1BSAA

Crystal structural analysis of mutations in the hydrophobic cores of barnase
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
107
structure length
107
Chain Sequence
INTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSVGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BARNASE
publication title Crystal structural analysis of mutations in the hydrophobic cores of barnase.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Endonuclease
total genus 33
structure length 107
sequence length 107
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 1993-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1bsaA00
3D4AA 1B2XA 2RNTA 1BSCA 1RDSA 2KF6A 4J5GA 6RNTA 1DE3A 1BU4A 2BU4A 1BRHA 1FYSA 1G02A 3D5IA 3Q3FA 4BU4A 1JBRA 1UCKA 1BNSA 4GSPA 1I8VA 1LRAA 1FUTA 1RCKA 2GSPA 2KF3A 1BSAA 1YVSA 3AGOA 6GSPA 1HZ1A 4BIRA 3RNTA 1BNGA 3AHWA 3D5GA 3WR2A 1HYFA 1B2UA 1B2MA 1YNVX 1B20A 1B2SA 1BGSA 1BSDA 1JBTA 1RGCA 2HOHA 1BSBA 1UCLA 1JBSA 1PYLA 1B2ZA 1RCLA 1RGLA 1LOVA 1RGHA 2C4BA 1BRJA 1I0VA 1UCJA 3SYUA 1UCIA 1I0XA 3WHOA 1RN4A 1LOWA 1SARA 1ZGXA 1RNTA 1BSEA 5BIRA 1BRKA 5GSPA 8RNTA 3URPA 1BAOA 2RBIA 1I2EA 1B27A 1GMQA 1R4YA 3AGNA 1YGWA 1AQZA 1CH0A 1RNBA 1GMPA 3AHSA 1FZUA 3BU4A 1TRQA 1I70A 2SARA 7GSPA 1RGFA 2KAAA 1RN1A 1RTUA 3DH2A 1BNJA 1GMRA 1FUSA 1RGGA 1TRPA 1X1UA 1I3IA 1B21A 1AY7A 1BIRA 1MGRA 1Q9EA 1RGAA 5BU4A 1LNIA 1PY3A 2AAEA 3A5EA 1IYYA 7RNTA 3BIRA 1RGKA 1BRNL 2F56A 2F5WA 2F5MA 2BIRA 1BRIA 1BRGA 2ZA4A 2AADA 1A2PA 1X1WA 2KF4A 4HAAA 2KF5A 9RNTA 1B3SA 1BNIA 1BVIA 1I2FA 3HOHA 1T2IA 1X1YA 1RHLA 5RNTA 1BNFA 1C54A 1BNRA 1BRSA 1BNEA 1GSPA 1I2GA 1RMSA 1I3FA 1GOYA 3DGYA 1X1XA 1BANA 1GOUA 3GSPA 1DETA 2F4YA 4J5KA 1TTOA 1MGWA 1RLSA 1GOVA 3KCHA 4GHOA 1BOXA 1LOYA 1BUJA 1FW7A 5HOHA 4RNTA 1T2HA 1RGEA 1RSNA 4HOHA
chains in the Genus database with same CATH superfamily
3D4AA 1EG9B 1K734 4J5GA 1RDSA 1JJ22 3PCSA 1VQL3 1BU4A 2BU4A 4BL2A 1FYSA 4HVNA 5EVHA 1KQS2 3FSDA 1GD4A 2CFKA 3V98A 4G1MB 3CC23 1FGQA 1NDOB 1ROAA 2OOVA 4K90B 2GSPA 3RGRA 1RCKA 1VQM3 1BSAA 2OTJ3 1A90A 4K1UA 1GYBA 1LQGC 1MWRA 1JZOA 2GBWB 3EE1A 2YFJB 3K63A 3FLJA 3K5TA 4FMBA 4HZ9B 1LXEA 2R4IA 2ZL8A 4KVHA 5M1AA 4K1VA 1YNVX 5IEPA 1JBTA 4WHAA 1S723 1WTHA 2HOHA 5LC7A 2QA43 1VQ43 1UCLA 3CMA3 2CFDA 2J8XB 3F8HA 4OVMA 1PYLA 2YFLB 2MC8A 3K9MC 1DYUA 1RCLA 4N3VA 1M904 3SEDA 2Z77A 3HZPA 3DGOA 2BT3A 1JN5B 1YVBI 1UCJA 3BLZA 4KFEA 1N8R4 2D42A 5A0OB 1DMMA 4GL6A 3ER7A 4MMXB 3WHOA 1LQMB 1KWIA 1ULIB 1STDA 5ELUA 4KZ1A 2I9WA 1K28A 4CPKA 3DUKA 1L5GB 3G0KA 4L8OA 3ZG0A 4BTXA 3N54B 1BRKA 5GSPA 5AYSC 1JKGB 2A15A 4XBXA 1K9M4 1HU9A 3URPA 2RBIA 3SOAA 3LTCA 5CF2A 1VQ93 2MF7A 1VQ63 1YGWA 1N5PA 4FMCA 3MG2A 3BNDA 3Q1CA 1TFOA 4LMIA 1I70A 1OUNA 2RCDA 1IQXA 5FGOA 1RN1A 3MG1A 1RTUA 1TIJA 4ZM8A 1PU4A 1YJN3 3EBTA 4EBGA 2FNQA 3D79A 4DKIA 4ILFA 5JBSA 1X1UA 4R1KA 1QJGA 1AY7A 1ISKA 3KE7A 4FMAA 3VF1A 1YI23 4HM6B 3K0ZA 2RFRA 4MEIA 7RNTA 1DVDA 1UGHI 4O8SA 5G1LA 3BIRA 3I563 2CFWA 3D3LA 2ML5A 2BIRA 2KRTA 2YFIB 2K54A 4HZBB 2XEPA 2AADA 1X1WA 1EUIC 4HBRA 3LXUX 2QIYA 1MWTA 3HIIA 1N9JA 1ZX2A 1E3VA 4LSOA 1NNVA 3V99A 4L7KA 4AKYA 4XBYA 1VQN3 1RHLA 4LGQA 2W9PA 5G2GA 3F7SA 5RNTA 1EQKA 1Q7Y4 3CCS3 2W2CA 1JB2A 2WOFA 4HM8B 1W2B2 1BNEA 3JUQA 1QVG2 4X2HA 2IYJA 1RRHA 1W01A 3HI7A 4PEJA 3AMOB 4EYCA 1UI8A 1G0TA 4BTYA 1DETA 3M8CA 2INXA 2F86B 4GHOA 1RKYA 3EHCA 2ZHXB 2UUGC 1N8QA 2BO9B 2KCDA 3L0RA 1LVNA 2B1XB 3CCL3 1T2HA 1NJI4 1VQ83 1EEJA 3S28A 4N6LA 1RSNA 3BNEA 2K3DA 2KF6A 6RNTA 1JRQA 2HMNB 1BRHA 2XF3A 1O7WB 2XGLA 2RSXA 3DXOA 1YIT3 1UCKA 1O7GB 4WYKB 3CCQ3 3EJVA 1UUGB 3NBJA 3CU3A 4GSPA 2BMOB 2W04A 1I8VA 3ZG5A 1C7HA 1NWWA 3FCSB 3GZYB 1MNLA 2KF3A 2P05A 2XSHB 1YVSA 3UB1A 2CWVA 5HGRA 1HZ1A 4BIRA 5CF1A 3RDEA 1JB5A 2W03A 3D5GA 1YIJ3 2WGOA 3NXJA 1NB3I 3FF0A 3TDGA 1B2SA 3U97A 3DZLA 1Q814 4RNYA 3DY5A 1M9GA 1MOLA 2OTL3 1TFKA 2HMMB 5STDA 2P09A 3FG4A 1RGHA 1DMQA 5CLKA 4I5QA 5JPPA 1WNHA 3UNLA 2GEXA 1I0VA 3LOYA 1D6UA 3SYUA 2HMOB 3OWUA 4BL3A 1UCIA 5IG4A 4BTWA 3F7XA 2D1WA 5D82A 1SARA 3PXMA 3OV4A 1V57A 1JB4A 3IMAB 5EEOA 3UJMA 1BSEA 3WOEB 3X3XA 1IQ8A 1PFPA 1TUHA 1CEWI 4HM2B 1G96A 3F40A 5CXOA 1Q40B 1SIIA 3KN4A 3JUPA 3LMLA 1GMQA 3X42A 1AR0A 3BNBA 1N5HA 1UDII 4OK0A 6STDA 1GY6A 1GMPA 2OCTA 3BU4A 4CDLA 3NUVA 4RZMA 4IIAA 1IV7A 3EN1B 2IMJA 2KAAA 4FMDA 5M19A 5D81A 2GEYA 1FUSA 2HMJB 2KXGA 1TP6A 1TRPA 3H3HA 3CC43 3S67A 1E3RA 1B21A 5IG0A 4R9LA 3SOYA 2CX0A 1Z1SA 2XFSA 1BIRA 4KT3B 3MG3A 1PY3A 3WODG 1IYYA 3F14A 3AMOA 1FGMA 1RGKA 2BMQB 2F5WA 3T8NA 1EKMA 1W6GA 2B24B 2C11A 2CW9A 1DMNA 4AEQA 3CCM3 1A2PA 1W02A 1W6YA 4HAAA 9RNTA 3N9HA 3CD63 3IPTA 1OPYA 3B8LA 2P0XA 5DRVA 1OH0A 5LC6A 3VGNA 1IV9A 2STDA 3WDGB 1KD14 3ALAA 3BNCA 1BVIA 1I2FA 3FG1A 3HOHA 3LYGA 1NB5I 2P0MA 3IJEB 4NHFA 1EA2A 1IVXA 2OWPA 4N6OB 3WMDA 1U5OA 1GY7A 1GY5A 1OF5B 1X1YA 4WYKA 1O7NB 3LTAA 1UUVB 2P38A 1BNFA 4TX4A 1YGEA 1TJDA 1BNRA 1W2ZA 1BRSA 3VSYA 3I553 2LQVA 3J7Yd 1IVWA 2WGQA 3PZWA 4O2HA 1W7CA 1Q42A 4J9AA 1GOUA 3G16A 3GSPA 4HKVB 8CHOA 3CCJ3 3UL6A 3DGLA 2F4YA 4Q53A 5BXQA 5IERA 4J5KA 5ELJA 2XH9A 1MGWA 1GOVA 1BOXA 4JF8A 4LZIA 2CKFB 2GXFA 2L1SA 1OHSA 3QRDA 4RNTA 3NM7A 5M18A 4HOHA 1VQQA 5KP1A 1ULJB 2XR8B 1B2XA 4RNZA 1BSCA 1DE3A 3CCR3 1FGOA 1SIHA 3UL5A 1A67A 1NU3A 3NM2A 1G02A 5AIHA 4BU4A 3HK4A 1CQSA 3I0YA 2CWTA 2W6JH 5AIFA 1F8NA 2JQ5A 2R41A 3WA2X 1LRAA 1FUTA 5IG5A 3GZRA 2M7OA 3AGOA 3B4OA 4RBNA 1W5ZA 4XB5A 5AYRB 6GSPA 1CYUA 2HMLB 1BNGA 2XFTA 3NBRA 1AVKA 4XDVA 2WOHA 3CCV3 3LT9A 3PGBA 4IT7A 1Q864 3WR2A 4LEHA 3FGYA 3X41A 3PYJA 2H0HA 1B2MA 3FG3A 1B20A 1BGSA 2IUKA 1BSDA 3CNXA 1RGCA 3E99A 1ZS7A 1BSBA 1STFI 3EB8A 2IUJA 1E97A 1UGIA 1OCVA 3MSOA 4HJLB 2Y73A 1B2ZA 1JBSA 1US1A 1NO3A 1Y4KA 1RGLA 2RGQA 4N6MA 1JN5A 1IQYA 2GU1A 3G8ZA 3EC9A 2C4BA 2CH9A 1BRJA 3MKIA 1KSIA 1I0XA 2CFLA 1RN4A 1O7MB 1LOWA 1T5YA 3OWSA 2BNGA 2CX1A 1FA3A 1ZGXA 2H0IA 1RNTA 2FGTA 3KFQC 5BIRA 4R9KA 1JKGA 1HKXA 1Q7HA 8RNTA 5AEUB 3KZTA 1I2EA 3B4PA 1W6CA 1B27A 1R4YA 1T3BA 3A76A 4O02B 4HM4B 3JVCA 1A2KA 5IF6A 1FZUA 3N8BA 1TU5A 2IA7A 3OWYA 2OQEC 1K8A4 3PCRA 2SARA 4X2OA 7GSPA 3ZFZA 1U8CB 2XGNA 4NPBA 1RGFA 2PNCA 3F8XA 1YJW3 1BNJA 1GMRA 3FH1A 1RGGA 2CHCA 2YX9A 4KFDA 4HM5B 3NQZA 2W56B 4MMYB 2OQEA 3WA3A 2ZDJA 1RGAA 5BU4A 3A5EA 2AAEA 3CPOA 4FCMA 1IDPA 2Y74A 1ROVA 2V1LA 2F5MA 3MYTA 3X40A 1BRGA 2ZA4A 1WMPA 1D6ZA 1BUQA 1W4NA 3FF2A 3OX9A 3OXAA 4FCZA 4LYLB 4STDA 2UGIA 3S29A 4L8PA 4N6UA 1RJOA 3EF8A 2BHMA 2CG1A 3RGAA 3K7CA 1T2IA 3SXXA 1VZZA 3Q90A 1FGRA 1WMNA 2K0MA 1W00A 5JPUA 2Z76A 1QAFA 2SBLA 3NQYA 2C10A 5I97A 3JUNA 3JUOA 2LYXA 4EXRA 3Q2PA 3QK9A 2H0GA 3B7CA 1I2GA 3KKGA 1I3FA 5IW9A 4WWUC 3U1WA 3DGYA 3CPW2 2W9QA 3JUMA 2JDIH 5AIGA 4WFOA 7STDA 4H3UA 2WO0A 2PZVA 1TTOA 1RLSA 1FW7A 1QMAA 1LOYA 1FUWA 4MJDA 4N6V0 2FXTA 3GZBA 3CME3 3LZAA 1K41A 1CYVA 3KSPA 1VQK3 1RGEA 3FKAA 5BVBA 5IG3A 3G4S3 1UW1A 2RNTA 3NBBA 3Q3FA 1M1XB 3D5IA 5FW5A 1JBRA 1SJWA 4EV2A 3LH4A 1YJ93 1BNSA 1JZDA 4NREA 2HMKB 1IU7A 3DMCA 4FR9A 2CK3H 3NV0B 1ASKA 4XDWA 3CCU3 3RNTA 3AHWA 3PS8A 3O8YA 4JRFA 3SLUA 2ML6A 1HYFA 1B2UA 4U13A 5IENA 1WQLB 5DREA 3D9RA 1IVUA 4I4KA 2Q07A 4MMZB 3SX1A 1QALA 3H51A 1UI7A 1Q824 1OGZA 1YHQ3 1D6YA 1JV2B 2BMRB 2CWUA 4OUQA 5G1KA 3X3ZA 1LOVA 2E2UA 1DVCA 2XSOB 3GZXB 3GAXA 4N6TA 5KP4A 2CC3A 2W56A 4IPBA 3NX0A 2O3OA 1VQ73 2QEX3 1KC84 3WOFB 2Z7AA 3HX8A 1LNHA 5CK6A 1IVVA 3LTDA 4O3VA 4CJNA 2IY2A 3F9SA 3MWZA 4K61A 5AI1A 1IK3A 4R80A 1A2VA 1Q40A 1GS3A 2UX0A 3MHEA 1WMOA 1BAOA 3G6E3 2OOVC 1V58A 3X3YA 3CXC2 1V74A 3HIGA 1AVLA 3AGNA 1AQZA 1AV4A 1CH0A 3FZWA 1RNBA 1VQ53 3AHSA 1MWSA 3STDA 4HM3B 1GD3A 1TRQA 1RRLA 3LTBA 2CFGA 5D83A 3T8UA 1IT8A 3DGMA 4H61A 3DH2A 3DGNA 3SVAA 4GB5A 3EQQB 3T0UA 2O9UX 2CIUA 1I3IA 4HM0B 2W0QA 1M1K4 3LT8A 2GBXB 1MGRA 1OHPA 1Q9EA 1LNIA 2L4VA 1UUWB 2E2VA 1O7PB 4J8TA 3EN8A 4EC6A 4KFFA 2F56A 1VQO3 1BRNL 4EW5A 1OACA 2F99A 1BRIA 4HM7B 4N6NB 1QAKA 3CC73 4XBTA 4AKZA 3GRDA 3EX9A 2KF4A 3GWRA 2KF5A 5EQLA 4FCJA 1FGTA 3CNMA 1B3SA 3S27A 1QVF2 1BNIA 3OW22 4QWTA 2Z6BA 5AIIA 4CCVA 4ORLA 3ROBA 3S5CA 4XM4A 2CG0A 1N9EA 1SQWA 1OF5A 2QGUA 5TGNA 4HM1B 5AEWB 3KSED 1SPUA 1LOXA 3EBYA 1VQP3 1C54A 1OHOA 3MPHA 1IT7A 2GU3A 3G713 3NV0A 1GSPA 1RMSA 3NHXA 4R4KA 1R4CA 1GOYA 1J2BA 1X1XA 1BANA 3BB9A 4WP5A 4EV5A 1O7HB 3KIIA 2F98A 1OGXA 2E2TA 1S5AA 1RN7A 3KCHA 3ECFA 3DM8A 1BUJA 5IEOA 5HOHA 4HYZA 3V92A 3CCE3 1MWUA 1JNQA 5KP3A 1ZO2A 2XRXB
chains in the Genus database with same CATH topology
3D4AA 1B2XA 2RNTA 1BSCA 1RDSA 2KF6A 4J5GA 6RNTA 1DE3A 1BU4A 2BU4A 1BRHA 1FYSA 1G02A 3D5IA 3Q3FA 4BU4A 1JBRA 1UCKA 1BNSA 4GSPA 1I8VA 1LRAA 1FUTA 1RCKA 2GSPA 2KF3A 1BSAA 1YVSA 3AGOA 6GSPA 1HZ1A 4BIRA 3RNTA 1BNGA 3AHWA 3D5GA 3WR2A 1HYFA 1B2UA 1B2MA 1YNVX 1B20A 1B2SA 1BGSA 1BSDA 1JBTA 1RGCA 2HOHA 1BSBA 1UCLA 1JBSA 1PYLA 1B2ZA 1RCLA 1RGLA 1LOVA 1RGHA 2C4BA 1BRJA 1I0VA 1UCJA 3SYUA 1UCIA 1I0XA 3WHOA 1RN4A 1LOWA 1SARA 1ZGXA 1RNTA 1BSEA 5BIRA 1BRKA 5GSPA 8RNTA 3URPA 1BAOA 2RBIA 1I2EA 1B27A 1GMQA 1R4YA 3AGNA 1YGWA 1AQZA 1CH0A 1RNBA 1GMPA 3AHSA 1FZUA 3BU4A 1TRQA 1I70A 2SARA 7GSPA 1RGFA 2KAAA 1RN1A 1RTUA 3DH2A 1BNJA 1GMRA 1FUSA 1RGGA 1TRPA 1X1UA 1I3IA 1B21A 1AY7A 1BIRA 1MGRA 1Q9EA 1RGAA 5BU4A 1LNIA 1PY3A 2AAEA 3A5EA 1IYYA 7RNTA 3BIRA 1RGKA 1BRNL 2F56A 2F5WA 2F5MA 2BIRA 1BRIA 1BRGA 2ZA4A 2AADA 1A2PA 1X1WA 2KF4A 4HAAA 2KF5A 9RNTA 1B3SA 1BNIA 1BVIA 1I2FA 3HOHA 1T2IA 1X1YA 1RHLA 5RNTA 1BNFA 1C54A 1BNRA 1BRSA 1BNEA 1GSPA 1I2GA 1RMSA 1I3FA 1GOYA 3DGYA 1X1XA 1BANA 1GOUA 3GSPA 1DETA 2F4YA 4J5KA 1TTOA 1MGWA 1RLSA 1GOVA 3KCHA 4GHOA 1BOXA 1LOYA 1BUJA 1FW7A 5HOHA 4RNTA 1T2HA 1RGEA 1RSNA 4HOHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D4A A;  1B2X A;  2RNT A;  1BSC A;  1RDS A;  2KF6 A;  4J5G A;  6RNT A;  1DE3 A;  1BU4 A;  2BU4 A;  1BRH A;  1FYS A;  1G02 A;  3D5I A;  3Q3F A;  4BU4 A;  1JBR A;  1UCK A;  1BNS A;  4GSP A;  1I8V A;  1LRA A;  1FUT A;  1RCK A;  2GSP A;  2KF3 A;  1BSA A;  1YVS A;  3AGO A;  6GSP A;  1HZ1 A;  4BIR A;  3RNT A;  1BNG A;  3AHW A;  3D5G A;  3WR2 A;  1HYF A;  1B2U A;  1B2M A;  1YNV X;  1B20 A;  1B2S A;  1BGS A;  1BSD A;  1JBT A;  1RGC A;  2HOH A;  1BSB A;  1UCL A;  1JBS A;  1PYL A;  1B2Z A;  1RCL A;  1RGL A;  1LOV A;  1RGH A;  2C4B A;  1BRJ A;  1I0V A;  1UCJ A;  3SYU A;  1UCI A;  1I0X A;  3WHO A;  1RN4 A;  1LOW A;  1SAR A;  1ZGX A;  1RNT A;  1BSE A;  5BIR A;  1BRK A;  5GSP A;  8RNT A;  3URP A;  1BAO A;  2RBI A;  1I2E A;  1B27 A;  1GMQ A;  1R4Y A;  3AGN A;  1YGW A;  1AQZ A;  1CH0 A;  1RNB A;  1GMP A;  3AHS A;  1FZU A;  3BU4 A;  1TRQ A;  1I70 A;  2SAR A;  7GSP A;  1RGF A;  2KAA A;  1RN1 A;  1RTU A;  3DH2 A;  1BNJ A;  1GMR A;  1FUS A;  1RGG A;  1TRP A;  1X1U A;  1I3I A;  1B21 A;  1AY7 A;  1BIR A;  1MGR A;  1Q9E A;  1RGA A;  5BU4 A;  1LNI A;  1PY3 A;  2AAE A;  3A5E A;  1IYY A;  7RNT A;  3BIR A;  1RGK A;  1BRN L;  2F56 A;  2F5W A;  2F5M A;  2BIR A;  1BRI A;  1BRG A;  2ZA4 A;  2AAD A;  1A2P A;  1X1W A;  2KF4 A;  4HAA A;  2KF5 A;  9RNT A;  1B3S A;  1BNI A;  1BVI A;  1I2F A;  3HOH A;  1T2I A;  1X1Y A;  1RHL A;  5RNT A;  1BNF A;  1C54 A;  1BNR A;  1BRS A;  1BNE A;  1GSP A;  1I2G A;  1RMS A;  1I3F A;  1GOY A;  3DGY A;  1X1X A;  1BAN A;  1GOU A;  3GSP A;  1DET A;  2F4Y A;  4J5K A;  1TTO A;  1MGW A;  1RLS A;  1GOV A;  3KCH A;  4GHO A;  1BOX A;  1LOY A;  1BUJ A;  1FW7 A;  5HOH A;  4RNT A;  1T2H A;  1RGE A;  1RSN A;  4HOH A; 
#chains in the Genus database with same CATH topology
 3D4A A;  1EG9 B;  1K73 4;  4J5G A;  1RDS A;  1JJ2 2;  3PCS A;  1VQL 3;  1BU4 A;  2BU4 A;  4BL2 A;  1FYS A;  4HVN A;  5EVH A;  1KQS 2;  3FSD A;  1GD4 A;  2CFK A;  3V98 A;  4G1M B;  3CC2 3;  1FGQ A;  1NDO B;  1ROA A;  2OOV A;  4K90 B;  2GSP A;  3RGR A;  1RCK A;  1VQM 3;  1BSA A;  2OTJ 3;  1A90 A;  4K1U A;  1GYB A;  1LQG C;  1MWR A;  1JZO A;  2GBW B;  3EE1 A;  2YFJ B;  3K63 A;  3FLJ A;  3K5T A;  4FMB A;  4HZ9 B;  1LXE A;  2R4I A;  2ZL8 A;  4KVH A;  5M1A A;  4K1V A;  1YNV X;  5IEP A;  1JBT A;  4WHA A;  1S72 3;  1WTH A;  2HOH A;  5LC7 A;  2QA4 3;  1VQ4 3;  1UCL A;  3CMA 3;  2CFD A;  2J8X B;  3F8H A;  4OVM A;  1PYL A;  2YFL B;  2MC8 A;  3K9M C;  1DYU A;  1RCL A;  4N3V A;  1M90 4;  3SED A;  2Z77 A;  3HZP A;  3DGO A;  2BT3 A;  1JN5 B;  1YVB I;  1UCJ A;  3BLZ A;  4KFE A;  1N8R 4;  2D42 A;  5A0O B;  1DMM A;  4GL6 A;  3ER7 A;  4MMX B;  3WHO A;  1LQM B;  1KWI A;  1ULI B;  1STD A;  5ELU A;  4KZ1 A;  2I9W A;  1K28 A;  4CPK A;  3DUK A;  1L5G B;  3G0K A;  4L8O A;  3ZG0 A;  4BTX A;  3N54 B;  1BRK A;  5GSP A;  5AYS C;  1JKG B;  2A15 A;  4XBX A;  1K9M 4;  1HU9 A;  3URP A;  2RBI A;  3SOA A;  3LTC A;  5CF2 A;  1VQ9 3;  2MF7 A;  1VQ6 3;  1YGW A;  1N5P A;  4FMC A;  3MG2 A;  3BND A;  3Q1C A;  1TFO A;  4LMI A;  1I70 A;  1OUN A;  2RCD A;  1IQX A;  5FGO A;  1RN1 A;  3MG1 A;  1RTU A;  1TIJ A;  4ZM8 A;  1PU4 A;  1YJN 3;  3EBT A;  4EBG A;  2FNQ A;  3D79 A;  4DKI A;  4ILF A;  5JBS A;  1X1U A;  4R1K A;  1QJG A;  1AY7 A;  1ISK A;  3KE7 A;  4FMA A;  3VF1 A;  1YI2 3;  4HM6 B;  3K0Z A;  2RFR A;  4MEI A;  7RNT A;  1DVD A;  1UGH I;  4O8S A;  5G1L A;  3BIR A;  3I56 3;  2CFW A;  3D3L A;  2ML5 A;  2BIR A;  2KRT A;  2YFI B;  2K54 A;  4HZB B;  2XEP A;  2AAD A;  1X1W A;  1EUI C;  4HBR A;  3LXU X;  2QIY A;  1MWT A;  3HII A;  1N9J A;  1ZX2 A;  1E3V A;  4LSO A;  1NNV A;  3V99 A;  4L7K A;  4AKY A;  4XBY A;  1VQN 3;  1RHL A;  4LGQ A;  2W9P A;  5G2G A;  3F7S A;  5RNT A;  1EQK A;  1Q7Y 4;  3CCS 3;  2W2C A;  1JB2 A;  2WOF A;  4HM8 B;  1W2B 2;  1BNE A;  3JUQ A;  1QVG 2;  4X2H A;  2IYJ A;  1RRH A;  1W01 A;  3HI7 A;  4PEJ A;  3AMO B;  4EYC A;  1UI8 A;  1G0T A;  4BTY A;  1DET A;  3M8C A;  2INX A;  2F86 B;  4GHO A;  1RKY A;  3EHC A;  2ZHX B;  2UUG C;  1N8Q A;  2BO9 B;  2KCD A;  3L0R A;  1LVN A;  2B1X B;  3CCL 3;  1T2H A;  1NJI 4;  1VQ8 3;  1EEJ A;  3S28 A;  4N6L A;  1RSN A;  3BNE A;  2K3D A;  2KF6 A;  6RNT A;  1JRQ A;  2HMN B;  1BRH A;  2XF3 A;  1O7W B;  2XGL A;  2RSX A;  3DXO A;  1YIT 3;  1UCK A;  1O7G B;  4WYK B;  3CCQ 3;  3EJV A;  1UUG B;  3NBJ A;  3CU3 A;  4GSP A;  2BMO B;  2W04 A;  1I8V A;  3ZG5 A;  1C7H A;  1NWW A;  3FCS B;  3GZY B;  1MNL A;  2KF3 A;  2P05 A;  2XSH B;  1YVS A;  3UB1 A;  2CWV A;  5HGR A;  1HZ1 A;  4BIR A;  5CF1 A;  3RDE A;  1JB5 A;  2W03 A;  3D5G A;  1YIJ 3;  2WGO A;  3NXJ A;  1NB3 I;  3FF0 A;  3TDG A;  1B2S A;  3U97 A;  3DZL A;  1Q81 4;  4RNY A;  3DY5 A;  1M9G A;  1MOL A;  2OTL 3;  1TFK A;  2HMM B;  5STD A;  2P09 A;  3FG4 A;  1RGH A;  1DMQ A;  5CLK A;  4I5Q A;  5JPP A;  1WNH A;  3UNL A;  2GEX A;  1I0V A;  3LOY A;  1D6U A;  3SYU A;  2HMO B;  3OWU A;  4BL3 A;  1UCI A;  5IG4 A;  4BTW A;  3F7X A;  2D1W A;  5D82 A;  1SAR A;  3PXM A;  3OV4 A;  1V57 A;  1JB4 A;  3IMA B;  5EEO A;  3UJM A;  1BSE A;  3WOE B;  3X3X A;  1IQ8 A;  1PFP A;  1TUH A;  1CEW I;  4HM2 B;  1G96 A;  3F40 A;  5CXO A;  1Q40 B;  1SII A;  3KN4 A;  3JUP A;  3LML A;  1GMQ A;  3X42 A;  1AR0 A;  3BNB A;  1N5H A;  1UDI I;  4OK0 A;  6STD A;  1GY6 A;  1GMP A;  2OCT A;  3BU4 A;  4CDL A;  3NUV A;  4RZM A;  4IIA A;  1IV7 A;  3EN1 B;  2IMJ A;  2KAA A;  4FMD A;  5M19 A;  5D81 A;  2GEY A;  1FUS A;  2HMJ B;  2KXG A;  1TP6 A;  1TRP A;  3H3H A;  3CC4 3;  3S67 A;  1E3R A;  1B21 A;  5IG0 A;  4R9L A;  3SOY A;  2CX0 A;  1Z1S A;  2XFS A;  1BIR A;  4KT3 B;  3MG3 A;  1PY3 A;  3WOD G;  1IYY A;  3F14 A;  3AMO A;  1FGM A;  1RGK A;  2BMQ B;  2F5W A;  3T8N A;  1EKM A;  1W6G A;  2B24 B;  2C11 A;  2CW9 A;  1DMN A;  4AEQ A;  3CCM 3;  1A2P A;  1W02 A;  1W6Y A;  4HAA A;  9RNT A;  3N9H A;  3CD6 3;  3IPT A;  1OPY A;  3B8L A;  2P0X A;  5DRV A;  1OH0 A;  5LC6 A;  3VGN A;  1IV9 A;  2STD A;  3WDG B;  1KD1 4;  3ALA A;  3BNC A;  1BVI A;  1I2F A;  3FG1 A;  3HOH A;  3LYG A;  1NB5 I;  2P0M A;  3IJE B;  4NHF A;  1EA2 A;  1IVX A;  2OWP A;  4N6O B;  3WMD A;  1U5O A;  1GY7 A;  1GY5 A;  1OF5 B;  1X1Y A;  4WYK A;  1O7N B;  3LTA A;  1UUV B;  2P38 A;  1BNF A;  4TX4 A;  1YGE A;  1TJD A;  1BNR A;  1W2Z A;  1BRS A;  3VSY A;  3I55 3;  2LQV A;  3J7Y d;  1IVW A;  2WGQ A;  3PZW A;  4O2H A;  1W7C A;  1Q42 A;  4J9A A;  1GOU A;  3G16 A;  3GSP A;  4HKV B;  8CHO A;  3CCJ 3;  3UL6 A;  3DGL A;  2F4Y A;  4Q53 A;  5BXQ A;  5IER A;  4J5K A;  5ELJ A;  2XH9 A;  1MGW A;  1GOV A;  1BOX A;  4JF8 A;  4LZI A;  2CKF B;  2GXF A;  2L1S A;  1OHS A;  3QRD A;  4RNT A;  3NM7 A;  5M18 A;  4HOH A;  1VQQ A;  5KP1 A;  1ULJ B;  2XR8 B;  1B2X A;  4RNZ A;  1BSC A;  1DE3 A;  3CCR 3;  1FGO A;  1SIH A;  3UL5 A;  1A67 A;  1NU3 A;  3NM2 A;  1G02 A;  5AIH A;  4BU4 A;  3HK4 A;  1CQS A;  3I0Y A;  2CWT A;  2W6J H;  5AIF A;  1F8N A;  2JQ5 A;  2R41 A;  3WA2 X;  1LRA A;  1FUT A;  5IG5 A;  3GZR A;  2M7O A;  3AGO A;  3B4O A;  4RBN A;  1W5Z A;  4XB5 A;  5AYR B;  6GSP A;  1CYU A;  2HML B;  1BNG A;  2XFT A;  3NBR A;  1AVK A;  4XDV A;  2WOH A;  3CCV 3;  3LT9 A;  3PGB A;  4IT7 A;  1Q86 4;  3WR2 A;  4LEH A;  3FGY A;  3X41 A;  3PYJ A;  2H0H A;  1B2M A;  3FG3 A;  1B20 A;  1BGS A;  2IUK A;  1BSD A;  3CNX A;  1RGC A;  3E99 A;  1ZS7 A;  1BSB A;  1STF I;  3EB8 A;  2IUJ A;  1E97 A;  1UGI A;  1OCV A;  3MSO A;  4HJL B;  2Y73 A;  1B2Z A;  1JBS A;  1US1 A;  1NO3 A;  1Y4K A;  1RGL A;  2RGQ A;  4N6M A;  1JN5 A;  1IQY A;  2GU1 A;  3G8Z A;  3EC9 A;  2C4B A;  2CH9 A;  1BRJ A;  3MKI A;  1KSI A;  1I0X A;  2CFL A;  1RN4 A;  1O7M B;  1LOW A;  1T5Y A;  3OWS A;  2BNG A;  2CX1 A;  1FA3 A;  1ZGX A;  2H0I A;  1RNT A;  2FGT A;  3KFQ C;  5BIR A;  4R9K A;  1JKG A;  1HKX A;  1Q7H A;  8RNT A;  5AEU B;  3KZT A;  1I2E A;  3B4P A;  1W6C A;  1B27 A;  1R4Y A;  1T3B A;  3A76 A;  4O02 B;  4HM4 B;  3JVC A;  1A2K A;  5IF6 A;  1FZU A;  3N8B A;  1TU5 A;  2IA7 A;  3OWY A;  2OQE C;  1K8A 4;  3PCR A;  2SAR A;  4X2O A;  7GSP A;  3ZFZ A;  1U8C B;  2XGN A;  4NPB A;  1RGF A;  2PNC A;  3F8X A;  1YJW 3;  1BNJ A;  1GMR A;  3FH1 A;  1RGG A;  2CHC A;  2YX9 A;  4KFD A;  4HM5 B;  3NQZ A;  2W56 B;  4MMY B;  2OQE A;  3WA3 A;  2ZDJ A;  1RGA A;  5BU4 A;  3A5E A;  2AAE A;  3CPO A;  4FCM A;  1IDP A;  2Y74 A;  1ROV A;  2V1L A;  2F5M A;  3MYT A;  3X40 A;  1BRG A;  2ZA4 A;  1WMP A;  1D6Z A;  1BUQ A;  1W4N A;  3FF2 A;  3OX9 A;  3OXA A;  4FCZ A;  4LYL B;  4STD A;  2UGI A;  3S29 A;  4L8P A;  4N6U A;  1RJO A;  3EF8 A;  2BHM A;  2CG1 A;  3RGA A;  3K7C A;  1T2I A;  3SXX A;  1VZZ A;  3Q90 A;  1FGR A;  1WMN A;  2K0M A;  1W00 A;  5JPU A;  2Z76 A;  1QAF A;  2SBL A;  3NQY A;  2C10 A;  5I97 A;  3JUN A;  3JUO A;  2LYX A;  4EXR A;  3Q2P A;  3QK9 A;  2H0G A;  3B7C A;  1I2G A;  3KKG A;  1I3F A;  5IW9 A;  4WWU C;  3U1W A;  3DGY A;  3CPW 2;  2W9Q A;  3JUM A;  2JDI H;  5AIG A;  4WFO A;  7STD A;  4H3U A;  2WO0 A;  2PZV A;  1TTO A;  1RLS A;  1FW7 A;  1QMA A;  1LOY A;  1FUW A;  4MJD A;  4N6V 0;  2FXT A;  3GZB A;  3CME 3;  3LZA A;  1K41 A;  1CYV A;  3KSP A;  1VQK 3;  1RGE A;  3FKA A;  5BVB A;  5IG3 A;  3G4S 3;  1UW1 A;  2RNT A;  3NBB A;  3Q3F A;  1M1X B;  3D5I A;  5FW5 A;  1JBR A;  1SJW A;  4EV2 A;  3LH4 A;  1YJ9 3;  1BNS A;  1JZD A;  4NRE A;  2HMK B;  1IU7 A;  3DMC A;  4FR9 A;  2CK3 H;  3NV0 B;  1ASK A;  4XDW A;  3CCU 3;  3RNT A;  3AHW A;  3PS8 A;  3O8Y A;  4JRF A;  3SLU A;  2ML6 A;  1HYF A;  1B2U A;  4U13 A;  5IEN A;  1WQL B;  5DRE A;  3D9R A;  1IVU A;  4I4K A;  2Q07 A;  4MMZ B;  3SX1 A;  1QAL A;  3H51 A;  1UI7 A;  1Q82 4;  1OGZ A;  1YHQ 3;  1D6Y A;  1JV2 B;  2BMR B;  2CWU A;  4OUQ A;  5G1K A;  3X3Z A;  1LOV A;  2E2U A;  1DVC A;  2XSO B;  3GZX B;  3GAX A;  4N6T A;  5KP4 A;  2CC3 A;  2W56 A;  4IPB A;  3NX0 A;  2O3O A;  1VQ7 3;  2QEX 3;  1KC8 4;  3WOF B;  2Z7A A;  3HX8 A;  1LNH A;  5CK6 A;  1IVV A;  3LTD A;  4O3V A;  4CJN A;  2IY2 A;  3F9S A;  3MWZ A;  4K61 A;  5AI1 A;  1IK3 A;  4R80 A;  1A2V A;  1Q40 A;  1GS3 A;  2UX0 A;  3MHE A;  1WMO A;  1BAO A;  3G6E 3;  2OOV C;  1V58 A;  3X3Y A;  3CXC 2;  1V74 A;  3HIG A;  1AVL A;  3AGN A;  1AQZ A;  1AV4 A;  1CH0 A;  3FZW A;  1RNB A;  1VQ5 3;  3AHS A;  1MWS A;  3STD A;  4HM3 B;  1GD3 A;  1TRQ A;  1RRL A;  3LTB A;  2CFG A;  5D83 A;  3T8U A;  1IT8 A;  3DGM A;  4H61 A;  3DH2 A;  3DGN A;  3SVA A;  4GB5 A;  3EQQ B;  3T0U A;  2O9U X;  2CIU A;  1I3I A;  4HM0 B;  2W0Q A;  1M1K 4;  3LT8 A;  2GBX B;  1MGR A;  1OHP A;  1Q9E A;  1LNI A;  2L4V A;  1UUW B;  2E2V A;  1O7P B;  4J8T A;  3EN8 A;  4EC6 A;  4KFF A;  2F56 A;  1VQO 3;  1BRN L;  4EW5 A;  1OAC A;  2F99 A;  1BRI A;  4HM7 B;  4N6N B;  1QAK A;  3CC7 3;  4XBT A;  4AKZ A;  3GRD A;  3EX9 A;  2KF4 A;  3GWR A;  2KF5 A;  5EQL A;  4FCJ A;  1FGT A;  3CNM A;  1B3S A;  3S27 A;  1QVF 2;  1BNI A;  3OW2 2;  4QWT A;  2Z6B A;  5AII A;  4CCV A;  4ORL A;  3ROB A;  3S5C A;  4XM4 A;  2CG0 A;  1N9E A;  1SQW A;  1OF5 A;  2QGU A;  5TGN A;  4HM1 B;  5AEW B;  3KSE D;  1SPU A;  1LOX A;  3EBY A;  1VQP 3;  1C54 A;  1OHO A;  3MPH A;  1IT7 A;  2GU3 A;  3G71 3;  3NV0 A;  1GSP A;  1RMS A;  3NHX A;  4R4K A;  1R4C A;  1GOY A;  1J2B A;  1X1X A;  1BAN A;  3BB9 A;  4WP5 A;  4EV5 A;  1O7H B;  3KII A;  2F98 A;  1OGX A;  2E2T A;  1S5A A;  1RN7 A;  3KCH A;  3ECF A;  3DM8 A;  1BUJ A;  5IEO A;  5HOH A;  4HYZ A;  3V92 A;  3CCE 3;  1MWU A;  1JNQ A;  5KP3 A;  1ZO2 A;  2XRX B; 
#chains in the Genus database with same CATH homology
 3D4A A;  1B2X A;  2RNT A;  1BSC A;  1RDS A;  2KF6 A;  4J5G A;  6RNT A;  1DE3 A;  1BU4 A;  2BU4 A;  1BRH A;  1FYS A;  1G02 A;  3D5I A;  3Q3F A;  4BU4 A;  1JBR A;  1UCK A;  1BNS A;  4GSP A;  1I8V A;  1LRA A;  1FUT A;  1RCK A;  2GSP A;  2KF3 A;  1BSA A;  1YVS A;  3AGO A;  6GSP A;  1HZ1 A;  4BIR A;  3RNT A;  1BNG A;  3AHW A;  3D5G A;  3WR2 A;  1HYF A;  1B2U A;  1B2M A;  1YNV X;  1B20 A;  1B2S A;  1BGS A;  1BSD A;  1JBT A;  1RGC A;  2HOH A;  1BSB A;  1UCL A;  1JBS A;  1PYL A;  1B2Z A;  1RCL A;  1RGL A;  1LOV A;  1RGH A;  2C4B A;  1BRJ A;  1I0V A;  1UCJ A;  3SYU A;  1UCI A;  1I0X A;  3WHO A;  1RN4 A;  1LOW A;  1SAR A;  1ZGX A;  1RNT A;  1BSE A;  5BIR A;  1BRK A;  5GSP A;  8RNT A;  3URP A;  1BAO A;  2RBI A;  1I2E A;  1B27 A;  1GMQ A;  1R4Y A;  3AGN A;  1YGW A;  1AQZ A;  1CH0 A;  1RNB A;  1GMP A;  3AHS A;  1FZU A;  3BU4 A;  1TRQ A;  1I70 A;  2SAR A;  7GSP A;  1RGF A;  2KAA A;  1RN1 A;  1RTU A;  3DH2 A;  1BNJ A;  1GMR A;  1FUS A;  1RGG A;  1TRP A;  1X1U A;  1I3I A;  1B21 A;  1AY7 A;  1BIR A;  1MGR A;  1Q9E A;  1RGA A;  5BU4 A;  1LNI A;  1PY3 A;  2AAE A;  3A5E A;  1IYY A;  7RNT A;  3BIR A;  1RGK A;  1BRN L;  2F56 A;  2F5W A;  2F5M A;  2BIR A;  1BRI A;  1BRG A;  2ZA4 A;  2AAD A;  1A2P A;  1X1W A;  2KF4 A;  4HAA A;  2KF5 A;  9RNT A;  1B3S A;  1BNI A;  1BVI A;  1I2F A;  3HOH A;  1T2I A;  1X1Y A;  1RHL A;  5RNT A;  1BNF A;  1C54 A;  1BNR A;  1BRS A;  1BNE A;  1GSP A;  1I2G A;  1RMS A;  1I3F A;  1GOY A;  3DGY A;  1X1X A;  1BAN A;  1GOU A;  3GSP A;  1DET A;  2F4Y A;  4J5K A;  1TTO A;  1MGW A;  1RLS A;  1GOV A;  3KCH A;  4GHO A;  1BOX A;  1LOY A;  1BUJ A;  1FW7 A;  5HOH A;  4RNT A;  1T2H A;  1RGE A;  1RSN A;  4HOH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...