2P09A

Structural insights into the evolution of a non-biological protein
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
69
structure length
69
Chain Sequence
DDDDKKTNWLKRIYRVRPCVKCKVAPRDWKVKNKHLRIYNMCKTCFNNSIDIGDDTYHGHVDWLMYADS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the evolution of a non-biological protein: importance of surface residues in protein fold optimization.
pubmed doi rcsb
source organism Unidentified
molecule tags De novo protein
molecule keywords a non-biological ATP binding protein with two mutations N32D
total genus 19
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2007-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.210 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2p09A00
3LTAA 3LT9A 3LT8A 3LTBA 3DGOA 1UW1A 3DGLA 3DGNA 2P0XA 3LTCA 3LTDA 2P05A 2P09A 3DGMA
chains in the Genus database with same CATH superfamily
5BIRA 1A2KA 2XFSA 2CFGA 5FW5A 3T8UA 2K3DA 1RSNA 3AMOB 1PU4A 4CDLA 2O9UX 1ULIB 2P09A 2R41A 4K90B 3KCHA 1JN5A 4X2OA 5HGRA 5KP4A 2WGQA 1DVCA 3ALAA 1HU9A 1S5AA 3EN1B 4BTWA 2LYXA 1V74A 1BUJA 1BNGA 3F40A 3GSPA 1RLSA 1YVSA 3DGLA 4O3VA 1Q7Y4 1NJI4 2FNQA 3ZG5A 3V98A 1BNJA 1VQ43 4HBRA 1I2FA 2CG0A 5IW9A 1LRAA 1B2SA 1FUTA 4N6NB 3SXXA 3F14A 2B24B 3I563 2BT3A 1I0XA 2P05A 1DMMA 3IMAB 1VZZA 1W6YA 1OF5B 2CW9A 4HVNA 2W2CA 2IY2A 3QK9A 2SARA 2KF4A 4BL3A 2KXGA 1NNVA 2ML5A 2W9PA 3LZAA 1Q7HA 1BVIA 4JRFA 3O8YA 1SQWA 4BTYA 1FW7A 3JUQA 1LOVA 2WGOA 3DY5A 3WODG 2BO9B 1UGIA 2HMMB 1JZDA 4OVMA 1F8NA 1QVF2 3Q1CA 8CHOA 3PCSA 2JQ5A 3QRDA 2CG1A 1A67A 4O02B 3SVAA 5IERA 1T2HA 5AIGA 1WNHA 1HKXA 2XH9A 3V92A 1KSIA 4WWUC 1EEJA 5AYSC 3X3ZA 1OCVA 1BSBA 1MGRA 3JVCA 2QIYA 1FGOA 3NQYA 3MYTA 4X2HA 1N5PA 4XM4A 1OPYA 1FUSA 4EBGA 1NDOB 4H3UA 1YIJ3 3RGRA 1A90A 2XEPA 1RGGA 1UW1A 2KCDA 3PS8A 1TRQA 1V57A 3CU3A 3CCS3 1U5OA 3BNBA 1LVNA 1K9M4 4N6MA 1N9JA 4R1KA 1O7WB 1ZGXA 2ZL8A 2ZA4A 2V1LA 5IG0A 4R9KA 3ER7A 1UGHI 3I553 1BU4A 1EKMA 5M18A 1GMRA 1X1XA 4O2HA 1RGKA 4N3VA 1Y4KA 1ZO2A 1BSAA 1V58A 3NV0A 2JDIH 4FCJA 3KE7A 3SOAA 5AYRB 4J8TA 1SPUA 3KSED 3BB9A 5TGNA 2LQVA 1ROVA 4LMIA 1BOXA 3OWSA 5HOHA 2HMNB 1DYUA 2BMRB 1X1UA 2Z7AA 1TFKA 3HIGA 3IPTA 3SLUA 5AEWB 4U13A 2MF7A 1Q864 1I8VA 2HMJB 1AR0A 4JF8A 1STDA 4WP5A 1IK3A 3DGYA 3Q3FA 1FZUA 1O7NB 1KC84 3KN4A 3GWRA 2YX9A 1AVLA 5AIHA 1OHOA 3FCSB 3CC73 1HYFA 1GSPA 4XBXA 3DUKA 3EF8A 3KKGA 1OF5A 1B2MA 2UX0A 3OWYA 4MEIA 1WMNA 1SIHA 5EQLA 3MG3A 1YI23 1TUHA 1JB4A 2W9QA 3VGNA 1ZS7A 2Z6BA 3N8BA 3NM2A 3UL6A 2CIUA 3FLJA 2GEXA 2IMJA 1HZ1A 4HM0B 3FF0A 3X40A 3K5TA 4EW5A 1O7HB 4MMYB 3CCM3 2CX0A 1JB5A 2F5MA 2HMKB 3FGYA 2GXFA 3AGOA 1IVUA 1E3VA 2QGUA 2KF3A 2W04A 1MWRA 5JPUA 2RGQA 3LYGA 4N6OB 2HMOB 3KSPA 2ZHXB 1VQO3 1YJ93 3EHCA 3BNEA 5IEOA 3NUVA 3EC9A 1E97A 1ASKA 3LTBA 5EEOA 3AMOA 4HKVB 1M1XB 3UJMA 1WTHA 4EC6A 5EVHA 4FMCA 1US1A 1Q824 2W0QA 4WHAA 3AHSA 3NQZA 4IIAA 3CME3 2FGTA 1B20A 2QEX3 3EN8A 5LC6A 3SEDA 5JBSA 3K63A 1LQMB 1STFI 4ORLA 4KT3B 1DETA 2QA43 3OV4A 3CC43 1VQP3 1B2XA 4K1UA 3F8HA 4AKYA 4AEQA 5CK6A 1QAKA 1VQK3 1B21A 2KAAA 3G6E3 2OCTA 1X1WA 1RGHA 1TIJA 4NPBA 1EG9B 1I3IA 3WOEB 1MWSA 2OOVC 4R4KA 3CCR3 1PYLA 3FG3A 1GOVA 1BUQA 1LNHA 1RNTA 3L0RA 1Z1SA 4I4KA 1OH0A 4HM3B 1PFPA 3K9MC 1B2ZA 5D83A 1YGWA 1Q40B 1X1YA 3LT8A 3CMA3 2C11A 2RBIA 1BRJA 3WDGB 3PZWA 1RRHA 2RNTA 4GB5A 3STDA 3LMLA 3KZTA 4GL6A 3NM7A 5DRVA 1AY7A 2BMOB 2RSXA 1JKGA 2FXTA 2W6JH 1MNLA 1JZOA 1TFOA 1UCKA 4G1MB 1RGLA 3IJEB 1FGQA 3H3HA 2INXA 4NREA 3X41A 1TTOA 4ZM8A 3OW22 2H0HA 1T3BA 4IT7A 3CD63 1BSDA 3LH4A 2F99A 1AV4A 2Q07A 1M9GA 4Q53A 5GSPA 1DVDA 4LYLB 1WMOA 3HZPA 1BRNL 3TDGA 4KVHA 4MJDA 7RNTA 1UCIA 3ECFA 5CLKA 5M19A 1RNBA 1UUGB 3BU4A 1J2BA 5IG3A 1KD14 1DMQA 1W02A 4EV5A 3PCRA 1YJN3 2W56B 2F98A 4R9LA 2WO0A 3D79A 2GSPA 2W56A 3WR2A 1CQSA 2Y73A 7STDA 3N54B 4TX4A 3H51A 2P0XA 3UL5A 4HOHA 5G1LA 4EXRA 1FA3A 5D81A 4O8SA 5IG5A 1R4YA 1I70A 5AI1A 1RRLA 4HM1B 5DREA 2BMQB 2UUGC 1DMNA 1RCLA 1GS3A 1TJDA 2XSOB 1G02A 3FZWA 3DM8A 1MOLA 2KRTA 1B3SA 1IVXA 4ILFA 1I2GA 2P38A 4BU4A 1N5HA 3DGMA 1FYSA 4KFFA 4N6TA 2BNGA 2A15A 1NU3A 4K61A 2HMLB 3D9RA 3I0YA 3BNDA 4LGQA 1CYVA 2ZDJA 1GY5A 3X42A 2F5WA 3K7CA 3JUPA 3RGAA 2XF3A 3S67A 5G1KA 3DXOA 2XGNA 4GSPA 1TU5A 3D4AA 3PYJA 5FGOA 2OQEA 1W6CA 5JPPA 2K0MA 5STDA 1UI8A 2YFJB 3RDEA 2OWPA 3ZG0A 3NXJA 4RNZA 5IEPA 3NHXA 1VQ73 1W01A 2CHCA 4DKIA 1GOUA 1BSEA 4HZBB 1JV2B 3HI7A 5AIIA 5IENA 1FGTA 1WQLB 1EA2A 4MMXB 2F56A 2E2VA 1B27A 3EB8A 1IV7A 3SX1A 3CCE3 1LQGC 1VQ93 1I3FA 2D1WA 4WYKB 1VQM3 1JKGB 1O7GB 1UCJA 1BRGA 2O3OA 2YFIB 3JUNA 4BL2A 4HM4B 2Z76A 1GY6A 1JN5B 3DZLA 1CH0A 3ROBA 4J5GA 3NBBA 1RCKA 1BGSA 1UDII 1IT8A 3OWUA 4WFOA 3D5GA 1BRHA 3F7SA 1SJWA 3B4PA 4KFEA 1LNIA 1A2VA 2M7OA 3FSDA 3MSOA 3VF1A 4LZIA 4L8OA 5AIFA 2XR8B 1OHSA 4RNYA 1Q9EA 1K734 3WA3A 4HZ9B 1IV9A 1I0VA 2RCDA 3A76A 3FG1A 2K54A 1IYYA 2E2TA 3CCQ3 4KZ1A 1EQKA 1D6ZA 2CFLA 2CX1A 1UUVB 3WMDA 3S27A 1JJ22 1W4NA 2SBLA 3SOYA 3SYUA 1M904 1B2UA 5CXOA 1BNRA 2XSHB 1PY3A 3MHEA 3DH2A 1NB3I 2Y74A 3BIRA 3WOFB 1LOXA 2ML6A 6RNTA 3VSYA 1LOWA 4HM8B 5CF1A 5LC7A 4LSOA 3N9HA 3K0ZA 1RGCA 1L5GB 2F4YA 3CC23 5CF2A 1VQ83 2C4BA 2CWUA 4RZMA 1RN4A 1KQS2 3DGNA 1RMSA 3PXMA 1BSCA 4N6UA 1NWWA 1QALA 2CH9A 3HX8A 4K1VA 3U1WA 3KIIA 1OUNA 2MC8A 1IVWA 3F8XA 3CCV3 1BRKA 2OQEC 4AKZA 2IA7A 4J5KA 3LTDA 1JBTA 1ISKA 5RNTA 1FGMA 1E3RA 3G0KA 3CCL3 1W6GA 1IQ8A 3CNMA 3UNLA 1YIT3 5BXQA 1S723 2GU3A 2L4VA 4PEJA 1VQN3 2WOHA 3UB1A 3B7CA 3AGNA 4FMAA 4N6LA 2BIRA 2IUJA 3KFQC 4OUQA 2XFTA 3CPW2 1RKYA 4EV2A 1K41A 2I9WA 1WMPA 1UUWB 4XB5A 2L1SA 1EUIC 6STDA 4HAAA 3U97A 1C54A 4HYZA 1G96A 1SIIA 3EX9A 4CPKA 3WA2X 1T5YA 1RJOA 4NHFA 4R80A 3PGBA 5G2GA 1UCLA 5IG4A 3G4S3 2CK3H 2F86B 3BNCA 2STDA 4H61A 2PNCA 3RNTA 2AAEA 4EYCA 4BTXA 1OACA 4XBTA 5I97A 1RN1A 1IDPA 4STDA 3GAXA 3LOYA 4RNTA 1BNIA 1GMPA 1LOYA 3G16A 8RNTA 1RN7A 4FR9A 2XGLA 3HOHA 1K8A4 3OX9A 2RFRA 3D5IA 4MMZB 1NB5I 3MPHA 1C7HA 1IQXA 3FF2A 3JUMA 4N6V0 5D82A 1BIRA 1QVG2 5ELUA 4CJNA 4HM2B 1RGEA 2KF5A 3CNXA 2IYJA 3HIIA 1T2IA 2W03A 5BVBA 9RNTA 4I5QA 1N8R4 2CWTA 1Q42A 5KP3A 2AADA 2HOHA 1QAFA 1RHLA 3NX0A 1AQZA 3EQQB 5KP1A 1I2EA 1IU7A 3OXAA 1FGRA 1IT7A 1GD3A 1LXEA 4WYKA 1BAOA 2E2UA 1M1K4 3DMCA 3NV0B 3CXC2 1N8QA 3X3YA 1W2ZA 5IF6A 1TRPA 2IUKA 3S5CA 1N9EA 3GZYB 2CC3A 3Q90A 4LEHA 3S28A 1FUWA 3E99A 3Q2PA 1YVBI 4CCVA 1BRSA 2D42A 1W2B2 1BNEA 1O7MB 1ZX2A 4XBYA 1CYUA 1BNFA 1JB2A 2OOVA 2YFLB 4OK0A 3LTAA 2GBWB 5M1AA 2CFWA 1SARA 2KF6A 1RDSA 2P0MA 3J7Yd 3EBYA 3MKIA 1BANA 4XDVA 2H0GA 4FCMA 3FH1A 3GZRA 1BRIA 4L8PA 1JBSA 3T0UA 1A2PA 1GYBA 2GEYA 3NBJA 3EE1A 4HM6B 1OGZA 1D6UA 1NO3A 4FMBA 1MGWA 3G713 3FKAA 4HM5B 5BU4A 1IVVA 3JUOA 3FG4A 1G0TA 3B8LA 3V99A 3WHOA 6GSPA 1YNVX 4BIRA 1VQL3 1R4CA 4RBNA 2OTJ3 4L7KA 1VQQA 2CKFB 1GMQA 1OHPA 1YJW3 3ZFZA 3LTCA 1BNSA 1ULJB 2CFDA 2J8XB 1GOYA 3CPOA 2CFKA 1CEWI 1D6YA 1KWIA 1MWTA 3LT9A 4FCZA 7GSPA 1VQ53 3F9SA 3GRDA 1RGAA 3S29A 1OGXA 1W5ZA 2PZVA 3G8ZA 3MG1A 3NBRA 1JNQA 3A5EA 1IQYA 2BU4A 2H0IA 1QMAA 1W00A 2OTL3 1Q40A 5A0OB 2XRXB 3AHWA 1JBRA 2C10A 1YGEA 1U8CB 2BHMA 2UGIA 4HJLB 2Z77A 5AEUB 1K28A 1TP6A 4J9AA 1JRQA 3T8NA 3DGOA 5ELJA 3GZXB 3MG2A 3MWZA 1Q814 3EBTA 3EJVA 2GU1A 3M8CA 4QWTA 1QJGA 1RGFA 3CCU3 3LXUX 1ROAA 4GHOA 4IPBA 1GY7A 1W7CA 3D3LA 3GZBA 4XDWA 2R4IA 1GD4A 1VQ63 1MWUA 1DE3A 3URPA 1AVKA 1YHQ3 3B4OA 3F7XA 3X3XA 1O7PB 4KFDA 3BLZA 4HM7B 1UI7A 4FMDA 3CCJ3 3HK4A 2B1XB 2GBXB 2CWVA 1RTUA 2WOFA
chains in the Genus database with same CATH topology
1A2KA 2XFSA 2CFGA 5FW5A 3T8UA 3AMOB 1PU4A 4CDLA 2O9UX 1ULIB 2P09A 4K90B 1JN5A 4X2OA 5HGRA 5KP4A 2WGQA 1DVCA 3ALAA 1HU9A 1S5AA 3EN1B 4BTWA 2LYXA 1V74A 3F40A 3DGLA 4O3VA 1Q7Y4 1NJI4 2FNQA 3V98A 1VQ43 4HBRA 5IW9A 2CG0A 4N6NB 3SXXA 3F14A 2B24B 3I563 2BT3A 2P05A 1DMMA 3IMAB 1VZZA 1W6YA 1OF5B 2CW9A 4HVNA 2W2CA 3QK9A 2KXGA 2ML5A 2W9PA 3LZAA 4JRFA 3O8YA 1SQWA 4BTYA 3JUQA 2WGOA 3DY5A 3WODG 2BO9B 2HMMB 4OVMA 1F8NA 1QVF2 3Q1CA 8CHOA 3PCSA 2JQ5A 3QRDA 2CG1A 1A67A 4O02B 3SVAA 5IERA 5AIGA 1WNHA 1HKXA 2XH9A 3V92A 1KSIA 4WWUC 5AYSC 3X3ZA 1OCVA 3JVCA 2QIYA 1FGOA 3NQYA 3MYTA 4X2HA 1N5PA 4XM4A 1OPYA 4EBGA 1NDOB 4H3UA 1YIJ3 3RGRA 1A90A 2XEPA 1UW1A 2KCDA 3PS8A 3CU3A 3CCS3 1U5OA 3BNBA 1LVNA 1K9M4 4N6MA 1N9JA 4R1KA 1O7WB 2ZL8A 5IG0A 2V1LA 4R9KA 3ER7A 3I553 1EKMA 4O2HA 4N3VA 1Y4KA 1ZO2A 3NV0A 2JDIH 4FCJA 3KE7A 3SOAA 5AYRB 4J8TA 1SPUA 3KSED 3BB9A 5TGNA 2LQVA 1ROVA 4LMIA 3OWSA 2HMNB 1DYUA 2BMRB 2Z7AA 1TFKA 3HIGA 3IPTA 3SLUA 5AEWB 4U13A 2MF7A 1Q864 2HMJB 1AR0A 4JF8A 1STDA 4WP5A 1IK3A 1O7NB 1KC84 3KN4A 3GWRA 2YX9A 1AVLA 5AIHA 1OHOA 3FCSB 3CC73 4XBXA 3DUKA 3EF8A 3KKGA 1OF5A 2UX0A 3OWYA 4MEIA 1WMNA 1SIHA 5EQLA 3MG3A 1YI23 1TUHA 1JB4A 2W9QA 3VGNA 2Z6BA 3N8BA 3NM2A 3UL6A 2CIUA 3FLJA 2GEXA 2IMJA 4HM0B 3X40A 3FF0A 3K5TA 1O7HB 4MMYB 3CCM3 1JB5A 2HMKB 3FGYA 2GXFA 1IVUA 1E3VA 2QGUA 2W04A 5JPUA 2RGQA 3LYGA 4N6OB 2HMOB 3KSPA 1VQO3 1YJ93 3EHCA 3BNEA 5IEOA 3NUVA 3EC9A 1E97A 1ASKA 3LTBA 5EEOA 3AMOA 4HKVB 1M1XB 3UJMA 1WTHA 4EC6A 5EVHA 4FMCA 1US1A 1Q824 2W0QA 4WHAA 3NQZA 4IIAA 3CME3 2FGTA 2QEX3 3EN8A 5LC6A 3SEDA 5JBSA 3K63A 4ORLA 1STFI 2QA43 3OV4A 3CC43 1VQP3 4K1UA 3F8HA 4AKYA 4AEQA 5CK6A 1QAKA 1VQK3 3G6E3 2OCTA 1TIJA 1EG9B 3WOEB 2OOVC 4R4KA 3CCR3 3FG3A 1BUQA 1LNHA 3L0RA 1Z1SA 4I4KA 1OH0A 4HM3B 1PFPA 3K9MC 5D83A 1Q40B 3LT8A 3CMA3 2C11A 3WDGB 3PZWA 1RRHA 4GB5A 3STDA 3LMLA 3KZTA 4GL6A 3NM7A 5DRVA 2BMOB 2RSXA 1JKGA 2FXTA 2W6JH 1MNLA 1TFOA 4G1MB 3IJEB 1FGQA 3H3HA 2INXA 4NREA 3X41A 4ZM8A 3OW22 4IT7A 3CD63 3LH4A 2F99A 1AV4A 2Q07A 1M9GA 4Q53A 1DVDA 1WMOA 3HZPA 3TDGA 4KVHA 4MJDA 3ECFA 5CLKA 1J2BA 5IG3A 1KD14 1DMQA 1W02A 4EV5A 3PCRA 1YJN3 2W56B 2F98A 4R9LA 2WO0A 2W56A 1CQSA 2Y73A 7STDA 3N54B 4TX4A 3H51A 2P0XA 3UL5A 4EXRA 1FA3A 5D81A 4O8SA 5IG5A 5AI1A 1RRLA 4HM1B 5DREA 2BMQB 1DMNA 1GS3A 2XSOB 3FZWA 3DM8A 1MOLA 2KRTA 1IVXA 2P38A 1N5HA 3DGMA 4KFFA 4N6TA 2BNGA 2A15A 1NU3A 4K61A 2HMLB 3D9RA 3I0YA 3BNDA 4LGQA 1CYVA 2ZDJA 1GY5A 3X42A 3K7CA 3JUPA 3RGAA 2XF3A 3S67A 3DXOA 2XGNA 1TU5A 3PYJA 5FGOA 2OQEA 1W6CA 5JPPA 2K0MA 5STDA 1UI8A 2YFJB 3RDEA 2OWPA 3NXJA 4RNZA 5IEPA 3NHXA 1VQ73 1W01A 2CHCA 4HZBB 1JV2B 3HI7A 5AIIA 5IENA 1FGTA 1WQLB 1EA2A 4MMXB 3EB8A 2E2VA 3CCE3 1IV7A 3SX1A 1VQ93 2D1WA 4WYKB 1VQM3 1JKGB 1O7GB 2YFIB 2O3OA 3JUNA 4HM4B 2Z76A 1GY6A 1JN5B 3DZLA 3ROBA 3NBBA 1IT8A 3OWUA 4WFOA 3F7SA 1SJWA 3B4PA 4KFEA 3FSDA 1A2VA 2M7OA 3MSOA 3VF1A 4LZIA 4L8OA 5AIFA 2XR8B 1OHSA 4RNYA 1K734 3WA3A 4HZ9B 1IV9A 3FG1A 2RCDA 3A76A 2K54A 2E2TA 3CCQ3 4KZ1A 1EQKA 1D6ZA 2CFLA 1UUVB 3WMDA 3S27A 1JJ22 1W4NA 2SBLA 3SOYA 1M904 5CXOA 2XSHB 3MHEA 1NB3I 2Y74A 3WOFB 1LOXA 2ML6A 3VSYA 4HM8B 5CF1A 5LC7A 4LSOA 3N9HA 3K0ZA 1VQ83 1L5GB 3CC23 5CF2A 4RZMA 2CWUA 1KQS2 3DGNA 4N6UA 3PXMA 1NWWA 1QALA 2CH9A 3HX8A 4K1VA 3U1WA 3KIIA 1OUNA 2MC8A 1IVWA 3F8XA 3CCV3 2OQEC 4AKZA 2IA7A 3LTDA 1ISKA 1FGMA 1E3RA 3G0KA 3CCL3 1W6GA 1IQ8A 3CNMA 3UNLA 1YIT3 5BXQA 1S723 2GU3A 2L4VA 4PEJA 1VQN3 2WOHA 3UB1A 3B7CA 4FMAA 4N6LA 2IUJA 3KFQC 4OUQA 2XFTA 3CPW2 1RKYA 4EV2A 1K41A 2I9WA 1WMPA 1UUWB 4XB5A 6STDA 3U97A 4HYZA 1G96A 1SIIA 3EX9A 3WA2X 1T5YA 1RJOA 4NHFA 4R80A 3PGBA 5G2GA 5IG4A 3G4S3 2CK3H 2F86B 3BNCA 2STDA 4H61A 2PNCA 4EYCA 4BTXA 1OACA 4XBTA 5I97A 4STDA 1IDPA 3GAXA 3LOYA 3G16A 1RN7A 4FR9A 2XGLA 1K8A4 3OX9A 2RFRA 4MMZB 1NB5I 3MPHA 1C7HA 1IQXA 3FF2A 3JUMA 4N6V0 5D82A 1QVG2 5ELUA 4HM2B 3CNXA 3HIIA 2W03A 5BVBA 1N8R4 2CWTA 1Q42A 5KP3A 1QAFA 3NX0A 3EQQB 5KP1A 1IU7A 3OXAA 1FGRA 1IT7A 1GD3A 1LXEA 4WYKA 2E2UA 1M1K4 3DMCA 3NV0B 3CXC2 1N8QA 3X3YA 1W2ZA 5IF6A 3S5CA 2IUKA 1N9EA 3GZYB 2CC3A 3Q90A 4LEHA 3S28A 1FUWA 3E99A 3Q2PA 1YVBI 4CCVA 1CYUA 2D42A 1W2B2 1O7MB 1ZX2A 4XBYA 1JB2A 2OOVA 2YFLB 4OK0A 3LTAA 2GBWB 2CFWA 2P0MA 3J7Yd 3EBYA 3MKIA 4XDVA 4FCMA 3FH1A 3GZRA 4L8PA 3T0UA 1GYBA 2GEYA 3NBJA 3EE1A 4HM6B 1OGZA 1D6UA 1NO3A 4FMBA 3G713 3FKAA 4HM5B 1IVVA 3JUOA 3FG4A 3V99A 3B8LA 1VQL3 1R4CA 4RBNA 2OTJ3 4L7KA 2CKFB 1OHPA 1YJW3 3LTCA 1ULJB 2CFDA 3CPOA 1CEWI 1D6YA 1KWIA 2CFKA 3LT9A 4FCZA 1VQ53 3F9SA 3GRDA 3S29A 1OGXA 1W5ZA 2PZVA 3G8ZA 3MG1A 3NBRA 1JNQA 1IQYA 1QMAA 1W00A 2OTL3 1Q40A 5A0OB 2XRXB 2C10A 1YGEA 1U8CB 2BHMA 4HJLB 2Z77A 5AEUB 1K28A 1TP6A 4J9AA 1JRQA 3T8NA 3DGOA 5ELJA 3GZXB 3MG2A 3MWZA 1Q814 3EBTA 3EJVA 2GU1A 3M8CA 4QWTA 1QJGA 3CCU3 3LXUX 1ROAA 4IPBA 1GY7A 1W7CA 3D3LA 3GZBA 4XDWA 2R4IA 1GD4A 1VQ63 1AVKA 1YHQ3 3B4OA 3F7XA 3X3XA 1O7PB 4KFDA 3BLZA 4HM7B 1UI7A 4FMDA 3CCJ3 3HK4A 2B1XB 2GBXB 2CWVA 2WOFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LTA A;  3LT9 A;  3LT8 A;  3LTB A;  3DGO A;  1UW1 A;  3DGL A;  3DGN A;  2P0X A;  3LTC A;  3LTD A;  2P05 A;  2P09 A;  3DGM A; 
#chains in the Genus database with same CATH topology
 5BIR A;  1A2K A;  2XFS A;  2CFG A;  5FW5 A;  3T8U A;  2K3D A;  1RSN A;  3AMO B;  1PU4 A;  4CDL A;  2O9U X;  1ULI B;  2P09 A;  2R41 A;  4K90 B;  3KCH A;  1JN5 A;  4X2O A;  5HGR A;  5KP4 A;  2WGQ A;  1DVC A;  3ALA A;  1HU9 A;  1S5A A;  3EN1 B;  4BTW A;  2LYX A;  1V74 A;  1BUJ A;  1BNG A;  3F40 A;  3GSP A;  1RLS A;  1YVS A;  3DGL A;  4O3V A;  1Q7Y 4;  1NJI 4;  2FNQ A;  3ZG5 A;  3V98 A;  1BNJ A;  1VQ4 3;  4HBR A;  1I2F A;  2CG0 A;  5IW9 A;  1LRA A;  1B2S A;  1FUT A;  4N6N B;  3SXX A;  3F14 A;  2B24 B;  3I56 3;  2BT3 A;  1I0X A;  2P05 A;  1DMM A;  3IMA B;  1VZZ A;  1W6Y A;  1OF5 B;  2CW9 A;  4HVN A;  2W2C A;  2IY2 A;  3QK9 A;  2SAR A;  2KF4 A;  4BL3 A;  2KXG A;  1NNV A;  2ML5 A;  2W9P A;  3LZA A;  1Q7H A;  1BVI A;  4JRF A;  3O8Y A;  1SQW A;  4BTY A;  1FW7 A;  3JUQ A;  1LOV A;  2WGO A;  3DY5 A;  3WOD G;  2BO9 B;  1UGI A;  2HMM B;  1JZD A;  4OVM A;  1F8N A;  1QVF 2;  3Q1C A;  8CHO A;  3PCS A;  2JQ5 A;  3QRD A;  2CG1 A;  1A67 A;  4O02 B;  3SVA A;  5IER A;  1T2H A;  5AIG A;  1WNH A;  1HKX A;  2XH9 A;  3V92 A;  1KSI A;  4WWU C;  1EEJ A;  5AYS C;  3X3Z A;  1OCV A;  1BSB A;  1MGR A;  3JVC A;  2QIY A;  1FGO A;  3NQY A;  3MYT A;  4X2H A;  1N5P A;  4XM4 A;  1OPY A;  1FUS A;  4EBG A;  1NDO B;  4H3U A;  1YIJ 3;  3RGR A;  1A90 A;  2XEP A;  1RGG A;  1UW1 A;  2KCD A;  3PS8 A;  1TRQ A;  1V57 A;  3CU3 A;  3CCS 3;  1U5O A;  3BNB A;  1LVN A;  1K9M 4;  4N6M A;  1N9J A;  4R1K A;  1O7W B;  1ZGX A;  2ZL8 A;  2ZA4 A;  2V1L A;  5IG0 A;  4R9K A;  3ER7 A;  1UGH I;  3I55 3;  1BU4 A;  1EKM A;  5M18 A;  1GMR A;  1X1X A;  4O2H A;  1RGK A;  4N3V A;  1Y4K A;  1ZO2 A;  1BSA A;  1V58 A;  3NV0 A;  2JDI H;  4FCJ A;  3KE7 A;  3SOA A;  5AYR B;  4J8T A;  1SPU A;  3KSE D;  3BB9 A;  5TGN A;  2LQV A;  1ROV A;  4LMI A;  1BOX A;  3OWS A;  5HOH A;  2HMN B;  1DYU A;  2BMR B;  1X1U A;  2Z7A A;  1TFK A;  3HIG A;  3IPT A;  3SLU A;  5AEW B;  4U13 A;  2MF7 A;  1Q86 4;  1I8V A;  2HMJ B;  1AR0 A;  4JF8 A;  1STD A;  4WP5 A;  1IK3 A;  3DGY A;  3Q3F A;  1FZU A;  1O7N B;  1KC8 4;  3KN4 A;  3GWR A;  2YX9 A;  1AVL A;  5AIH A;  1OHO A;  3FCS B;  3CC7 3;  1HYF A;  1GSP A;  4XBX A;  3DUK A;  3EF8 A;  3KKG A;  1OF5 A;  1B2M A;  2UX0 A;  3OWY A;  4MEI A;  1WMN A;  1SIH A;  5EQL A;  3MG3 A;  1YI2 3;  1TUH A;  1JB4 A;  2W9Q A;  3VGN A;  1ZS7 A;  2Z6B A;  3N8B A;  3NM2 A;  3UL6 A;  2CIU A;  3FLJ A;  2GEX A;  2IMJ A;  1HZ1 A;  4HM0 B;  3FF0 A;  3X40 A;  3K5T A;  4EW5 A;  1O7H B;  4MMY B;  3CCM 3;  2CX0 A;  1JB5 A;  2F5M A;  2HMK B;  3FGY A;  2GXF A;  3AGO A;  1IVU A;  1E3V A;  2QGU A;  2KF3 A;  2W04 A;  1MWR A;  5JPU A;  2RGQ A;  3LYG A;  4N6O B;  2HMO B;  3KSP A;  2ZHX B;  1VQO 3;  1YJ9 3;  3EHC A;  3BNE A;  5IEO A;  3NUV A;  3EC9 A;  1E97 A;  1ASK A;  3LTB A;  5EEO A;  3AMO A;  4HKV B;  1M1X B;  3UJM A;  1WTH A;  4EC6 A;  5EVH A;  4FMC A;  1US1 A;  1Q82 4;  2W0Q A;  4WHA A;  3AHS A;  3NQZ A;  4IIA A;  3CME 3;  2FGT A;  1B20 A;  2QEX 3;  3EN8 A;  5LC6 A;  3SED A;  5JBS A;  3K63 A;  1LQM B;  1STF I;  4ORL A;  4KT3 B;  1DET A;  2QA4 3;  3OV4 A;  3CC4 3;  1VQP 3;  1B2X A;  4K1U A;  3F8H A;  4AKY A;  4AEQ A;  5CK6 A;  1QAK A;  1VQK 3;  1B21 A;  2KAA A;  3G6E 3;  2OCT A;  1X1W A;  1RGH A;  1TIJ A;  4NPB A;  1EG9 B;  1I3I A;  3WOE B;  1MWS A;  2OOV C;  4R4K A;  3CCR 3;  1PYL A;  3FG3 A;  1GOV A;  1BUQ A;  1LNH A;  1RNT A;  3L0R A;  1Z1S A;  4I4K A;  1OH0 A;  4HM3 B;  1PFP A;  3K9M C;  1B2Z A;  5D83 A;  1YGW A;  1Q40 B;  1X1Y A;  3LT8 A;  3CMA 3;  2C11 A;  2RBI A;  1BRJ A;  3WDG B;  3PZW A;  1RRH A;  2RNT A;  4GB5 A;  3STD A;  3LML A;  3KZT A;  4GL6 A;  3NM7 A;  5DRV A;  1AY7 A;  2BMO B;  2RSX A;  1JKG A;  2FXT A;  2W6J H;  1MNL A;  1JZO A;  1TFO A;  1UCK A;  4G1M B;  1RGL A;  3IJE B;  1FGQ A;  3H3H A;  2INX A;  4NRE A;  3X41 A;  1TTO A;  4ZM8 A;  3OW2 2;  2H0H A;  1T3B A;  4IT7 A;  3CD6 3;  1BSD A;  3LH4 A;  2F99 A;  1AV4 A;  2Q07 A;  1M9G A;  4Q53 A;  5GSP A;  1DVD A;  4LYL B;  1WMO A;  3HZP A;  1BRN L;  3TDG A;  4KVH A;  4MJD A;  7RNT A;  1UCI A;  3ECF A;  5CLK A;  5M19 A;  1RNB A;  1UUG B;  3BU4 A;  1J2B A;  5IG3 A;  1KD1 4;  1DMQ A;  1W02 A;  4EV5 A;  3PCR A;  1YJN 3;  2W56 B;  2F98 A;  4R9L A;  2WO0 A;  3D79 A;  2GSP A;  2W56 A;  3WR2 A;  1CQS A;  2Y73 A;  7STD A;  3N54 B;  4TX4 A;  3H51 A;  2P0X A;  3UL5 A;  4HOH A;  5G1L A;  4EXR A;  1FA3 A;  5D81 A;  4O8S A;  5IG5 A;  1R4Y A;  1I70 A;  5AI1 A;  1RRL A;  4HM1 B;  5DRE A;  2BMQ B;  2UUG C;  1DMN A;  1RCL A;  1GS3 A;  1TJD A;  2XSO B;  1G02 A;  3FZW A;  3DM8 A;  1MOL A;  2KRT A;  1B3S A;  1IVX A;  4ILF A;  1I2G A;  2P38 A;  4BU4 A;  1N5H A;  3DGM A;  1FYS A;  4KFF A;  4N6T A;  2BNG A;  2A15 A;  1NU3 A;  4K61 A;  2HML B;  3D9R A;  3I0Y A;  3BND A;  4LGQ A;  1CYV A;  2ZDJ A;  1GY5 A;  3X42 A;  2F5W A;  3K7C A;  3JUP A;  3RGA A;  2XF3 A;  3S67 A;  5G1K A;  3DXO A;  2XGN A;  4GSP A;  1TU5 A;  3D4A A;  3PYJ A;  5FGO A;  2OQE A;  1W6C A;  5JPP A;  2K0M A;  5STD A;  1UI8 A;  2YFJ B;  3RDE A;  2OWP A;  3ZG0 A;  3NXJ A;  4RNZ A;  5IEP A;  3NHX A;  1VQ7 3;  1W01 A;  2CHC A;  4DKI A;  1GOU A;  1BSE A;  4HZB B;  1JV2 B;  3HI7 A;  5AII A;  5IEN A;  1FGT A;  1WQL B;  1EA2 A;  4MMX B;  2F56 A;  2E2V A;  1B27 A;  3EB8 A;  1IV7 A;  3SX1 A;  3CCE 3;  1LQG C;  1VQ9 3;  1I3F A;  2D1W A;  4WYK B;  1VQM 3;  1JKG B;  1O7G B;  1UCJ A;  1BRG A;  2O3O A;  2YFI B;  3JUN A;  4BL2 A;  4HM4 B;  2Z76 A;  1GY6 A;  1JN5 B;  3DZL A;  1CH0 A;  3ROB A;  4J5G A;  3NBB A;  1RCK A;  1BGS A;  1UDI I;  1IT8 A;  3OWU A;  4WFO A;  3D5G A;  1BRH A;  3F7S A;  1SJW A;  3B4P A;  4KFE A;  1LNI A;  1A2V A;  2M7O A;  3FSD A;  3MSO A;  3VF1 A;  4LZI A;  4L8O A;  5AIF A;  2XR8 B;  1OHS A;  4RNY A;  1Q9E A;  1K73 4;  3WA3 A;  4HZ9 B;  1IV9 A;  1I0V A;  2RCD A;  3A76 A;  3FG1 A;  2K54 A;  1IYY A;  2E2T A;  3CCQ 3;  4KZ1 A;  1EQK A;  1D6Z A;  2CFL A;  2CX1 A;  1UUV B;  3WMD A;  3S27 A;  1JJ2 2;  1W4N A;  2SBL A;  3SOY A;  3SYU A;  1M90 4;  1B2U A;  5CXO A;  1BNR A;  2XSH B;  1PY3 A;  3MHE A;  3DH2 A;  1NB3 I;  2Y74 A;  3BIR A;  3WOF B;  1LOX A;  2ML6 A;  6RNT A;  3VSY A;  1LOW A;  4HM8 B;  5CF1 A;  5LC7 A;  4LSO A;  3N9H A;  3K0Z A;  1RGC A;  1L5G B;  2F4Y A;  3CC2 3;  5CF2 A;  1VQ8 3;  2C4B A;  2CWU A;  4RZM A;  1RN4 A;  1KQS 2;  3DGN A;  1RMS A;  3PXM A;  1BSC A;  4N6U A;  1NWW A;  1QAL A;  2CH9 A;  3HX8 A;  4K1V A;  3U1W A;  3KII A;  1OUN A;  2MC8 A;  1IVW A;  3F8X A;  3CCV 3;  1BRK A;  2OQE C;  4AKZ A;  2IA7 A;  4J5K A;  3LTD A;  1JBT A;  1ISK A;  5RNT A;  1FGM A;  1E3R A;  3G0K A;  3CCL 3;  1W6G A;  1IQ8 A;  3CNM A;  3UNL A;  1YIT 3;  5BXQ A;  1S72 3;  2GU3 A;  2L4V A;  4PEJ A;  1VQN 3;  2WOH A;  3UB1 A;  3B7C A;  3AGN A;  4FMA A;  4N6L A;  2BIR A;  2IUJ A;  3KFQ C;  4OUQ A;  2XFT A;  3CPW 2;  1RKY A;  4EV2 A;  1K41 A;  2I9W A;  1WMP A;  1UUW B;  4XB5 A;  2L1S A;  1EUI C;  6STD A;  4HAA A;  3U97 A;  1C54 A;  4HYZ A;  1G96 A;  1SII A;  3EX9 A;  4CPK A;  3WA2 X;  1T5Y A;  1RJO A;  4NHF A;  4R80 A;  3PGB A;  5G2G A;  1UCL A;  5IG4 A;  3G4S 3;  2CK3 H;  2F86 B;  3BNC A;  2STD A;  4H61 A;  2PNC A;  3RNT A;  2AAE A;  4EYC A;  4BTX A;  1OAC A;  4XBT A;  5I97 A;  1RN1 A;  1IDP A;  4STD A;  3GAX A;  3LOY A;  4RNT A;  1BNI A;  1GMP A;  1LOY A;  3G16 A;  8RNT A;  1RN7 A;  4FR9 A;  2XGL A;  3HOH A;  1K8A 4;  3OX9 A;  2RFR A;  3D5I A;  4MMZ B;  1NB5 I;  3MPH A;  1C7H A;  1IQX A;  3FF2 A;  3JUM A;  4N6V 0;  5D82 A;  1BIR A;  1QVG 2;  5ELU A;  4CJN A;  4HM2 B;  1RGE A;  2KF5 A;  3CNX A;  2IYJ A;  3HII A;  1T2I A;  2W03 A;  5BVB A;  9RNT A;  4I5Q A;  1N8R 4;  2CWT A;  1Q42 A;  5KP3 A;  2AAD A;  2HOH A;  1QAF A;  1RHL A;  3NX0 A;  1AQZ A;  3EQQ B;  5KP1 A;  1I2E A;  1IU7 A;  3OXA A;  1FGR A;  1IT7 A;  1GD3 A;  1LXE A;  4WYK A;  1BAO A;  2E2U A;  1M1K 4;  3DMC A;  3NV0 B;  3CXC 2;  1N8Q A;  3X3Y A;  1W2Z A;  5IF6 A;  1TRP A;  2IUK A;  3S5C A;  1N9E A;  3GZY B;  2CC3 A;  3Q90 A;  4LEH A;  3S28 A;  1FUW A;  3E99 A;  3Q2P A;  1YVB I;  4CCV A;  1BRS A;  2D42 A;  1W2B 2;  1BNE A;  1O7M B;  1ZX2 A;  4XBY A;  1CYU A;  1BNF A;  1JB2 A;  2OOV A;  2YFL B;  4OK0 A;  3LTA A;  2GBW B;  5M1A A;  2CFW A;  1SAR A;  2KF6 A;  1RDS A;  2P0M A;  3J7Y d;  3EBY A;  3MKI A;  1BAN A;  4XDV A;  2H0G A;  4FCM A;  3FH1 A;  3GZR A;  1BRI A;  4L8P A;  1JBS A;  3T0U A;  1A2P A;  1GYB A;  2GEY A;  3NBJ A;  3EE1 A;  4HM6 B;  1OGZ A;  1D6U A;  1NO3 A;  4FMB A;  1MGW A;  3G71 3;  3FKA A;  4HM5 B;  5BU4 A;  1IVV A;  3JUO A;  3FG4 A;  1G0T A;  3B8L A;  3V99 A;  3WHO A;  6GSP A;  1YNV X;  4BIR A;  1VQL 3;  1R4C A;  4RBN A;  2OTJ 3;  4L7K A;  1VQQ A;  2CKF B;  1GMQ A;  1OHP A;  1YJW 3;  3ZFZ A;  3LTC A;  1BNS A;  1ULJ B;  2CFD A;  2J8X B;  1GOY A;  3CPO A;  2CFK A;  1CEW I;  1D6Y A;  1KWI A;  1MWT A;  3LT9 A;  4FCZ A;  7GSP A;  1VQ5 3;  3F9S A;  3GRD A;  1RGA A;  3S29 A;  1OGX A;  1W5Z A;  2PZV A;  3G8Z A;  3MG1 A;  3NBR A;  1JNQ A;  3A5E A;  1IQY A;  2BU4 A;  2H0I A;  1QMA A;  1W00 A;  2OTL 3;  1Q40 A;  5A0O B;  2XRX B;  3AHW A;  1JBR A;  2C10 A;  1YGE A;  1U8C B;  2BHM A;  2UGI A;  4HJL B;  2Z77 A;  5AEU B;  1K28 A;  1TP6 A;  4J9A A;  1JRQ A;  3T8N A;  3DGO A;  5ELJ A;  3GZX B;  3MG2 A;  3MWZ A;  1Q81 4;  3EBT A;  3EJV A;  2GU1 A;  3M8C A;  4QWT A;  1QJG A;  1RGF A;  3CCU 3;  3LXU X;  1ROA A;  4GHO A;  4IPB A;  1GY7 A;  1W7C A;  3D3L A;  3GZB A;  4XDW A;  2R4I A;  1GD4 A;  1VQ6 3;  1MWU A;  1DE3 A;  3URP A;  1AVK A;  1YHQ 3;  3B4O A;  3F7X A;  3X3X A;  1O7P B;  4KFD A;  3BLZ A;  4HM7 B;  1UI7 A;  4FMD A;  3CCJ 3;  3HK4 A;  2B1X B;  2GBX B;  2CWV A;  1RTU A;  2WOF A; 
#chains in the Genus database with same CATH homology
 1A2K A;  2XFS A;  2CFG A;  5FW5 A;  3T8U A;  3AMO B;  1PU4 A;  4CDL A;  2O9U X;  1ULI B;  2P09 A;  4K90 B;  1JN5 A;  4X2O A;  5HGR A;  5KP4 A;  2WGQ A;  1DVC A;  3ALA A;  1HU9 A;  1S5A A;  3EN1 B;  4BTW A;  2LYX A;  1V74 A;  3F40 A;  3DGL A;  4O3V A;  1Q7Y 4;  1NJI 4;  2FNQ A;  3V98 A;  1VQ4 3;  4HBR A;  5IW9 A;  2CG0 A;  4N6N B;  3SXX A;  3F14 A;  2B24 B;  3I56 3;  2BT3 A;  2P05 A;  1DMM A;  3IMA B;  1VZZ A;  1W6Y A;  1OF5 B;  2CW9 A;  4HVN A;  2W2C A;  3QK9 A;  2KXG A;  2ML5 A;  2W9P A;  3LZA A;  4JRF A;  3O8Y A;  1SQW A;  4BTY A;  3JUQ A;  2WGO A;  3DY5 A;  3WOD G;  2BO9 B;  2HMM B;  4OVM A;  1F8N A;  1QVF 2;  3Q1C A;  8CHO A;  3PCS A;  2JQ5 A;  3QRD A;  2CG1 A;  1A67 A;  4O02 B;  3SVA A;  5IER A;  5AIG A;  1WNH A;  1HKX A;  2XH9 A;  3V92 A;  1KSI A;  4WWU C;  5AYS C;  3X3Z A;  1OCV A;  3JVC A;  2QIY A;  1FGO A;  3NQY A;  3MYT A;  4X2H A;  1N5P A;  4XM4 A;  1OPY A;  4EBG A;  1NDO B;  4H3U A;  1YIJ 3;  3RGR A;  1A90 A;  2XEP A;  1UW1 A;  2KCD A;  3PS8 A;  3CU3 A;  3CCS 3;  1U5O A;  3BNB A;  1LVN A;  1K9M 4;  4N6M A;  1N9J A;  4R1K A;  1O7W B;  2ZL8 A;  5IG0 A;  2V1L A;  4R9K A;  3ER7 A;  3I55 3;  1EKM A;  4O2H A;  4N3V A;  1Y4K A;  1ZO2 A;  3NV0 A;  2JDI H;  4FCJ A;  3KE7 A;  3SOA A;  5AYR B;  4J8T A;  1SPU A;  3KSE D;  3BB9 A;  5TGN A;  2LQV A;  1ROV A;  4LMI A;  3OWS A;  2HMN B;  1DYU A;  2BMR B;  2Z7A A;  1TFK A;  3HIG A;  3IPT A;  3SLU A;  5AEW B;  4U13 A;  2MF7 A;  1Q86 4;  2HMJ B;  1AR0 A;  4JF8 A;  1STD A;  4WP5 A;  1IK3 A;  1O7N B;  1KC8 4;  3KN4 A;  3GWR A;  2YX9 A;  1AVL A;  5AIH A;  1OHO A;  3FCS B;  3CC7 3;  4XBX A;  3DUK A;  3EF8 A;  3KKG A;  1OF5 A;  2UX0 A;  3OWY A;  4MEI A;  1WMN A;  1SIH A;  5EQL A;  3MG3 A;  1YI2 3;  1TUH A;  1JB4 A;  2W9Q A;  3VGN A;  2Z6B A;  3N8B A;  3NM2 A;  3UL6 A;  2CIU A;  3FLJ A;  2GEX A;  2IMJ A;  4HM0 B;  3X40 A;  3FF0 A;  3K5T A;  1O7H B;  4MMY B;  3CCM 3;  1JB5 A;  2HMK B;  3FGY A;  2GXF A;  1IVU A;  1E3V A;  2QGU A;  2W04 A;  5JPU A;  2RGQ A;  3LYG A;  4N6O B;  2HMO B;  3KSP A;  1VQO 3;  1YJ9 3;  3EHC A;  3BNE A;  5IEO A;  3NUV A;  3EC9 A;  1E97 A;  1ASK A;  3LTB A;  5EEO A;  3AMO A;  4HKV B;  1M1X B;  3UJM A;  1WTH A;  4EC6 A;  5EVH A;  4FMC A;  1US1 A;  1Q82 4;  2W0Q A;  4WHA A;  3NQZ A;  4IIA A;  3CME 3;  2FGT A;  2QEX 3;  3EN8 A;  5LC6 A;  3SED A;  5JBS A;  3K63 A;  4ORL A;  1STF I;  2QA4 3;  3OV4 A;  3CC4 3;  1VQP 3;  4K1U A;  3F8H A;  4AKY A;  4AEQ A;  5CK6 A;  1QAK A;  1VQK 3;  3G6E 3;  2OCT A;  1TIJ A;  1EG9 B;  3WOE B;  2OOV C;  4R4K A;  3CCR 3;  3FG3 A;  1BUQ A;  1LNH A;  3L0R A;  1Z1S A;  4I4K A;  1OH0 A;  4HM3 B;  1PFP A;  3K9M C;  5D83 A;  1Q40 B;  3LT8 A;  3CMA 3;  2C11 A;  3WDG B;  3PZW A;  1RRH A;  4GB5 A;  3STD A;  3LML A;  3KZT A;  4GL6 A;  3NM7 A;  5DRV A;  2BMO B;  2RSX A;  1JKG A;  2FXT A;  2W6J H;  1MNL A;  1TFO A;  4G1M B;  3IJE B;  1FGQ A;  3H3H A;  2INX A;  4NRE A;  3X41 A;  4ZM8 A;  3OW2 2;  4IT7 A;  3CD6 3;  3LH4 A;  2F99 A;  1AV4 A;  2Q07 A;  1M9G A;  4Q53 A;  1DVD A;  1WMO A;  3HZP A;  3TDG A;  4KVH A;  4MJD A;  3ECF A;  5CLK A;  1J2B A;  5IG3 A;  1KD1 4;  1DMQ A;  1W02 A;  4EV5 A;  3PCR A;  1YJN 3;  2W56 B;  2F98 A;  4R9L A;  2WO0 A;  2W56 A;  1CQS A;  2Y73 A;  7STD A;  3N54 B;  4TX4 A;  3H51 A;  2P0X A;  3UL5 A;  4EXR A;  1FA3 A;  5D81 A;  4O8S A;  5IG5 A;  5AI1 A;  1RRL A;  4HM1 B;  5DRE A;  2BMQ B;  1DMN A;  1GS3 A;  2XSO B;  3FZW A;  3DM8 A;  1MOL A;  2KRT A;  1IVX A;  2P38 A;  1N5H A;  3DGM A;  4KFF A;  4N6T A;  2BNG A;  2A15 A;  1NU3 A;  4K61 A;  2HML B;  3D9R A;  3I0Y A;  3BND A;  4LGQ A;  1CYV A;  2ZDJ A;  1GY5 A;  3X42 A;  3K7C A;  3JUP A;  3RGA A;  2XF3 A;  3S67 A;  3DXO A;  2XGN A;  1TU5 A;  3PYJ A;  5FGO A;  2OQE A;  1W6C A;  5JPP A;  2K0M A;  5STD A;  1UI8 A;  2YFJ B;  3RDE A;  2OWP A;  3NXJ A;  4RNZ A;  5IEP A;  3NHX A;  1VQ7 3;  1W01 A;  2CHC A;  4HZB B;  1JV2 B;  3HI7 A;  5AII A;  5IEN A;  1FGT A;  1WQL B;  1EA2 A;  4MMX B;  3EB8 A;  2E2V A;  3CCE 3;  1IV7 A;  3SX1 A;  1VQ9 3;  2D1W A;  4WYK B;  1VQM 3;  1JKG B;  1O7G B;  2YFI B;  2O3O A;  3JUN A;  4HM4 B;  2Z76 A;  1GY6 A;  1JN5 B;  3DZL A;  3ROB A;  3NBB A;  1IT8 A;  3OWU A;  4WFO A;  3F7S A;  1SJW A;  3B4P A;  4KFE A;  3FSD A;  1A2V A;  2M7O A;  3MSO A;  3VF1 A;  4LZI A;  4L8O A;  5AIF A;  2XR8 B;  1OHS A;  4RNY A;  1K73 4;  3WA3 A;  4HZ9 B;  1IV9 A;  3FG1 A;  2RCD A;  3A76 A;  2K54 A;  2E2T A;  3CCQ 3;  4KZ1 A;  1EQK A;  1D6Z A;  2CFL A;  1UUV B;  3WMD A;  3S27 A;  1JJ2 2;  1W4N A;  2SBL A;  3SOY A;  1M90 4;  5CXO A;  2XSH B;  3MHE A;  1NB3 I;  2Y74 A;  3WOF B;  1LOX A;  2ML6 A;  3VSY A;  4HM8 B;  5CF1 A;  5LC7 A;  4LSO A;  3N9H A;  3K0Z A;  1VQ8 3;  1L5G B;  3CC2 3;  5CF2 A;  4RZM A;  2CWU A;  1KQS 2;  3DGN A;  4N6U A;  3PXM A;  1NWW A;  1QAL A;  2CH9 A;  3HX8 A;  4K1V A;  3U1W A;  3KII A;  1OUN A;  2MC8 A;  1IVW A;  3F8X A;  3CCV 3;  2OQE C;  4AKZ A;  2IA7 A;  3LTD A;  1ISK A;  1FGM A;  1E3R A;  3G0K A;  3CCL 3;  1W6G A;  1IQ8 A;  3CNM A;  3UNL A;  1YIT 3;  5BXQ A;  1S72 3;  2GU3 A;  2L4V A;  4PEJ A;  1VQN 3;  2WOH A;  3UB1 A;  3B7C A;  4FMA A;  4N6L A;  2IUJ A;  3KFQ C;  4OUQ A;  2XFT A;  3CPW 2;  1RKY A;  4EV2 A;  1K41 A;  2I9W A;  1WMP A;  1UUW B;  4XB5 A;  6STD A;  3U97 A;  4HYZ A;  1G96 A;  1SII A;  3EX9 A;  3WA2 X;  1T5Y A;  1RJO A;  4NHF A;  4R80 A;  3PGB A;  5G2G A;  5IG4 A;  3G4S 3;  2CK3 H;  2F86 B;  3BNC A;  2STD A;  4H61 A;  2PNC A;  4EYC A;  4BTX A;  1OAC A;  4XBT A;  5I97 A;  4STD A;  1IDP A;  3GAX A;  3LOY A;  3G16 A;  1RN7 A;  4FR9 A;  2XGL A;  1K8A 4;  3OX9 A;  2RFR A;  4MMZ B;  1NB5 I;  3MPH A;  1C7H A;  1IQX A;  3FF2 A;  3JUM A;  4N6V 0;  5D82 A;  1QVG 2;  5ELU A;  4HM2 B;  3CNX A;  3HII A;  2W03 A;  5BVB A;  1N8R 4;  2CWT A;  1Q42 A;  5KP3 A;  1QAF A;  3NX0 A;  3EQQ B;  5KP1 A;  1IU7 A;  3OXA A;  1FGR A;  1IT7 A;  1GD3 A;  1LXE A;  4WYK A;  2E2U A;  1M1K 4;  3DMC A;  3NV0 B;  3CXC 2;  1N8Q A;  3X3Y A;  1W2Z A;  5IF6 A;  3S5C A;  2IUK A;  1N9E A;  3GZY B;  2CC3 A;  3Q90 A;  4LEH A;  3S28 A;  1FUW A;  3E99 A;  3Q2P A;  1YVB I;  4CCV A;  1CYU A;  2D42 A;  1W2B 2;  1O7M B;  1ZX2 A;  4XBY A;  1JB2 A;  2OOV A;  2YFL B;  4OK0 A;  3LTA A;  2GBW B;  2CFW A;  2P0M A;  3J7Y d;  3EBY A;  3MKI A;  4XDV A;  4FCM A;  3FH1 A;  3GZR A;  4L8P A;  3T0U A;  1GYB A;  2GEY A;  3NBJ A;  3EE1 A;  4HM6 B;  1OGZ A;  1D6U A;  1NO3 A;  4FMB A;  3G71 3;  3FKA A;  4HM5 B;  1IVV A;  3JUO A;  3FG4 A;  3V99 A;  3B8L A;  1VQL 3;  1R4C A;  4RBN A;  2OTJ 3;  4L7K A;  2CKF B;  1OHP A;  1YJW 3;  3LTC A;  1ULJ B;  2CFD A;  3CPO A;  1CEW I;  1D6Y A;  1KWI A;  2CFK A;  3LT9 A;  4FCZ A;  1VQ5 3;  3F9S A;  3GRD A;  3S29 A;  1OGX A;  1W5Z A;  2PZV A;  3G8Z A;  3MG1 A;  3NBR A;  1JNQ A;  1IQY A;  1QMA A;  1W00 A;  2OTL 3;  1Q40 A;  5A0O B;  2XRX B;  2C10 A;  1YGE A;  1U8C B;  2BHM A;  4HJL B;  2Z77 A;  5AEU B;  1K28 A;  1TP6 A;  4J9A A;  1JRQ A;  3T8N A;  3DGO A;  5ELJ A;  3GZX B;  3MG2 A;  3MWZ A;  1Q81 4;  3EBT A;  3EJV A;  2GU1 A;  3M8C A;  4QWT A;  1QJG A;  3CCU 3;  3LXU X;  1ROA A;  4IPB A;  1GY7 A;  1W7C A;  3D3L A;  3GZB A;  4XDW A;  2R4I A;  1GD4 A;  1VQ6 3;  1AVK A;  1YHQ 3;  3B4O A;  3F7X A;  3X3X A;  1O7P B;  4KFD A;  3BLZ A;  4HM7 B;  1UI7 A;  4FMD A;  3CCJ 3;  3HK4 A;  2B1X B;  2GBX B;  2CWV A;  2WOF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...