB4A 3OXAA 4XB5A 1EG9B 4I4KA 1Z1SA 3RGAA 3EC9A 1OGZA 5CF2A 3FGYA 4HZ9B 5KP4A 3FKAA 3OX9A 2I9WA 1ZX2A 3KZTA 5AEWB 1S5AA 5AIGA 4OUQA 4LGQA 2YFIB 5IEPA 4WWUC 3CNMA 3STDA 2XSHB 3JUPA 4K1UA 5CLKA 3B4PA 1OH0A 4STDA 3EBTA 3F7XA 1IDPA 4HM8B 4XBTA 4J9AA 1OUNA 1NWWA 3KE7A 2BMQB 5D82A 5AIIA 4HJLB 5IEOA 2RGQA 3K7CA 5EVHA 3KSPA 2OWPA 4FCJA 1VZZA 3ER7A 3IPTA 4Q53A 3K0ZA 3EN8A 3F14A 1DMMA 4GB5A 2QGUA 4HM0B 5JPPA 3OWSA 1STDA 1GYBA 1W02A 1JB5A 1O7PB 5CF1A 5AEUB 2BMRB 3G0KA 3T8NA 3EX9A 1OCVA 2JQ5A 2CHCA 4L8PA 2Z76A 1BUQA 1ULIB 3HX8A
chains in the Genus database with same CATH superfamily
3OW22 3B8LA 4BTXA 3GAXA 1LOWA 3X42A 2CFDA 1ZO2A 3MKIA 5M18A 1NB5I 1O7GB 5AIFA 5AYRB 2CWUA 2F99A 4EW5A 1M1K4 3ALAA 3WMDA 1NO3A 1SJWA 1QVG2 4KFEA 5RNTA 1TP6A 2F5MA 5D83A 1UCLA 3FZWA 1GMQA 5IG4A 3PCRA 1RCKA 1YNVX 2P0MA 3DGLA 1QMAA 4MMZB 3A5EA 1UCKA 2F98A 1YJN3 2B24B 1AV4A 1YGWA 3SX1A 2GSPA 4BTWA 5BVBA 6RNTA 1IT8A 1LNIA 1JKGA 3BNCA 1RRLA 1UI7A 1YIJ3 1JKGB 4EV2A 1HYFA 2CFGA 1T2HA 3MWZA 4HM1B 2E2VA 2CX1A 2F86B 3F9SA 2XRXB 1SQWA 3MHEA 2BMOB 2IA7A 7RNTA 3WA2X 3UL5A 3BNDA 3CNXA 3JUOA 1M904 3NX0A 2Z77A 3N8BA 3J7Yd 3G8ZA 2AAEA 4U13A 1A2KA 5D81A 1IQ8A 3WODG 3VF1A 1BNSA 1W6GA 2KXGA 1Q7Y4 3KSED 1RRHA 2WOHA 3UNLA 1ULJB 4LMIA 5DREA 3ZFZA 2H0IA 5I97A 1GSPA 4FCMA 1BRSA 2HMNB 1EA2A 1IU7A 1B20A 2ZDJA 1RHLA 1OPYA 2PZVA 4XDVA 2GXFA 3GZXB 4NHFA 1IVWA 3B4OA 1BSEA 1Q7HA 2XFTA 2XF3A 1TFOA 4I5QA 1W5ZA 2IUJA 5BU4A 2E2TA 4J8TA 3LTBA 1C54A 3URPA 3EJVA 4X2HA 1LXEA 1FGOA 3NBJA 4KT3B 1RLSA 3FLJA 3JUNA 3EF8A 1EEJA 3D4AA 3N54B 3GZYB 4PEJA 5JPUA 1LOXA 3Q2PA 1WNHA 5IF6A 4RZMA 3CME3 4DKIA 4CCVA 1M1XB 1WQLB 1BRGA 1RMSA 1N9EA 2BHMA 3M8CA 2B1XB 3S5CA 1BVIA 2J8XB 2OTL3 4BIRA 1X1WA 3V98A 4EC6A 3BU4A 3HOHA 3LT9A 1C7HA 3IJEB 3DM8A 3BLZA 3DGYA 3ECFA 5KP1A 1IYYA 3OV4A 2CFLA 2HMLB 3D3LA 1G02A 3X3YA 2K3DA 1E97A 3JUQA 3GZBA 2INXA 2W0QA 1UGHI 4GL6A 1DE3A 1N5HA 1QAKA 2HMMB 2CWVA 1RGKA 2XGNA 4HM3B 4KVHA 2KF3A 1RGLA 1R4YA 1LQMB 4OVMA 1VQM3 3F7SA 5AI1A 3Q1CA 1BU4A 1MWTA 4K61A 6GSPA 1AY7A 1WTHA 4N6OB 3UL6A 1GOVA 2CW9A 3LT8A 1OF5A 1Q42A 1BANA 1T3BA 2STDA 1BNGA 3HI7A 3JUMA 3GRDA 4O2HA 2UX0A 2Z7AA 4R80A 3SEDA 1DYUA 1CEWI 3L0RA 4XDWA 1B2MA 3KFQC 2L1SA 4MJDA 4AKZA 2SBLA 4XBXA 1GD4A 1RGAA 1OGXA 2HMKB 1VQO3 1FUWA 2RFRA 2R4IA 3CCL3 1N8QA 1BNEA 2KCDA 1D6UA 2Z6BA 4RBNA 4FMBA 1DETA 1YGEA 5G1LA 1JV2B 1QJGA 4FCZA 1FUSA 3D5GA 5STDA 1IVVA 2P38A 4H3UA 2GBWB 4HZBB 3EN1B 1AVLA 1V57A 3UJMA 1RN1A 1ASKA 2IMJA 2WGQA 4EBGA 1TFKA 4TX4A 4BTYA 3EQQB 1ROVA 2BO9B 4H61A 3FG3A 1JZOA 3FG1A 3EHCA 1JN5A 3CMA3 1O7NB 1JN5B 2R41A 1Q9EA 2W56A 1I0XA 1F8NA 2W56B 4OK0A 1BSDA 2RNTA 1PFPA 4KFFA 1LOVA 8CHOA 3LTDA 1Q40A 4K90B 1BSAA 3TDGA 3WR2A 1X1YA 1MWUA 3NV0A 1PYLA 5EQLA 5TGNA 3NV0B 4WFOA 4FMAA 5IG5A 4HBRA 4HYZA 3NQZA 1V74A 1UI8A 2W9PA 1A90A 2YFLB 1RKYA 1GOUA 3CCS3 1W00A 3U97A 1OHSA 2ZL8A 4XM4A 2QIYA 3CPOA 3LOYA 2XEPA 4K1VA 1DVCA 1US1A 3DH2A 2GU1A 1RSNA 3AGOA 1T2IA 5IG3A 1W6YA 3BB9A 4X2OA 5KP3A 1IV7A 2MC8A 3CCE3 2LYXA 2XH9A 1OHOA 3DGOA 1UCIA 2OOVC 1UGIA 4ORLA 3B7CA 3CPW2 1GY7A 4RNYA 3MSOA 5IG0A 1BRIA 3LTCA 1IQYA 2CFWA 2PNCA 3T0UA 3UB1A 1VQ63 4HM7B 1M9GA 3SYUA 1IK3A 1U5OA 3KN4A 5AYSC 3DMCA 1DMNA 3CXC2 1VQ43 1CYVA 2OCTA 1NNVA 1UDII 2GBXB 1CQSA 2KF6A 4KFDA 5BXQA 3LTAA 2ZHXB 1MWRA 2CG0A 2C11A 3LYGA 4CPKA 1I8VA 1YHQ3 3CC43 3GWRA 1LRAA 2GEYA 4QWTA 2XSOB 4R1KA 3DXOA 1I2FA 3F40A 3CC23 1AR0A 1K41A 1D6YA 3CCJ3 1BRNL 2HMJB 3CCM3 3FSDA 1YJ93 3GSPA 4KZ1A 5ELJA 5LC7A 4XBYA 3BIRA 1CYUA 3FH1A 1K28A 2WGOA 1TIJA 2XR8B 3F8HA 2P09A 3GZRA 4ZM8A 3S28A 2FGTA 3EE1A 2M7OA 2CC3A 3AMOA 3NHXA 3X40A 3AMOB 1I2GA 3NUVA 1IQXA 7GSPA 1B27A 4LEHA 4N6LA 1EQKA 3HX8A 3U1WA 3OWUA 2E2UA 1GD3A 1LOYA 3QRDA 4HM2B 3BNBA 5G2GA 3G713 3CCQ3 2ZA4A 2ML5A 2CH9A 1E3RA 3MYTA 3SOAA 5AIHA 4HM4B 2Q07A 3SOYA 2L4VA 1B2ZA 5IENA 3DY5A 1GOYA 2CIUA 1J2BA 2CKFB 9RNTA 1L5GB 3RGRA 4J5KA 1WMNA 1I3IA 1OHPA 4WP5A 1MGWA 1RN4A 1OF5B 2W2CA 3H3HA 4BL2A 2K54A 1RNBA 1VQN3 1K8A4 1KSIA 2YX9A 1FZUA 3FG4A 4L8OA 3SVAA 1JZDA 3MG1A 4R4KA 1W7CA 2H0GA 3Q90A 4EXRA 4R9LA 3LMLA 3ZG0A 2QA43 1U8CB 3G16A 1N8R4 1PU4A 2D42A 2YFJB 1NB3I 5CXOA 2A15A 4IPBA 3NXJA 2RSXA 2QEX3 4EV5A 3OWYA 4L7KA 1TRPA 2ML6A 1E3VA 1TJDA 1TRQA 1DMQA 3PZWA 5FW5A 1W6CA 1JNQA 3N9HA 3EB8A 2HMOB 1O7HB 1YVSA 2MF7A 3DUKA 1VQ93 2CFKA 4HKVB 1R4CA 3DZLA 1MNLA 2KF5A 3WHOA 2F56A 1NDOB 1B21A 3LZAA 1GY5A 3KKGA 3FF0A 3HIIA 1RGEA 1N9JA 4BU4A 4HM5B 1FGMA 1BGSA 3NM7A 4NREA 3LH4A 1O7WB 2CK3H 1B2XA 1FUTA 1VQP3 2OQEC 3JVCA 1BRKA 4O3VA 3PS8A 3H51A 5GSPA 1TUHA 1A2VA 3S29A 5IW9A 3RDEA 2GU3A 1GS3A 3QK9A 3NM2A 1Q40B 3CU3A 1JB2A 5LC6A 1HKXA 1V58A 1NU3A 4MMXB 1W01A 2C4BA 3AHWA 3K9MC 3PYJA 5ELUA 1FGRA 3K5TA 1KWIA 1LQGC 3E99A 1IVXA 2W9QA 1ROAA 1MOLA 1SIIA 3ROBA 1UUVB 2IYJA 3A76A 3I0YA 4O02B 2CG1A 3VSYA 6STDA 3CC73 2AADA 1KC84 3FF2A 3D9RA 1LNHA 4N6MA 5M19A 4LSOA 4WYKA 5HGRA 5IERA 4R9KA 4WYKB 2W04A 2UUGC 1BSCA 1I2EA 2RCDA 1BUJA 3X41A 1EKMA 3EBYA 1JRQA 1UCJA 3O8YA 2IUKA 4AKYA 2RBIA 5M1AA 1FGQA 1VQ73 1YI23 3F8XA 5CK6A 3X3ZA 1RGFA 4N6TA 3DGMA 1S723 2LQVA 2W03A 3HZPA 1HZ1A 3NBRA 1O7MB 4N3VA 7STDA 1K734 4ILFA 1UUWB 4IT7A 3CCU3 1GY6A 3BNEA 3CCV3 2OTJ3 1TTOA 4IIAA 4LZIA 3T8UA 4HVNA 4RNTA 2V1LA 1Q864 1JJ22 3MG3A 2IY2A 4MEIA 3SXXA 3WOEB 2K0MA 2OOVA 2GEXA 2CWTA 4CJNA 3I553 1W2B2 1FA3A 1I70A 4HAAA 4GHOA 1RN7A 4CDLA 1ISKA 4HM6B 1IVUA 4JF8A 2XFSA 4FR9A 2F5WA 1MWSA 1Q814 3VGNA 3X3XA 2BNGA 1VQ53 1BSBA 1UUGB 2CX0A 5DRVA 1A67A 1GMRA 2H0HA 1W2ZA 3HK4A 3MG2A 2XGLA 1QVF2 1BOXA 3PGBA 1JB4A 1DVDA 1CH0A 1W4NA 2O3OA 2P05A 3OXAA 4XB5A 3I563 1EG9B 4J5GA 1RGGA 4I4KA 1Z1SA 3RGAA 3RNTA 2W6JH 3IMAB 1RDSA 3EC9A 1OGZA 4FMCA 1BNFA 4JRFA 3G6E3 1D6ZA 1SARA 3FGYA 3MPHA 4HZ9B 5CF2A 1SPUA 1IT7A 1PY3A 3FKAA 5EEOA 2Y74A 3OX9A 2I9WA 1ZX2A 1STFI 3KZTA 2P0XA 5AEWB 5FGOA 1BAOA 3PXMA 5A0OB 1RNTA 1S5AA 2KAAA 5AIGA 4OUQA 4LGQA 1B2UA 2YFIB 3FCSB 1I3FA 5G1KA 1VQ83 4NPBA 4AEQA 3G4S3 4MMYB 5IEPA 1N5PA 2O9UX 1IV9A 3AGNA 1KQS2 3K63A 3PCSA 3WA3A 1MGRA 3D5IA 1B3SA 4WWUC 2D1WA 1JBTA 1EUIC 2BU4A 3CNMA 3WDGB 1YJW3 3STDA 4G1MB 1LVNA 2XSHB 3JUPA 4K1UA 2C10A 1RCLA 1B2SA 1RJOA 1TU5A 1BNRA 1T5YA 5CLKA 3B4PA 1OH0A 1BRJA 3Q3FA 1BNJA 1GMPA 3DGNA 3EBTA 1IDPA 3F7XA 4STDA 3S67A 4HOHA 2BT3A 1HU9A 4HM8B 1NJI4 3NQYA 3KCHA 1JBRA 1A2PA 2WO0A 4XBTA 4WHAA 1G0TA 4J9AA 1UW1A 4N6V0 1VQQA 2WOFA 2FXTA 4N6UA 1OUNA 1NWWA 3KE7A 2BMQB 1RGHA 1JBSA 1I0VA 5D82A 4FMDA 5AIIA 3HIGA 4BL3A 4HJLB 1AQZA 1FGTA 5IEOA 2RGQA 2UGIA 5BIRA 2F4YA 2KF4A 3K7CA 3AHSA 5EVHA 1YVBI 3KSPA 1AVKA 2OWPA 4FCJA 3SLUA 1VZZA 1SIHA 2FNQA 2HOHA 3ER7A 3IPTA 4Q53A 3K0ZA 1KD14 8RNTA 4O8SA 3EN8A 3CD63 1BNIA 1RTUA 3KIIA 1X1XA 1ZGXA 3F14A 1K9M4 3NBBA 1DMMA 4N6NB 4GB5A 1G96A 3WOFB 1QALA 2QGUA 4HM0B 2Y73A 5JPPA 4LYLB 1ZS7A 3LXUX 3OWSA 1BRHA 1X1UA 1VQK3 5JBSA 1STDA 1GYBA 1W02A 1FYSA 1JB5A 5HOHA 2KRTA 1WMPA 2SARA 2OQEA 3CCR3 1BIRA 1O7PB 1FW7A 5CF1A 1RGCA 1YIT3 5AEUB 2BMRB 2BIRA 4EYCA 2JDIH 3D79A 1Y4KA 3G0KA 1WMOA 3ZG5A 1OACA 4RNZA 5KP4A 3V99A 3T8NA 1QAFA 1VQL3 1Q824 3EX9A 3S27A 1OCVA 2JQ5A 4GSPA 3V92A 4L8PA 2Z76A 1BUQA 1ULIB 2CHCA
chains in the Genus database with same CATH topology
3OW22 3B8LA 4BTXA 3GAXA 3X42A 2CFDA 1ZO2A 3MKIA 1NB5I 1O7GB 5AIFA 5AYRB 2CWUA 2F99A 1M1K4 3ALAA 3WMDA 1NO3A 1SJWA 1QVG2 4KFEA 1TP6A 5D83A 3FZWA 5IG4A 3PCRA 3DGLA 2P0MA 1QMAA 4MMZB 1YJN3 2F98A 2B24B 1AV4A 3SX1A 5BVBA 4BTWA 1IT8A 1JKGA 3BNCA 1RRLA 1UI7A 1YIJ3 1JKGB 4EV2A 2CFGA 3MWZA 4HM1B 2E2VA 2F86B 3F9SA 2XRXB 1SQWA 3MHEA 2BMOB 2IA7A 3WA2X 3UL5A 3BNDA 3CNXA 3JUOA 1M904 3NX0A 2Z77A 3N8BA 3J7Yd 3G8ZA 4U13A 5D81A 1A2KA 1IQ8A 3WODG 3VF1A 1W6GA 2KXGA 1Q7Y4 3KSED 1RRHA 2WOHA 3UNLA 1ULJB 4LMIA 5DREA 5I97A 4FCMA 2HMNB 1EA2A 1IU7A 2ZDJA 1OPYA 2PZVA 4XDVA 2GXFA 3GZXB 4NHFA 1IVWA 3B4OA 2XFTA 2XF3A 1TFOA 1W5ZA 2IUJA 2E2TA 4J8TA 3LTBA 3EJVA 4X2HA 1LXEA 1FGOA 3NBJA 3FLJA 3JUNA 3EF8A 3N54B 3GZYB 4PEJA 5JPUA 1LOXA 3Q2PA 1WNHA 5IF6A 4RZMA 3CME3 4CCVA 1M1XB 1WQLB 1N9EA 2BHMA 3M8CA 2B1XB 3S5CA 2OTL3 3V98A 4EC6A 3LT9A 1C7HA 3IJEB 3DM8A 3BLZA 3ECFA 5KP1A 3OV4A 2CFLA 2HMLB 3D3LA 3X3YA 1E97A 3JUQA 3GZBA 2INXA 2W0QA 4GL6A 1N5HA 1QAKA 2HMMB 2CWVA 4HM3B 2XGNA 4KVHA 1VQM3 4OVMA 3F7SA 5AI1A 3Q1CA 4K61A 1WTHA 4N6OB 3UL6A 2CW9A 3LT8A 1OF5A 1Q42A 2STDA 3HI7A 3JUMA 3GRDA 4O2HA 2UX0A 2Z7AA 4R80A 3SEDA 1DYUA 1CEWI 3L0RA 4XDWA 3KFQC 4MJDA 4AKZA 2SBLA 4XBXA 1GD4A 1OGXA 2HMKB 1VQO3 1FUWA 2RFRA 2R4IA 3CCL3 1N8QA 2KCDA 1D6UA 2Z6BA 4RBNA 4FMBA 1YGEA 1JV2B 1QJGA 4FCZA 5STDA 1IVVA 2P38A 4H3UA 2GBWB 4HZBB 3EN1B 1AVLA 3UJMA 1ASKA 2IMJA 2WGQA 4EBGA 1TFKA 4TX4A 4BTYA 3EQQB 1ROVA 2BO9B 4H61A 3FG3A 3FG1A 3EHCA 1JN5A 3CMA3 1O7NB 1JN5B 2W56A 1F8NA 2W56B 4OK0A 1PFPA 4KFFA 8CHOA 3LTDA 1Q40A 4K90B 3TDGA 3NV0A 5TGNA 5EQLA 3NV0B 4WFOA 4FMAA 5IG5A 4HBRA 4HYZA 3NQZA 1V74A 1UI8A 2W9PA 1A90A 2YFLB 1RKYA 3CCS3 1W00A 3U97A 1OHSA 2ZL8A 4XM4A 2QIYA 3CPOA 3LOYA 2XEPA 4K1VA 1DVCA 1US1A 2GU1A 5IG3A 1W6YA 3BB9A 4X2OA 5KP3A 1IV7A 2MC8A 3CCE3 2LYXA 2XH9A 1OHOA 3DGOA 2OOVC 4ORLA 3B7CA 3CPW2 1GY7A 4RNYA 3MSOA 5IG0A 3LTCA 2PNCA 1IQYA 2CFWA 3T0UA 3UB1A 1VQ63 4HM7B 1M9GA 1IK3A 1U5OA 3KN4A 5AYSC 3DMCA 1DMNA 3CXC2 1VQ43 1CYVA 2OCTA 2GBXB 1CQSA 4KFDA 5BXQA 3LTAA 2CG0A 2C11A 3LYGA 1YHQ3 3CC43 3GWRA 2GEYA 4QWTA 2XSOB 4R1KA 3DXOA 3F40A 3CC23 1AR0A 1K41A 1D6YA 3CCJ3 2HMJB 3CCM3 3FSDA 1YJ93 4KZ1A 5ELJA 5LC7A 4XBYA 1CYUA 3FH1A 1K28A 2WGOA 1TIJA 2XR8B 3F8HA 2P09A 3GZRA 4ZM8A 3S28A 2FGTA 3EE1A 2M7OA 2CC3A 3AMOA 3NHXA 3X40A 3AMOB 3NUVA 1IQXA 4LEHA 4N6LA 1EQKA 3HX8A 3U1WA 3OWUA 2E2UA 1GD3A 4HM2B 3QRDA 5G2GA 3BNBA 3G713 3CCQ3 2ML5A 2CH9A 1E3RA 3MYTA 3SOAA 5AIHA 4HM4B 2Q07A 3SOYA 2L4VA 5IENA 3DY5A 2CIUA 1J2BA 2CKFB 1L5GB 3RGRA 1WMNA 1OHPA 4WP5A 2W2CA 1OF5B 3H3HA 2K54A 1VQN3 1K8A4 1KSIA 2YX9A 4L8OA 3FG4A 3SVAA 3MG1A 4R4KA 1W7CA 3Q90A 4EXRA 2QA43 4R9LA 3LMLA 1U8CB 3G16A 1N8R4 1PU4A 2D42A 2YFJB 1NB3I 5CXOA 2A15A 4IPBA 3NXJA 2RSXA 2QEX3 4EV5A 3OWYA 4L7KA 2ML6A 1E3VA 3PZWA 5FW5A 1DMQA 1W6CA 1JNQA 3N9HA 3EB8A 2HMOB 1O7HB 2MF7A 3DUKA 1VQ93 2CFKA 4HKVB 1R4CA 3DZLA 1MNLA 1NDOB 3LZAA 1GY5A 3KKGA 3FF0A 3HIIA 1N9JA 4HM5B 1FGMA 3NM7A 4NREA 3LH4A 1O7WB 2CK3H 1VQP3 2OQEC 3JVCA 4O3VA 3PS8A 3H51A 1TUHA 1A2VA 3S29A 5IW9A 3RDEA 2GU3A 1GS3A 3QK9A 3NM2A 1Q40B 3CU3A 1JB2A 5LC6A 1HKXA 1NU3A 4MMXB 1W01A 3K9MC 3PYJA 5ELUA 1FGRA 3K5TA 1KWIA 3E99A 1IVXA 2W9QA 1ROAA 1MOLA 1SIIA 3ROBA 1UUVB 3I0YA 3A76A 4O02B 2CG1A 3VSYA 6STDA 3CC73 1KC84 3FF2A 3D9RA 1LNHA 4N6MA 4LSOA 4WYKA 5HGRA 5IERA 4R9KA 4WYKB 2W04A 2RCDA 3X41A 1EKMA 3EBYA 1JRQA 3O8YA 2IUKA 4AKYA 1VQ73 1FGQA 1YI23 3F8XA 5CK6A 3X3ZA 4N6TA 3DGMA 1S723 2LQVA 2W03A 3HZPA 3NBRA 1O7MB 4N3VA 7STDA 1K734 1UUWB 4IT7A 3CCU3 1GY6A 3BNEA 3CCV3 2OTJ3 4IIAA 4LZIA 3T8UA 4HVNA 2V1LA 1Q864 1JJ22 3MG3A 4MEIA 3SXXA 3WOEB 2K0MA 2OOVA 2GEXA 2CWTA 3I553 1W2B2 1FA3A 1ISKA 1RN7A 4CDLA 4HM6B 1IVUA 4JF8A 2XFSA 4FR9A 1Q814 3VGNA 3X3XA 2BNGA 1VQ53 5DRVA 1A67A 1W2ZA 3HK4A 3MG2A 2XGLA 1QVF2 3PGBA 1JB4A 1DVDA 3OXAA 1W4NA 2O3OA 2P05A 4XB5A 3I563 1EG9B 4I4KA 1Z1SA 3RGAA 2W6JH 3IMAB 3EC9A 4FMCA 1OGZA 4JRFA 3G6E3 1D6ZA 3MPHA 3FGYA 4HZ9B 5CF2A 5KP4A 1SPUA 1IT7A 3FKAA 5EEOA 2Y74A 3OX9A 2I9WA 1ZX2A 1STFI 3KZTA 2P0XA 5AEWB 5FGOA 3PXMA 5A0OB 1S5AA 5AIGA 4OUQA 4LGQA 2YFIB 3FCSB 1VQ83 4AEQA 3G4S3 4MMYB 5IEPA 1N5PA 2O9UX 1IV9A 1KQS2 3K63A 3PCSA 3WA3A 4WWUC 2D1WA 3CNMA 3WDGB 1YJW3 3STDA 4G1MB 1LVNA 2XSHB 3JUPA 4K1UA 2C10A 1TU5A 1RJOA 1T5YA 5CLKA 3B4PA 1OH0A 3DGNA 3EBTA 4STDA 3F7XA 1IDPA 3S67A 2BT3A 1HU9A 4HM8B 1NJI4 3NQYA 2WO0A 4XBTA 4WHAA 4J9AA 4N6V0 1UW1A 2WOFA 2FXTA 4N6UA 1OUNA 1NWWA 3KE7A 2BMQB 5D82A 4FMDA 5AIIA 3HIGA 4HJLB 1FGTA 5IEOA 2RGQA 3K7CA 5EVHA 1YVBI 3KSPA 1AVKA 2OWPA 4FCJA 3SLUA 1VZZA 1SIHA 2FNQA 3ER7A 3IPTA 4Q53A 3K0ZA 1KD14 4O8SA 3EN8A 3CD63 1K9M4 3KIIA 3F14A 3NBBA 1DMMA 4N6NB 4GB5A 1G96A 3WOFB 1QALA 2QGUA 4HM0B 2Y73A 5JPPA 3OWSA 3LXUX 1VQK3 5JBSA 1STDA 1GYBA 1W02A 1JB5A 2KRTA 1WMPA 3CCR3 2OQEA 1O7PB 5CF1A 1YIT3 5AEUB 2BMRB 4EYCA 2JDIH 1Y4KA 3G0KA 1WMOA 1OACA 4RNZA 3V99A 3T8NA 1QAFA 1VQL3 1Q824 3EX9A 3S27A 1OCVA 2JQ5A 3V92A 4L8PA 2Z76A 1BUQA 1ULIB 2CHCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B8L A;  1ZO2 A;  3MKI A;  1O7G B;  5AIF A;  2F99 A;  3WMD A;  1SJW A;  1TP6 A;  5D83 A;  3FZW A;  5IG4 A;  1QMA A;  2F98 A;  2B24 B;  5BVB A;  1JKG A;  1JKG B;  4HM1 B;  2F86 B;  3F9S A;  2XRX B;  3MHE A;  2BMO B;  3CNX A;  3JUO A;  2Z77 A;  3G8Z A;  4U13 A;  5D81 A;  1A2K A;  3UNL A;  1ULJ B;  4LMI A;  5DRE A;  4FCM A;  2HMN B;  1EA2 A;  1OPY A;  2PZV A;  4XDV A;  2GXF A;  3GZX B;  3B4O A;  4J8T A;  3EJV A;  4X2H A;  3FLJ A;  3JUN A;  3EF8 A;  4PEJ A;  3GZY B;  5JPU A;  5IF6 A;  4RZM A;  1WQL B;  3M8C A;  3S5C A;  2B1X B;  1C7H A;  3DM8 A;  3BLZ A;  3ECF A;  5KP1 A;  3OV4 A;  2HML B;  1E97 A;  3JUQ A;  3GZB A;  2INX A;  2HMM B;  4HM3 B;  4KVH A;  4OVM A;  3F7S A;  5AI1 A;  1OF5 A;  1Q42 A;  2STD A;  3JUM A;  3GRD A;  2UX0 A;  2Z7A A;  3SED A;  4XDW A;  4MJD A;  4XBX A;  1OGX A;  2HMK B;  2RFR A;  2R4I A;  1QJG A;  5STD A;  4H3U A;  2GBW B;  4HZB B;  3EN1 B;  3UJM A;  1ASK A;  2IMJ A;  3EQQ B;  3EHC A;  1JN5 A;  1O7N B;  1JN5 B;  8CHO A;  1Q40 A;  3NV0 A;  5TGN A;  3NV0 B;  5IG5 A;  2YFL B;  1W00 A;  1OHS A;  4XM4 A;  2QIY A;  3CPO A;  4K1V A;  5IG3 A;  1W6Y A;  3BB9 A;  4X2O A;  5KP3 A;  1OHO A;  4ORL A;  3B7C A;  1GY7 A;  5IG0 A;  3MSO A;  4HM7 B;  1U5O A;  3DMC A;  1DMN A;  2GBX B;  1CQS A;  5BXQ A;  3LYG A;  3GWR A;  2GEY A;  2XSO B;  4R1K A;  3DXO A;  3F40 A;  1AR0 A;  1K41 A;  2HMJ B;  3FSD A;  4XBY A;  3FH1 A;  2XR8 B;  3F8H A;  3GZR A;  3NHX A;  3NUV A;  4LEH A;  3OWU A;  4HM2 B;  5G2G A;  1E3R A;  3MYT A;  3SOA A;  5AIH A;  4HM4 B;  3SOY A;  5IEN A;  2CKF B;  3RGR A;  1OHP A;  4WP5 A;  2W2C A;  1OF5 B;  3H3H A;  2K54 A;  4L8O A;  3MG1 A;  3Q90 A;  4R9L A;  3G16 A;  2YFJ B;  5CXO A;  2A15 A;  3NXJ A;  3OWY A;  4L7K A;  1E3V A;  5FW5 A;  1DMQ A;  2HMO B;  1O7H B;  3DUK A;  4HKV B;  3DZL A;  1NDO B;  3LZA A;  1GY5 A;  3KKG A;  3FF0 A;  4HM5 B;  1O7W B;  3H51 A;  1TUH A;  1GS3 A;  3NM2 A;  1Q40 B;  3CU3 A;  1JB2 A;  1HKX A;  1NU3 A;  1W01 A;  3E99 A;  3ROB A;  1UUV B;  3I0Y A;  3A76 A;  3VSY A;  6STD A;  3FF2 A;  3D9R A;  4WYK A;  5HGR A;  5IER A;  4R9K A;  4WYK B;  2RCD A;  3EBY A;  3F8X A;  5CK6 A;  3HZP A;  3NBR A;  1O7M B;  4N3V A;  7STD A;  1UUW B;  1GY6 A;  4IIA A;  3T8U A;  4HVN A;  3MG3 A;  2GEX A;  1ISK A;  4CDL A;  4HM6 B;  3VGN A;  2BNG A;  5DRV A;  3HK4 A;  3MG2 A;  1JB4 A;  3OXA A;  4XB5 A;  1EG9 B;  4I4K A;  1Z1S A;  3RGA A;  3EC9 A;  1OGZ A;  5CF2 A;  3FGY A;  4HZ9 B;  5KP4 A;  3FKA A;  3OX9 A;  2I9W A;  1ZX2 A;  3KZT A;  5AEW B;  1S5A A;  5AIG A;  4OUQ A;  4LGQ A;  2YFI B;  5IEP A;  4WWU C;  3CNM A;  3STD A;  2XSH B;  3JUP A;  4K1U A;  5CLK A;  3B4P A;  1OH0 A;  4STD A;  3EBT A;  3F7X A;  1IDP A;  4HM8 B;  4XBT A;  4J9A A;  1OUN A;  1NWW A;  3KE7 A;  2BMQ B;  5D82 A;  5AII A;  4HJL B;  5IEO A;  2RGQ A;  3K7C A;  5EVH A;  3KSP A;  2OWP A;  4FCJ A;  1VZZ A;  3ER7 A;  3IPT A;  4Q53 A;  3K0Z A;  3EN8 A;  3F14 A;  1DMM A;  4GB5 A;  2QGU A;  4HM0 B;  5JPP A;  3OWS A;  1STD A;  1GYB A;  1W02 A;  1JB5 A;  1O7P B;  5CF1 A;  5AEU B;  2BMR B;  3G0K A;  3T8N A;  3EX9 A;  1OCV A;  2JQ5 A;  2CHC A;  4L8P A;  2Z76 A;  1BUQ A;  1ULI B;  3HX8 A; 
#chains in the Genus database with same CATH topology
 3OW2 2;  3B8L A;  4BTX A;  3GAX A;  1LOW A;  3X42 A;  2CFD A;  1ZO2 A;  3MKI A;  5M18 A;  1NB5 I;  1O7G B;  5AIF A;  5AYR B;  2CWU A;  2F99 A;  4EW5 A;  1M1K 4;  3ALA A;  3WMD A;  1NO3 A;  1SJW A;  1QVG 2;  4KFE A;  5RNT A;  1TP6 A;  2F5M A;  5D83 A;  1UCL A;  3FZW A;  1GMQ A;  5IG4 A;  3PCR A;  1RCK A;  1YNV X;  2P0M A;  3DGL A;  1QMA A;  4MMZ B;  3A5E A;  1UCK A;  2F98 A;  1YJN 3;  2B24 B;  1AV4 A;  1YGW A;  3SX1 A;  2GSP A;  4BTW A;  5BVB A;  6RNT A;  1IT8 A;  1LNI A;  1JKG A;  3BNC A;  1RRL A;  1UI7 A;  1YIJ 3;  1JKG B;  4EV2 A;  1HYF A;  2CFG A;  1T2H A;  3MWZ A;  4HM1 B;  2E2V A;  2CX1 A;  2F86 B;  3F9S A;  2XRX B;  1SQW A;  3MHE A;  2BMO B;  2IA7 A;  7RNT A;  3WA2 X;  3UL5 A;  3BND A;  3CNX A;  3JUO A;  1M90 4;  3NX0 A;  2Z77 A;  3N8B A;  3J7Y d;  3G8Z A;  2AAE A;  4U13 A;  1A2K A;  5D81 A;  1IQ8 A;  3WOD G;  3VF1 A;  1BNS A;  1W6G A;  2KXG A;  1Q7Y 4;  3KSE D;  1RRH A;  2WOH A;  3UNL A;  1ULJ B;  4LMI A;  5DRE A;  3ZFZ A;  2H0I A;  5I97 A;  1GSP A;  4FCM A;  1BRS A;  2HMN B;  1EA2 A;  1IU7 A;  1B20 A;  2ZDJ A;  1RHL A;  1OPY A;  2PZV A;  4XDV A;  2GXF A;  3GZX B;  4NHF A;  1IVW A;  3B4O A;  1BSE A;  1Q7H A;  2XFT A;  2XF3 A;  1TFO A;  4I5Q A;  1W5Z A;  2IUJ A;  5BU4 A;  2E2T A;  4J8T A;  3LTB A;  1C54 A;  3URP A;  3EJV A;  4X2H A;  1LXE A;  1FGO A;  3NBJ A;  4KT3 B;  1RLS A;  3FLJ A;  3JUN A;  3EF8 A;  1EEJ A;  3D4A A;  3N54 B;  3GZY B;  4PEJ A;  5JPU A;  1LOX A;  3Q2P A;  1WNH A;  5IF6 A;  4RZM A;  3CME 3;  4DKI A;  4CCV A;  1M1X B;  1WQL B;  1BRG A;  1RMS A;  1N9E A;  2BHM A;  3M8C A;  2B1X B;  3S5C A;  1BVI A;  2J8X B;  2OTL 3;  4BIR A;  1X1W A;  3V98 A;  4EC6 A;  3BU4 A;  3HOH A;  3LT9 A;  1C7H A;  3IJE B;  3DM8 A;  3BLZ A;  3DGY A;  3ECF A;  5KP1 A;  1IYY A;  3OV4 A;  2CFL A;  2HML B;  3D3L A;  1G02 A;  3X3Y A;  2K3D A;  1E97 A;  3JUQ A;  3GZB A;  2INX A;  2W0Q A;  1UGH I;  4GL6 A;  1DE3 A;  1N5H A;  1QAK A;  2HMM B;  2CWV A;  1RGK A;  2XGN A;  4HM3 B;  4KVH A;  2KF3 A;  1RGL A;  1R4Y A;  1LQM B;  4OVM A;  1VQM 3;  3F7S A;  5AI1 A;  3Q1C A;  1BU4 A;  1MWT A;  4K61 A;  6GSP A;  1AY7 A;  1WTH A;  4N6O B;  3UL6 A;  1GOV A;  2CW9 A;  3LT8 A;  1OF5 A;  1Q42 A;  1BAN A;  1T3B A;  2STD A;  1BNG A;  3HI7 A;  3JUM A;  3GRD A;  4O2H A;  2UX0 A;  2Z7A A;  4R80 A;  3SED A;  1DYU A;  1CEW I;  3L0R A;  4XDW A;  1B2M A;  3KFQ C;  2L1S A;  4MJD A;  4AKZ A;  2SBL A;  4XBX A;  1GD4 A;  1RGA A;  1OGX A;  2HMK B;  1VQO 3;  1FUW A;  2RFR A;  2R4I A;  3CCL 3;  1N8Q A;  1BNE A;  2KCD A;  1D6U A;  2Z6B A;  4RBN A;  4FMB A;  1DET A;  1YGE A;  5G1L A;  1JV2 B;  1QJG A;  4FCZ A;  1FUS A;  3D5G A;  5STD A;  1IVV A;  2P38 A;  4H3U A;  2GBW B;  4HZB B;  3EN1 B;  1AVL A;  1V57 A;  3UJM A;  1RN1 A;  1ASK A;  2IMJ A;  2WGQ A;  4EBG A;  1TFK A;  4TX4 A;  4BTY A;  3EQQ B;  1ROV A;  2BO9 B;  4H61 A;  3FG3 A;  1JZO A;  3FG1 A;  3EHC A;  1JN5 A;  3CMA 3;  1O7N B;  1JN5 B;  2R41 A;  1Q9E A;  2W56 A;  1I0X A;  1F8N A;  2W56 B;  4OK0 A;  1BSD A;  2RNT A;  1PFP A;  4KFF A;  1LOV A;  8CHO A;  3LTD A;  1Q40 A;  4K90 B;  1BSA A;  3TDG A;  3WR2 A;  1X1Y A;  1MWU A;  3NV0 A;  1PYL A;  5EQL A;  5TGN A;  3NV0 B;  4WFO A;  4FMA A;  5IG5 A;  4HBR A;  4HYZ A;  3NQZ A;  1V74 A;  1UI8 A;  2W9P A;  1A90 A;  2YFL B;  1RKY A;  1GOU A;  3CCS 3;  1W00 A;  3U97 A;  1OHS A;  2ZL8 A;  4XM4 A;  2QIY A;  3CPO A;  3LOY A;  2XEP A;  4K1V A;  1DVC A;  1US1 A;  3DH2 A;  2GU1 A;  1RSN A;  3AGO A;  1T2I A;  5IG3 A;  1W6Y A;  3BB9 A;  4X2O A;  5KP3 A;  1IV7 A;  2MC8 A;  3CCE 3;  2LYX A;  2XH9 A;  1OHO A;  3DGO A;  1UCI A;  2OOV C;  1UGI A;  4ORL A;  3B7C A;  3CPW 2;  1GY7 A;  4RNY A;  3MSO A;  5IG0 A;  1BRI A;  3LTC A;  1IQY A;  2CFW A;  2PNC A;  3T0U A;  3UB1 A;  1VQ6 3;  4HM7 B;  1M9G A;  3SYU A;  1IK3 A;  1U5O A;  3KN4 A;  5AYS C;  3DMC A;  1DMN A;  3CXC 2;  1VQ4 3;  1CYV A;  2OCT A;  1NNV A;  1UDI I;  2GBX B;  1CQS A;  2KF6 A;  4KFD A;  5BXQ A;  3LTA A;  2ZHX B;  1MWR A;  2CG0 A;  2C11 A;  3LYG A;  4CPK A;  1I8V A;  1YHQ 3;  3CC4 3;  3GWR A;  1LRA A;  2GEY A;  4QWT A;  2XSO B;  4R1K A;  3DXO A;  1I2F A;  3F40 A;  3CC2 3;  1AR0 A;  1K41 A;  1D6Y A;  3CCJ 3;  1BRN L;  2HMJ B;  3CCM 3;  3FSD A;  1YJ9 3;  3GSP A;  4KZ1 A;  5ELJ A;  5LC7 A;  4XBY A;  3BIR A;  1CYU A;  3FH1 A;  1K28 A;  2WGO A;  1TIJ A;  2XR8 B;  3F8H A;  2P09 A;  3GZR A;  4ZM8 A;  3S28 A;  2FGT A;  3EE1 A;  2M7O A;  2CC3 A;  3AMO A;  3NHX A;  3X40 A;  3AMO B;  1I2G A;  3NUV A;  1IQX A;  7GSP A;  1B27 A;  4LEH A;  4N6L A;  1EQK A;  3HX8 A;  3U1W A;  3OWU A;  2E2U A;  1GD3 A;  1LOY A;  3QRD A;  4HM2 B;  3BNB A;  5G2G A;  3G71 3;  3CCQ 3;  2ZA4 A;  2ML5 A;  2CH9 A;  1E3R A;  3MYT A;  3SOA A;  5AIH A;  4HM4 B;  2Q07 A;  3SOY A;  2L4V A;  1B2Z A;  5IEN A;  3DY5 A;  1GOY A;  2CIU A;  1J2B A;  2CKF B;  9RNT A;  1L5G B;  3RGR A;  4J5K A;  1WMN A;  1I3I A;  1OHP A;  4WP5 A;  1MGW A;  1RN4 A;  1OF5 B;  2W2C A;  3H3H A;  4BL2 A;  2K54 A;  1RNB A;  1VQN 3;  1K8A 4;  1KSI A;  2YX9 A;  1FZU A;  3FG4 A;  4L8O A;  3SVA A;  1JZD A;  3MG1 A;  4R4K A;  1W7C A;  2H0G A;  3Q90 A;  4EXR A;  4R9L A;  3LML A;  3ZG0 A;  2QA4 3;  1U8C B;  3G16 A;  1N8R 4;  1PU4 A;  2D42 A;  2YFJ B;  1NB3 I;  5CXO A;  2A15 A;  4IPB A;  3NXJ A;  2RSX A;  2QEX 3;  4EV5 A;  3OWY A;  4L7K A;  1TRP A;  2ML6 A;  1E3V A;  1TJD A;  1TRQ A;  1DMQ A;  3PZW A;  5FW5 A;  1W6C A;  1JNQ A;  3N9H A;  3EB8 A;  2HMO B;  1O7H B;  1YVS A;  2MF7 A;  3DUK A;  1VQ9 3;  2CFK A;  4HKV B;  1R4C A;  3DZL A;  1MNL A;  2KF5 A;  3WHO A;  2F56 A;  1NDO B;  1B21 A;  3LZA A;  1GY5 A;  3KKG A;  3FF0 A;  3HII A;  1RGE A;  1N9J A;  4BU4 A;  4HM5 B;  1FGM A;  1BGS A;  3NM7 A;  4NRE A;  3LH4 A;  1O7W B;  2CK3 H;  1B2X A;  1FUT A;  1VQP 3;  2OQE C;  3JVC A;  1BRK A;  4O3V A;  3PS8 A;  3H51 A;  5GSP A;  1TUH A;  1A2V A;  3S29 A;  5IW9 A;  3RDE A;  2GU3 A;  1GS3 A;  3QK9 A;  3NM2 A;  1Q40 B;  3CU3 A;  1JB2 A;  5LC6 A;  1HKX A;  1V58 A;  1NU3 A;  4MMX B;  1W01 A;  2C4B A;  3AHW A;  3K9M C;  3PYJ A;  5ELU A;  1FGR A;  3K5T A;  1KWI A;  1LQG C;  3E99 A;  1IVX A;  2W9Q A;  1ROA A;  1MOL A;  1SII A;  3ROB A;  1UUV B;  2IYJ A;  3A76 A;  3I0Y A;  4O02 B;  2CG1 A;  3VSY A;  6STD A;  3CC7 3;  2AAD A;  1KC8 4;  3FF2 A;  3D9R A;  1LNH A;  4N6M A;  5M19 A;  4LSO A;  4WYK A;  5HGR A;  5IER A;  4R9K A;  4WYK B;  2W04 A;  2UUG C;  1BSC A;  1I2E A;  2RCD A;  1BUJ A;  3X41 A;  1EKM A;  3EBY A;  1JRQ A;  1UCJ A;  3O8Y A;  2IUK A;  4AKY A;  2RBI A;  5M1A A;  1FGQ A;  1VQ7 3;  1YI2 3;  3F8X A;  5CK6 A;  3X3Z A;  1RGF A;  4N6T A;  3DGM A;  1S72 3;  2LQV A;  2W03 A;  3HZP A;  1HZ1 A;  3NBR A;  1O7M B;  4N3V A;  7STD A;  1K73 4;  4ILF A;  1UUW B;  4IT7 A;  3CCU 3;  1GY6 A;  3BNE A;  3CCV 3;  2OTJ 3;  1TTO A;  4IIA A;  4LZI A;  3T8U A;  4HVN A;  4RNT A;  2V1L A;  1Q86 4;  1JJ2 2;  3MG3 A;  2IY2 A;  4MEI A;  3SXX A;  3WOE B;  2K0M A;  2OOV A;  2GEX A;  2CWT A;  4CJN A;  3I55 3;  1W2B 2;  1FA3 A;  1I70 A;  4HAA A;  4GHO A;  1RN7 A;  4CDL A;  1ISK A;  4HM6 B;  1IVU A;  4JF8 A;  2XFS A;  4FR9 A;  2F5W A;  1MWS A;  1Q81 4;  3VGN A;  3X3X A;  2BNG A;  1VQ5 3;  1BSB A;  1UUG B;  2CX0 A;  5DRV A;  1A67 A;  1GMR A;  2H0H A;  1W2Z A;  3HK4 A;  3MG2 A;  2XGL A;  1QVF 2;  1BOX A;  3PGB A;  1JB4 A;  1DVD A;  1CH0 A;  1W4N A;  2O3O A;  2P05 A;  3OXA A;  4XB5 A;  3I56 3;  1EG9 B;  4J5G A;  1RGG A;  4I4K A;  1Z1S A;  3RGA A;  3RNT A;  2W6J H;  3IMA B;  1RDS A;  3EC9 A;  1OGZ A;  4FMC A;  1BNF A;  4JRF A;  3G6E 3;  1D6Z A;  1SAR A;  3FGY A;  3MPH A;  4HZ9 B;  5CF2 A;  1SPU A;  1IT7 A;  1PY3 A;  3FKA A;  5EEO A;  2Y74 A;  3OX9 A;  2I9W A;  1ZX2 A;  1STF I;  3KZT A;  2P0X A;  5AEW B;  5FGO A;  1BAO A;  3PXM A;  5A0O B;  1RNT A;  1S5A A;  2KAA A;  5AIG A;  4OUQ A;  4LGQ A;  1B2U A;  2YFI B;  3FCS B;  1I3F A;  5G1K A;  1VQ8 3;  4NPB A;  4AEQ A;  3G4S 3;  4MMY B;  5IEP A;  1N5P A;  2O9U X;  1IV9 A;  3AGN A;  1KQS 2;  3K63 A;  3PCS A;  3WA3 A;  1MGR A;  3D5I A;  1B3S A;  4WWU C;  2D1W A;  1JBT A;  1EUI C;  2BU4 A;  3CNM A;  3WDG B;  1YJW 3;  3STD A;  4G1M B;  1LVN A;  2XSH B;  3JUP A;  4K1U A;  2C10 A;  1RCL A;  1B2S A;  1RJO A;  1TU5 A;  1BNR A;  1T5Y A;  5CLK A;  3B4P A;  1OH0 A;  1BRJ A;  3Q3F A;  1BNJ A;  1GMP A;  3DGN A;  3EBT A;  1IDP A;  3F7X A;  4STD A;  3S67 A;  4HOH A;  2BT3 A;  1HU9 A;  4HM8 B;  1NJI 4;  3NQY A;  3KCH A;  1JBR A;  1A2P A;  2WO0 A;  4XBT A;  4WHA A;  1G0T A;  4J9A A;  1UW1 A;  4N6V 0;  1VQQ A;  2WOF A;  2FXT A;  4N6U A;  1OUN A;  1NWW A;  3KE7 A;  2BMQ B;  1RGH A;  1JBS A;  1I0V A;  5D82 A;  4FMD A;  5AII A;  3HIG A;  4BL3 A;  4HJL B;  1AQZ A;  1FGT A;  5IEO A;  2RGQ A;  2UGI A;  5BIR A;  2F4Y A;  2KF4 A;  3K7C A;  3AHS A;  5EVH A;  1YVB I;  3KSP A;  1AVK A;  2OWP A;  4FCJ A;  3SLU A;  1VZZ A;  1SIH A;  2FNQ A;  2HOH A;  3ER7 A;  3IPT A;  4Q53 A;  3K0Z A;  1KD1 4;  8RNT A;  4O8S A;  3EN8 A;  3CD6 3;  1BNI A;  1RTU A;  3KII A;  1X1X A;  1ZGX A;  3F14 A;  1K9M 4;  3NBB A;  1DMM A;  4N6N B;  4GB5 A;  1G96 A;  3WOF B;  1QAL A;  2QGU A;  4HM0 B;  2Y73 A;  5JPP A;  4LYL B;  1ZS7 A;  3LXU X;  3OWS A;  1BRH A;  1X1U A;  1VQK 3;  5JBS A;  1STD A;  1GYB A;  1W02 A;  1FYS A;  1JB5 A;  5HOH A;  2KRT A;  1WMP A;  2SAR A;  2OQE A;  3CCR 3;  1BIR A;  1O7P B;  1FW7 A;  5CF1 A;  1RGC A;  1YIT 3;  5AEU B;  2BMR B;  2BIR A;  4EYC A;  2JDI H;  3D79 A;  1Y4K A;  3G0K A;  1WMO A;  3ZG5 A;  1OAC A;  4RNZ A;  5KP4 A;  3V99 A;  3T8N A;  1QAF A;  1VQL 3;  1Q82 4;  3EX9 A;  3S27 A;  1OCV A;  2JQ5 A;  4GSP A;  3V92 A;  4L8P A;  2Z76 A;  1BUQ A;  1ULI B;  2CHC A; 
#chains in the Genus database with same CATH homology
 3OW2 2;  3B8L A;  4BTX A;  3GAX A;  3X42 A;  2CFD A;  1ZO2 A;  3MKI A;  1NB5 I;  1O7G B;  5AIF A;  5AYR B;  2CWU A;  2F99 A;  1M1K 4;  3ALA A;  3WMD A;  1NO3 A;  1SJW A;  1QVG 2;  4KFE A;  1TP6 A;  5D83 A;  3FZW A;  5IG4 A;  3PCR A;  3DGL A;  2P0M A;  1QMA A;  4MMZ B;  1YJN 3;  2F98 A;  2B24 B;  1AV4 A;  3SX1 A;  5BVB A;  4BTW A;  1IT8 A;  1JKG A;  3BNC A;  1RRL A;  1UI7 A;  1YIJ 3;  1JKG B;  4EV2 A;  2CFG A;  3MWZ A;  4HM1 B;  2E2V A;  2F86 B;  3F9S A;  2XRX B;  1SQW A;  3MHE A;  2BMO B;  2IA7 A;  3WA2 X;  3UL5 A;  3BND A;  3CNX A;  3JUO A;  1M90 4;  3NX0 A;  2Z77 A;  3N8B A;  3J7Y d;  3G8Z A;  4U13 A;  5D81 A;  1A2K A;  1IQ8 A;  3WOD G;  3VF1 A;  1W6G A;  2KXG A;  1Q7Y 4;  3KSE D;  1RRH A;  2WOH A;  3UNL A;  1ULJ B;  4LMI A;  5DRE A;  5I97 A;  4FCM A;  2HMN B;  1EA2 A;  1IU7 A;  2ZDJ A;  1OPY A;  2PZV A;  4XDV A;  2GXF A;  3GZX B;  4NHF A;  1IVW A;  3B4O A;  2XFT A;  2XF3 A;  1TFO A;  1W5Z A;  2IUJ A;  2E2T A;  4J8T A;  3LTB A;  3EJV A;  4X2H A;  1LXE A;  1FGO A;  3NBJ A;  3FLJ A;  3JUN A;  3EF8 A;  3N54 B;  3GZY B;  4PEJ A;  5JPU A;  1LOX A;  3Q2P A;  1WNH A;  5IF6 A;  4RZM A;  3CME 3;  4CCV A;  1M1X B;  1WQL B;  1N9E A;  2BHM A;  3M8C A;  2B1X B;  3S5C A;  2OTL 3;  3V98 A;  4EC6 A;  3LT9 A;  1C7H A;  3IJE B;  3DM8 A;  3BLZ A;  3ECF A;  5KP1 A;  3OV4 A;  2CFL A;  2HML B;  3D3L A;  3X3Y A;  1E97 A;  3JUQ A;  3GZB A;  2INX A;  2W0Q A;  4GL6 A;  1N5H A;  1QAK A;  2HMM B;  2CWV A;  4HM3 B;  2XGN A;  4KVH A;  1VQM 3;  4OVM A;  3F7S A;  5AI1 A;  3Q1C A;  4K61 A;  1WTH A;  4N6O B;  3UL6 A;  2CW9 A;  3LT8 A;  1OF5 A;  1Q42 A;  2STD A;  3HI7 A;  3JUM A;  3GRD A;  4O2H A;  2UX0 A;  2Z7A A;  4R80 A;  3SED A;  1DYU A;  1CEW I;  3L0R A;  4XDW A;  3KFQ C;  4MJD A;  4AKZ A;  2SBL A;  4XBX A;  1GD4 A;  1OGX A;  2HMK B;  1VQO 3;  1FUW A;  2RFR A;  2R4I A;  3CCL 3;  1N8Q A;  2KCD A;  1D6U A;  2Z6B A;  4RBN A;  4FMB A;  1YGE A;  1JV2 B;  1QJG A;  4FCZ A;  5STD A;  1IVV A;  2P38 A;  4H3U A;  2GBW B;  4HZB B;  3EN1 B;  1AVL A;  3UJM A;  1ASK A;  2IMJ A;  2WGQ A;  4EBG A;  1TFK A;  4TX4 A;  4BTY A;  3EQQ B;  1ROV A;  2BO9 B;  4H61 A;  3FG3 A;  3FG1 A;  3EHC A;  1JN5 A;  3CMA 3;  1O7N B;  1JN5 B;  2W56 A;  1F8N A;  2W56 B;  4OK0 A;  1PFP A;  4KFF A;  8CHO A;  3LTD A;  1Q40 A;  4K90 B;  3TDG A;  3NV0 A;  5TGN A;  5EQL A;  3NV0 B;  4WFO A;  4FMA A;  5IG5 A;  4HBR A;  4HYZ A;  3NQZ A;  1V74 A;  1UI8 A;  2W9P A;  1A90 A;  2YFL B;  1RKY A;  3CCS 3;  1W00 A;  3U97 A;  1OHS A;  2ZL8 A;  4XM4 A;  2QIY A;  3CPO A;  3LOY A;  2XEP A;  4K1V A;  1DVC A;  1US1 A;  2GU1 A;  5IG3 A;  1W6Y A;  3BB9 A;  4X2O A;  5KP3 A;  1IV7 A;  2MC8 A;  3CCE 3;  2LYX A;  2XH9 A;  1OHO A;  3DGO A;  2OOV C;  4ORL A;  3B7C A;  3CPW 2;  1GY7 A;  4RNY A;  3MSO A;  5IG0 A;  3LTC A;  2PNC A;  1IQY A;  2CFW A;  3T0U A;  3UB1 A;  1VQ6 3;  4HM7 B;  1M9G A;  1IK3 A;  1U5O A;  3KN4 A;  5AYS C;  3DMC A;  1DMN A;  3CXC 2;  1VQ4 3;  1CYV A;  2OCT A;  2GBX B;  1CQS A;  4KFD A;  5BXQ A;  3LTA A;  2CG0 A;  2C11 A;  3LYG A;  1YHQ 3;  3CC4 3;  3GWR A;  2GEY A;  4QWT A;  2XSO B;  4R1K A;  3DXO A;  3F40 A;  3CC2 3;  1AR0 A;  1K41 A;  1D6Y A;  3CCJ 3;  2HMJ B;  3CCM 3;  3FSD A;  1YJ9 3;  4KZ1 A;  5ELJ A;  5LC7 A;  4XBY A;  1CYU A;  3FH1 A;  1K28 A;  2WGO A;  1TIJ A;  2XR8 B;  3F8H A;  2P09 A;  3GZR A;  4ZM8 A;  3S28 A;  2FGT A;  3EE1 A;  2M7O A;  2CC3 A;  3AMO A;  3NHX A;  3X40 A;  3AMO B;  3NUV A;  1IQX A;  4LEH A;  4N6L A;  1EQK A;  3HX8 A;  3U1W A;  3OWU A;  2E2U A;  1GD3 A;  4HM2 B;  3QRD A;  5G2G A;  3BNB A;  3G71 3;  3CCQ 3;  2ML5 A;  2CH9 A;  1E3R A;  3MYT A;  3SOA A;  5AIH A;  4HM4 B;  2Q07 A;  3SOY A;  2L4V A;  5IEN A;  3DY5 A;  2CIU A;  1J2B A;  2CKF B;  1L5G B;  3RGR A;  1WMN A;  1OHP A;  4WP5 A;  2W2C A;  1OF5 B;  3H3H A;  2K54 A;  1VQN 3;  1K8A 4;  1KSI A;  2YX9 A;  4L8O A;  3FG4 A;  3SVA A;  3MG1 A;  4R4K A;  1W7C A;  3Q90 A;  4EXR A;  2QA4 3;  4R9L A;  3LML A;  1U8C B;  3G16 A;  1N8R 4;  1PU4 A;  2D42 A;  2YFJ B;  1NB3 I;  5CXO A;  2A15 A;  4IPB A;  3NXJ A;  2RSX A;  2QEX 3;  4EV5 A;  3OWY A;  4L7K A;  2ML6 A;  1E3V A;  3PZW A;  5FW5 A;  1DMQ A;  1W6C A;  1JNQ A;  3N9H A;  3EB8 A;  2HMO B;  1O7H B;  2MF7 A;  3DUK A;  1VQ9 3;  2CFK A;  4HKV B;  1R4C A;  3DZL A;  1MNL A;  1NDO B;  3LZA A;  1GY5 A;  3KKG A;  3FF0 A;  3HII A;  1N9J A;  4HM5 B;  1FGM A;  3NM7 A;  4NRE A;  3LH4 A;  1O7W B;  2CK3 H;  1VQP 3;  2OQE C;  3JVC A;  4O3V A;  3PS8 A;  3H51 A;  1TUH A;  1A2V A;  3S29 A;  5IW9 A;  3RDE A;  2GU3 A;  1GS3 A;  3QK9 A;  3NM2 A;  1Q40 B;  3CU3 A;  1JB2 A;  5LC6 A;  1HKX A;  1NU3 A;  4MMX B;  1W01 A;  3K9M C;  3PYJ A;  5ELU A;  1FGR A;  3K5T A;  1KWI A;  3E99 A;  1IVX A;  2W9Q A;  1ROA A;  1MOL A;  1SII A;  3ROB A;  1UUV B;  3I0Y A;  3A76 A;  4O02 B;  2CG1 A;  3VSY A;  6STD A;  3CC7 3;  1KC8 4;  3FF2 A;  3D9R A;  1LNH A;  4N6M A;  4LSO A;  4WYK A;  5HGR A;  5IER A;  4R9K A;  4WYK B;  2W04 A;  2RCD A;  3X41 A;  1EKM A;  3EBY A;  1JRQ A;  3O8Y A;  2IUK A;  4AKY A;  1VQ7 3;  1FGQ A;  1YI2 3;  3F8X A;  5CK6 A;  3X3Z A;  4N6T A;  3DGM A;  1S72 3;  2LQV A;  2W03 A;  3HZP A;  3NBR A;  1O7M B;  4N3V A;  7STD A;  1K73 4;  1UUW B;  4IT7 A;  3CCU 3;  1GY6 A;  3BNE A;  3CCV 3;  2OTJ 3;  4IIA A;  4LZI A;  3T8U A;  4HVN A;  2V1L A;  1Q86 4;  1JJ2 2;  3MG3 A;  4MEI A;  3SXX A;  3WOE B;  2K0M A;  2OOV A;  2GEX A;  2CWT A;  3I55 3;  1W2B 2;  1FA3 A;  1ISK A;  1RN7 A;  4CDL A;  4HM6 B;  1IVU A;  4JF8 A;  2XFS A;  4FR9 A;  1Q81 4;  3VGN A;  3X3X A;  2BNG A;  1VQ5 3;  5DRV A;  1A67 A;  1W2Z A;  3HK4 A;  3MG2 A;  2XGL A;  1QVF 2;  3PGB A;  1JB4 A;  1DVD A;  3OXA A;  1W4N A;  2O3O A;  2P05 A;  4XB5 A;  3I56 3;  1EG9 B;  4I4K A;  1Z1S A;  3RGA A;  2W6J H;  3IMA B;  3EC9 A;  4FMC A;  1OGZ A;  4JRF A;  3G6E 3;  1D6Z A;  3MPH A;  3FGY A;  4HZ9 B;  5CF2 A;  5KP4 A;  1SPU A;  1IT7 A;  3FKA A;  5EEO A;  2Y74 A;  3OX9 A;  2I9W A;  1ZX2 A;  1STF I;  3KZT A;  2P0X A;  5AEW B;  5FGO A;  3PXM A;  5A0O B;  1S5A A;  5AIG A;  4OUQ A;  4LGQ A;  2YFI B;  3FCS B;  1VQ8 3;  4AEQ A;  3G4S 3;  4MMY B;  5IEP A;  1N5P A;  2O9U X;  1IV9 A;  1KQS 2;  3K63 A;  3PCS A;  3WA3 A;  4WWU C;  2D1W A;  3CNM A;  3WDG B;  1YJW 3;  3STD A;  4G1M B;  1LVN A;  2XSH B;  3JUP A;  4K1U A;  2C10 A;  1TU5 A;  1RJO A;  1T5Y A;  5CLK A;  3B4P A;  1OH0 A;  3DGN A;  3EBT A;  4STD A;  3F7X A;  1IDP A;  3S67 A;  2BT3 A;  1HU9 A;  4HM8 B;  1NJI 4;  3NQY A;  2WO0 A;  4XBT A;  4WHA A;  4J9A A;  4N6V 0;  1UW1 A;  2WOF A;  2FXT A;  4N6U A;  1OUN A;  1NWW A;  3KE7 A;  2BMQ B;  5D82 A;  4FMD A;  5AII A;  3HIG A;  4HJL B;  1FGT A;  5IEO A;  2RGQ A;  3K7C A;  5EVH A;  1YVB I;  3KSP A;  1AVK A;  2OWP A;  4FCJ A;  3SLU A;  1VZZ A;  1SIH A;  2FNQ A;  3ER7 A;  3IPT A;  4Q53 A;  3K0Z A;  1KD1 4;  4O8S A;  3EN8 A;  3CD6 3;  1K9M 4;  3KII A;  3F14 A;  3NBB A;  1DMM A;  4N6N B;  4GB5 A;  1G96 A;  3WOF B;  1QAL A;  2QGU A;  4HM0 B;  2Y73 A;  5JPP A;  3OWS A;  3LXU X;  1VQK 3;  5JBS A;  1STD A;  1GYB A;  1W02 A;  1JB5 A;  2KRT A;  1WMP A;  3CCR 3;  2OQE A;  1O7P B;  5CF1 A;  1YIT 3;  5AEU B;  2BMR B;  4EYC A;  2JDI H;  1Y4K A;  3G0K A;  1WMO A;  1OAC A;  4RNZ A;  3V99 A;  3T8N A;  1QAF A;  1VQL 3;  1Q82 4;  3EX9 A;  3S27 A;  1OCV A;  2JQ5 A;  3V92 A;  4L8P A;  2Z76 A;  1BUQ A;  1ULI B;  2CHC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...