2P09A

Structural insights into the evolution of a non-biological protein
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
69
structure length
69
Chain Sequence
DDDDKKTNWLKRIYRVRPCVKCKVAPRDWKVKNKHLRIYNMCKTCFNNSIDIGDDTYHGHVDWLMYADS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords a non-biological ATP binding protein with two mutations N32D
publication title Structural insights into the evolution of a non-biological protein: importance of surface residues in protein fold optimization.
pubmed doi rcsb
source organism Unidentified
molecule tags De novo protein
total genus 19
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2007-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.210 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2p09A00
3LT9A 2P05A 3LTBA 3LTDA 3LT8A 1UW1A 2P09A 3DGOA 3DGMA 3DGNA 3DGLA 3LTAA 3LTCA 2P0XA
chains in the Genus database with same CATH superfamily
1O7WB 2F56A 2BMRB 1FZUA 1K8A4 1ISKA 3O8YA 1HZ1A 3X41A 2F98A 4EBGA 3CCR3 4N6MA 1W01A 2JQ5A 2Z6BA 1BU4A 2KF6A 3WMDA 1N9JA 3K0ZA 4TX4A 1BNJA 5AIGA 3NV0A 1W7CA 4CCVA 1I3IA 1O7HB 1UUWB 2IA7A 2RBIA 2STDA 3EX9A 4BU4A 1YI23 2Q07A 4HVNA 2GBWB 5DRVA 3NUVA 5IEOA 1BNFA 1GD4A 5CXOA 1Z1SA 3GSPA 3H51A 1BNIA 4N6TA 4XBTA 1SQWA 4JF8A 1OHPA 4FCZA 1YIJ3 1HYFA 8CHOA 3FG1A 3T8NA 3DUKA 3JUQA 2K3DA 5D81A 4HM0B 2XR8B 2GBXB 3UJMA 3DMCA 1ULJB 1SIHA 5IERA 1PY3A 3HOHA 1NDOB 3ECFA 4J5KA 1HU9A 1Q42A 1RGKA 2D42A 5G1KA 5ELJA 3V92A 5M19A 3CC23 2CK3H 2OTJ3 1I0XA 1W6GA 4WFOA 1K28A 2FGTA 5D82A 1Q7HA 1TTOA 4BTXA 1QVF2 1A2PA 3AHSA 1BSDA 2AADA 2FXTA 2RCDA 1O7PB 1WTHA 3VGNA 2C10A 2HMMB 1TJDA 1HKXA 3OWUA 2IUKA 1RN7A 3F7XA 1JN5B 1MWTA 1B2UA 5IG3A 1EUIC 2XH9A 1JBSA 4XBYA 3MKIA 3AMOB 2W0QA 5G1LA 3LMLA 1W02A 2CG1A 1M1XB 1BIRA 1WMOA 2CFDA 3EB8A 3NM2A 4FMAA 4DKIA 1KSIA 2XFTA 1RGGA 1TRQA 3SLUA 1C54A 2OCTA 1RMSA 3F40A 4MEIA 1AR0A 2IYJA 2O3OA 1IK3A 1IQXA 1VQ83 1JKGB 1IDPA 1UW1A 4O8SA 3FCSB 4MMYB 1I70A 2ZDJA 3OWYA 3G6E3 1TP6A 1WMNA 3HK4A 4RNZA 1JB2A 7RNTA 1IVWA 1I2FA 4R80A 2A15A 1M9GA 1T2HA 3QRDA 4HM6B 3V98A 2CHCA 1YJW3 4J9AA 1LOVA 1B21A 1RGHA 4HAAA 4KT3B 1W6CA 4HM1B 4EYCA 3X40A 3MWZA 1TRPA 2KRTA 3KZTA 3LTDA 3ZG5A 3S5CA 4ZM8A 3J7Yd 1Q40B 2IY2A 4WYKA 2KAAA 3EHCA 2M7OA 3EBYA 4N6UA 1FW7A 2JDIH 4EV5A 5IF6A 2W56B 1ZO2A 1ZX2A 3WA3A 1V74A 4K61A 1A2KA 1G0TA 3FKAA 4BL3A 3DGMA 3D5GA 3K5TA 1KWIA 1D6UA 3EQQB 3MHEA 1OGXA 1QAKA 5AEUB 2Y73A 1IYYA 1BGSA 5CK6A 2QIYA 3SEDA 3UL5A 3OW22 1JRQA 3UL6A 2Z76A 5KP4A 1GOVA 4R1KA 1NO3A 1OACA 3NX0A 2XRXB 1UI8A 4HZ9B 2BMQB 4LZIA 1RGAA 4L7KA 1LVNA 3JUMA 1QJGA 1G02A 3KCHA 3PXMA 1US1A 4ORLA 4LGQA 1Q824 3CMA3 3MG1A 4Q53A 2CFWA 3SOYA 2XGLA 1B3SA 1V58A 4RNYA 1T3BA 4HJLB 1JB5A 1GSPA 1E3VA 1SIIA 1UDII 2HMJB 1YHQ3 3FG4A 3X3YA 3A5EA 3S67A 1OGZA 3WHOA 1RGEA 1AY7A 2BMOB 3GZRA 1W4NA 2PZVA 5JBSA 4XB5A 5RNTA 3DY5A 8RNTA 4HKVB 3K9MC 5EVHA 1KD14 3CPW2 1FA3A 3M8CA 1BSEA 3H3HA 3DH2A 4GB5A 4FMCA 3FLJA 3CNXA 1PU4A 4BL2A 1A2VA 3EJVA 2OQEA 3T8UA 1I8VA 1YNVX 2YX9A 1FYSA 2CFLA 3FF0A 4HM7B 4N6OB 3X3XA 3BNEA 1BNRA 3AHWA 1TFKA 1X1WA 2LYXA 3Q3FA 5IG5A 1UUVB 4N6V0 1TUHA 3N54B 3PZWA 4GL6A 5CLKA 1FGQA 4HM8B 3LXUX 2J8XB 3NBRA 2BHMA 3KKGA 4IIAA 1FUSA 1MGWA 4HBRA 1LRAA 2P38A 1MWUA 2F5MA 2H0IA 4MMXB 3LZAA 5AIHA 2W2CA 3F7SA 3EE1A 3MG2A 2QA43 1BRKA 2H0GA 3FF2A 3NXJA 2H0HA 3WODG 1SJWA 2B1XB 3K63A 1Q864 1DE3A 4O2HA 3S27A 4AKZA 1UCKA 1O7NB 2YFIB 4KZ1A 1OH0A 1B2ZA 3ZFZA 5BXQA 4MJDA 3JUPA 1JKGA 3BLZA 4FMDA 4BTYA 4U13A 1TFOA 3CCS3 4XDWA 2IUJA 2GEXA 2L4VA 3WR2A 3AGOA 3B8LA 4KFEA 2V1LA 5LC6A 3X42A 1VQO3 1WNHA 4LMIA 3GWRA 4X2OA 3I0YA 3SXXA 3CC73 3JUOA 1RKYA 2KF4A 3DGYA 1EG9B 3OXAA 3CCU3 1ASKA 1GMQA 2RFRA 3LYGA 2W56A 1AVLA 1U5OA 2F4YA 3T0UA 4EV2A 5HOHA 3PS8A 3IJEB 1NWWA 3CU3A 1RN1A 1E3RA 2GU1A 1OF5A 3B4OA 2CFKA 4XM4A 7STDA 5BIRA 2XFSA 3OWSA 1EKMA 3CCJ3 2INXA 3B4PA 3RNTA 2B24B 3N9HA 2CH9A 4EXRA 3DGNA 1RGFA 2HMNB 1RCLA 7GSPA 3X3ZA 5FW5A 1N9EA 1VQ63 4AEQA 2W04A 3LOYA 5M1AA 1LOXA 1QAFA 4OUQA 1UI7A 3ER7A 1UCJA 3NBJA 1MNLA 3SOAA 1AVKA 4HYZA 1BSBA 1BRIA 2YFJB 3Q2PA 1C7HA 1A90A 1VQP3 1YJ93 4R9LA 1VQQA 1OUNA 4HM3B 3F8XA 1NU3A 2WOHA 3G4S3 1SPUA 5JPUA 3D79A 1JJ22 1RRLA 1GMPA 1X1XA 2XF3A 1RLSA 2L1SA 1DMQA 2UUGC 5IG0A 1U8CB 2SARA 1RSNA 1IV7A 1CQSA 1DMNA 4EC6A 1RNBA 3SYUA 1IT8A 1WMPA 2AAEA 4CPKA 4I4KA 4KVHA 5BU4A 3HX8A 1LNIA 3D3LA 1RGCA 3D9RA 4O3VA 1ROAA 2GXFA 3FSDA 1RCKA 3LTCA 1BVIA 1W5ZA 2WGQA 2WO0A 2ML6A 2CW9A 4STDA 2HMLB 4FR9A 1Q7Y4 1FGMA 3K7CA 2OOVC 3DGOA 3PYJA 1MWSA 1I2EA 3GAXA 1R4CA 2C11A 1D6YA 2CWUA 1A67A 1VQM3 1JBRA 2D1WA 1GS3A 1LQGC 1N5PA 1T5YA 1T2IA 1IT7A 2CFGA 3ALAA 3F9SA 5D83A 3CCL3 1IV9A 1I0VA 2C4BA 2BNGA 3RGRA 4WWUC 2K54A 9RNTA 2RNTA 3EBTA 3A76A 3CME3 5HGRA 3OX9A 2BU4A 2K0MA 2KF3A 3BU4A 3BNCA 2BO9B 3FH1A 4CDLA 3IMAB 2E2UA 2YFLB 3PCRA 3GZBA 3RDEA 3VSYA 1VQL3 1UGIA 5CF1A 3HIGA 1BAOA 3I563 4G1MB 2GEYA 2F5WA 1B2SA 1YGWA 4HM4B 3CC43 3L0RA 4H61A 3BIRA 3MPHA 3MYTA 1LXEA 1J2BA 1AV4A 1GOYA 3NHXA 3WDGB 2LQVA 1OCVA 4HM5B 4K1VA 1NNVA 1X1YA 2RGQA 1QMAA 3DZLA 1JB4A 3LT9A 4KFDA 4NHFA 4XDVA 3UB1A 3CXC2 3CCE3 1JZDA 1Y4KA 5AIFA 1VQK3 1YJN3 1VQ93 1FUWA 1GY6A 1FGTA 3B7CA 4IT7A 1JNQA 1UCIA 1Q814 3FZWA 1VQ73 1BUQA 1GY7A 2CX0A 1NJI4 5IG4A 3KN4A 4LYLB 3NQZA 3OV4A 3UNLA 1ULIB 3NBBA 3G713 1JN5A 2XGNA 5IW9A 1MWRA 2P0MA 3AGNA 3RGAA 5DREA 3AMOA 4K90B 2ZL8A 2CWVA 4OK0A 5BVBA 3LTBA 1GD3A 3ZG0A 2R4IA 4N6NB 2W03A 2FNQA 1B2MA 2Z77A 3KSED 1DMMA 5IENA 1KQS2 3NM7A 3QK9A 5KP1A 3EC9A 3KE7A 1IQ8A 3CCQ3 5KP3A 3KSPA 1FGOA 3LT8A 1LNHA 2UX0A 3S29A 4NPBA 2BT3A 4J8TA 1AQZA 4EW5A 3EN8A 1PFPA 1YVSA 1W6YA 3CCM3 1X1UA 4RZMA 3CPOA 1Q40A 2F99A 2WOFA 4HOHA 1N5HA 2CX1A 2P05A 2PNCA 2HMKB 1NB3I 3NQYA 3I553 1OHSA 5AYRB 1UGHI 2Z7AA 1R4YA 4RBNA 1RJOA 3IPTA 4FCJA 5AI1A 2MC8A 1JBTA 4QWTA 4ILFA 6RNTA 1BRHA 1VZZA 1BRGA 1DVCA 5GSPA 2IMJA 4HZBB 3GRDA 1BNSA 2R41A 1CH0A 2ZA4A 2CG0A 2P09A 1CYUA 1GOUA 1RDSA 4GSPA 3N8BA 1D6ZA 1PYLA 1BANA 2ZHXB 6STDA 1JZOA 2E2VA 4I5QA 1S723 1MOLA 3D5IA 5CF2A 1IQYA 1K41A 4PEJA 4X2HA 2HOHA 4J5GA 4R9KA 3G16A 1BSAA 2ML5A 1BNGA 3HIIA 3KIIA 3SX1A 4OVMA 3BNDA 2CKFB 3PCSA 1STDA 1DVDA 1YGEA 1I3FA 2W9QA 2CC3A 3NV0B 1O7GB 4BIRA 1RN4A 1M1K4 1WQLB 3GZXB 3VF1A 2W6JH 1GMRA 1O7MB 2KF5A 1EEJA 1LOWA 2GSPA 5IEPA 1YVBI 1GY5A 3U97A 4CJNA 1B20A 3D4AA 3V99A 2SBLA 1SARA 4BTWA 1RNTA 4JRFA 1BSCA 5STDA 1K734 1B27A 1RHLA 5FGOA 3WOEB 1BUJA 1G96A 1UUGB 1YIT3 3HZPA 3F14A 3F8HA 4GHOA 1QVG2 1ZS7A 1VQ53 2W9PA 1IU7A 1DETA 5JPPA 5ELUA 1IVXA 2KCDA 2P0XA 4L8PA 1EQKA 1S5AA 1TU5A 2CIUA 4K1UA 2QGUA 3FG3A 5M18A 3Q1CA 1JV2B 1FGRA 3KFQC 2OOVA 3BB9A 4WHAA 4XBXA 4LEHA 1BRJA 4WP5A 2F86B 1CYVA 3WOFB 1BNEA 1OF5B 1UCLA 3Q90A 1M904 5AYSC 1CEWI 4LSOA 1NB5I 5I97A 4FMBA 1ROVA 2XSOB 4N6LA 5TGNA 3TDGA 1W2B2 1EA2A 2OTL3 1TIJA 2O9UX 1N8R4 2Y74A 3CCV3 3HI7A 1BOXA 3PGBA 1Q9EA 2QEX3 2HMOB 1K9M4 1QALA 1LOYA 2WGOA 5A0OB 1STFI 1BRSA 3S28A 1V57A 1RGLA 1W2ZA 4KFFA 3U1WA 2GU3A 1OHOA 3MG3A 1N8QA 5AIIA 1VQ43 2BIRA 2E2TA 3DM8A 4NREA 3FGYA 3JVCA 3CNMA 5G2GA 3G0KA 2CWTA 4FCMA 4AKYA 1BRNL 3SVAA 4O02B 3MSOA 4MMZB 5EEOA 3G8ZA 3ROBA 1OPYA 1IVVA 3STDA 1KC84 1L5GB 3DXOA 3EN1B 4L8OA 1B2XA 3EF8A 4IPBA 2OQEC 2RSXA 4RNTA 1I2GA 4WYKB 5EQLA 6GSPA 2UGIA 4HM2B 5AEWB 2XSHB 3GZYB 1ZGXA 1RTUA 3BNBA 1FUTA 1E97A 3WA2X 2I9WA 2KXGA 2OWPA 2XEPA 1W00A 1LQMB 2MF7A 1VQN3 1MGRA 3DGLA 3LTAA 3JUNA 3URPA 1GYBA 1RRHA 1F8NA 5LC7A 3LH4A 4H3UA 4N3VA 1DYUA 4R4KA 3CD63 1IVUA 3E99A
chains in the Genus database with same CATH topology
1O7WB 2BMRB 1K8A4 1ISKA 3O8YA 3X41A 2F98A 4EBGA 3CCR3 4N6MA 1W01A 2JQ5A 2Z6BA 3WMDA 1N9JA 3K0ZA 4TX4A 5AIGA 3NV0A 1W7CA 4CCVA 2IA7A 1O7HB 1UUWB 2STDA 3EX9A 1YI23 2Q07A 4HVNA 2GBWB 5DRVA 3NUVA 5IEOA 1GD4A 5CXOA 1Z1SA 3H51A 4N6TA 4XBTA 1SQWA 4JF8A 1OHPA 4FCZA 1YIJ3 8CHOA 3FG1A 3T8NA 3DUKA 3JUQA 5D81A 4HM0B 2XR8B 2GBXB 3UJMA 3DMCA 1ULJB 1SIHA 5IERA 1NDOB 3ECFA 1HU9A 1Q42A 2D42A 2OTJ3 5ELJA 3V92A 3CC23 2CK3H 1W6GA 4WFOA 1K28A 2FGTA 5D82A 1QVF2 4BTXA 2RCDA 2FXTA 1O7PB 1WTHA 3VGNA 2C10A 2HMMB 1HKXA 3OWUA 2IUKA 1RN7A 3F7XA 1JN5B 5IG3A 2XH9A 4XBYA 3MKIA 3AMOB 2W0QA 3LMLA 1W02A 2CG1A 1M1XB 1WMOA 2CFDA 3EB8A 3NM2A 4FMAA 1KSIA 2XFTA 3SLUA 2OCTA 3F40A 4MEIA 1AR0A 1IK3A 2O3OA 1VQ83 1IQXA 1JKGB 1IDPA 1UW1A 4O8SA 3FCSB 4MMYB 2ZDJA 3OWYA 3G6E3 1TP6A 1WMNA 3HK4A 4RNZA 1JB2A 1IVWA 4R80A 1YJW3 2A15A 1M9GA 3QRDA 4HM6B 3V98A 2CHCA 4J9AA 4EYCA 1W6CA 4HM1B 3X40A 3MWZA 3KZTA 2KRTA 3LTDA 4ZM8A 3S5CA 3J7Yd 1Q40B 4WYKA 3EHCA 2M7OA 3EBYA 4N6UA 2JDIH 4EV5A 5IF6A 2W56B 1ZO2A 1ZX2A 3WA3A 1V74A 4K61A 1A2KA 3FKAA 3DGMA 3K5TA 1KWIA 1D6UA 3EQQB 3MHEA 1OGXA 1QAKA 5AEUB 2Y73A 5CK6A 3SEDA 2QIYA 3OW22 3UL5A 1JRQA 3UL6A 2Z76A 5KP4A 4R1KA 1NO3A 1OACA 3NX0A 2XRXB 1UI8A 4HZ9B 2BMQB 4LZIA 4L7KA 1LVNA 3JUMA 1QJGA 1Q824 3PXMA 4ORLA 1US1A 4LGQA 3CMA3 3MG1A 4Q53A 2CFWA 3SOYA 2XGLA 4RNYA 4HJLB 1JB5A 1E3VA 2HMJB 1SIIA 1YHQ3 3FG4A 3X3YA 3S67A 1OGZA 2BMOB 3GZRA 1W4NA 2PZVA 5JBSA 4XB5A 3DY5A 4HKVB 3K9MC 5EVHA 1KD14 3CPW2 1FA3A 3M8CA 3H3HA 4GB5A 4FMCA 3FLJA 3CNXA 1PU4A 1A2VA 3EJVA 2OQEA 3T8UA 2YX9A 3FF0A 4HM7B 2CFLA 4N6OB 3X3XA 3BNEA 1TFKA 2LYXA 5IG5A 1UUVB 4N6V0 1TUHA 3N54B 3PZWA 4GL6A 5CLKA 1FGQA 4HM8B 3LXUX 3NBRA 2BHMA 3KKGA 4IIAA 4HBRA 2P38A 4MMXB 3LZAA 5AIHA 2W2CA 3F7SA 3EE1A 3MG2A 2QA43 3NXJA 3FF2A 3WODG 1SJWA 2B1XB 3K63A 1Q864 4O2HA 3S27A 4AKZA 2YFIB 1O7NB 4KZ1A 1OH0A 5BXQA 4MJDA 3JUPA 1JKGA 3BLZA 4FMDA 4BTYA 4U13A 1TFOA 3CCS3 4XDWA 2IUJA 2GEXA 2L4VA 3B8LA 4KFEA 2V1LA 5LC6A 3X42A 1VQO3 1WNHA 4LMIA 3GWRA 4X2OA 3I0YA 3SXXA 3CC73 3JUOA 1RKYA 1EG9B 3OXAA 3CCU3 1ASKA 2RFRA 3LYGA 2W56A 1AVLA 1U5OA 3T0UA 4EV2A 3PS8A 3IJEB 1NWWA 3CU3A 1E3RA 2GU1A 1OF5A 3B4OA 2CFKA 4XM4A 7STDA 2XFSA 3OWSA 1EKMA 3CCJ3 2INXA 3B4PA 2B24B 3N9HA 2CH9A 4EXRA 3DGNA 2HMNB 3X3ZA 5FW5A 1N9EA 1VQ63 4AEQA 2W04A 3LOYA 1LOXA 1QAFA 4OUQA 1UI7A 3ER7A 3NBJA 1MNLA 3SOAA 1AVKA 4HYZA 2YFJB 3Q2PA 1C7HA 1A90A 1VQP3 1YJ93 4R9LA 1OUNA 4HM3B 3F8XA 1NU3A 2WOHA 3G4S3 1SPUA 5JPUA 1JJ22 1RRLA 2XF3A 1DMQA 5IG0A 1U8CB 4EC6A 1IV7A 1CQSA 1DMNA 1IT8A 1WMPA 4I4KA 4KVHA 3HX8A 3D3LA 3D9RA 4O3VA 1ROAA 2GXFA 3FSDA 3LTCA 1W5ZA 2WGQA 2WO0A 2ML6A 2CW9A 4STDA 2HMLB 4FR9A 1Q7Y4 1FGMA 3K7CA 2OOVC 3DGOA 3PYJA 3GAXA 1R4CA 2C11A 1D6YA 2CWUA 1A67A 1VQM3 2D1WA 1GS3A 1N5PA 1T5YA 2CFGA 3F9SA 1IT7A 3ALAA 3CCL3 5D83A 1IV9A 2BNGA 3RGRA 4WWUC 2K54A 3CME3 3EBTA 3A76A 5HGRA 3OX9A 2K0MA 3BNCA 2BO9B 3FH1A 4CDLA 3IMAB 2E2UA 2YFLB 3PCRA 3GZBA 3RDEA 3VSYA 1VQL3 5CF1A 3HIGA 3I563 4G1MB 2GEYA 4HM4B 3CC43 3L0RA 4H61A 3MPHA 3MYTA 1LXEA 1J2BA 1AV4A 3NHXA 3WDGB 2LQVA 1OCVA 4HM5B 4K1VA 4KFDA 2RGQA 4NHFA 1QMAA 3DZLA 1JB4A 3LT9A 3UB1A 4XDVA 3CXC2 3CCE3 1Y4KA 5AIFA 1VQ93 1VQK3 1YJN3 1FUWA 1GY6A 1FGTA 3B7CA 4IT7A 1JNQA 1Q814 3FZWA 1VQ73 1BUQA 1GY7A 1NJI4 5IG4A 3KN4A 3NQZA 3OV4A 3UNLA 1ULIB 3NBBA 3G713 1JN5A 2XGNA 5IW9A 2P0MA 3RGAA 5DREA 3AMOA 4K90B 2ZL8A 2CWVA 4OK0A 5BVBA 3LTBA 1GD3A 2R4IA 4N6NB 2W03A 2FNQA 2Z77A 3KSED 1DMMA 5IENA 1KQS2 3NM7A 3QK9A 5KP1A 3EC9A 3KE7A 1IQ8A 3CCQ3 5KP3A 3KSPA 1FGOA 3LT8A 1LNHA 2UX0A 3S29A 2BT3A 4J8TA 3EN8A 1PFPA 1W6YA 3CCM3 4RZMA 3CPOA 1Q40A 2F99A 2WOFA 2PNCA 1N5HA 2P05A 2HMKB 1NB3I 3NQYA 3I553 1OHSA 5AYRB 2Z7AA 4RBNA 1RJOA 3IPTA 4FCJA 5AI1A 2MC8A 4QWTA 1VZZA 1DVCA 2IMJA 4HZBB 3GRDA 2CG0A 2P09A 1CYUA 3N8BA 1D6ZA 6STDA 2E2VA 1S723 1MOLA 5CF2A 1IQYA 1K41A 4PEJA 4X2HA 4R9KA 3G16A 2ML5A 3HIIA 3KIIA 3SX1A 4OVMA 3BNDA 2CKFB 3PCSA 1STDA 1DVDA 1YGEA 2W9QA 2CC3A 3NV0B 1O7GB 1M1K4 1WQLB 3GZXB 3VF1A 2W6JH 1O7MB 5IEPA 1YVBI 1GY5A 3U97A 3V99A 2SBLA 4BTWA 4JRFA 5STDA 1K734 5FGOA 3WOEB 1G96A 1YIT3 3HZPA 3F14A 3F8HA 1QVG2 1VQ53 2W9PA 1IU7A 5JPPA 5ELUA 1IVXA 2KCDA 2P0XA 4L8PA 1EQKA 1S5AA 1TU5A 2CIUA 4K1UA 2QGUA 3FG3A 3Q1CA 1JV2B 1FGRA 3KFQC 2OOVA 3BB9A 4WHAA 4XBXA 4LEHA 4WP5A 2F86B 1CYVA 3WOFB 1OF5B 3Q90A 1M904 5AYSC 1CEWI 4LSOA 1NB5I 5I97A 4FMBA 1ROVA 2XSOB 4N6LA 5TGNA 3TDGA 1W2B2 1EA2A 2OTL3 1TIJA 2O9UX 1N8R4 2Y74A 3CCV3 3HI7A 3PGBA 2QEX3 2HMOB 1K9M4 1QALA 2WGOA 5A0OB 1STFI 3S28A 1W2ZA 4KFFA 3U1WA 2GU3A 1OHOA 3MG3A 1N8QA 5AIIA 1VQ43 2E2TA 3DM8A 4NREA 3FGYA 3JVCA 3CNMA 5G2GA 3G0KA 2CWTA 4FCMA 4AKYA 3SVAA 4O02B 3MSOA 4MMZB 5EEOA 3G8ZA 3ROBA 1OPYA 1IVVA 3STDA 1KC84 1L5GB 3DXOA 3EN1B 4L8OA 3EF8A 4IPBA 2OQEC 2RSXA 5EQLA 4WYKB 4HM2B 5AEWB 2XSHB 3GZYB 3BNBA 1E97A 3WA2X 2XEPA 2I9WA 2KXGA 2OWPA 1W00A 1VQN3 2MF7A 3DGLA 3LTAA 3JUNA 1GYBA 1RRHA 1F8NA 5LC7A 3LH4A 4H3UA 4N3VA 1DYUA 4R4KA 3CD63 1IVUA 3E99A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LT9 A;  2P05 A;  3LTB A;  3LTD A;  3LT8 A;  1UW1 A;  2P09 A;  3DGO A;  3DGM A;  3DGN A;  3DGL A;  3LTA A;  3LTC A;  2P0X A; 
#chains in the Genus database with same CATH topology
 1O7W B;  2F56 A;  2BMR B;  1FZU A;  1K8A 4;  1ISK A;  3O8Y A;  1HZ1 A;  3X41 A;  2F98 A;  4EBG A;  3CCR 3;  4N6M A;  1W01 A;  2JQ5 A;  2Z6B A;  1BU4 A;  2KF6 A;  3WMD A;  1N9J A;  3K0Z A;  4TX4 A;  1BNJ A;  5AIG A;  3NV0 A;  1W7C A;  4CCV A;  1I3I A;  1O7H B;  1UUW B;  2IA7 A;  2RBI A;  2STD A;  3EX9 A;  4BU4 A;  1YI2 3;  2Q07 A;  4HVN A;  2GBW B;  5DRV A;  3NUV A;  5IEO A;  1BNF A;  1GD4 A;  5CXO A;  1Z1S A;  3GSP A;  3H51 A;  1BNI A;  4N6T A;  4XBT A;  1SQW A;  4JF8 A;  1OHP A;  4FCZ A;  1YIJ 3;  1HYF A;  8CHO A;  3FG1 A;  3T8N A;  3DUK A;  3JUQ A;  2K3D A;  5D81 A;  4HM0 B;  2XR8 B;  2GBX B;  3UJM A;  3DMC A;  1ULJ B;  1SIH A;  5IER A;  1PY3 A;  3HOH A;  1NDO B;  3ECF A;  4J5K A;  1HU9 A;  1Q42 A;  1RGK A;  2D42 A;  5G1K A;  5ELJ A;  3V92 A;  5M19 A;  3CC2 3;  2CK3 H;  2OTJ 3;  1I0X A;  1W6G A;  4WFO A;  1K28 A;  2FGT A;  5D82 A;  1Q7H A;  1TTO A;  4BTX A;  1QVF 2;  1A2P A;  3AHS A;  1BSD A;  2AAD A;  2FXT A;  2RCD A;  1O7P B;  1WTH A;  3VGN A;  2C10 A;  2HMM B;  1TJD A;  1HKX A;  3OWU A;  2IUK A;  1RN7 A;  3F7X A;  1JN5 B;  1MWT A;  1B2U A;  5IG3 A;  1EUI C;  2XH9 A;  1JBS A;  4XBY A;  3MKI A;  3AMO B;  2W0Q A;  5G1L A;  3LML A;  1W02 A;  2CG1 A;  1M1X B;  1BIR A;  1WMO A;  2CFD A;  3EB8 A;  3NM2 A;  4FMA A;  4DKI A;  1KSI A;  2XFT A;  1RGG A;  1TRQ A;  3SLU A;  1C54 A;  2OCT A;  1RMS A;  3F40 A;  4MEI A;  1AR0 A;  2IYJ A;  2O3O A;  1IK3 A;  1IQX A;  1VQ8 3;  1JKG B;  1IDP A;  1UW1 A;  4O8S A;  3FCS B;  4MMY B;  1I70 A;  2ZDJ A;  3OWY A;  3G6E 3;  1TP6 A;  1WMN A;  3HK4 A;  4RNZ A;  1JB2 A;  7RNT A;  1IVW A;  1I2F A;  4R80 A;  2A15 A;  1M9G A;  1T2H A;  3QRD A;  4HM6 B;  3V98 A;  2CHC A;  1YJW 3;  4J9A A;  1LOV A;  1B21 A;  1RGH A;  4HAA A;  4KT3 B;  1W6C A;  4HM1 B;  4EYC A;  3X40 A;  3MWZ A;  1TRP A;  2KRT A;  3KZT A;  3LTD A;  3ZG5 A;  3S5C A;  4ZM8 A;  3J7Y d;  1Q40 B;  2IY2 A;  4WYK A;  2KAA A;  3EHC A;  2M7O A;  3EBY A;  4N6U A;  1FW7 A;  2JDI H;  4EV5 A;  5IF6 A;  2W56 B;  1ZO2 A;  1ZX2 A;  3WA3 A;  1V74 A;  4K61 A;  1A2K A;  1G0T A;  3FKA A;  4BL3 A;  3DGM A;  3D5G A;  3K5T A;  1KWI A;  1D6U A;  3EQQ B;  3MHE A;  1OGX A;  1QAK A;  5AEU B;  2Y73 A;  1IYY A;  1BGS A;  5CK6 A;  2QIY A;  3SED A;  3UL5 A;  3OW2 2;  1JRQ A;  3UL6 A;  2Z76 A;  5KP4 A;  1GOV A;  4R1K A;  1NO3 A;  1OAC A;  3NX0 A;  2XRX B;  1UI8 A;  4HZ9 B;  2BMQ B;  4LZI A;  1RGA A;  4L7K A;  1LVN A;  3JUM A;  1QJG A;  1G02 A;  3KCH A;  3PXM A;  1US1 A;  4ORL A;  4LGQ A;  1Q82 4;  3CMA 3;  3MG1 A;  4Q53 A;  2CFW A;  3SOY A;  2XGL A;  1B3S A;  1V58 A;  4RNY A;  1T3B A;  4HJL B;  1JB5 A;  1GSP A;  1E3V A;  1SII A;  1UDI I;  2HMJ B;  1YHQ 3;  3FG4 A;  3X3Y A;  3A5E A;  3S67 A;  1OGZ A;  3WHO A;  1RGE A;  1AY7 A;  2BMO B;  3GZR A;  1W4N A;  2PZV A;  5JBS A;  4XB5 A;  5RNT A;  3DY5 A;  8RNT A;  4HKV B;  3K9M C;  5EVH A;  1KD1 4;  3CPW 2;  1FA3 A;  3M8C A;  1BSE A;  3H3H A;  3DH2 A;  4GB5 A;  4FMC A;  3FLJ A;  3CNX A;  1PU4 A;  4BL2 A;  1A2V A;  3EJV A;  2OQE A;  3T8U A;  1I8V A;  1YNV X;  2YX9 A;  1FYS A;  2CFL A;  3FF0 A;  4HM7 B;  4N6O B;  3X3X A;  3BNE A;  1BNR A;  3AHW A;  1TFK A;  1X1W A;  2LYX A;  3Q3F A;  5IG5 A;  1UUV B;  4N6V 0;  1TUH A;  3N54 B;  3PZW A;  4GL6 A;  5CLK A;  1FGQ A;  4HM8 B;  3LXU X;  2J8X B;  3NBR A;  2BHM A;  3KKG A;  4IIA A;  1FUS A;  1MGW A;  4HBR A;  1LRA A;  2P38 A;  1MWU A;  2F5M A;  2H0I A;  4MMX B;  3LZA A;  5AIH A;  2W2C A;  3F7S A;  3EE1 A;  3MG2 A;  2QA4 3;  1BRK A;  2H0G A;  3FF2 A;  3NXJ A;  2H0H A;  3WOD G;  1SJW A;  2B1X B;  3K63 A;  1Q86 4;  1DE3 A;  4O2H A;  3S27 A;  4AKZ A;  1UCK A;  1O7N B;  2YFI B;  4KZ1 A;  1OH0 A;  1B2Z A;  3ZFZ A;  5BXQ A;  4MJD A;  3JUP A;  1JKG A;  3BLZ A;  4FMD A;  4BTY A;  4U13 A;  1TFO A;  3CCS 3;  4XDW A;  2IUJ A;  2GEX A;  2L4V A;  3WR2 A;  3AGO A;  3B8L A;  4KFE A;  2V1L A;  5LC6 A;  3X42 A;  1VQO 3;  1WNH A;  4LMI A;  3GWR A;  4X2O A;  3I0Y A;  3SXX A;  3CC7 3;  3JUO A;  1RKY A;  2KF4 A;  3DGY A;  1EG9 B;  3OXA A;  3CCU 3;  1ASK A;  1GMQ A;  2RFR A;  3LYG A;  2W56 A;  1AVL A;  1U5O A;  2F4Y A;  3T0U A;  4EV2 A;  5HOH A;  3PS8 A;  3IJE B;  1NWW A;  3CU3 A;  1RN1 A;  1E3R A;  2GU1 A;  1OF5 A;  3B4O A;  2CFK A;  4XM4 A;  7STD A;  5BIR A;  2XFS A;  3OWS A;  1EKM A;  3CCJ 3;  2INX A;  3B4P A;  3RNT A;  2B24 B;  3N9H A;  2CH9 A;  4EXR A;  3DGN A;  1RGF A;  2HMN B;  1RCL A;  7GSP A;  3X3Z A;  5FW5 A;  1N9E A;  1VQ6 3;  4AEQ A;  2W04 A;  3LOY A;  5M1A A;  1LOX A;  1QAF A;  4OUQ A;  1UI7 A;  3ER7 A;  1UCJ A;  3NBJ A;  1MNL A;  3SOA A;  1AVK A;  4HYZ A;  1BSB A;  1BRI A;  2YFJ B;  3Q2P A;  1C7H A;  1A90 A;  1VQP 3;  1YJ9 3;  4R9L A;  1VQQ A;  1OUN A;  4HM3 B;  3F8X A;  1NU3 A;  2WOH A;  3G4S 3;  1SPU A;  5JPU A;  3D79 A;  1JJ2 2;  1RRL A;  1GMP A;  1X1X A;  2XF3 A;  1RLS A;  2L1S A;  1DMQ A;  2UUG C;  5IG0 A;  1U8C B;  2SAR A;  1RSN A;  1IV7 A;  1CQS A;  1DMN A;  4EC6 A;  1RNB A;  3SYU A;  1IT8 A;  1WMP A;  2AAE A;  4CPK A;  4I4K A;  4KVH A;  5BU4 A;  3HX8 A;  1LNI A;  3D3L A;  1RGC A;  3D9R A;  4O3V A;  1ROA A;  2GXF A;  3FSD A;  1RCK A;  3LTC A;  1BVI A;  1W5Z A;  2WGQ A;  2WO0 A;  2ML6 A;  2CW9 A;  4STD A;  2HML B;  4FR9 A;  1Q7Y 4;  1FGM A;  3K7C A;  2OOV C;  3DGO A;  3PYJ A;  1MWS A;  1I2E A;  3GAX A;  1R4C A;  2C11 A;  1D6Y A;  2CWU A;  1A67 A;  1VQM 3;  1JBR A;  2D1W A;  1GS3 A;  1LQG C;  1N5P A;  1T5Y A;  1T2I A;  1IT7 A;  2CFG A;  3ALA A;  3F9S A;  5D83 A;  3CCL 3;  1IV9 A;  1I0V A;  2C4B A;  2BNG A;  3RGR A;  4WWU C;  2K54 A;  9RNT A;  2RNT A;  3EBT A;  3A76 A;  3CME 3;  5HGR A;  3OX9 A;  2BU4 A;  2K0M A;  2KF3 A;  3BU4 A;  3BNC A;  2BO9 B;  3FH1 A;  4CDL A;  3IMA B;  2E2U A;  2YFL B;  3PCR A;  3GZB A;  3RDE A;  3VSY A;  1VQL 3;  1UGI A;  5CF1 A;  3HIG A;  1BAO A;  3I56 3;  4G1M B;  2GEY A;  2F5W A;  1B2S A;  1YGW A;  4HM4 B;  3CC4 3;  3L0R A;  4H61 A;  3BIR A;  3MPH A;  3MYT A;  1LXE A;  1J2B A;  1AV4 A;  1GOY A;  3NHX A;  3WDG B;  2LQV A;  1OCV A;  4HM5 B;  4K1V A;  1NNV A;  1X1Y A;  2RGQ A;  1QMA A;  3DZL A;  1JB4 A;  3LT9 A;  4KFD A;  4NHF A;  4XDV A;  3UB1 A;  3CXC 2;  3CCE 3;  1JZD A;  1Y4K A;  5AIF A;  1VQK 3;  1YJN 3;  1VQ9 3;  1FUW A;  1GY6 A;  1FGT A;  3B7C A;  4IT7 A;  1JNQ A;  1UCI A;  1Q81 4;  3FZW A;  1VQ7 3;  1BUQ A;  1GY7 A;  2CX0 A;  1NJI 4;  5IG4 A;  3KN4 A;  4LYL B;  3NQZ A;  3OV4 A;  3UNL A;  1ULI B;  3NBB A;  3G71 3;  1JN5 A;  2XGN A;  5IW9 A;  1MWR A;  2P0M A;  3AGN A;  3RGA A;  5DRE A;  3AMO A;  4K90 B;  2ZL8 A;  2CWV A;  4OK0 A;  5BVB A;  3LTB A;  1GD3 A;  3ZG0 A;  2R4I A;  4N6N B;  2W03 A;  2FNQ A;  1B2M A;  2Z77 A;  3KSE D;  1DMM A;  5IEN A;  1KQS 2;  3NM7 A;  3QK9 A;  5KP1 A;  3EC9 A;  3KE7 A;  1IQ8 A;  3CCQ 3;  5KP3 A;  3KSP A;  1FGO A;  3LT8 A;  1LNH A;  2UX0 A;  3S29 A;  4NPB A;  2BT3 A;  4J8T A;  1AQZ A;  4EW5 A;  3EN8 A;  1PFP A;  1YVS A;  1W6Y A;  3CCM 3;  1X1U A;  4RZM A;  3CPO A;  1Q40 A;  2F99 A;  2WOF A;  4HOH A;  1N5H A;  2CX1 A;  2P05 A;  2PNC A;  2HMK B;  1NB3 I;  3NQY A;  3I55 3;  1OHS A;  5AYR B;  1UGH I;  2Z7A A;  1R4Y A;  4RBN A;  1RJO A;  3IPT A;  4FCJ A;  5AI1 A;  2MC8 A;  1JBT A;  4QWT A;  4ILF A;  6RNT A;  1BRH A;  1VZZ A;  1BRG A;  1DVC A;  5GSP A;  2IMJ A;  4HZB B;  3GRD A;  1BNS A;  2R41 A;  1CH0 A;  2ZA4 A;  2CG0 A;  2P09 A;  1CYU A;  1GOU A;  1RDS A;  4GSP A;  3N8B A;  1D6Z A;  1PYL A;  1BAN A;  2ZHX B;  6STD A;  1JZO A;  2E2V A;  4I5Q A;  1S72 3;  1MOL A;  3D5I A;  5CF2 A;  1IQY A;  1K41 A;  4PEJ A;  4X2H A;  2HOH A;  4J5G A;  4R9K A;  3G16 A;  1BSA A;  2ML5 A;  1BNG A;  3HII A;  3KII A;  3SX1 A;  4OVM A;  3BND A;  2CKF B;  3PCS A;  1STD A;  1DVD A;  1YGE A;  1I3F A;  2W9Q A;  2CC3 A;  3NV0 B;  1O7G B;  4BIR A;  1RN4 A;  1M1K 4;  1WQL B;  3GZX B;  3VF1 A;  2W6J H;  1GMR A;  1O7M B;  2KF5 A;  1EEJ A;  1LOW A;  2GSP A;  5IEP A;  1YVB I;  1GY5 A;  3U97 A;  4CJN A;  1B20 A;  3D4A A;  3V99 A;  2SBL A;  1SAR A;  4BTW A;  1RNT A;  4JRF A;  1BSC A;  5STD A;  1K73 4;  1B27 A;  1RHL A;  5FGO A;  3WOE B;  1BUJ A;  1G96 A;  1UUG B;  1YIT 3;  3HZP A;  3F14 A;  3F8H A;  4GHO A;  1QVG 2;  1ZS7 A;  1VQ5 3;  2W9P A;  1IU7 A;  1DET A;  5JPP A;  5ELU A;  1IVX A;  2KCD A;  2P0X A;  4L8P A;  1EQK A;  1S5A A;  1TU5 A;  2CIU A;  4K1U A;  2QGU A;  3FG3 A;  5M18 A;  3Q1C A;  1JV2 B;  1FGR A;  3KFQ C;  2OOV A;  3BB9 A;  4WHA A;  4XBX A;  4LEH A;  1BRJ A;  4WP5 A;  2F86 B;  1CYV A;  3WOF B;  1BNE A;  1OF5 B;  1UCL A;  3Q90 A;  1M90 4;  5AYS C;  1CEW I;  4LSO A;  1NB5 I;  5I97 A;  4FMB A;  1ROV A;  2XSO B;  4N6L A;  5TGN A;  3TDG A;  1W2B 2;  1EA2 A;  2OTL 3;  1TIJ A;  2O9U X;  1N8R 4;  2Y74 A;  3CCV 3;  3HI7 A;  1BOX A;  3PGB A;  1Q9E A;  2QEX 3;  2HMO B;  1K9M 4;  1QAL A;  1LOY A;  2WGO A;  5A0O B;  1STF I;  1BRS A;  3S28 A;  1V57 A;  1RGL A;  1W2Z A;  4KFF A;  3U1W A;  2GU3 A;  1OHO A;  3MG3 A;  1N8Q A;  5AII A;  1VQ4 3;  2BIR A;  2E2T A;  3DM8 A;  4NRE A;  3FGY A;  3JVC A;  3CNM A;  5G2G A;  3G0K A;  2CWT A;  4FCM A;  4AKY A;  1BRN L;  3SVA A;  4O02 B;  3MSO A;  4MMZ B;  5EEO A;  3G8Z A;  3ROB A;  1OPY A;  1IVV A;  3STD A;  1KC8 4;  1L5G B;  3DXO A;  3EN1 B;  4L8O A;  1B2X A;  3EF8 A;  4IPB A;  2OQE C;  2RSX A;  4RNT A;  1I2G A;  4WYK B;  5EQL A;  6GSP A;  2UGI A;  4HM2 B;  5AEW B;  2XSH B;  3GZY B;  1ZGX A;  1RTU A;  3BNB A;  1FUT A;  1E97 A;  3WA2 X;  2I9W A;  2KXG A;  2OWP A;  2XEP A;  1W00 A;  1LQM B;  2MF7 A;  1VQN 3;  1MGR A;  3DGL A;  3LTA A;  3JUN A;  3URP A;  1GYB A;  1RRH A;  1F8N A;  5LC7 A;  3LH4 A;  4H3U A;  4N3V A;  1DYU A;  4R4K A;  3CD6 3;  1IVU A;  3E99 A; 
#chains in the Genus database with same CATH homology
 1O7W B;  2BMR B;  1K8A 4;  1ISK A;  3O8Y A;  3X41 A;  2F98 A;  4EBG A;  3CCR 3;  4N6M A;  1W01 A;  2JQ5 A;  2Z6B A;  3WMD A;  1N9J A;  3K0Z A;  4TX4 A;  5AIG A;  3NV0 A;  1W7C A;  4CCV A;  2IA7 A;  1O7H B;  1UUW B;  2STD A;  3EX9 A;  1YI2 3;  2Q07 A;  4HVN A;  2GBW B;  5DRV A;  3NUV A;  5IEO A;  1GD4 A;  5CXO A;  1Z1S A;  3H51 A;  4N6T A;  4XBT A;  1SQW A;  4JF8 A;  1OHP A;  4FCZ A;  1YIJ 3;  8CHO A;  3FG1 A;  3T8N A;  3DUK A;  3JUQ A;  5D81 A;  4HM0 B;  2XR8 B;  2GBX B;  3UJM A;  3DMC A;  1ULJ B;  1SIH A;  5IER A;  1NDO B;  3ECF A;  1HU9 A;  1Q42 A;  2D42 A;  2OTJ 3;  5ELJ A;  3V92 A;  3CC2 3;  2CK3 H;  1W6G A;  4WFO A;  1K28 A;  2FGT A;  5D82 A;  1QVF 2;  4BTX A;  2RCD A;  2FXT A;  1O7P B;  1WTH A;  3VGN A;  2C10 A;  2HMM B;  1HKX A;  3OWU A;  2IUK A;  1RN7 A;  3F7X A;  1JN5 B;  5IG3 A;  2XH9 A;  4XBY A;  3MKI A;  3AMO B;  2W0Q A;  3LML A;  1W02 A;  2CG1 A;  1M1X B;  1WMO A;  2CFD A;  3EB8 A;  3NM2 A;  4FMA A;  1KSI A;  2XFT A;  3SLU A;  2OCT A;  3F40 A;  4MEI A;  1AR0 A;  1IK3 A;  2O3O A;  1VQ8 3;  1IQX A;  1JKG B;  1IDP A;  1UW1 A;  4O8S A;  3FCS B;  4MMY B;  2ZDJ A;  3OWY A;  3G6E 3;  1TP6 A;  1WMN A;  3HK4 A;  4RNZ A;  1JB2 A;  1IVW A;  4R80 A;  1YJW 3;  2A15 A;  1M9G A;  3QRD A;  4HM6 B;  3V98 A;  2CHC A;  4J9A A;  4EYC A;  1W6C A;  4HM1 B;  3X40 A;  3MWZ A;  3KZT A;  2KRT A;  3LTD A;  4ZM8 A;  3S5C A;  3J7Y d;  1Q40 B;  4WYK A;  3EHC A;  2M7O A;  3EBY A;  4N6U A;  2JDI H;  4EV5 A;  5IF6 A;  2W56 B;  1ZO2 A;  1ZX2 A;  3WA3 A;  1V74 A;  4K61 A;  1A2K A;  3FKA A;  3DGM A;  3K5T A;  1KWI A;  1D6U A;  3EQQ B;  3MHE A;  1OGX A;  1QAK A;  5AEU B;  2Y73 A;  5CK6 A;  3SED A;  2QIY A;  3OW2 2;  3UL5 A;  1JRQ A;  3UL6 A;  2Z76 A;  5KP4 A;  4R1K A;  1NO3 A;  1OAC A;  3NX0 A;  2XRX B;  1UI8 A;  4HZ9 B;  2BMQ B;  4LZI A;  4L7K A;  1LVN A;  3JUM A;  1QJG A;  1Q82 4;  3PXM A;  4ORL A;  1US1 A;  4LGQ A;  3CMA 3;  3MG1 A;  4Q53 A;  2CFW A;  3SOY A;  2XGL A;  4RNY A;  4HJL B;  1JB5 A;  1E3V A;  2HMJ B;  1SII A;  1YHQ 3;  3FG4 A;  3X3Y A;  3S67 A;  1OGZ A;  2BMO B;  3GZR A;  1W4N A;  2PZV A;  5JBS A;  4XB5 A;  3DY5 A;  4HKV B;  3K9M C;  5EVH A;  1KD1 4;  3CPW 2;  1FA3 A;  3M8C A;  3H3H A;  4GB5 A;  4FMC A;  3FLJ A;  3CNX A;  1PU4 A;  1A2V A;  3EJV A;  2OQE A;  3T8U A;  2YX9 A;  3FF0 A;  4HM7 B;  2CFL A;  4N6O B;  3X3X A;  3BNE A;  1TFK A;  2LYX A;  5IG5 A;  1UUV B;  4N6V 0;  1TUH A;  3N54 B;  3PZW A;  4GL6 A;  5CLK A;  1FGQ A;  4HM8 B;  3LXU X;  3NBR A;  2BHM A;  3KKG A;  4IIA A;  4HBR A;  2P38 A;  4MMX B;  3LZA A;  5AIH A;  2W2C A;  3F7S A;  3EE1 A;  3MG2 A;  2QA4 3;  3NXJ A;  3FF2 A;  3WOD G;  1SJW A;  2B1X B;  3K63 A;  1Q86 4;  4O2H A;  3S27 A;  4AKZ A;  2YFI B;  1O7N B;  4KZ1 A;  1OH0 A;  5BXQ A;  4MJD A;  3JUP A;  1JKG A;  3BLZ A;  4FMD A;  4BTY A;  4U13 A;  1TFO A;  3CCS 3;  4XDW A;  2IUJ A;  2GEX A;  2L4V A;  3B8L A;  4KFE A;  2V1L A;  5LC6 A;  3X42 A;  1VQO 3;  1WNH A;  4LMI A;  3GWR A;  4X2O A;  3I0Y A;  3SXX A;  3CC7 3;  3JUO A;  1RKY A;  1EG9 B;  3OXA A;  3CCU 3;  1ASK A;  2RFR A;  3LYG A;  2W56 A;  1AVL A;  1U5O A;  3T0U A;  4EV2 A;  3PS8 A;  3IJE B;  1NWW A;  3CU3 A;  1E3R A;  2GU1 A;  1OF5 A;  3B4O A;  2CFK A;  4XM4 A;  7STD A;  2XFS A;  3OWS A;  1EKM A;  3CCJ 3;  2INX A;  3B4P A;  2B24 B;  3N9H A;  2CH9 A;  4EXR A;  3DGN A;  2HMN B;  3X3Z A;  5FW5 A;  1N9E A;  1VQ6 3;  4AEQ A;  2W04 A;  3LOY A;  1LOX A;  1QAF A;  4OUQ A;  1UI7 A;  3ER7 A;  3NBJ A;  1MNL A;  3SOA A;  1AVK A;  4HYZ A;  2YFJ B;  3Q2P A;  1C7H A;  1A90 A;  1VQP 3;  1YJ9 3;  4R9L A;  1OUN A;  4HM3 B;  3F8X A;  1NU3 A;  2WOH A;  3G4S 3;  1SPU A;  5JPU A;  1JJ2 2;  1RRL A;  2XF3 A;  1DMQ A;  5IG0 A;  1U8C B;  4EC6 A;  1IV7 A;  1CQS A;  1DMN A;  1IT8 A;  1WMP A;  4I4K A;  4KVH A;  3HX8 A;  3D3L A;  3D9R A;  4O3V A;  1ROA A;  2GXF A;  3FSD A;  3LTC A;  1W5Z A;  2WGQ A;  2WO0 A;  2ML6 A;  2CW9 A;  4STD A;  2HML B;  4FR9 A;  1Q7Y 4;  1FGM A;  3K7C A;  2OOV C;  3DGO A;  3PYJ A;  3GAX A;  1R4C A;  2C11 A;  1D6Y A;  2CWU A;  1A67 A;  1VQM 3;  2D1W A;  1GS3 A;  1N5P A;  1T5Y A;  2CFG A;  3F9S A;  1IT7 A;  3ALA A;  3CCL 3;  5D83 A;  1IV9 A;  2BNG A;  3RGR A;  4WWU C;  2K54 A;  3CME 3;  3EBT A;  3A76 A;  5HGR A;  3OX9 A;  2K0M A;  3BNC A;  2BO9 B;  3FH1 A;  4CDL A;  3IMA B;  2E2U A;  2YFL B;  3PCR A;  3GZB A;  3RDE A;  3VSY A;  1VQL 3;  5CF1 A;  3HIG A;  3I56 3;  4G1M B;  2GEY A;  4HM4 B;  3CC4 3;  3L0R A;  4H61 A;  3MPH A;  3MYT A;  1LXE A;  1J2B A;  1AV4 A;  3NHX A;  3WDG B;  2LQV A;  1OCV A;  4HM5 B;  4K1V A;  4KFD A;  2RGQ A;  4NHF A;  1QMA A;  3DZL A;  1JB4 A;  3LT9 A;  3UB1 A;  4XDV A;  3CXC 2;  3CCE 3;  1Y4K A;  5AIF A;  1VQ9 3;  1VQK 3;  1YJN 3;  1FUW A;  1GY6 A;  1FGT A;  3B7C A;  4IT7 A;  1JNQ A;  1Q81 4;  3FZW A;  1VQ7 3;  1BUQ A;  1GY7 A;  1NJI 4;  5IG4 A;  3KN4 A;  3NQZ A;  3OV4 A;  3UNL A;  1ULI B;  3NBB A;  3G71 3;  1JN5 A;  2XGN A;  5IW9 A;  2P0M A;  3RGA A;  5DRE A;  3AMO A;  4K90 B;  2ZL8 A;  2CWV A;  4OK0 A;  5BVB A;  3LTB A;  1GD3 A;  2R4I A;  4N6N B;  2W03 A;  2FNQ A;  2Z77 A;  3KSE D;  1DMM A;  5IEN A;  1KQS 2;  3NM7 A;  3QK9 A;  5KP1 A;  3EC9 A;  3KE7 A;  1IQ8 A;  3CCQ 3;  5KP3 A;  3KSP A;  1FGO A;  3LT8 A;  1LNH A;  2UX0 A;  3S29 A;  2BT3 A;  4J8T A;  3EN8 A;  1PFP A;  1W6Y A;  3CCM 3;  4RZM A;  3CPO A;  1Q40 A;  2F99 A;  2WOF A;  2PNC A;  1N5H A;  2P05 A;  2HMK B;  1NB3 I;  3NQY A;  3I55 3;  1OHS A;  5AYR B;  2Z7A A;  4RBN A;  1RJO A;  3IPT A;  4FCJ A;  5AI1 A;  2MC8 A;  4QWT A;  1VZZ A;  1DVC A;  2IMJ A;  4HZB B;  3GRD A;  2CG0 A;  2P09 A;  1CYU A;  3N8B A;  1D6Z A;  6STD A;  2E2V A;  1S72 3;  1MOL A;  5CF2 A;  1IQY A;  1K41 A;  4PEJ A;  4X2H A;  4R9K A;  3G16 A;  2ML5 A;  3HII A;  3KII A;  3SX1 A;  4OVM A;  3BND A;  2CKF B;  3PCS A;  1STD A;  1DVD A;  1YGE A;  2W9Q A;  2CC3 A;  3NV0 B;  1O7G B;  1M1K 4;  1WQL B;  3GZX B;  3VF1 A;  2W6J H;  1O7M B;  5IEP A;  1YVB I;  1GY5 A;  3U97 A;  3V99 A;  2SBL A;  4BTW A;  4JRF A;  5STD A;  1K73 4;  5FGO A;  3WOE B;  1G96 A;  1YIT 3;  3HZP A;  3F14 A;  3F8H A;  1QVG 2;  1VQ5 3;  2W9P A;  1IU7 A;  5JPP A;  5ELU A;  1IVX A;  2KCD A;  2P0X A;  4L8P A;  1EQK A;  1S5A A;  1TU5 A;  2CIU A;  4K1U A;  2QGU A;  3FG3 A;  3Q1C A;  1JV2 B;  1FGR A;  3KFQ C;  2OOV A;  3BB9 A;  4WHA A;  4XBX A;  4LEH A;  4WP5 A;  2F86 B;  1CYV A;  3WOF B;  1OF5 B;  3Q90 A;  1M90 4;  5AYS C;  1CEW I;  4LSO A;  1NB5 I;  5I97 A;  4FMB A;  1ROV A;  2XSO B;  4N6L A;  5TGN A;  3TDG A;  1W2B 2;  1EA2 A;  2OTL 3;  1TIJ A;  2O9U X;  1N8R 4;  2Y74 A;  3CCV 3;  3HI7 A;  3PGB A;  2QEX 3;  2HMO B;  1K9M 4;  1QAL A;  2WGO A;  5A0O B;  1STF I;  3S28 A;  1W2Z A;  4KFF A;  3U1W A;  2GU3 A;  1OHO A;  3MG3 A;  1N8Q A;  5AII A;  1VQ4 3;  2E2T A;  3DM8 A;  4NRE A;  3FGY A;  3JVC A;  3CNM A;  5G2G A;  3G0K A;  2CWT A;  4FCM A;  4AKY A;  3SVA A;  4O02 B;  3MSO A;  4MMZ B;  5EEO A;  3G8Z A;  3ROB A;  1OPY A;  1IVV A;  3STD A;  1KC8 4;  1L5G B;  3DXO A;  3EN1 B;  4L8O A;  3EF8 A;  4IPB A;  2OQE C;  2RSX A;  5EQL A;  4WYK B;  4HM2 B;  5AEW B;  2XSH B;  3GZY B;  3BNB A;  1E97 A;  3WA2 X;  2XEP A;  2I9W A;  2KXG A;  2OWP A;  1W00 A;  1VQN 3;  2MF7 A;  3DGL A;  3LTA A;  3JUN A;  1GYB A;  1RRH A;  1F8N A;  5LC7 A;  3LH4 A;  4H3U A;  4N3V A;  1DYU A;  4R4K A;  3CD6 3;  1IVU A;  3E99 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...