2P09A

Structural insights into the evolution of a non-biological protein
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
69
structure length
69
Chain Sequence
b'DDDDKKTNWLKRIYRVRPCVKCKVAPRDWKVKNKHLRIYNMCKTCFNNSIDIGDDTYHGHVDWLMYADS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords a non-biological ATP binding protein with two mutations N32D
publication title Structural insights into the evolution of a non-biological protein: importance of surface residues in protein fold optimization.
pubmed doi rcsb
source organism Unidentified
molecule tags De novo protein
total genus 19
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2007-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.210 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2p09A00
3DGNA 3DGMA 2P09A 3DGOA 1UW1A 3LT8A 3DGLA 2P05A 3LTBA 3LTDA 3LTCA 2P0XA 3LT9A 3LTAA
chains in the Genus database with same CATH superfamily
1G96A 4J9AA 1UCIA 3ECFA 1WMNA 1UCJA 1G02A 3CD63 1VZZA 4OVMA 2GXFA 1GOYA 1MNLA 3CCE3 2E2UA 3D5GA 4HYZA 5CK6A 1UI7A 4GL6A 3LXUX 4RZMA 2IY2A 1RKYA 1BNSA 3LOYA 4EV2A 5AI1A 2HOHA 1JN5A 1IDPA 1UCKA 2ZL8A 3DZLA 3F40A 2Y74A 3OW22 1DE3A 1DMNA 1FGOA 2CC3A 4CCVA 3NV0B 5IG3A 3SYUA 1BNJA 8CHOA 3WR2A 2XFSA 5G2GA 2SBLA 1B2ZA 4O8SA 1BGSA 1Q7HA 2RSXA 4RNZA 3RGAA 1BVIA 2B1XB 1YJW3 1OF5A 5CXOA 1W2B2 3D79A 2UX0A 3URPA 2KF4A 1WNHA 1LRAA 1OGZA 5M1AA 3KSPA 1GMQA 3RNTA 3D9RA 1BNFA 3CME3 3CCV3 1GOVA 1I2FA 3KN4A 3MKIA 1FA3A 1NB5I 1BOXA 2B24B 1V58A 2STDA 3T0UA 3ROBA 3T8NA 4FMBA 1A2PA 5D83A 3B8LA 3WMDA 1C54A 1BIRA 4FMCA 1N8QA 3LYGA 3CCM3 2F86B 1YI23 3CCQ3 1C7HA 1ASKA 2XSHB 3LZAA 4H61A 2IMJA 1JV2B 4LGQA 3G6E3 3ALAA 3GAXA 4XBYA 4K90B 2IA7A 2CFKA 3OWYA 4R9KA 3OWUA 5I97A 2XF3A 2CFGA 1T5YA 3V99A 2OCTA 3KFQC 1VQ63 5IEOA 1LOWA 1BRIA 2AAEA 2XR8B 2YFIB 4CJNA 3EE1A 1F8NA 1RRHA 3GSPA 1QALA 5GSPA 3CCL3 1UUVB 1X1UA 1Q7Y4 5IF6A 3FF2A 5AYRB 4CDLA 4O02B 3NHXA 3F8XA 1IV7A 2QIYA 3K9MC 3L0RA 2GU1A 5DRVA 3I553 1L5GB 2LYXA 4I5QA 3FG1A 5STDA 1EEJA 1SARA 5AIGA 1UGIA 1TP6A 4HM4B 1RNBA 2W2CA 4OUQA 2RNTA 1BSDA 4DKIA 1Q9EA 3K0ZA 1BU4A 5CF1A 1FGTA 1BSEA 3S29A 3QK9A 3Q90A 3SEDA 3IPTA 2FNQA 1GY7A 3H51A 2W9QA 3NV0A 4JRFA 2MC8A 4LZIA 4ILFA 2YX9A 1A2VA 3DGLA 3G16A 1E97A 1I3IA 3N8BA 3SX1A 2I9WA 1RLSA 2BIRA 2KAAA 1W7CA 2C11A 3BLZA 3MG2A 3D4AA 3S28A 3BU4A 3EBYA 3CCR3 1ZO2A 1VQL3 1T3BA 1M904 5CLKA 3MWZA 1RGFA 2QEX3 2V1LA 4WWUC 4IIAA 3DM8A 4MMZB 2UGIA 1JB4A 4HJLB 3BNBA 4XB5A 1GD4A 1EKMA 1IQYA 1ROVA 1LOVA 1UGHI 1R4YA 1BRSA 1LOYA 3A5EA 4L8OA 1ULIB 1YJN3 3DGNA 5ELUA 1K8A4 4NHFA 3JUMA 1UI8A 4BTYA 3K7CA 3WA3A 4HOHA 4ORLA 1VQP3 1IVUA 1BANA 1MWTA 2F98A 3BIRA 3B7CA 3FG4A 3CNXA 1QAFA 4XM4A 2FGTA 1W4NA 1RN4A 2XGLA 4O2HA 1BNRA 1TUHA 3FCSB 1I0XA 1RN1A 2BMOB 1B27A 3F8HA 3UL5A 2F56A 1DMMA 3WODG 2BMRB 3ER7A 3J7Yd 1NWWA 1NU3A 3CC43 1U5OA 4KT3B 5AEWB 1WMOA 2R4IA 1B2MA 2CG0A 1VQN3 1W01A 2GSPA 4KFDA 1STDA 4N6UA 3LMLA 1DVDA 1HYFA 1RRLA 1AQZA 2AADA 3ZG0A 2WO0A 5FW5A 2W0QA 3LTDA 2E2VA 2QA43 3HI7A 1O7PB 2C10A 1DETA 1OACA 1YVBI 3AHWA 2OTJ3 1OUNA 2M7OA 1IV9A 3FF0A 3HK4A 2KF6A 1JBRA 4GB5A 1A90A 1BSBA 5G1LA 1GYBA 1GMRA 3X40A 4PEJA 2D1WA 1RJOA 5BXQA 2XH9A 3EBTA 2ZDJA 5EQLA 1MGRA 3PZWA 3N54B 3Q1CA 3GZBA 2WGOA 3GZYB 2W56B 1TU5A 3G4S3 2CKFB 2W03A 3G0KA 1UUGB 4HM5B 5D82A 3PS8A 2E2TA 1FGRA 2Z7AA 3Q3FA 1N8R4 1YNVX 1RGGA 5AIIA 3E99A 4BTXA 2JQ5A 3EN8A 1HKXA 2BHMA 4N6NB 3DXOA 3HIIA 1ZS7A 4R80A 2W9PA 4MEIA 3TDGA 1S5AA 1LQMB 1B2XA 4GSPA 2OOVC 4KFFA 4BL3A 4EC6A 3DGMA 1NNVA 1LOXA 1FUSA 1CYVA 2RCDA 3HIGA 1ISKA 1JB5A 1CEWI 4HBRA 1OGXA 2HMOB 1YIJ3 1FZUA 4TX4A 4FMAA 5JPPA 3JUOA 1BNIA 2D42A 3O8YA 7RNTA 1OPYA 3MPHA 1X1YA 3HOHA 3IJEB 1RDSA 1JZOA 2XSOB 3MYTA 1E3VA 3NX0A 4RBNA 4O3VA 1VQ93 1W6CA 3EN1B 1BSAA 2BT3A 1SIHA 2KCDA 1SPUA 3JUQA 2RFRA 3X3ZA 5KP4A 1IVXA 1KSIA 3GWRA 3WHOA 4BL2A 3AMOA 3DMCA 5AIHA 5CF2A 1VQ53 1T2IA 2XRXB 4FCMA 4WYKB 1VQK3 1YHQ3 4WP5A 1IQ8A 2KF3A 4EW5A 3CNMA 3HX8A 5IW9A 1W02A 4GHOA 4LYLB 2F99A 1Q42A 1FGMA 2CK3H 2Z6BA 3OXAA 4K1UA 4HAAA 1O7NB 5BIRA 1Q824 1W5ZA 5HGRA 4RNYA 1A2KA 4EXRA 4CPKA 3S5CA 3LH4A 4R1KA 1GSPA 1CQSA 2PNCA 3CCS3 1O7MB 3EJVA 3KZTA 2W6JH 5BU4A 2C4BA 3I0YA 4L7KA 4MMXB 1X1XA 2W56A 2BO9B 3F14A 3EC9A 1UUWB 4G1MB 1UW1A 3HZPA 1SIIA 3ZG5A 3ZFZA 4EYCA 3FLJA 4BTWA 8RNTA 3CPOA 1D6ZA 2P0XA 1ZGXA 3BB9A 2IUKA 4XDVA 4HKVB 4WFOA 3SOYA 5EEOA 1TIJA 3FSDA 4AKYA 2GBXB 1O7WB 3CU3A 3MG1A 1TFKA 3UJMA 2F4YA 1YJ93 1BAOA 2ZHXB 5KP3A 5JBSA 1IK3A 5M18A 1EG9B 2YFLB 1US1A 1EUIC 5IERA 1VQ43 1PFPA 4Q53A 3GRDA 3LTCA 1RGLA 3EB8A 4FCJA 1E3RA 4RNTA 1A67A 2P38A 3G713 4KFEA 5IG5A 1O7GB 3U97A 1RMSA 4J5KA 1VQM3 3QRDA 3WA2X 2K54A 4LEHA 1M1K4 1W6GA 4U13A 4QWTA 3OV4A 3V92A 3CMA3 4N3VA 4N6V0 3S67A 5BVBA 5JPUA 1TRQA 3KSED 3CXC2 2ZA4A 1RGKA 3PXMA 1Q814 2OTL3 1NB3I 1IVWA 1KC84 4WYKA 3EX9A 1OHOA 1I2GA 5M19A 1X1WA 3EQQB 3SLUA 1BUQA 1AVLA 3AHSA 4IT7A 5AIFA 6GSPA 1W00A 2CWTA 1AVKA 1BRJA 1Q40B 3BNDA 5HOHA 1YIT3 4N6TA 1DMQA 3CPW2 3UB1A 3VSYA 5IG0A 3AMOB 1IYYA 1IU7A 1OHSA 2O3OA 4L8PA 3BNEA 1KD14 1JJ22 2WOFA 1BNGA 3AGOA 1YVSA 2XGNA 1BRNL 4AKZA 1YGWA 1JBSA 3NM7A 3LTBA 4KZ1A 1FUTA 1BRKA 1OCVA 1D6YA 3N9HA 1Y4KA 1EQKA 1RTUA 2KXGA 4NPBA 5IG4A 1B3SA 1QAKA 4HM7B 1MWUA 6STDA 2UUGC 1V74A 1GS3A 5FGOA 2CHCA 4HZ9B 1KQS2 1RN7A 1QMAA 2CX1A 1BRHA 4FMDA 1VQQA 1IT8A 4STDA 1S723 3K5TA 4X2OA 4X2HA 1BUJA 1LNIA 1IT7A 3D5IA 1I8VA 1IQXA 1HU9A 2HMMB 2R41A 3CC73 1GY5A 5RNTA 4H3UA 3X41A 3Q2PA 1B21A 2JDIH 1N5PA 5D81A 2H0GA 5G1KA 2HMJB 2XEPA 2GEXA 2GEYA 1I70A 2SARA 5IENA 2L1SA 2P0MA 2OQEA 3MSOA 2INXA 3DGOA 4MMYB 4XDWA 1I0VA 1T2HA 1JNQA 2BNGA 2IUJA 2QGUA 4HM0B 3EF8A 1K734 2H0IA 1RSNA 3CCU3 3JUPA 3K63A 1W2ZA 3A76A 1SJWA 1JBTA 1JZDA 1BSCA 4HM8B 1RGEA 1LXEA 1Q40A 1RGAA 1WQLB 2K3DA 4WHAA 3CCJ3 2BU4A 3T8UA 1LVNA 1AV4A 3KE7A 4EBGA 1K28A 1J2BA 3LT8A 5ELJA 1GMPA 1RGHA 1OH0A 4HM2B 2Z76A 2CW9A 3PYJA 3S27A 5AYSC 4I4KA 1ROAA 2OOVA 4HM3B 3SVAA 1LNHA 1N5HA 1JKGA 2L4VA 3UL6A 2H0HA 3DUKA 3B4PA 2W04A 3EHCA 3D3LA 1I3FA 1UCLA 2F5WA 2OWPA 3G8ZA 4FCZA 1M9GA 4N6LA 2CX0A 3F7XA 1NDOB 3I563 1MGWA 1RNTA 3JUNA 3AGNA 2J8XB 1VQ83 3NQYA 3U1WA 9RNTA 1RHLA 1KWIA 1WTHA 4FR9A 1QVG2 1TFOA 2XFTA 2ML6A 3B4OA 1PU4A 2CWUA 3RDEA 1NJI4 3V98A 2CFLA 1K9M4 1LQGC 3GZRA 1FGQA 4LMIA 1CH0A 1GY6A 2MF7A 3OWSA 3WOEB 1PY3A 1B20A 7STDA 2Y73A 3X3YA 1MWSA 3PGBA 1AR0A 1MWRA 1R4CA 3KCHA 3WOFB 5TGNA 3KKGA 2CG1A 1IVVA 1GD3A 1D6UA 1ZX2A 2A15A 4NREA 3SOAA 2ML5A 4BU4A 4BIRA 1V57A 4HVNA 4XBXA 3X3XA 1FUWA 1PYLA 1VQ73 2YFJB 1WMPA 3NBBA 1HZ1A 1FW7A 2CH9A 2Q07A 4R4KA 3MHEA 4K1VA 1B2SA 1O7HB 3DGYA 1DYUA 1YGEA 1QVF2 4N6MA 4N6OB 1AY7A 2GBWB 3M8CA 4LSOA 4AEQA 1VQO3 3FKAA 1RCKA 3JVCA 3NM2A 3OX9A 1JN5B 4HZBB 1RCLA 1M1XB 4MJDA 1NO3A 3CC23 1ULJB 2RBIA 3NBRA 2HMKB 1W6YA 2LQVA 4EV5A 4K61A 3F7SA 1Q864 1TTOA 3LTAA 1STFI 3FZWA 3PCRA 1N9EA 1JB2A 3F9SA 2HMNB 3VF1A 6RNTA 4IPBA 3NBJA 4XBTA 1OF5B 1Z1SA 1EA2A 1U8CB 3H3HA 3NUVA 1MOLA 1TJDA 5LC6A 3X42A 5A0OB 2F5MA 2HMLB 4R9LA 3BNCA 4J8TA 2K0MA 3NXJA 1FYSA 1B2UA 1RGCA 2BMQB 2O9UX 4OK0A 2KRTA 1JRQA 2P09A 3STDA 1JKGB 1CYUA 2P05A 7GSPA 1BNEA 4HM1B 5EVHA 4J5GA 5AEUB 3FH1A 1GOUA 3PCSA 1SQWA 3WDGB 2CFWA 1N9JA 2CWVA 5IEPA 3DY5A 2WOHA 3NQZA 4KVHA 2CFDA 3KIIA 5DREA 3RGRA 2Z77A 2RGQA 4HM6B 3SXXA 2FXTA 1QJGA 1TRPA 3VGNA 2GU3A 2WGQA 1I2EA 3FGYA 2KF5A 3FG3A 3MG3A 3UNLA 2CIUA 3DH2A 3IMAB 1BRGA 3LT9A 5LC7A 1G0TA 1OHPA 2PZVA 5KP1A 2IYJA 2OQEC 1UDII 4ZM8A 1DVCA 1K41A 3GZXB 4JF8A
chains in the Genus database with same CATH topology
1G96A 4J9AA 3ECFA 1WMNA 3CD63 1VZZA 4OVMA 2GXFA 1MNLA 3CCE3 2E2UA 4HYZA 5CK6A 1UI7A 4GL6A 3LXUX 4RZMA 1RKYA 3LOYA 4EV2A 5AI1A 3DZLA 1JN5A 1IDPA 2ZL8A 3F40A 3OW22 2Y74A 1DMNA 1FGOA 2CC3A 4CCVA 3NV0B 5IG3A 8CHOA 2XFSA 5G2GA 2SBLA 4O8SA 2RSXA 4RNZA 3RGAA 2B1XB 1YJW3 1OF5A 5CXOA 1W2B2 2UX0A 1WNHA 1OGZA 3KSPA 3D9RA 3CME3 3CCV3 3KN4A 3MKIA 1FA3A 1NB5I 2B24B 2STDA 3T8NA 3T0UA 3ROBA 3WMDA 4FMBA 5D83A 3B8LA 4FMCA 1N8QA 3LYGA 3CCM3 2F86B 1YI23 3CCQ3 1C7HA 1ASKA 2XSHB 3LZAA 4H61A 2IMJA 1JV2B 4LGQA 3G6E3 3ALAA 3GAXA 4XBYA 4K90B 2IA7A 2CFKA 3OWYA 4R9KA 3OWUA 5I97A 2XF3A 2CFGA 1T5YA 3V99A 2OCTA 3KFQC 1VQ63 5IEOA 2XR8B 2YFIB 3EE1A 1F8NA 1RRHA 3CCL3 1QALA 1UUVB 1Q7Y4 5IF6A 3FF2A 5AYRB 4CDLA 4O02B 3NHXA 3F8XA 1IV7A 2QIYA 3K9MC 3L0RA 2GU1A 5DRVA 3I553 1L5GB 2LYXA 3FG1A 5STDA 5AIGA 4HM4B 1TP6A 2W2CA 4OUQA 3K0ZA 5CF1A 1FGTA 3S29A 3QK9A 3Q90A 3SEDA 3IPTA 2FNQA 1GY7A 3H51A 2W9QA 3NV0A 4JRFA 2MC8A 4LZIA 2YX9A 1A2VA 3DGLA 3G16A 1E97A 3N8BA 3SX1A 2I9WA 1W7CA 2C11A 3BLZA 3MG2A 3S28A 3EBYA 3CCR3 1ZO2A 1VQL3 1M904 5CLKA 3MWZA 2QEX3 2V1LA 4WWUC 4IIAA 3DM8A 4MMZB 1JB4A 4HJLB 3BNBA 4XB5A 1GD4A 1EKMA 1IQYA 1ROVA 4L8OA 1ULIB 1YJN3 3DGNA 5ELUA 1K8A4 4NHFA 3JUMA 1UI8A 4BTYA 3K7CA 3WA3A 4ORLA 1VQP3 1IVUA 2F98A 3B7CA 3FG4A 3CNXA 1QAFA 4XM4A 2FGTA 1W4NA 2XGLA 4O2HA 1TUHA 3FCSB 2BMOB 3F8HA 3UL5A 3WODG 1DMMA 2BMRB 3ER7A 3J7Yd 1NWWA 1NU3A 3CC43 1U5OA 1VQN3 5AEWB 1WMOA 2R4IA 2CG0A 1W01A 4KFDA 1STDA 4N6UA 3LMLA 1DVDA 1RRLA 2WO0A 5FW5A 2W0QA 3LTDA 2E2VA 2QA43 3HI7A 1O7PB 2C10A 1OACA 1YVBI 2OTJ3 1OUNA 2M7OA 1IV9A 3FF0A 3HK4A 4GB5A 1A90A 1GYBA 3X40A 4PEJA 2D1WA 1RJOA 5BXQA 2XH9A 3EBTA 2ZDJA 5EQLA 3PZWA 3N54B 3Q1CA 3GZBA 2WGOA 3GZYB 2W56B 1TU5A 3G4S3 2CKFB 2W03A 3G0KA 4HM5B 5D82A 3PS8A 2E2TA 1FGRA 2Z7AA 1N8R4 5AIIA 3E99A 4BTXA 2JQ5A 3EN8A 1HKXA 2BHMA 4N6NB 3DXOA 3HIIA 4R80A 3TDGA 2W9PA 4MEIA 1S5AA 2OOVC 4KFFA 4EC6A 3DGMA 1LOXA 1CYVA 2RCDA 3HIGA 1JB5A 1CEWI 4HBRA 1OGXA 2HMOB 1YIJ3 4TX4A 4FMAA 5JPPA 3JUOA 3O8YA 2D42A 1OPYA 3MPHA 3IJEB 2XSOB 3MYTA 3NX0A 1E3VA 4RBNA 1VQ93 4O3VA 1W6CA 3EN1B 2BT3A 2KCDA 1SIHA 3JUQA 1SPUA 3X3ZA 2RFRA 5KP4A 1ISKA 1IVXA 1KSIA 3GWRA 5CF2A 1VQ53 3AMOA 3DMCA 5AIHA 2XRXB 4WYKB 4FCMA 1YHQ3 1VQK3 4WP5A 1IQ8A 3CNMA 3HX8A 5IW9A 1W02A 2F99A 1Q42A 1FGMA 2CK3H 2Z6BA 3OXAA 4K1UA 1O7NB 1Q824 1W5ZA 5HGRA 4RNYA 1A2KA 4EXRA 3S5CA 3LH4A 4R1KA 1CQSA 2PNCA 3CCS3 1O7MB 3EJVA 3KZTA 2W6JH 3I0YA 4L7KA 4MMXB 2W56A 2BO9B 3F14A 3EC9A 1UUWB 4G1MB 1UW1A 3HZPA 1SIIA 4EYCA 3FLJA 4BTWA 3CPOA 1D6ZA 2P0XA 3BB9A 2IUKA 4XDVA 4HKVB 4WFOA 3SOYA 5EEOA 1TIJA 3FSDA 4AKYA 2GBXB 1O7WB 3CU3A 3MG1A 1TFKA 3UJMA 1YJ93 5KP3A 5JBSA 1IK3A 1EG9B 2YFLB 1US1A 5IERA 1VQ43 1PFPA 4Q53A 3GRDA 3LTCA 3EB8A 4FCJA 1E3RA 1A67A 2P38A 3G713 4KFEA 5IG5A 1O7GB 3U97A 1VQM3 3QRDA 3WA2X 2K54A 4LEHA 1M1K4 1W6GA 4U13A 4QWTA 3OV4A 3V92A 3CMA3 4N3VA 4N6V0 3S67A 5BVBA 5JPUA 3KSED 3CXC2 3PXMA 1Q814 2OTL3 1NB3I 1IVWA 1KC84 4WYKA 3EX9A 1OHOA 3EQQB 3SLUA 1BUQA 1AVLA 5AIFA 4IT7A 1W00A 2CWTA 1AVKA 1Q40B 3BNDA 1YIT3 4N6TA 1DMQA 3CPW2 3UB1A 3VSYA 5IG0A 3AMOB 1IU7A 1OHSA 2O3OA 4L8PA 3BNEA 1KD14 1JJ22 2WOFA 2XGNA 4AKZA 3NM7A 3LTBA 4KZ1A 1OCVA 1D6YA 3N9HA 1Y4KA 1EQKA 2KXGA 5IG4A 1QAKA 4HM7B 6STDA 1V74A 1GS3A 5FGOA 2CHCA 4HZ9B 1KQS2 1RN7A 1QMAA 4FMDA 1IT8A 4STDA 1S723 3K5TA 4X2OA 4X2HA 1IT7A 1IQXA 1HU9A 2HMMB 3CC73 1GY5A 4H3UA 3X41A 3Q2PA 2JDIH 1N5PA 5D81A 2HMJB 2XEPA 2GEXA 2GEYA 5IENA 2P0MA 2OQEA 3MSOA 2INXA 3DGOA 4MMYB 4XDWA 1JNQA 2BNGA 2IUJA 2QGUA 4HM0B 3EF8A 1K734 3CCU3 3JUPA 3K63A 1W2ZA 3A76A 1SJWA 4HM8B 1LXEA 1Q40A 1WQLB 4WHAA 3CCJ3 3T8UA 1LVNA 1AV4A 3KE7A 4EBGA 1K28A 1J2BA 3LT8A 5ELJA 4HM2B 1OH0A 2Z76A 2CW9A 3PYJA 3S27A 5AYSC 4I4KA 1ROAA 2OOVA 4HM3B 3SVAA 1LNHA 1N5HA 1JKGA 2L4VA 3UL6A 3DUKA 3B4PA 2W04A 3EHCA 3D3LA 3G8ZA 4FCZA 2OWPA 4N6LA 1M9GA 3F7XA 1NDOB 3I563 3JUNA 1VQ83 3NQYA 3U1WA 1KWIA 1WTHA 4FR9A 1QVG2 1TFOA 2XFTA 2ML6A 3B4OA 1PU4A 2CWUA 3RDEA 1NJI4 3V98A 2CFLA 1K9M4 3GZRA 1FGQA 4LMIA 1GY6A 2MF7A 3OWSA 3WOEB 7STDA 2Y73A 3X3YA 3PGBA 1AR0A 1R4CA 3WOFB 5TGNA 3KKGA 2CG1A 1IVVA 1GD3A 1D6UA 1ZX2A 2A15A 4NREA 3SOAA 2ML5A 4HVNA 4XBXA 3X3XA 1FUWA 1VQ73 2YFJB 1WMPA 3NBBA 2CH9A 2Q07A 4R4KA 3MHEA 4K1VA 1O7HB 1DYUA 1YGEA 1QVF2 4N6MA 4N6OB 2GBWB 3M8CA 4LSOA 4AEQA 1VQO3 3FKAA 3JVCA 3NM2A 3OX9A 4HZBB 1JN5B 4MJDA 1M1XB 3CC23 1NO3A 1ULJB 3NBRA 2HMKB 1W6YA 2LQVA 4EV5A 4K61A 3F7SA 1Q864 3LTAA 1STFI 3FZWA 3PCRA 1N9EA 1JB2A 3F9SA 2HMNB 3VF1A 4IPBA 3NBJA 4XBTA 1OF5B 1Z1SA 1EA2A 1U8CB 3H3HA 3NUVA 1MOLA 3X42A 5LC6A 5A0OB 2HMLB 4R9LA 3BNCA 4J8TA 2K0MA 3NXJA 2BMQB 4OK0A 2O9UX 2KRTA 1JRQA 2P09A 3STDA 1JKGB 1CYUA 2P05A 4HM1B 5EVHA 5AEUB 3FH1A 3PCSA 3WDGB 1SQWA 5IEPA 2CFWA 1N9JA 2CWVA 3DY5A 2WOHA 3NQZA 4KVHA 2CFDA 3KIIA 5DREA 3RGRA 2Z77A 2RGQA 4HM6B 3SXXA 2FXTA 1QJGA 3VGNA 2GU3A 2WGQA 3FGYA 3FG3A 3MG3A 3UNLA 2CIUA 3IMAB 3LT9A 5LC7A 1OHPA 2PZVA 5KP1A 2OQEC 4ZM8A 1DVCA 1K41A 3GZXB 4JF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DGN A;  3DGM A;  2P09 A;  3DGO A;  1UW1 A;  3LT8 A;  3DGL A;  2P05 A;  3LTB A;  3LTD A;  3LTC A;  2P0X A;  3LT9 A;  3LTA A; 
#chains in the Genus database with same CATH topology
 1G96 A;  4J9A A;  1UCI A;  3ECF A;  1WMN A;  1UCJ A;  1G02 A;  3CD6 3;  1VZZ A;  4OVM A;  2GXF A;  1GOY A;  1MNL A;  3CCE 3;  2E2U A;  3D5G A;  4HYZ A;  5CK6 A;  1UI7 A;  4GL6 A;  3LXU X;  4RZM A;  2IY2 A;  1RKY A;  1BNS A;  3LOY A;  4EV2 A;  5AI1 A;  2HOH A;  1JN5 A;  1IDP A;  1UCK A;  2ZL8 A;  3DZL A;  3F40 A;  2Y74 A;  3OW2 2;  1DE3 A;  1DMN A;  1FGO A;  2CC3 A;  4CCV A;  3NV0 B;  5IG3 A;  3SYU A;  1BNJ A;  8CHO A;  3WR2 A;  2XFS A;  5G2G A;  2SBL A;  1B2Z A;  4O8S A;  1BGS A;  1Q7H A;  2RSX A;  4RNZ A;  3RGA A;  1BVI A;  2B1X B;  1YJW 3;  1OF5 A;  5CXO A;  1W2B 2;  3D79 A;  2UX0 A;  3URP A;  2KF4 A;  1WNH A;  1LRA A;  1OGZ A;  5M1A A;  3KSP A;  1GMQ A;  3RNT A;  3D9R A;  1BNF A;  3CME 3;  3CCV 3;  1GOV A;  1I2F A;  3KN4 A;  3MKI A;  1FA3 A;  1NB5 I;  1BOX A;  2B24 B;  1V58 A;  2STD A;  3T0U A;  3ROB A;  3T8N A;  4FMB A;  1A2P A;  5D83 A;  3B8L A;  3WMD A;  1C54 A;  1BIR A;  4FMC A;  1N8Q A;  3LYG A;  3CCM 3;  2F86 B;  1YI2 3;  3CCQ 3;  1C7H A;  1ASK A;  2XSH B;  3LZA A;  4H61 A;  2IMJ A;  1JV2 B;  4LGQ A;  3G6E 3;  3ALA A;  3GAX A;  4XBY A;  4K90 B;  2IA7 A;  2CFK A;  3OWY A;  4R9K A;  3OWU A;  5I97 A;  2XF3 A;  2CFG A;  1T5Y A;  3V99 A;  2OCT A;  3KFQ C;  1VQ6 3;  5IEO A;  1LOW A;  1BRI A;  2AAE A;  2XR8 B;  2YFI B;  4CJN A;  3EE1 A;  1F8N A;  1RRH A;  3GSP A;  1QAL A;  5GSP A;  3CCL 3;  1UUV B;  1X1U A;  1Q7Y 4;  5IF6 A;  3FF2 A;  5AYR B;  4CDL A;  4O02 B;  3NHX A;  3F8X A;  1IV7 A;  2QIY A;  3K9M C;  3L0R A;  2GU1 A;  5DRV A;  3I55 3;  1L5G B;  2LYX A;  4I5Q A;  3FG1 A;  5STD A;  1EEJ A;  1SAR A;  5AIG A;  1UGI A;  1TP6 A;  4HM4 B;  1RNB A;  2W2C A;  4OUQ A;  2RNT A;  1BSD A;  4DKI A;  1Q9E A;  3K0Z A;  1BU4 A;  5CF1 A;  1FGT A;  1BSE A;  3S29 A;  3QK9 A;  3Q90 A;  3SED A;  3IPT A;  2FNQ A;  1GY7 A;  3H51 A;  2W9Q A;  3NV0 A;  4JRF A;  2MC8 A;  4LZI A;  4ILF A;  2YX9 A;  1A2V A;  3DGL A;  3G16 A;  1E97 A;  1I3I A;  3N8B A;  3SX1 A;  2I9W A;  1RLS A;  2BIR A;  2KAA A;  1W7C A;  2C11 A;  3BLZ A;  3MG2 A;  3D4A A;  3S28 A;  3BU4 A;  3EBY A;  3CCR 3;  1ZO2 A;  1VQL 3;  1T3B A;  1M90 4;  5CLK A;  3MWZ A;  1RGF A;  2QEX 3;  2V1L A;  4WWU C;  4IIA A;  3DM8 A;  4MMZ B;  2UGI A;  1JB4 A;  4HJL B;  3BNB A;  4XB5 A;  1GD4 A;  1EKM A;  1IQY A;  1ROV A;  1LOV A;  1UGH I;  1R4Y A;  1BRS A;  1LOY A;  3A5E A;  4L8O A;  1ULI B;  1YJN 3;  3DGN A;  5ELU A;  1K8A 4;  4NHF A;  3JUM A;  1UI8 A;  4BTY A;  3K7C A;  3WA3 A;  4HOH A;  4ORL A;  1VQP 3;  1IVU A;  1BAN A;  1MWT A;  2F98 A;  3BIR A;  3B7C A;  3FG4 A;  3CNX A;  1QAF A;  4XM4 A;  2FGT A;  1W4N A;  1RN4 A;  2XGL A;  4O2H A;  1BNR A;  1TUH A;  3FCS B;  1I0X A;  1RN1 A;  2BMO B;  1B27 A;  3F8H A;  3UL5 A;  2F56 A;  1DMM A;  3WOD G;  2BMR B;  3ER7 A;  3J7Y d;  1NWW A;  1NU3 A;  3CC4 3;  1U5O A;  4KT3 B;  5AEW B;  1WMO A;  2R4I A;  1B2M A;  2CG0 A;  1VQN 3;  1W01 A;  2GSP A;  4KFD A;  1STD A;  4N6U A;  3LML A;  1DVD A;  1HYF A;  1RRL A;  1AQZ A;  2AAD A;  3ZG0 A;  2WO0 A;  5FW5 A;  2W0Q A;  3LTD A;  2E2V A;  2QA4 3;  3HI7 A;  1O7P B;  2C10 A;  1DET A;  1OAC A;  1YVB I;  3AHW A;  2OTJ 3;  1OUN A;  2M7O A;  1IV9 A;  3FF0 A;  3HK4 A;  2KF6 A;  1JBR A;  4GB5 A;  1A90 A;  1BSB A;  5G1L A;  1GYB A;  1GMR A;  3X40 A;  4PEJ A;  2D1W A;  1RJO A;  5BXQ A;  2XH9 A;  3EBT A;  2ZDJ A;  5EQL A;  1MGR A;  3PZW A;  3N54 B;  3Q1C A;  3GZB A;  2WGO A;  3GZY B;  2W56 B;  1TU5 A;  3G4S 3;  2CKF B;  2W03 A;  3G0K A;  1UUG B;  4HM5 B;  5D82 A;  3PS8 A;  2E2T A;  1FGR A;  2Z7A A;  3Q3F A;  1N8R 4;  1YNV X;  1RGG A;  5AII A;  3E99 A;  4BTX A;  2JQ5 A;  3EN8 A;  1HKX A;  2BHM A;  4N6N B;  3DXO A;  3HII A;  1ZS7 A;  4R80 A;  2W9P A;  4MEI A;  3TDG A;  1S5A A;  1LQM B;  1B2X A;  4GSP A;  2OOV C;  4KFF A;  4BL3 A;  4EC6 A;  3DGM A;  1NNV A;  1LOX A;  1FUS A;  1CYV A;  2RCD A;  3HIG A;  1ISK A;  1JB5 A;  1CEW I;  4HBR A;  1OGX A;  2HMO B;  1YIJ 3;  1FZU A;  4TX4 A;  4FMA A;  5JPP A;  3JUO A;  1BNI A;  2D42 A;  3O8Y A;  7RNT A;  1OPY A;  3MPH A;  1X1Y A;  3HOH A;  3IJE B;  1RDS A;  1JZO A;  2XSO B;  3MYT A;  1E3V A;  3NX0 A;  4RBN A;  4O3V A;  1VQ9 3;  1W6C A;  3EN1 B;  1BSA A;  2BT3 A;  1SIH A;  2KCD A;  1SPU A;  3JUQ A;  2RFR A;  3X3Z A;  5KP4 A;  1IVX A;  1KSI A;  3GWR A;  3WHO A;  4BL2 A;  3AMO A;  3DMC A;  5AIH A;  5CF2 A;  1VQ5 3;  1T2I A;  2XRX B;  4FCM A;  4WYK B;  1VQK 3;  1YHQ 3;  4WP5 A;  1IQ8 A;  2KF3 A;  4EW5 A;  3CNM A;  3HX8 A;  5IW9 A;  1W02 A;  4GHO A;  4LYL B;  2F99 A;  1Q42 A;  1FGM A;  2CK3 H;  2Z6B A;  3OXA A;  4K1U A;  4HAA A;  1O7N B;  5BIR A;  1Q82 4;  1W5Z A;  5HGR A;  4RNY A;  1A2K A;  4EXR A;  4CPK A;  3S5C A;  3LH4 A;  4R1K A;  1GSP A;  1CQS A;  2PNC A;  3CCS 3;  1O7M B;  3EJV A;  3KZT A;  2W6J H;  5BU4 A;  2C4B A;  3I0Y A;  4L7K A;  4MMX B;  1X1X A;  2W56 A;  2BO9 B;  3F14 A;  3EC9 A;  1UUW B;  4G1M B;  1UW1 A;  3HZP A;  1SII A;  3ZG5 A;  3ZFZ A;  4EYC A;  3FLJ A;  4BTW A;  8RNT A;  3CPO A;  1D6Z A;  2P0X A;  1ZGX A;  3BB9 A;  2IUK A;  4XDV A;  4HKV B;  4WFO A;  3SOY A;  5EEO A;  1TIJ A;  3FSD A;  4AKY A;  2GBX B;  1O7W B;  3CU3 A;  3MG1 A;  1TFK A;  3UJM A;  2F4Y A;  1YJ9 3;  1BAO A;  2ZHX B;  5KP3 A;  5JBS A;  1IK3 A;  5M18 A;  1EG9 B;  2YFL B;  1US1 A;  1EUI C;  5IER A;  1VQ4 3;  1PFP A;  4Q53 A;  3GRD A;  3LTC A;  1RGL A;  3EB8 A;  4FCJ A;  1E3R A;  4RNT A;  1A67 A;  2P38 A;  3G71 3;  4KFE A;  5IG5 A;  1O7G B;  3U97 A;  1RMS A;  4J5K A;  1VQM 3;  3QRD A;  3WA2 X;  2K54 A;  4LEH A;  1M1K 4;  1W6G A;  4U13 A;  4QWT A;  3OV4 A;  3V92 A;  3CMA 3;  4N3V A;  4N6V 0;  3S67 A;  5BVB A;  5JPU A;  1TRQ A;  3KSE D;  3CXC 2;  2ZA4 A;  1RGK A;  3PXM A;  1Q81 4;  2OTL 3;  1NB3 I;  1IVW A;  1KC8 4;  4WYK A;  3EX9 A;  1OHO A;  1I2G A;  5M19 A;  1X1W A;  3EQQ B;  3SLU A;  1BUQ A;  1AVL A;  3AHS A;  4IT7 A;  5AIF A;  6GSP A;  1W00 A;  2CWT A;  1AVK A;  1BRJ A;  1Q40 B;  3BND A;  5HOH A;  1YIT 3;  4N6T A;  1DMQ A;  3CPW 2;  3UB1 A;  3VSY A;  5IG0 A;  3AMO B;  1IYY A;  1IU7 A;  1OHS A;  2O3O A;  4L8P A;  3BNE A;  1KD1 4;  1JJ2 2;  2WOF A;  1BNG A;  3AGO A;  1YVS A;  2XGN A;  1BRN L;  4AKZ A;  1YGW A;  1JBS A;  3NM7 A;  3LTB A;  4KZ1 A;  1FUT A;  1BRK A;  1OCV A;  1D6Y A;  3N9H A;  1Y4K A;  1EQK A;  1RTU A;  2KXG A;  4NPB A;  5IG4 A;  1B3S A;  1QAK A;  4HM7 B;  1MWU A;  6STD A;  2UUG C;  1V74 A;  1GS3 A;  5FGO A;  2CHC A;  4HZ9 B;  1KQS 2;  1RN7 A;  1QMA A;  2CX1 A;  1BRH A;  4FMD A;  1VQQ A;  1IT8 A;  4STD A;  1S72 3;  3K5T A;  4X2O A;  4X2H A;  1BUJ A;  1LNI A;  1IT7 A;  3D5I A;  1I8V A;  1IQX A;  1HU9 A;  2HMM B;  2R41 A;  3CC7 3;  1GY5 A;  5RNT A;  4H3U A;  3X41 A;  3Q2P A;  1B21 A;  2JDI H;  1N5P A;  5D81 A;  2H0G A;  5G1K A;  2HMJ B;  2XEP A;  2GEX A;  2GEY A;  1I70 A;  2SAR A;  5IEN A;  2L1S A;  2P0M A;  2OQE A;  3MSO A;  2INX A;  3DGO A;  4MMY B;  4XDW A;  1I0V A;  1T2H A;  1JNQ A;  2BNG A;  2IUJ A;  2QGU A;  4HM0 B;  3EF8 A;  1K73 4;  2H0I A;  1RSN A;  3CCU 3;  3JUP A;  3K63 A;  1W2Z A;  3A76 A;  1SJW A;  1JBT A;  1JZD A;  1BSC A;  4HM8 B;  1RGE A;  1LXE A;  1Q40 A;  1RGA A;  1WQL B;  2K3D A;  4WHA A;  3CCJ 3;  2BU4 A;  3T8U A;  1LVN A;  1AV4 A;  3KE7 A;  4EBG A;  1K28 A;  1J2B A;  3LT8 A;  5ELJ A;  1GMP A;  1RGH A;  1OH0 A;  4HM2 B;  2Z76 A;  2CW9 A;  3PYJ A;  3S27 A;  5AYS C;  4I4K A;  1ROA A;  2OOV A;  4HM3 B;  3SVA A;  1LNH A;  1N5H A;  1JKG A;  2L4V A;  3UL6 A;  2H0H A;  3DUK A;  3B4P A;  2W04 A;  3EHC A;  3D3L A;  1I3F A;  1UCL A;  2F5W A;  2OWP A;  3G8Z A;  4FCZ A;  1M9G A;  4N6L A;  2CX0 A;  3F7X A;  1NDO B;  3I56 3;  1MGW A;  1RNT A;  3JUN A;  3AGN A;  2J8X B;  1VQ8 3;  3NQY A;  3U1W A;  9RNT A;  1RHL A;  1KWI A;  1WTH A;  4FR9 A;  1QVG 2;  1TFO A;  2XFT A;  2ML6 A;  3B4O A;  1PU4 A;  2CWU A;  3RDE A;  1NJI 4;  3V98 A;  2CFL A;  1K9M 4;  1LQG C;  3GZR A;  1FGQ A;  4LMI A;  1CH0 A;  1GY6 A;  2MF7 A;  3OWS A;  3WOE B;  1PY3 A;  1B20 A;  7STD A;  2Y73 A;  3X3Y A;  1MWS A;  3PGB A;  1AR0 A;  1MWR A;  1R4C A;  3KCH A;  3WOF B;  5TGN A;  3KKG A;  2CG1 A;  1IVV A;  1GD3 A;  1D6U A;  1ZX2 A;  2A15 A;  4NRE A;  3SOA A;  2ML5 A;  4BU4 A;  4BIR A;  1V57 A;  4HVN A;  4XBX A;  3X3X A;  1FUW A;  1PYL A;  1VQ7 3;  2YFJ B;  1WMP A;  3NBB A;  1HZ1 A;  1FW7 A;  2CH9 A;  2Q07 A;  4R4K A;  3MHE A;  4K1V A;  1B2S A;  1O7H B;  3DGY A;  1DYU A;  1YGE A;  1QVF 2;  4N6M A;  4N6O B;  1AY7 A;  2GBW B;  3M8C A;  4LSO A;  4AEQ A;  1VQO 3;  3FKA A;  1RCK A;  3JVC A;  3NM2 A;  3OX9 A;  1JN5 B;  4HZB B;  1RCL A;  1M1X B;  4MJD A;  1NO3 A;  3CC2 3;  1ULJ B;  2RBI A;  3NBR A;  2HMK B;  1W6Y A;  2LQV A;  4EV5 A;  4K61 A;  3F7S A;  1Q86 4;  1TTO A;  3LTA A;  1STF I;  3FZW A;  3PCR A;  1N9E A;  1JB2 A;  3F9S A;  2HMN B;  3VF1 A;  6RNT A;  4IPB A;  3NBJ A;  4XBT A;  1OF5 B;  1Z1S A;  1EA2 A;  1U8C B;  3H3H A;  3NUV A;  1MOL A;  1TJD A;  5LC6 A;  3X42 A;  5A0O B;  2F5M A;  2HML B;  4R9L A;  3BNC A;  4J8T A;  2K0M A;  3NXJ A;  1FYS A;  1B2U A;  1RGC A;  2BMQ B;  2O9U X;  4OK0 A;  2KRT A;  1JRQ A;  2P09 A;  3STD A;  1JKG B;  1CYU A;  2P05 A;  7GSP A;  1BNE A;  4HM1 B;  5EVH A;  4J5G A;  5AEU B;  3FH1 A;  1GOU A;  3PCS A;  1SQW A;  3WDG B;  2CFW A;  1N9J A;  2CWV A;  5IEP A;  3DY5 A;  2WOH A;  3NQZ A;  4KVH A;  2CFD A;  3KII A;  5DRE A;  3RGR A;  2Z77 A;  2RGQ A;  4HM6 B;  3SXX A;  2FXT A;  1QJG A;  1TRP A;  3VGN A;  2GU3 A;  2WGQ A;  1I2E A;  3FGY A;  2KF5 A;  3FG3 A;  3MG3 A;  3UNL A;  2CIU A;  3DH2 A;  3IMA B;  1BRG A;  3LT9 A;  5LC7 A;  1G0T A;  1OHP A;  2PZV A;  5KP1 A;  2IYJ A;  2OQE C;  1UDI I;  4ZM8 A;  1DVC A;  1K41 A;  3GZX B;  4JF8 A; 
#chains in the Genus database with same CATH homology
 1G96 A;  4J9A A;  3ECF A;  1WMN A;  3CD6 3;  1VZZ A;  4OVM A;  2GXF A;  1MNL A;  3CCE 3;  2E2U A;  4HYZ A;  5CK6 A;  1UI7 A;  4GL6 A;  3LXU X;  4RZM A;  1RKY A;  3LOY A;  4EV2 A;  5AI1 A;  3DZL A;  1JN5 A;  1IDP A;  2ZL8 A;  3F40 A;  3OW2 2;  2Y74 A;  1DMN A;  1FGO A;  2CC3 A;  4CCV A;  3NV0 B;  5IG3 A;  8CHO A;  2XFS A;  5G2G A;  2SBL A;  4O8S A;  2RSX A;  4RNZ A;  3RGA A;  2B1X B;  1YJW 3;  1OF5 A;  5CXO A;  1W2B 2;  2UX0 A;  1WNH A;  1OGZ A;  3KSP A;  3D9R A;  3CME 3;  3CCV 3;  3KN4 A;  3MKI A;  1FA3 A;  1NB5 I;  2B24 B;  2STD A;  3T8N A;  3T0U A;  3ROB A;  3WMD A;  4FMB A;  5D83 A;  3B8L A;  4FMC A;  1N8Q A;  3LYG A;  3CCM 3;  2F86 B;  1YI2 3;  3CCQ 3;  1C7H A;  1ASK A;  2XSH B;  3LZA A;  4H61 A;  2IMJ A;  1JV2 B;  4LGQ A;  3G6E 3;  3ALA A;  3GAX A;  4XBY A;  4K90 B;  2IA7 A;  2CFK A;  3OWY A;  4R9K A;  3OWU A;  5I97 A;  2XF3 A;  2CFG A;  1T5Y A;  3V99 A;  2OCT A;  3KFQ C;  1VQ6 3;  5IEO A;  2XR8 B;  2YFI B;  3EE1 A;  1F8N A;  1RRH A;  3CCL 3;  1QAL A;  1UUV B;  1Q7Y 4;  5IF6 A;  3FF2 A;  5AYR B;  4CDL A;  4O02 B;  3NHX A;  3F8X A;  1IV7 A;  2QIY A;  3K9M C;  3L0R A;  2GU1 A;  5DRV A;  3I55 3;  1L5G B;  2LYX A;  3FG1 A;  5STD A;  5AIG A;  4HM4 B;  1TP6 A;  2W2C A;  4OUQ A;  3K0Z A;  5CF1 A;  1FGT A;  3S29 A;  3QK9 A;  3Q90 A;  3SED A;  3IPT A;  2FNQ A;  1GY7 A;  3H51 A;  2W9Q A;  3NV0 A;  4JRF A;  2MC8 A;  4LZI A;  2YX9 A;  1A2V A;  3DGL A;  3G16 A;  1E97 A;  3N8B A;  3SX1 A;  2I9W A;  1W7C A;  2C11 A;  3BLZ A;  3MG2 A;  3S28 A;  3EBY A;  3CCR 3;  1ZO2 A;  1VQL 3;  1M90 4;  5CLK A;  3MWZ A;  2QEX 3;  2V1L A;  4WWU C;  4IIA A;  3DM8 A;  4MMZ B;  1JB4 A;  4HJL B;  3BNB A;  4XB5 A;  1GD4 A;  1EKM A;  1IQY A;  1ROV A;  4L8O A;  1ULI B;  1YJN 3;  3DGN A;  5ELU A;  1K8A 4;  4NHF A;  3JUM A;  1UI8 A;  4BTY A;  3K7C A;  3WA3 A;  4ORL A;  1VQP 3;  1IVU A;  2F98 A;  3B7C A;  3FG4 A;  3CNX A;  1QAF A;  4XM4 A;  2FGT A;  1W4N A;  2XGL A;  4O2H A;  1TUH A;  3FCS B;  2BMO B;  3F8H A;  3UL5 A;  3WOD G;  1DMM A;  2BMR B;  3ER7 A;  3J7Y d;  1NWW A;  1NU3 A;  3CC4 3;  1U5O A;  1VQN 3;  5AEW B;  1WMO A;  2R4I A;  2CG0 A;  1W01 A;  4KFD A;  1STD A;  4N6U A;  3LML A;  1DVD A;  1RRL A;  2WO0 A;  5FW5 A;  2W0Q A;  3LTD A;  2E2V A;  2QA4 3;  3HI7 A;  1O7P B;  2C10 A;  1OAC A;  1YVB I;  2OTJ 3;  1OUN A;  2M7O A;  1IV9 A;  3FF0 A;  3HK4 A;  4GB5 A;  1A90 A;  1GYB A;  3X40 A;  4PEJ A;  2D1W A;  1RJO A;  5BXQ A;  2XH9 A;  3EBT A;  2ZDJ A;  5EQL A;  3PZW A;  3N54 B;  3Q1C A;  3GZB A;  2WGO A;  3GZY B;  2W56 B;  1TU5 A;  3G4S 3;  2CKF B;  2W03 A;  3G0K A;  4HM5 B;  5D82 A;  3PS8 A;  2E2T A;  1FGR A;  2Z7A A;  1N8R 4;  5AII A;  3E99 A;  4BTX A;  2JQ5 A;  3EN8 A;  1HKX A;  2BHM A;  4N6N B;  3DXO A;  3HII A;  4R80 A;  3TDG A;  2W9P A;  4MEI A;  1S5A A;  2OOV C;  4KFF A;  4EC6 A;  3DGM A;  1LOX A;  1CYV A;  2RCD A;  3HIG A;  1JB5 A;  1CEW I;  4HBR A;  1OGX A;  2HMO B;  1YIJ 3;  4TX4 A;  4FMA A;  5JPP A;  3JUO A;  3O8Y A;  2D42 A;  1OPY A;  3MPH A;  3IJE B;  2XSO B;  3MYT A;  3NX0 A;  1E3V A;  4RBN A;  1VQ9 3;  4O3V A;  1W6C A;  3EN1 B;  2BT3 A;  2KCD A;  1SIH A;  3JUQ A;  1SPU A;  3X3Z A;  2RFR A;  5KP4 A;  1ISK A;  1IVX A;  1KSI A;  3GWR A;  5CF2 A;  1VQ5 3;  3AMO A;  3DMC A;  5AIH A;  2XRX B;  4WYK B;  4FCM A;  1YHQ 3;  1VQK 3;  4WP5 A;  1IQ8 A;  3CNM A;  3HX8 A;  5IW9 A;  1W02 A;  2F99 A;  1Q42 A;  1FGM A;  2CK3 H;  2Z6B A;  3OXA A;  4K1U A;  1O7N B;  1Q82 4;  1W5Z A;  5HGR A;  4RNY A;  1A2K A;  4EXR A;  3S5C A;  3LH4 A;  4R1K A;  1CQS A;  2PNC A;  3CCS 3;  1O7M B;  3EJV A;  3KZT A;  2W6J H;  3I0Y A;  4L7K A;  4MMX B;  2W56 A;  2BO9 B;  3F14 A;  3EC9 A;  1UUW B;  4G1M B;  1UW1 A;  3HZP A;  1SII A;  4EYC A;  3FLJ A;  4BTW A;  3CPO A;  1D6Z A;  2P0X A;  3BB9 A;  2IUK A;  4XDV A;  4HKV B;  4WFO A;  3SOY A;  5EEO A;  1TIJ A;  3FSD A;  4AKY A;  2GBX B;  1O7W B;  3CU3 A;  3MG1 A;  1TFK A;  3UJM A;  1YJ9 3;  5KP3 A;  5JBS A;  1IK3 A;  1EG9 B;  2YFL B;  1US1 A;  5IER A;  1VQ4 3;  1PFP A;  4Q53 A;  3GRD A;  3LTC A;  3EB8 A;  4FCJ A;  1E3R A;  1A67 A;  2P38 A;  3G71 3;  4KFE A;  5IG5 A;  1O7G B;  3U97 A;  1VQM 3;  3QRD A;  3WA2 X;  2K54 A;  4LEH A;  1M1K 4;  1W6G A;  4U13 A;  4QWT A;  3OV4 A;  3V92 A;  3CMA 3;  4N3V A;  4N6V 0;  3S67 A;  5BVB A;  5JPU A;  3KSE D;  3CXC 2;  3PXM A;  1Q81 4;  2OTL 3;  1NB3 I;  1IVW A;  1KC8 4;  4WYK A;  3EX9 A;  1OHO A;  3EQQ B;  3SLU A;  1BUQ A;  1AVL A;  5AIF A;  4IT7 A;  1W00 A;  2CWT A;  1AVK A;  1Q40 B;  3BND A;  1YIT 3;  4N6T A;  1DMQ A;  3CPW 2;  3UB1 A;  3VSY A;  5IG0 A;  3AMO B;  1IU7 A;  1OHS A;  2O3O A;  4L8P A;  3BNE A;  1KD1 4;  1JJ2 2;  2WOF A;  2XGN A;  4AKZ A;  3NM7 A;  3LTB A;  4KZ1 A;  1OCV A;  1D6Y A;  3N9H A;  1Y4K A;  1EQK A;  2KXG A;  5IG4 A;  1QAK A;  4HM7 B;  6STD A;  1V74 A;  1GS3 A;  5FGO A;  2CHC A;  4HZ9 B;  1KQS 2;  1RN7 A;  1QMA A;  4FMD A;  1IT8 A;  4STD A;  1S72 3;  3K5T A;  4X2O A;  4X2H A;  1IT7 A;  1IQX A;  1HU9 A;  2HMM B;  3CC7 3;  1GY5 A;  4H3U A;  3X41 A;  3Q2P A;  2JDI H;  1N5P A;  5D81 A;  2HMJ B;  2XEP A;  2GEX A;  2GEY A;  5IEN A;  2P0M A;  2OQE A;  3MSO A;  2INX A;  3DGO A;  4MMY B;  4XDW A;  1JNQ A;  2BNG A;  2IUJ A;  2QGU A;  4HM0 B;  3EF8 A;  1K73 4;  3CCU 3;  3JUP A;  3K63 A;  1W2Z A;  3A76 A;  1SJW A;  4HM8 B;  1LXE A;  1Q40 A;  1WQL B;  4WHA A;  3CCJ 3;  3T8U A;  1LVN A;  1AV4 A;  3KE7 A;  4EBG A;  1K28 A;  1J2B A;  3LT8 A;  5ELJ A;  4HM2 B;  1OH0 A;  2Z76 A;  2CW9 A;  3PYJ A;  3S27 A;  5AYS C;  4I4K A;  1ROA A;  2OOV A;  4HM3 B;  3SVA A;  1LNH A;  1N5H A;  1JKG A;  2L4V A;  3UL6 A;  3DUK A;  3B4P A;  2W04 A;  3EHC A;  3D3L A;  3G8Z A;  4FCZ A;  2OWP A;  4N6L A;  1M9G A;  3F7X A;  1NDO B;  3I56 3;  3JUN A;  1VQ8 3;  3NQY A;  3U1W A;  1KWI A;  1WTH A;  4FR9 A;  1QVG 2;  1TFO A;  2XFT A;  2ML6 A;  3B4O A;  1PU4 A;  2CWU A;  3RDE A;  1NJI 4;  3V98 A;  2CFL A;  1K9M 4;  3GZR A;  1FGQ A;  4LMI A;  1GY6 A;  2MF7 A;  3OWS A;  3WOE B;  7STD A;  2Y73 A;  3X3Y A;  3PGB A;  1AR0 A;  1R4C A;  3WOF B;  5TGN A;  3KKG A;  2CG1 A;  1IVV A;  1GD3 A;  1D6U A;  1ZX2 A;  2A15 A;  4NRE A;  3SOA A;  2ML5 A;  4HVN A;  4XBX A;  3X3X A;  1FUW A;  1VQ7 3;  2YFJ B;  1WMP A;  3NBB A;  2CH9 A;  2Q07 A;  4R4K A;  3MHE A;  4K1V A;  1O7H B;  1DYU A;  1YGE A;  1QVF 2;  4N6M A;  4N6O B;  2GBW B;  3M8C A;  4LSO A;  4AEQ A;  1VQO 3;  3FKA A;  3JVC A;  3NM2 A;  3OX9 A;  4HZB B;  1JN5 B;  4MJD A;  1M1X B;  3CC2 3;  1NO3 A;  1ULJ B;  3NBR A;  2HMK B;  1W6Y A;  2LQV A;  4EV5 A;  4K61 A;  3F7S A;  1Q86 4;  3LTA A;  1STF I;  3FZW A;  3PCR A;  1N9E A;  1JB2 A;  3F9S A;  2HMN B;  3VF1 A;  4IPB A;  3NBJ A;  4XBT A;  1OF5 B;  1Z1S A;  1EA2 A;  1U8C B;  3H3H A;  3NUV A;  1MOL A;  3X42 A;  5LC6 A;  5A0O B;  2HML B;  4R9L A;  3BNC A;  4J8T A;  2K0M A;  3NXJ A;  2BMQ B;  4OK0 A;  2O9U X;  2KRT A;  1JRQ A;  2P09 A;  3STD A;  1JKG B;  1CYU A;  2P05 A;  4HM1 B;  5EVH A;  5AEU B;  3FH1 A;  3PCS A;  3WDG B;  1SQW A;  5IEP A;  2CFW A;  1N9J A;  2CWV A;  3DY5 A;  2WOH A;  3NQZ A;  4KVH A;  2CFD A;  3KII A;  5DRE A;  3RGR A;  2Z77 A;  2RGQ A;  4HM6 B;  3SXX A;  2FXT A;  1QJG A;  3VGN A;  2GU3 A;  2WGQ A;  3FGY A;  3FG3 A;  3MG3 A;  3UNL A;  2CIU A;  3IMA B;  3LT9 A;  5LC7 A;  1OHP A;  2PZV A;  5KP1 A;  2OQE C;  4ZM8 A;  1DVC A;  1K41 A;  3GZX B;  4JF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...