2P09A

Structural insights into the evolution of a non-biological protein
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
69
structure length
69
Chain Sequence
DDDDKKTNWLKRIYRVRPCVKCKVAPRDWKVKNKHLRIYNMCKTCFNNSIDIGDDTYHGHVDWLMYADS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords a non-biological ATP binding protein with two mutations N32D
publication title Structural insights into the evolution of a non-biological protein: importance of surface residues in protein fold optimization.
pubmed doi rcsb
source organism Unidentified
total genus 19
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2007-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.210 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2p09A00
3DGNA 3LTBA 3DGLA 3LT8A 3LT9A 3LTDA 1UW1A 2P05A 3LTAA 2P09A 3LTCA 3DGMA 3DGOA 2P0XA
chains in the Genus database with same CATH superfamily
2BU4A 1IV7A 2F5WA 5DRVA 3AHSA 1K8A4 2WGQA 1BRNL 1E97A 3PCRA 1UDII 1RSNA 1YJW3 3HIIA 1W02A 2C11A 1VQ43 3X3YA 2L4VA 3FG4A 1TP6A 2BMQB 2CKFB 2ZDJA 4AKYA 8CHOA 2UUGC 3SYUA 3WHOA 3DGMA 1BOXA 2CX0A 4FCZA 2OWPA 2JQ5A 2XF3A 4R1KA 1YHQ3 1I2GA 1B20A 1UCIA 3MYTA 5BIRA 1RNTA 2K0MA 2P09A 4K1UA 1W6YA 3CCJ3 1AQZA 1NNVA 3WMDA 2JDIH 1WQLB 2BMRB 3QRDA 4EBGA 3H51A 1RJOA 1FGQA 5FW5A 5A0OB 4FCMA 3F7XA 1LOYA 1IVWA 1RRLA 2IMJA 2BIRA 2OOVC 3GZXB 1E3VA 4OK0A 3SLUA 1IVUA 1UI8A 1N8R4 3G0KA 2CG1A 1IQYA 1T3BA 1B2MA 2R41A 4XB5A 3LXUX 1TFKA 5CF1A 2CWUA 1EKMA 1B3SA 3LTAA 2ML6A 3X3XA 5IW9A 3CCQ3 1T2HA 4XBTA 3G6E3 2OTL3 2XSOB 1RGHA 1PY3A 3MSOA 1OH0A 1MWRA 1GY5A 1KC84 1LOWA 1ROAA 3CNMA 2HMKB 3KCHA 4FR9A 1GS3A 1K41A 4RBNA 4N6LA 2H0HA 4HM8B 2BNGA 1Q7Y4 2J8XB 1I0XA 3CC73 1BSCA 2HMOB 1RRHA 2QGUA 4HM5B 8RNTA 2I9WA 3SVAA 3CCL3 2CFKA 2O9UX 3NX0A 1VQ73 3CD63 1FUSA 1NO3A 4XBYA 3BIRA 1BSBA 4LMIA 3MKIA 3WDGB 3FH1A 1STFI 3B4OA 4K1VA 3D9RA 4R80A 1CEWI 1N9JA 2RCDA 2LQVA 3N9HA 1CYUA 2YFJB 1VQM3 2RFRA 1DMQA 1W6CA 1V58A 3PGBA 4O3VA 1IT8A 1EUIC 2AAEA 4O02B 1M1K4 2IYJA 2L1SA 1SPUA 3KZTA 3CCM3 1FYSA 6GSPA 5KP1A 3ALAA 1LRAA 1LNIA 3BNDA 3JUQA 2W03A 1X1XA 4CDLA 3PZWA 1GOUA 2P05A 2Z77A 3KSPA 3WOFB 3MG2A 1RLSA 4O8SA 4N6V0 2W9PA 3NQYA 4LEHA 4STDA 4GHOA 3AMOA 1UGIA 1IT7A 3EX9A 3HZPA 3D5GA 3X41A 1UGHI 2HMJB 3WODG 3AGOA 3QK9A 3MHEA 1QVG2 1UI7A 4XDWA 3JVCA 1ASKA 1QAFA 3OXAA 1GMRA 1N5PA 5IG0A 3NM7A 3UL6A 2F98A 2PZVA 1Q7HA 3CMA3 4XM4A 2F5MA 1HZ1A 3GRDA 2BHMA 1RGGA 2KXGA 3RGAA 5CXOA 3S5CA 3BLZA 2WGOA 1E3RA 1BNIA 1JN5B 3CCS3 1TJDA 2XGLA 3SX1A 1VQP3 3UNLA 2Z6BA 1DMNA 3FSDA 1JZOA 3GWRA 1IQXA 1RGKA 1KD14 1W5ZA 1I0VA 1I2FA 1YVSA 2K54A 4KZ1A 1WMNA 1K734 2XRXB 4R9LA 4EW5A 1UUWB 4MMZB 2QA43 1KWIA 1G0TA 3BNEA 3DZLA 4HM6B 5IG4A 1PU4A 1VQ93 1V74A 1Q814 1C54A 2SBLA 4BL2A 4BTYA 1JB2A 3I553 2BMOB 1UW1A 5FGOA 4R9KA 4EC6A 1FZUA 1ISKA 3K5TA 1R4YA 4RNZA 2UGIA 4HAAA 5CLKA 5M1AA 1D6UA 1JBTA 3N8BA 1O7WB 5IF6A 1S5AA 3HIGA 1NDOB 3KE7A 1M1XB 1ULJB 2XGNA 2V1LA 1Z1SA 3LOYA 5AIIA 4HM0B 2CC3A 2D1WA 3DGLA 1IVXA 3EQQB 5AYRB 1L5GB 3CCV3 5CF2A 1A90A 2CK3H 1X1UA 2O3OA 5HOHA 1FW7A 2CG0A 3CCE3 2CFWA 5DREA 3BU4A 1K28A 1ULIB 2XFSA 9RNTA 1BNGA 1QAKA 3ROBA 1JBSA 1JKGA 1FGTA 4N3VA 1W00A 2RGQA 3Q90A 2SARA 3Q1CA 2HMMB 3VGNA 1SIHA 2ZA4A 1OGXA 4RZMA 3S28A 3G713 1VQ83 2QEX3 5ELUA 2AADA 1B21A 4ILFA 1PYLA 3CXC2 1VQK3 1UUVB 1JBRA 3F40A 2W2CA 2XFTA 1WTHA 2Z76A 5JBSA 5GSPA 4FMBA 4CPKA 5EQLA 3O8YA 1BSDA 1RGFA 4Q53A 1CYVA 3FCSB 3MG1A 3AGNA 4BTXA 1FUWA 5IG3A 1O7MB 1RGEA 2ML5A 3WOEB 1RMSA 3Q2PA 3MG3A 2W56B 4HM1B 4QWTA 5IEPA 1BRGA 3RGRA 2KF3A 3S27A 1RN1A 1W2ZA 2FNQA 4RNYA 3STDA 1OGZA 3EF8A 3LTBA 3AHWA 3V98A 7RNTA 1ZS7A 1BNFA 1W6GA 3GSPA 3NQZA 2M7OA 1I2EA 1A2VA 3G16A 1MWTA 2RSXA 5JPUA 1UCKA 1MOLA 3LMLA 2XR8B 1GD3A 4KVHA 3X42A 4KFFA 1GMQA 3IJEB 1TRPA 1RN4A 1HYFA 2OQEC 3KKGA 4N6OB 1BU4A 1BRIA 3LT9A 3UB1A 4WP5A 1VQO3 1W01A 2E2TA 1YVBI 1Q40B 4LSOA 3G8ZA 1VZZA 1TTOA 1O7HB 1BNRA 5AEUB 2F86B 3PCSA 2GXFA 3OWYA 4HOHA 3UJMA 1AY7A 4FMCA 1LXEA 1I8VA 3KN4A 4CJNA 3OW22 3DM8A 3A76A 4WYKB 3EB8A 5AIHA 3FGYA 1IK3A 3KSED 2Y73A 2IA7A 4OUQA 4DKIA 3NV0A 2P0MA 1JB4A 1UCJA 3CME3 1T5YA 1B27A 1QMAA 3HOHA 3CU3A 3T8UA 2HMLB 7STDA 5G1KA 3F9SA 3JUPA 1YGWA 4N6TA 5BU4A 2CIUA 1G02A 2ZHXB 1BUQA 3SOYA 2WOFA 1OHSA 2CFGA 1MGRA 4HM3B 3EN8A 4GB5A 1RGLA 3FF0A 2KRTA 1WNHA 1NB5I 3LTCA 1N9EA 3FG3A 1AVKA 2GBXB 2GSPA 4MMXB 1DYUA 3BNBA 1M904 1VQ63 1OF5B 4CCVA 2CWTA 2IUKA 5RNTA 1IV9A 1IQ8A 4HVNA 1DETA 1A2KA 1US1A 3JUNA 3DH2A 5D81A 4MJDA 2INXA 2CFLA 3JUOA 3S67A 3MWZA 1O7NB 4HM4B 5M18A 1X1YA 1TFOA 1AR0A 1GY6A 3K63A 4L8OA 3FZWA 3SEDA 1YIJ3 3D79A 4HYZA 3WA2X 3ZG0A 2E2UA 5I97A 1TUHA 1Q824 1ZGXA 4LZIA 3ZG5A 1JB5A 4R4KA 1QJGA 2F4YA 5D82A 1EEJA 3FLJA 4IT7A 2B24B 3A5EA 1BSEA 3EHCA 1RDSA 2XEPA 1WMOA 1BRJA 4RNTA 4HKVB 1VQ53 3EC9A 1OCVA 4HZ9B 3LYGA 4H3UA 1FGMA 2WOHA 3GAXA 2PNCA 1UCLA 1LOVA 1HKXA 5BVBA 1BUJA 2KF4A 1JN5A 2P38A 5LC7A 2Z7AA 5KP4A 3E99A 5AIGA 3G4S3 3OX9A 1GOVA 3SXXA 4HBRA 4TX4A 2HOHA 4MEIA 2CX1A 3K7CA 3CC43 1Q9EA 3FF2A 4N6NB 2C4BA 1MNLA 1TIJA 2GBWB 4I4KA 2RBIA 4IPBA 3ECFA 1U8CB 5IERA 1RN7A 1B2XA 1N8QA 2OCTA 3V92A 4H61A 1V57A 5BXQA 2CH9A 3F7SA 2YX9A 4X2OA 1OPYA 1GOYA 1EQKA 4J8TA 4ZM8A 3EN1B 3V99A 2HMNB 1IVVA 3D3LA 2BT3A 2B1XB 4I5QA 3FKAA 3PXMA 3T8NA 1GSPA 1IU7A 1GYBA 5KP3A 3F14A 4GL6A 1IDPA 3X3ZA 3GZYB 1X1WA 2YFIB 1J2BA 1DMMA 1BNSA 1M9GA 1I3FA 1YJN3 3GZBA 3NBJA 5AEWB 3OWSA 4HM7B 2MF7A 1G96A 5G2GA 4K90B 4KT3B 2W9QA 4HM2B 4O2HA 2KF6A 3B7CA 2CHCA 5EEOA 1LNHA 3TDGA 3HX8A 3Q3FA 4PEJA 2F56A 4MMYB 4U13A 4AEQA 4LYLB 4ORLA 5CK6A 4XBXA 1NWWA 1UUGB 2STDA 1U5OA 1BANA 1GMPA 4HJLB 4WWUC 5LC6A 2Y74A 1SIIA 5EVHA 1Q864 3D4AA 1B2UA 3DGYA 3EJVA 4AKZA 1A2PA 1I3IA 3KIIA 1MWSA 1LOXA 3DGOA 3HI7A 2IY2A 2K3DA 3L0RA 4JRFA 2RNTA 3DUKA 1I70A 3JUMA 4N6UA 3GZRA 5STDA 1JZDA 1W7CA 4EV2A 1RNBA 2OTJ3 1RGCA 3RDEA 3URPA 3FG1A 3N54B 2BO9B 3K9MC 3DGNA 5AI1A 1VQQA 4BTWA 2W56A 4LGQA 1O7GB 1OUNA 3IPTA 5TGNA 1NU3A 2P0XA 1YGEA 3IMAB 4G1MB 1VQL3 4K61A 1ZO2A 3F8HA 1BIRA 1FGRA 1QVF2 4J9AA 3LTDA 3K0ZA 1MWUA 2GEXA 1SARA 3DMCA 1S723 3VSYA 3MPHA 4NPBA 1SJWA 2D42A 1BGSA 3EE1A 1YNVX 1OACA 4OVMA 3NXJA 3CPW2 1YJ93 4XDVA 4GSPA 1DE3A 1R4CA 1IYYA 2A15A 1BAOA 1Q42A 3KFQC 3EBYA 3NBBA 3U97A 3I563 1YI23 2ZL8A 1BRKA 4FMDA 1BNEA 4N6MA 3J7Yd 3NV0B 2W6JH 1PFPA 1EA2A 1Q40A 3F8XA 1D6YA 4EXRA 1KSIA 3CCU3 1OHPA 2YFLB 1JRQA 4HZBB 2CFDA 2UX0A 3NM2A 2MC8A 3BNCA 7GSPA 3AMOB 3NBRA 1AV4A 3I0YA 4X2HA 4L7KA 5D83A 1RHLA 1W4NA 1RKYA 3BB9A 3CCR3 5HGRA 4KFEA 3B8LA 1B2ZA 3OV4A 1NJI4 4WYKA 3DXOA 1FA3A 1BRHA 4WHAA 5AIFA 2XSHB 3X40A 3EBTA 2H0IA 1TRQA 1N5HA 3ZFZA 3WA3A 4FMAA 3CC23 2OOVA 2LYXA 1FGOA 4JF8A 3PYJA 2IUJA 2H0GA 1K9M4 1RTUA 3PS8A 1RGAA 5ELJA 3H3HA 2C10A 1GY7A 2FGTA 5IENA 1JNQA 3DY5A 4KFDA 4EYCA 1EG9B 1B2SA 1RCLA 2R4IA 3NHXA 4L8PA 5IG5A 1LQGC 4NREA 1ZX2A 2GEYA 2GU3A 3HK4A 1BVIA 5AYSC 2Q07A 3LZAA 1O7PB 5M19A 5JPPA 1TU5A 1T2IA 1OF5A 3U1WA 3S29A 2WO0A 3RNTA 3B4PA 1DVDA 6STDA 1NB3I 4FCJA 3LT8A 3T0UA 3NUVA 4BIRA 1CQSA 1BNJA 1QALA 3M8CA 1KQS2 1OHOA 2F99A 1STDA 4WFOA 4J5GA 2XH9A 1D6ZA 2OQEA 1ROVA 2W0QA 3WR2A 3LH4A 2W04A 1CH0A 1LVNA 3D5IA 3SOAA 6RNTA 1YIT3 1HU9A 1BSAA 1FUTA 1MGWA 1GD4A 1A67A 1AVLA 3ER7A 2GU1A 2KF5A 1LQMB 4IIAA 3UL5A 2KAAA 3VF1A 3CNXA 3OWUA 1F8NA 2FXTA 4EV5A 4J5KA 5IEOA 1JJ22 2CW9A 1RCKA 1JV2B 1Y4KA 1VQN3 4BL3A 4NHFA 2E2VA 2KCDA 3CPOA 4BU4A 1DVCA 2QIYA 5G1LA 1W2B2 1C7HA 1BRSA 1JKGB 2CWVA 1SQWA 1WMPA
chains in the Genus database with same CATH topology
1IV7A 5DRVA 1K8A4 2WGQA 1E97A 3PCRA 1YJW3 3HIIA 1W02A 2C11A 1VQ43 3X3YA 2L4VA 3FG4A 1TP6A 2BMQB 2CKFB 2ZDJA 4AKYA 8CHOA 3DGMA 4FCZA 2OWPA 2JQ5A 2XF3A 4R1KA 1YHQ3 3MYTA 2K0MA 2P09A 4K1UA 1W6YA 3CCJ3 3WMDA 2JDIH 1WQLB 2BMRB 3QRDA 4EBGA 3H51A 1RJOA 1FGQA 5FW5A 5A0OB 4FCMA 3F7XA 1IVWA 1RRLA 2IMJA 3GZXB 2OOVC 1E3VA 4OK0A 3SLUA 1IVUA 1UI8A 1N8R4 3G0KA 2CG1A 1IQYA 4XB5A 3LXUX 1TFKA 5CF1A 2CWUA 1EKMA 3LTAA 5IW9A 2ML6A 3X3XA 3CCQ3 3G6E3 4XBTA 2OTL3 2XSOB 3MSOA 1OH0A 1GY5A 1KC84 1ROAA 3CNMA 2HMKB 4FR9A 1GS3A 1K41A 4RBNA 4N6LA 4HM8B 2BNGA 1Q7Y4 3CC73 2HMOB 1RRHA 2QGUA 4HM5B 2I9WA 3SVAA 3CCL3 2CFKA 2O9UX 3NX0A 3CD63 1NO3A 4XBYA 4LMIA 3MKIA 3WDGB 3FH1A 1STFI 3B4OA 4K1VA 3D9RA 4R80A 1CEWI 1N9JA 2RCDA 2LQVA 3N9HA 1CYUA 2YFJB 1VQM3 2RFRA 1DMQA 1W6CA 3PGBA 4O3VA 1IT8A 4O02B 1M1K4 1SPUA 3KZTA 3CCM3 5KP1A 3ALAA 3BNDA 3JUQA 2W03A 4CDLA 3PZWA 2Z77A 2P05A 3KSPA 3WOFB 3MG2A 4STDA 4O8SA 4N6V0 2W9PA 3NQYA 4LEHA 3AMOA 1IT7A 3EX9A 3HZPA 3X41A 2HMJB 3WODG 3QK9A 3MHEA 1UI7A 4XDWA 3JVCA 1ASKA 1QAFA 3OXAA 1N5PA 5IG0A 3NM7A 3UL6A 2F98A 2PZVA 3CMA3 4XM4A 3GRDA 2BHMA 2KXGA 3RGAA 5CXOA 3S5CA 3BLZA 2WGOA 1E3RA 1JN5B 3CCS3 3SX1A 2XGLA 1VQP3 3UNLA 2Z6BA 1DMNA 3FSDA 3GWRA 1IQXA 1KD14 1W5ZA 2K54A 4KZ1A 1WMNA 1K734 2XRXB 4R9LA 1UUWB 4MMZB 2QA43 1KWIA 3BNEA 3DZLA 4HM6B 5IG4A 1PU4A 1VQ93 1V74A 1Q814 2SBLA 4BTYA 1JB2A 3I553 2BMOB 1UW1A 5FGOA 4R9KA 4EC6A 1ISKA 3K5TA 4RNZA 5CLKA 1D6UA 3N8BA 1O7WB 5IF6A 1S5AA 3HIGA 1NDOB 3KE7A 1M1XB 1ULJB 2XGNA 2V1LA 1Z1SA 3LOYA 5AIIA 4HM0B 2CC3A 2D1WA 3DGLA 1IVXA 3EQQB 5AYRB 1L5GB 3CCV3 5CF2A 1A90A 2CK3H 2O3OA 2CG0A 3CCE3 2CFWA 5DREA 1K28A 1ULIB 2XFSA 1QAKA 3ROBA 1JKGA 1FGTA 4N3VA 1W00A 2RGQA 3Q90A 3Q1CA 2HMMB 3VGNA 1SIHA 3G713 1OGXA 4RZMA 3S28A 1VQ83 2QEX3 5ELUA 1VQK3 3CXC2 1UUVB 3F40A 2W2CA 2XFTA 1WTHA 2Z76A 5JBSA 4FMBA 5EQLA 3O8YA 4Q53A 1CYVA 3FCSB 3MG1A 1FUWA 4BTXA 5IG3A 1O7MB 3WOEB 2ML5A 3Q2PA 3MG3A 2W56B 4HM1B 4QWTA 5IEPA 3RGRA 3S27A 1W2ZA 2FNQA 4RNYA 3STDA 1OGZA 3EF8A 3LTBA 3V98A 1W6GA 3NQZA 2M7OA 1A2VA 3G16A 2RSXA 5JPUA 1MOLA 3LMLA 2XR8B 1GD3A 4KVHA 3X42A 4KFFA 3IJEB 2OQEC 3KKGA 4N6OB 3LT9A 3UB1A 4WP5A 1VQO3 1W01A 2E2TA 1YVBI 1Q40B 4LSOA 3G8ZA 1VZZA 1O7HB 5AEUB 2F86B 3PCSA 2GXFA 3OWYA 3UJMA 4FMCA 1LXEA 3KN4A 3OW22 3DM8A 3A76A 4WYKB 3EB8A 5AIHA 3FGYA 1IK3A 3KSED 2Y73A 2IA7A 4OUQA 3NV0A 2P0MA 1JB4A 3CME3 1T5YA 1QMAA 3CU3A 3T8UA 2HMLB 7STDA 3F9SA 3JUPA 4N6TA 2CIUA 1BUQA 3SOYA 2WOFA 1OHSA 2CFGA 4HM3B 3EN8A 4GB5A 3FF0A 1NB5I 2KRTA 1WNHA 3LTCA 1N9EA 3FG3A 1AVKA 2GBXB 4MMXB 1DYUA 3BNBA 1M904 1VQ63 1OF5B 4CCVA 2CWTA 2IUKA 1IV9A 1IQ8A 4HVNA 1A2KA 1US1A 3JUNA 5D81A 4MJDA 2INXA 2CFLA 3JUOA 3S67A 3MWZA 1O7NB 4HM4B 4L8OA 1TFOA 1AR0A 1GY6A 3K63A 3SEDA 3FZWA 1YIJ3 4HYZA 3WA2X 2E2UA 5I97A 1TUHA 1Q824 4LZIA 1JB5A 4R4KA 1QJGA 5D82A 1QVG2 3FLJA 4IT7A 1VQ73 2B24B 3EHCA 2XEPA 1WMOA 4HKVB 1VQ53 3EC9A 1OCVA 4HZ9B 3LYGA 4H3UA 1FGMA 2WOHA 3GAXA 2PNCA 1HKXA 5BVBA 1JN5A 2P38A 5LC7A 2Z7AA 5KP4A 3E99A 5AIGA 3G4S3 3OX9A 3SXXA 4HBRA 4TX4A 4MEIA 3K7CA 3CC43 3FF2A 4N6NB 1MNLA 1TIJA 2GBWB 4I4KA 4IPBA 3ECFA 1U8CB 5IERA 1RN7A 1N8QA 2OCTA 3V92A 4H61A 5BXQA 2CH9A 3F7SA 2YX9A 4X2OA 1OPYA 1EQKA 4J8TA 4ZM8A 3EN1B 3V99A 2HMNB 1IVVA 3D3LA 2BT3A 2B1XB 3FKAA 3PXMA 3T8NA 1IU7A 1GYBA 5KP3A 3F14A 4GL6A 1IDPA 3X3ZA 3GZYB 2YFIB 1J2BA 1DMMA 1M9GA 1YJN3 3GZBA 3NBJA 5AEWB 3OWSA 4HM7B 2MF7A 1G96A 5G2GA 4K90B 2W9QA 4HM2B 4O2HA 3B7CA 2CHCA 5EEOA 1LNHA 3TDGA 3HX8A 4PEJA 4AEQA 4MMYB 4U13A 4ORLA 5CK6A 4XBXA 1NWWA 2STDA 1U5OA 4HJLB 4WWUC 5LC6A 2Y74A 1SIIA 5EVHA 3EJVA 4AKZA 3KIIA 1LOXA 3DGOA 3HI7A 4JRFA 3L0RA 3DUKA 3JUMA 4N6UA 3GZRA 5STDA 4EV2A 1W7CA 2OTJ3 3RDEA 3FG1A 3N54B 2BO9B 3K9MC 3DGNA 5AI1A 4BTWA 2W56A 4LGQA 1O7GB 1OUNA 3IPTA 5TGNA 1NU3A 2P0XA 1YGEA 3IMAB 4G1MB 1VQL3 4K61A 1ZO2A 3F8HA 1FGRA 1QVF2 4J9AA 3LTDA 3K0ZA 2GEXA 3DMCA 1S723 3VSYA 3MPHA 1SJWA 2D42A 3EE1A 1OACA 4OVMA 3NXJA 3CPW2 1YJ93 4XDVA 1R4CA 2A15A 3KFQC 1Q42A 3EBYA 3NBBA 3U97A 3I563 1YI23 2ZL8A 4FMDA 4N6MA 3J7Yd 3NV0B 2W6JH 1PFPA 1EA2A 1Q40A 3F8XA 1D6YA 4EXRA 1KSIA 3CCU3 1OHPA 2YFLB 1JRQA 4HZBB 2CFDA 2UX0A 3NM2A 2MC8A 3BNCA 3AMOB 3NBRA 1AV4A 3I0YA 4X2HA 4L7KA 5D83A 1W4NA 1RKYA 3BB9A 3CCR3 5HGRA 4KFEA 3B8LA 3OV4A 1NJI4 4WYKA 3DXOA 1FA3A 4WHAA 5AIFA 2XSHB 3X40A 3EBTA 1N5HA 3WA3A 4FMAA 3CC23 2OOVA 2LYXA 1FGOA 4JF8A 3PYJA 2IUJA 1K9M4 3PS8A 5IENA 5ELJA 3H3HA 2C10A 1GY7A 2FGTA 1JNQA 3DY5A 4KFDA 4EYCA 1EG9B 2R4IA 3NHXA 4L8PA 5IG5A 4NREA 1ZX2A 2GEYA 2GU3A 3HK4A 5AYSC 2Q07A 3LZAA 1O7PB 5JPPA 1TU5A 1OF5A 3U1WA 3S29A 2WO0A 3B4PA 1DVDA 6STDA 1NB3I 4FCJA 3LT8A 3T0UA 3NUVA 1CQSA 1QALA 3M8CA 1KQS2 1OHOA 2F99A 1STDA 4WFOA 2XH9A 1D6ZA 2OQEA 1ROVA 2W0QA 3LH4A 2W04A 1LVNA 3SOAA 1YIT3 1HU9A 1GD4A 1A67A 1AVLA 3ER7A 2GU1A 4IIAA 3UL5A 3VF1A 3CNXA 3OWUA 1F8NA 2FXTA 4EV5A 5IEOA 1JJ22 2CW9A 1JV2B 1Y4KA 1VQN3 4NHFA 2E2VA 2KCDA 3CPOA 1W2B2 1DVCA 2QIYA 1Q864 1C7HA 1JKGB 2CWVA 1SQWA 1WMPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DGN A;  3LTB A;  3DGL A;  3LT8 A;  3LT9 A;  3LTD A;  1UW1 A;  2P05 A;  3LTA A;  2P09 A;  3LTC A;  3DGM A;  3DGO A;  2P0X A; 
#chains in the Genus database with same CATH topology
 2BU4 A;  1IV7 A;  2F5W A;  5DRV A;  3AHS A;  1K8A 4;  2WGQ A;  1BRN L;  1E97 A;  3PCR A;  1UDI I;  1RSN A;  1YJW 3;  3HII A;  1W02 A;  2C11 A;  1VQ4 3;  3X3Y A;  2L4V A;  3FG4 A;  1TP6 A;  2BMQ B;  2CKF B;  2ZDJ A;  4AKY A;  8CHO A;  2UUG C;  3SYU A;  3WHO A;  3DGM A;  1BOX A;  2CX0 A;  4FCZ A;  2OWP A;  2JQ5 A;  2XF3 A;  4R1K A;  1YHQ 3;  1I2G A;  1B20 A;  1UCI A;  3MYT A;  5BIR A;  1RNT A;  2K0M A;  2P09 A;  4K1U A;  1W6Y A;  3CCJ 3;  1AQZ A;  1NNV A;  3WMD A;  2JDI H;  1WQL B;  2BMR B;  3QRD A;  4EBG A;  3H51 A;  1RJO A;  1FGQ A;  5FW5 A;  5A0O B;  4FCM A;  3F7X A;  1LOY A;  1IVW A;  1RRL A;  2IMJ A;  2BIR A;  2OOV C;  3GZX B;  1E3V A;  4OK0 A;  3SLU A;  1IVU A;  1UI8 A;  1N8R 4;  3G0K A;  2CG1 A;  1IQY A;  1T3B A;  1B2M A;  2R41 A;  4XB5 A;  3LXU X;  1TFK A;  5CF1 A;  2CWU A;  1EKM A;  1B3S A;  3LTA A;  2ML6 A;  3X3X A;  5IW9 A;  3CCQ 3;  1T2H A;  4XBT A;  3G6E 3;  2OTL 3;  2XSO B;  1RGH A;  1PY3 A;  3MSO A;  1OH0 A;  1MWR A;  1GY5 A;  1KC8 4;  1LOW A;  1ROA A;  3CNM A;  2HMK B;  3KCH A;  4FR9 A;  1GS3 A;  1K41 A;  4RBN A;  4N6L A;  2H0H A;  4HM8 B;  2BNG A;  1Q7Y 4;  2J8X B;  1I0X A;  3CC7 3;  1BSC A;  2HMO B;  1RRH A;  2QGU A;  4HM5 B;  8RNT A;  2I9W A;  3SVA A;  3CCL 3;  2CFK A;  2O9U X;  3NX0 A;  1VQ7 3;  3CD6 3;  1FUS A;  1NO3 A;  4XBY A;  3BIR A;  1BSB A;  4LMI A;  3MKI A;  3WDG B;  3FH1 A;  1STF I;  3B4O A;  4K1V A;  3D9R A;  4R80 A;  1CEW I;  1N9J A;  2RCD A;  2LQV A;  3N9H A;  1CYU A;  2YFJ B;  1VQM 3;  2RFR A;  1DMQ A;  1W6C A;  1V58 A;  3PGB A;  4O3V A;  1IT8 A;  1EUI C;  2AAE A;  4O02 B;  1M1K 4;  2IYJ A;  2L1S A;  1SPU A;  3KZT A;  3CCM 3;  1FYS A;  6GSP A;  5KP1 A;  3ALA A;  1LRA A;  1LNI A;  3BND A;  3JUQ A;  2W03 A;  1X1X A;  4CDL A;  3PZW A;  1GOU A;  2P05 A;  2Z77 A;  3KSP A;  3WOF B;  3MG2 A;  1RLS A;  4O8S A;  4N6V 0;  2W9P A;  3NQY A;  4LEH A;  4STD A;  4GHO A;  3AMO A;  1UGI A;  1IT7 A;  3EX9 A;  3HZP A;  3D5G A;  3X41 A;  1UGH I;  2HMJ B;  3WOD G;  3AGO A;  3QK9 A;  3MHE A;  1QVG 2;  1UI7 A;  4XDW A;  3JVC A;  1ASK A;  1QAF A;  3OXA A;  1GMR A;  1N5P A;  5IG0 A;  3NM7 A;  3UL6 A;  2F98 A;  2PZV A;  1Q7H A;  3CMA 3;  4XM4 A;  2F5M A;  1HZ1 A;  3GRD A;  2BHM A;  1RGG A;  2KXG A;  3RGA A;  5CXO A;  3S5C A;  3BLZ A;  2WGO A;  1E3R A;  1BNI A;  1JN5 B;  3CCS 3;  1TJD A;  2XGL A;  3SX1 A;  1VQP 3;  3UNL A;  2Z6B A;  1DMN A;  3FSD A;  1JZO A;  3GWR A;  1IQX A;  1RGK A;  1KD1 4;  1W5Z A;  1I0V A;  1I2F A;  1YVS A;  2K54 A;  4KZ1 A;  1WMN A;  1K73 4;  2XRX B;  4R9L A;  4EW5 A;  1UUW B;  4MMZ B;  2QA4 3;  1KWI A;  1G0T A;  3BNE A;  3DZL A;  4HM6 B;  5IG4 A;  1PU4 A;  1VQ9 3;  1V74 A;  1Q81 4;  1C54 A;  2SBL A;  4BL2 A;  4BTY A;  1JB2 A;  3I55 3;  2BMO B;  1UW1 A;  5FGO A;  4R9K A;  4EC6 A;  1FZU A;  1ISK A;  3K5T A;  1R4Y A;  4RNZ A;  2UGI A;  4HAA A;  5CLK A;  5M1A A;  1D6U A;  1JBT A;  3N8B A;  1O7W B;  5IF6 A;  1S5A A;  3HIG A;  1NDO B;  3KE7 A;  1M1X B;  1ULJ B;  2XGN A;  2V1L A;  1Z1S A;  3LOY A;  5AII A;  4HM0 B;  2CC3 A;  2D1W A;  3DGL A;  1IVX A;  3EQQ B;  5AYR B;  1L5G B;  3CCV 3;  5CF2 A;  1A90 A;  2CK3 H;  1X1U A;  2O3O A;  5HOH A;  1FW7 A;  2CG0 A;  3CCE 3;  2CFW A;  5DRE A;  3BU4 A;  1K28 A;  1ULI B;  2XFS A;  9RNT A;  1BNG A;  1QAK A;  3ROB A;  1JBS A;  1JKG A;  1FGT A;  4N3V A;  1W00 A;  2RGQ A;  3Q90 A;  2SAR A;  3Q1C A;  2HMM B;  3VGN A;  1SIH A;  2ZA4 A;  1OGX A;  4RZM A;  3S28 A;  3G71 3;  1VQ8 3;  2QEX 3;  5ELU A;  2AAD A;  1B21 A;  4ILF A;  1PYL A;  3CXC 2;  1VQK 3;  1UUV B;  1JBR A;  3F40 A;  2W2C A;  2XFT A;  1WTH A;  2Z76 A;  5JBS A;  5GSP A;  4FMB A;  4CPK A;  5EQL A;  3O8Y A;  1BSD A;  1RGF A;  4Q53 A;  1CYV A;  3FCS B;  3MG1 A;  3AGN A;  4BTX A;  1FUW A;  5IG3 A;  1O7M B;  1RGE A;  2ML5 A;  3WOE B;  1RMS A;  3Q2P A;  3MG3 A;  2W56 B;  4HM1 B;  4QWT A;  5IEP A;  1BRG A;  3RGR A;  2KF3 A;  3S27 A;  1RN1 A;  1W2Z A;  2FNQ A;  4RNY A;  3STD A;  1OGZ A;  3EF8 A;  3LTB A;  3AHW A;  3V98 A;  7RNT A;  1ZS7 A;  1BNF A;  1W6G A;  3GSP A;  3NQZ A;  2M7O A;  1I2E A;  1A2V A;  3G16 A;  1MWT A;  2RSX A;  5JPU A;  1UCK A;  1MOL A;  3LML A;  2XR8 B;  1GD3 A;  4KVH A;  3X42 A;  4KFF A;  1GMQ A;  3IJE B;  1TRP A;  1RN4 A;  1HYF A;  2OQE C;  3KKG A;  4N6O B;  1BU4 A;  1BRI A;  3LT9 A;  3UB1 A;  4WP5 A;  1VQO 3;  1W01 A;  2E2T A;  1YVB I;  1Q40 B;  4LSO A;  3G8Z A;  1VZZ A;  1TTO A;  1O7H B;  1BNR A;  5AEU B;  2F86 B;  3PCS A;  2GXF A;  3OWY A;  4HOH A;  3UJM A;  1AY7 A;  4FMC A;  1LXE A;  1I8V A;  3KN4 A;  4CJN A;  3OW2 2;  3DM8 A;  3A76 A;  4WYK B;  3EB8 A;  5AIH A;  3FGY A;  1IK3 A;  3KSE D;  2Y73 A;  2IA7 A;  4OUQ A;  4DKI A;  3NV0 A;  2P0M A;  1JB4 A;  1UCJ A;  3CME 3;  1T5Y A;  1B27 A;  1QMA A;  3HOH A;  3CU3 A;  3T8U A;  2HML B;  7STD A;  5G1K A;  3F9S A;  3JUP A;  1YGW A;  4N6T A;  5BU4 A;  2CIU A;  1G02 A;  2ZHX B;  1BUQ A;  3SOY A;  2WOF A;  1OHS A;  2CFG A;  1MGR A;  4HM3 B;  3EN8 A;  4GB5 A;  1RGL A;  3FF0 A;  2KRT A;  1WNH A;  1NB5 I;  3LTC A;  1N9E A;  3FG3 A;  1AVK A;  2GBX B;  2GSP A;  4MMX B;  1DYU A;  3BNB A;  1M90 4;  1VQ6 3;  1OF5 B;  4CCV A;  2CWT A;  2IUK A;  5RNT A;  1IV9 A;  1IQ8 A;  4HVN A;  1DET A;  1A2K A;  1US1 A;  3JUN A;  3DH2 A;  5D81 A;  4MJD A;  2INX A;  2CFL A;  3JUO A;  3S67 A;  3MWZ A;  1O7N B;  4HM4 B;  5M18 A;  1X1Y A;  1TFO A;  1AR0 A;  1GY6 A;  3K63 A;  4L8O A;  3FZW A;  3SED A;  1YIJ 3;  3D79 A;  4HYZ A;  3WA2 X;  3ZG0 A;  2E2U A;  5I97 A;  1TUH A;  1Q82 4;  1ZGX A;  4LZI A;  3ZG5 A;  1JB5 A;  4R4K A;  1QJG A;  2F4Y A;  5D82 A;  1EEJ A;  3FLJ A;  4IT7 A;  2B24 B;  3A5E A;  1BSE A;  3EHC A;  1RDS A;  2XEP A;  1WMO A;  1BRJ A;  4RNT A;  4HKV B;  1VQ5 3;  3EC9 A;  1OCV A;  4HZ9 B;  3LYG A;  4H3U A;  1FGM A;  2WOH A;  3GAX A;  2PNC A;  1UCL A;  1LOV A;  1HKX A;  5BVB A;  1BUJ A;  2KF4 A;  1JN5 A;  2P38 A;  5LC7 A;  2Z7A A;  5KP4 A;  3E99 A;  5AIG A;  3G4S 3;  3OX9 A;  1GOV A;  3SXX A;  4HBR A;  4TX4 A;  2HOH A;  4MEI A;  2CX1 A;  3K7C A;  3CC4 3;  1Q9E A;  3FF2 A;  4N6N B;  2C4B A;  1MNL A;  1TIJ A;  2GBW B;  4I4K A;  2RBI A;  4IPB A;  3ECF A;  1U8C B;  5IER A;  1RN7 A;  1B2X A;  1N8Q A;  2OCT A;  3V92 A;  4H61 A;  1V57 A;  5BXQ A;  2CH9 A;  3F7S A;  2YX9 A;  4X2O A;  1OPY A;  1GOY A;  1EQK A;  4J8T A;  4ZM8 A;  3EN1 B;  3V99 A;  2HMN B;  1IVV A;  3D3L A;  2BT3 A;  2B1X B;  4I5Q A;  3FKA A;  3PXM A;  3T8N A;  1GSP A;  1IU7 A;  1GYB A;  5KP3 A;  3F14 A;  4GL6 A;  1IDP A;  3X3Z A;  3GZY B;  1X1W A;  2YFI B;  1J2B A;  1DMM A;  1BNS A;  1M9G A;  1I3F A;  1YJN 3;  3GZB A;  3NBJ A;  5AEW B;  3OWS A;  4HM7 B;  2MF7 A;  1G96 A;  5G2G A;  4K90 B;  4KT3 B;  2W9Q A;  4HM2 B;  4O2H A;  2KF6 A;  3B7C A;  2CHC A;  5EEO A;  1LNH A;  3TDG A;  3HX8 A;  3Q3F A;  4PEJ A;  2F56 A;  4MMY B;  4U13 A;  4AEQ A;  4LYL B;  4ORL A;  5CK6 A;  4XBX A;  1NWW A;  1UUG B;  2STD A;  1U5O A;  1BAN A;  1GMP A;  4HJL B;  4WWU C;  5LC6 A;  2Y74 A;  1SII A;  5EVH A;  1Q86 4;  3D4A A;  1B2U A;  3DGY A;  3EJV A;  4AKZ A;  1A2P A;  1I3I A;  3KII A;  1MWS A;  1LOX A;  3DGO A;  3HI7 A;  2IY2 A;  2K3D A;  3L0R A;  4JRF A;  2RNT A;  3DUK A;  1I70 A;  3JUM A;  4N6U A;  3GZR A;  5STD A;  1JZD A;  1W7C A;  4EV2 A;  1RNB A;  2OTJ 3;  1RGC A;  3RDE A;  3URP A;  3FG1 A;  3N54 B;  2BO9 B;  3K9M C;  3DGN A;  5AI1 A;  1VQQ A;  4BTW A;  2W56 A;  4LGQ A;  1O7G B;  1OUN A;  3IPT A;  5TGN A;  1NU3 A;  2P0X A;  1YGE A;  3IMA B;  4G1M B;  1VQL 3;  4K61 A;  1ZO2 A;  3F8H A;  1BIR A;  1FGR A;  1QVF 2;  4J9A A;  3LTD A;  3K0Z A;  1MWU A;  2GEX A;  1SAR A;  3DMC A;  1S72 3;  3VSY A;  3MPH A;  4NPB A;  1SJW A;  2D42 A;  1BGS A;  3EE1 A;  1YNV X;  1OAC A;  4OVM A;  3NXJ A;  3CPW 2;  1YJ9 3;  4XDV A;  4GSP A;  1DE3 A;  1R4C A;  1IYY A;  2A15 A;  1BAO A;  1Q42 A;  3KFQ C;  3EBY A;  3NBB A;  3U97 A;  3I56 3;  1YI2 3;  2ZL8 A;  1BRK A;  4FMD A;  1BNE A;  4N6M A;  3J7Y d;  3NV0 B;  2W6J H;  1PFP A;  1EA2 A;  1Q40 A;  3F8X A;  1D6Y A;  4EXR A;  1KSI A;  3CCU 3;  1OHP A;  2YFL B;  1JRQ A;  4HZB B;  2CFD A;  2UX0 A;  3NM2 A;  2MC8 A;  3BNC A;  7GSP A;  3AMO B;  3NBR A;  1AV4 A;  3I0Y A;  4X2H A;  4L7K A;  5D83 A;  1RHL A;  1W4N A;  1RKY A;  3BB9 A;  3CCR 3;  5HGR A;  4KFE A;  3B8L A;  1B2Z A;  3OV4 A;  1NJI 4;  4WYK A;  3DXO A;  1FA3 A;  1BRH A;  4WHA A;  5AIF A;  2XSH B;  3X40 A;  3EBT A;  2H0I A;  1TRQ A;  1N5H A;  3ZFZ A;  3WA3 A;  4FMA A;  3CC2 3;  2OOV A;  2LYX A;  1FGO A;  4JF8 A;  3PYJ A;  2IUJ A;  2H0G A;  1K9M 4;  1RTU A;  3PS8 A;  1RGA A;  5ELJ A;  3H3H A;  2C10 A;  1GY7 A;  2FGT A;  5IEN A;  1JNQ A;  3DY5 A;  4KFD A;  4EYC A;  1EG9 B;  1B2S A;  1RCL A;  2R4I A;  3NHX A;  4L8P A;  5IG5 A;  1LQG C;  4NRE A;  1ZX2 A;  2GEY A;  2GU3 A;  3HK4 A;  1BVI A;  5AYS C;  2Q07 A;  3LZA A;  1O7P B;  5M19 A;  5JPP A;  1TU5 A;  1T2I A;  1OF5 A;  3U1W A;  3S29 A;  2WO0 A;  3RNT A;  3B4P A;  1DVD A;  6STD A;  1NB3 I;  4FCJ A;  3LT8 A;  3T0U A;  3NUV A;  4BIR A;  1CQS A;  1BNJ A;  1QAL A;  3M8C A;  1KQS 2;  1OHO A;  2F99 A;  1STD A;  4WFO A;  4J5G A;  2XH9 A;  1D6Z A;  2OQE A;  1ROV A;  2W0Q A;  3WR2 A;  3LH4 A;  2W04 A;  1CH0 A;  1LVN A;  3D5I A;  3SOA A;  6RNT A;  1YIT 3;  1HU9 A;  1BSA A;  1FUT A;  1MGW A;  1GD4 A;  1A67 A;  1AVL A;  3ER7 A;  2GU1 A;  2KF5 A;  1LQM B;  4IIA A;  3UL5 A;  2KAA A;  3VF1 A;  3CNX A;  3OWU A;  1F8N A;  2FXT A;  4EV5 A;  4J5K A;  5IEO A;  1JJ2 2;  2CW9 A;  1RCK A;  1JV2 B;  1Y4K A;  1VQN 3;  4BL3 A;  4NHF A;  2E2V A;  2KCD A;  3CPO A;  4BU4 A;  1DVC A;  2QIY A;  5G1L A;  1W2B 2;  1C7H A;  1BRS A;  1JKG B;  2CWV A;  1SQW A;  1WMP A; 
#chains in the Genus database with same CATH homology
 1IV7 A;  5DRV A;  1K8A 4;  2WGQ A;  1E97 A;  3PCR A;  1YJW 3;  3HII A;  1W02 A;  2C11 A;  1VQ4 3;  3X3Y A;  2L4V A;  3FG4 A;  1TP6 A;  2BMQ B;  2CKF B;  2ZDJ A;  4AKY A;  8CHO A;  3DGM A;  4FCZ A;  2OWP A;  2JQ5 A;  2XF3 A;  4R1K A;  1YHQ 3;  3MYT A;  2K0M A;  2P09 A;  4K1U A;  1W6Y A;  3CCJ 3;  3WMD A;  2JDI H;  1WQL B;  2BMR B;  3QRD A;  4EBG A;  3H51 A;  1RJO A;  1FGQ A;  5FW5 A;  5A0O B;  4FCM A;  3F7X A;  1IVW A;  1RRL A;  2IMJ A;  3GZX B;  2OOV C;  1E3V A;  4OK0 A;  3SLU A;  1IVU A;  1UI8 A;  1N8R 4;  3G0K A;  2CG1 A;  1IQY A;  4XB5 A;  3LXU X;  1TFK A;  5CF1 A;  2CWU A;  1EKM A;  3LTA A;  5IW9 A;  2ML6 A;  3X3X A;  3CCQ 3;  3G6E 3;  4XBT A;  2OTL 3;  2XSO B;  3MSO A;  1OH0 A;  1GY5 A;  1KC8 4;  1ROA A;  3CNM A;  2HMK B;  4FR9 A;  1GS3 A;  1K41 A;  4RBN A;  4N6L A;  4HM8 B;  2BNG A;  1Q7Y 4;  3CC7 3;  2HMO B;  1RRH A;  2QGU A;  4HM5 B;  2I9W A;  3SVA A;  3CCL 3;  2CFK A;  2O9U X;  3NX0 A;  3CD6 3;  1NO3 A;  4XBY A;  4LMI A;  3MKI A;  3WDG B;  3FH1 A;  1STF I;  3B4O A;  4K1V A;  3D9R A;  4R80 A;  1CEW I;  1N9J A;  2RCD A;  2LQV A;  3N9H A;  1CYU A;  2YFJ B;  1VQM 3;  2RFR A;  1DMQ A;  1W6C A;  3PGB A;  4O3V A;  1IT8 A;  4O02 B;  1M1K 4;  1SPU A;  3KZT A;  3CCM 3;  5KP1 A;  3ALA A;  3BND A;  3JUQ A;  2W03 A;  4CDL A;  3PZW A;  2Z77 A;  2P05 A;  3KSP A;  3WOF B;  3MG2 A;  4STD A;  4O8S A;  4N6V 0;  2W9P A;  3NQY A;  4LEH A;  3AMO A;  1IT7 A;  3EX9 A;  3HZP A;  3X41 A;  2HMJ B;  3WOD G;  3QK9 A;  3MHE A;  1UI7 A;  4XDW A;  3JVC A;  1ASK A;  1QAF A;  3OXA A;  1N5P A;  5IG0 A;  3NM7 A;  3UL6 A;  2F98 A;  2PZV A;  3CMA 3;  4XM4 A;  3GRD A;  2BHM A;  2KXG A;  3RGA A;  5CXO A;  3S5C A;  3BLZ A;  2WGO A;  1E3R A;  1JN5 B;  3CCS 3;  3SX1 A;  2XGL A;  1VQP 3;  3UNL A;  2Z6B A;  1DMN A;  3FSD A;  3GWR A;  1IQX A;  1KD1 4;  1W5Z A;  2K54 A;  4KZ1 A;  1WMN A;  1K73 4;  2XRX B;  4R9L A;  1UUW B;  4MMZ B;  2QA4 3;  1KWI A;  3BNE A;  3DZL A;  4HM6 B;  5IG4 A;  1PU4 A;  1VQ9 3;  1V74 A;  1Q81 4;  2SBL A;  4BTY A;  1JB2 A;  3I55 3;  2BMO B;  1UW1 A;  5FGO A;  4R9K A;  4EC6 A;  1ISK A;  3K5T A;  4RNZ A;  5CLK A;  1D6U A;  3N8B A;  1O7W B;  5IF6 A;  1S5A A;  3HIG A;  1NDO B;  3KE7 A;  1M1X B;  1ULJ B;  2XGN A;  2V1L A;  1Z1S A;  3LOY A;  5AII A;  4HM0 B;  2CC3 A;  2D1W A;  3DGL A;  1IVX A;  3EQQ B;  5AYR B;  1L5G B;  3CCV 3;  5CF2 A;  1A90 A;  2CK3 H;  2O3O A;  2CG0 A;  3CCE 3;  2CFW A;  5DRE A;  1K28 A;  1ULI B;  2XFS A;  1QAK A;  3ROB A;  1JKG A;  1FGT A;  4N3V A;  1W00 A;  2RGQ A;  3Q90 A;  3Q1C A;  2HMM B;  3VGN A;  1SIH A;  3G71 3;  1OGX A;  4RZM A;  3S28 A;  1VQ8 3;  2QEX 3;  5ELU A;  1VQK 3;  3CXC 2;  1UUV B;  3F40 A;  2W2C A;  2XFT A;  1WTH A;  2Z76 A;  5JBS A;  4FMB A;  5EQL A;  3O8Y A;  4Q53 A;  1CYV A;  3FCS B;  3MG1 A;  1FUW A;  4BTX A;  5IG3 A;  1O7M B;  3WOE B;  2ML5 A;  3Q2P A;  3MG3 A;  2W56 B;  4HM1 B;  4QWT A;  5IEP A;  3RGR A;  3S27 A;  1W2Z A;  2FNQ A;  4RNY A;  3STD A;  1OGZ A;  3EF8 A;  3LTB A;  3V98 A;  1W6G A;  3NQZ A;  2M7O A;  1A2V A;  3G16 A;  2RSX A;  5JPU A;  1MOL A;  3LML A;  2XR8 B;  1GD3 A;  4KVH A;  3X42 A;  4KFF A;  3IJE B;  2OQE C;  3KKG A;  4N6O B;  3LT9 A;  3UB1 A;  4WP5 A;  1VQO 3;  1W01 A;  2E2T A;  1YVB I;  1Q40 B;  4LSO A;  3G8Z A;  1VZZ A;  1O7H B;  5AEU B;  2F86 B;  3PCS A;  2GXF A;  3OWY A;  3UJM A;  4FMC A;  1LXE A;  3KN4 A;  3OW2 2;  3DM8 A;  3A76 A;  4WYK B;  3EB8 A;  5AIH A;  3FGY A;  1IK3 A;  3KSE D;  2Y73 A;  2IA7 A;  4OUQ A;  3NV0 A;  2P0M A;  1JB4 A;  3CME 3;  1T5Y A;  1QMA A;  3CU3 A;  3T8U A;  2HML B;  7STD A;  3F9S A;  3JUP A;  4N6T A;  2CIU A;  1BUQ A;  3SOY A;  2WOF A;  1OHS A;  2CFG A;  4HM3 B;  3EN8 A;  4GB5 A;  3FF0 A;  1NB5 I;  2KRT A;  1WNH A;  3LTC A;  1N9E A;  3FG3 A;  1AVK A;  2GBX B;  4MMX B;  1DYU A;  3BNB A;  1M90 4;  1VQ6 3;  1OF5 B;  4CCV A;  2CWT A;  2IUK A;  1IV9 A;  1IQ8 A;  4HVN A;  1A2K A;  1US1 A;  3JUN A;  5D81 A;  4MJD A;  2INX A;  2CFL A;  3JUO A;  3S67 A;  3MWZ A;  1O7N B;  4HM4 B;  4L8O A;  1TFO A;  1AR0 A;  1GY6 A;  3K63 A;  3SED A;  3FZW A;  1YIJ 3;  4HYZ A;  3WA2 X;  2E2U A;  5I97 A;  1TUH A;  1Q82 4;  4LZI A;  1JB5 A;  4R4K A;  1QJG A;  5D82 A;  1QVG 2;  3FLJ A;  4IT7 A;  1VQ7 3;  2B24 B;  3EHC A;  2XEP A;  1WMO A;  4HKV B;  1VQ5 3;  3EC9 A;  1OCV A;  4HZ9 B;  3LYG A;  4H3U A;  1FGM A;  2WOH A;  3GAX A;  2PNC A;  1HKX A;  5BVB A;  1JN5 A;  2P38 A;  5LC7 A;  2Z7A A;  5KP4 A;  3E99 A;  5AIG A;  3G4S 3;  3OX9 A;  3SXX A;  4HBR A;  4TX4 A;  4MEI A;  3K7C A;  3CC4 3;  3FF2 A;  4N6N B;  1MNL A;  1TIJ A;  2GBW B;  4I4K A;  4IPB A;  3ECF A;  1U8C B;  5IER A;  1RN7 A;  1N8Q A;  2OCT A;  3V92 A;  4H61 A;  5BXQ A;  2CH9 A;  3F7S A;  2YX9 A;  4X2O A;  1OPY A;  1EQK A;  4J8T A;  4ZM8 A;  3EN1 B;  3V99 A;  2HMN B;  1IVV A;  3D3L A;  2BT3 A;  2B1X B;  3FKA A;  3PXM A;  3T8N A;  1IU7 A;  1GYB A;  5KP3 A;  3F14 A;  4GL6 A;  1IDP A;  3X3Z A;  3GZY B;  2YFI B;  1J2B A;  1DMM A;  1M9G A;  1YJN 3;  3GZB A;  3NBJ A;  5AEW B;  3OWS A;  4HM7 B;  2MF7 A;  1G96 A;  5G2G A;  4K90 B;  2W9Q A;  4HM2 B;  4O2H A;  3B7C A;  2CHC A;  5EEO A;  1LNH A;  3TDG A;  3HX8 A;  4PEJ A;  4AEQ A;  4MMY B;  4U13 A;  4ORL A;  5CK6 A;  4XBX A;  1NWW A;  2STD A;  1U5O A;  4HJL B;  4WWU C;  5LC6 A;  2Y74 A;  1SII A;  5EVH A;  3EJV A;  4AKZ A;  3KII A;  1LOX A;  3DGO A;  3HI7 A;  4JRF A;  3L0R A;  3DUK A;  3JUM A;  4N6U A;  3GZR A;  5STD A;  4EV2 A;  1W7C A;  2OTJ 3;  3RDE A;  3FG1 A;  3N54 B;  2BO9 B;  3K9M C;  3DGN A;  5AI1 A;  4BTW A;  2W56 A;  4LGQ A;  1O7G B;  1OUN A;  3IPT A;  5TGN A;  1NU3 A;  2P0X A;  1YGE A;  3IMA B;  4G1M B;  1VQL 3;  4K61 A;  1ZO2 A;  3F8H A;  1FGR A;  1QVF 2;  4J9A A;  3LTD A;  3K0Z A;  2GEX A;  3DMC A;  1S72 3;  3VSY A;  3MPH A;  1SJW A;  2D42 A;  3EE1 A;  1OAC A;  4OVM A;  3NXJ A;  3CPW 2;  1YJ9 3;  4XDV A;  1R4C A;  2A15 A;  3KFQ C;  1Q42 A;  3EBY A;  3NBB A;  3U97 A;  3I56 3;  1YI2 3;  2ZL8 A;  4FMD A;  4N6M A;  3J7Y d;  3NV0 B;  2W6J H;  1PFP A;  1EA2 A;  1Q40 A;  3F8X A;  1D6Y A;  4EXR A;  1KSI A;  3CCU 3;  1OHP A;  2YFL B;  1JRQ A;  4HZB B;  2CFD A;  2UX0 A;  3NM2 A;  2MC8 A;  3BNC A;  3AMO B;  3NBR A;  1AV4 A;  3I0Y A;  4X2H A;  4L7K A;  5D83 A;  1W4N A;  1RKY A;  3BB9 A;  3CCR 3;  5HGR A;  4KFE A;  3B8L A;  3OV4 A;  1NJI 4;  4WYK A;  3DXO A;  1FA3 A;  4WHA A;  5AIF A;  2XSH B;  3X40 A;  3EBT A;  1N5H A;  3WA3 A;  4FMA A;  3CC2 3;  2OOV A;  2LYX A;  1FGO A;  4JF8 A;  3PYJ A;  2IUJ A;  1K9M 4;  3PS8 A;  5IEN A;  5ELJ A;  3H3H A;  2C10 A;  1GY7 A;  2FGT A;  1JNQ A;  3DY5 A;  4KFD A;  4EYC A;  1EG9 B;  2R4I A;  3NHX A;  4L8P A;  5IG5 A;  4NRE A;  1ZX2 A;  2GEY A;  2GU3 A;  3HK4 A;  5AYS C;  2Q07 A;  3LZA A;  1O7P B;  5JPP A;  1TU5 A;  1OF5 A;  3U1W A;  3S29 A;  2WO0 A;  3B4P A;  1DVD A;  6STD A;  1NB3 I;  4FCJ A;  3LT8 A;  3T0U A;  3NUV A;  1CQS A;  1QAL A;  3M8C A;  1KQS 2;  1OHO A;  2F99 A;  1STD A;  4WFO A;  2XH9 A;  1D6Z A;  2OQE A;  1ROV A;  2W0Q A;  3LH4 A;  2W04 A;  1LVN A;  3SOA A;  1YIT 3;  1HU9 A;  1GD4 A;  1A67 A;  1AVL A;  3ER7 A;  2GU1 A;  4IIA A;  3UL5 A;  3VF1 A;  3CNX A;  3OWU A;  1F8N A;  2FXT A;  4EV5 A;  5IEO A;  1JJ2 2;  2CW9 A;  1JV2 B;  1Y4K A;  1VQN 3;  4NHF A;  2E2V A;  2KCD A;  3CPO A;  1W2B 2;  1DVC A;  2QIY A;  1Q86 4;  1C7H A;  1JKG B;  2CWV A;  1SQW A;  1WMP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...