1BSAA

Crystal structural analysis of mutations in the hydrophobic cores of barnase
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
107
structure length
107
Chain Sequence
INTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSVGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endonuclease
molecule keywords BARNASE
publication title Crystal structural analysis of mutations in the hydrophobic cores of barnase.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
total genus 33
structure length 107
sequence length 107
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 1993-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1bsaA00
3DGYA 1I0XA 2F4YA 1BNGA 3AHWA 3AGNA 1RCLA 1RCKA 1I2GA 1BAOA 1B2ZA 1ZGXA 2KF5A 1CH0A 2RNTA 1YVSA 3AHSA 3KCHA 1BSCA 1BRSA 6RNTA 1BNIA 3Q3FA 1B21A 1RLSA 2C4BA 1YGWA 3WR2A 1BNJA 1JBSA 1RMSA 1MGWA 7RNTA 1RGHA 1SARA 1RGKA 2AAEA 1I3FA 1YNVX 6GSPA 5GSPA 1X1UA 1X1WA 1RGLA 1HYFA 3RNTA 1UCLA 4BU4A 2F5WA 1MGRA 1UCJA 1BRJA 1JBRA 1GSPA 1R4YA 1I70A 1X1XA 1DE3A 1BUJA 1T2IA 1B2XA 1TRPA 2HOHA 1B2SA 2KAAA 3AGOA 3SYUA 1LOVA 1C54A 1BGSA 1T2HA 1RN4A 1BOXA 1I8VA 3HOHA 1RGEA 1BSEA 1RGGA 4RNTA 1BSAA 1G02A 2F5MA 3BU4A 1B2UA 1BU4A 1B27A 1BANA 4HAAA 1RSNA 1I2FA 1BNSA 3URPA 1BSBA 1RNBA 1LOWA 1RDSA 4J5KA 1BVIA 1AQZA 2KF6A 3D4AA 5RNTA 1DETA 1BRIA 1LRAA 5BIRA 1BSDA 1BNFA 2ZA4A 1FW7A 1LOYA 1RGFA 4GHOA 4GSPA 1RTUA 1B2MA 1UCKA 5BU4A 3DH2A 2SARA 1B3SA 3WHOA 3GSPA 2GSPA 3A5EA 1UCIA 1RN1A 1I0VA 1BNRA 1FUSA 1BRGA 1LNIA 1PY3A 1X1YA 1BRNL 3D5GA 1BRKA 1RNTA 1TTOA 2BU4A 1I3IA 1A2PA 1IYYA 1PYLA 1Q9EA 1AY7A 1GOUA 1GMQA 9RNTA 5HOHA 1GMRA 3BIRA 1BRHA 1BIRA 2BIRA 4HOHA 1GOVA 1B20A 2F56A 8RNTA 1FYSA 1FUTA 2AADA 7GSPA 3D5IA 4J5GA 1JBTA 4BIRA 1RGCA 1GMPA 1TRQA 2KF3A 1BNEA 1GOYA 1HZ1A 1FZUA 1RHLA 2RBIA 1I2EA 1RGAA 2KF4A
chains in the Genus database with same CATH superfamily
2IUKA 1I0XA 3V92A 5AIIA 1BNGA 3AHWA 1ZS7A 3AGNA 4MMZB 1ROAA 3EF8A 4AEQA 1B2ZA 4WYKB 1CH0A 2JQ5A 3VGNA 3KE7A 2RNTA 5KP3A 1E97A 4EYCA 1OUNA 1W02A 1K28A 3PZWA 3DMCA 4MMXB 1QVG2 1FUWA 3KIIA 3NM7A 2E2UA 3Q3FA 3FCSB 3I563 3CMA3 3PS8A 1C7HA 2D1WA 1GYBA 4WWUC 3OW22 5IEPA 2KRTA 2B1XB 2CK3H 7RNTA 1MWRA 3GZXB 3MYTA 1SARA 2OTJ3 3CC23 2AAEA 1YNVX 2A15A 3HIIA 6GSPA 1TU5A 3X40A 1X1UA 1KWIA 3LTBA 1HYFA 4XBYA 1A2KA 5CF1A 2F5WA 1Q40A 2OCTA 1JB5A 1TFKA 4HBRA 1EA2A 1YVBI 4HM2B 1I70A 1X1XA 1GD3A 3CCV3 1B2SA 1IQ8A 5EQLA 1ZO2A 2BNGA 2FXTA 1Q824 1BGSA 1RN4A 3N54B 1WMPA 1Q7HA 3JUQA 3X3ZA 1EKMA 2KCDA 2O3OA 2YFIB 2F5MA 4N6V0 7STDA 1B27A 1RSNA 2IYJA 4WYKA 3CPW2 1I2FA 2W56A 1GS3A 3WODG 2CX0A 1W6YA 1BSBA 4R9LA 4FCMA 2OTL3 2Z6BA 1LOWA 1S723 2XGLA 1W2B2 4J5KA 2OQEC 4R80A 3UJMA 2BMOB 2KF6A 5RNTA 3SX1A 1JN5B 4BTXA 1LRAA 1ZX2A 1E3VA 3OWSA 1BSDA 3EN1B 1M1K4 3LOYA 1STDA 2Y73A 1FGOA 4ZM8A 2Y74A 3DXOA 4GSPA 4MMYB 3CCS3 2GEXA 3SOYA 4MJDA 3D3LA 3O8YA 1W6GA 2SARA 2UGIA 4BTYA 2OQEA 5M18A 3BB9A 3WHOA 3MG1A 1KC84 4L7KA 3N9HA 3LH4A 3LTDA 1FUSA 1LNIA 4HM5B 3B4PA 1BRKA 2H0GA 3D5GA 1G96A 3GZRA 4HYZA 3V98A 2D42A 1IYYA 2IA7A 3CCL3 4IPBA 3UB1A 1EEJA 1GOUA 2BT3A 2M7OA 3M8CA 3FLJA 9RNTA 3NUVA 3RGRA 2QA43 3BIRA 1BRHA 1N5HA 1FGMA 3FG3A 3QRDA 1YJ93 3MKIA 3KFQC 4O02B 1NB3I 4FCZA 5FGOA 1N9EA 3SXXA 1VQO3 2H0HA 2HMKB 2AADA 1FUTA 3G0KA 3KN4A 3MG2A 4J5GA 1OF5A 1GY7A 3EHCA 1JBTA 1GMPA 2UUGC 3NXJA 2CG0A 1TRQA 2KF3A 4KVHA 3LT8A 1FZUA 4ORLA 1BUQA 1I2EA 1PFPA 2GXFA 1W4NA 1RGAA 1VQL3 2KF4A 1D6ZA 3DGYA 3F7SA 1VQM3 1UUGB 4H3UA 3WOEB 2INXA 1EG9B 2CWVA 1IVUA 1UDII 5IEOA 3FF2A 3MWZA 2KF5A 3Q90A 4EC6A 3B8LA 5CXOA 5JBSA 1D6UA 3PGBA 1QVF2 2BO9B 1YVSA 4R9KA 1YIT3 1BRSA 3T0UA 2J8XB 3EJVA 3U97A 2ML6A 3CNXA 1BNIA 2BMRB 2JDIH 4G1MB 5KP4A 3OXAA 1B21A 1RLSA 4FCJA 4N3VA 2C4BA 1MWTA 2E2TA 3PCRA 1FGQA 1BNJA 3GWRA 3FG1A 1QJGA 1W5ZA 4HVNA 4CJNA 1MGWA 1W01A 4OUQA 2XGNA 1RGHA 2BHMA 1RGKA 2UX0A 1NU3A 5GSPA 3NV0B 1UCLA 5EVHA 1MGRA 1UCJA 1DYUA 4HM7B 4HM8B 1R4YA 1CYVA 1JRQA 2CH9A 3CD63 5JPUA 3GAXA 4HM4B 2XFTA 3CC43 5STDA 1LOVA 1VQ53 3SLUA 1RGEA 2CFDA 1G02A 4N6OB 3LZAA 3FG4A 1OCVA 3JUMA 1UUWB 1O7MB 3GZBA 3LTAA 4LMIA 2XEPA 4CCVA 1MNLA 1KSIA 1DMMA 5ELJA 2W2CA 3URPA 3NBBA 3NHXA 1LQMB 3ZG5A 4J8TA 2F86B 2YFJB 1IVVA 1TIJA 4JRFA 5HGRA 1WNHA 3STDA 1O7GB 1K734 1YI23 3B4OA 2F98A 3FH1A 3ZFZA 1AQZA 3D4AA 3D9RA 3S67A 4OVMA 1MWSA 3Q2PA 2WOFA 5BIRA 1NNVA 4EV2A 5AIGA 1FW7A 3VSYA 2QGUA 2L1SA 3FGYA 1RGFA 1RTUA 3NBRA 2W03A 1VQ63 2ZHXB 3BNBA 1B3SA 1K8A4 4HZBB 3GSPA 3CME3 2GSPA 1OACA 1CEWI 3WOFB 1UCIA 5M19A 1I0VA 3SOAA 3NV0A 2CWUA 1T3BA 1BNRA 1ULIB 1EQKA 1M1XB 2HMMB 4HZ9B 1BRNL 1LNHA 5AYRB 3N8BA 3VF1A 1M9GA 1A2PA 1NO3A 1STFI 1UI7A 3PCSA 3G713 4AKYA 1M904 3NX0A 1Q9EA 4HM1B 3MPHA 4U13A 1GMQA 4RNZA 3CU3A 5LC7A 2GU3A 4XDWA 2P05A 4DKIA 3EX9A 1OGZA 2Q07A 1FA3A 1NJI4 1W7CA 4PEJA 5EEOA 1GOVA 1B20A 1JKGB 1VQ83 2F56A 4O8SA 2OWPA 1Z1SA 2CKFB 8RNTA 4WHAA 4H61A 5D82A 2FGTA 5KP1A 2RFRA 1K41A 1LOXA 5JPPA 3K9MC 3WMDA 3NQYA 3X3XA 1IK3A 3HK4A 3B7CA 2CFKA 3EC9A 1R4CA 1WTHA 1BNEA 1NWWA 2YX9A 5A0OB 3WDGB 1JJ22 1JZDA 3UL5A 4L8PA 1AV4A 3OWUA 3EBTA 4JF8A 1RCLA 1RCKA 1I2GA 3EQQB 1BAOA 4O3VA 3RDEA 5AIFA 2YFLB 2F99A 5LC6A 3G6E3 1K9M4 2CW9A 2WO0A 3F14A 2P0MA 2WGQA 1U5OA 2SBLA 1WMNA 1G0TA 2XSOB 3AHSA 1Q7Y4 5IG0A 4HM0B 3K0ZA 3H51A 1PU4A 6RNTA 2ZL8A 3OX9A 3EB8A 2H0IA 1TUHA 3KSPA 3K7CA 8CHOA 1GY5A 3DGOA 3G16A 5DREA 3WA2X 1OH0A 3S28A 1N8QA 1QALA 4Q53A 1RMSA 4RNYA 2W04A 3J7Yd 3EBYA 4GL6A 2PNCA 2K3DA 4N6NB 1JN5A 1I3FA 4LSOA 2W9PA 1O7PB 2Z77A 1TJDA 1RGLA 4LYLB 4X2OA 2CG1A 2XSHB 1TP6A 5BXQA 1JKGA 1QAKA 2XF3A 3MSOA 4HKVB 1UI8A 2P0XA 1VQ93 1GSPA 1JBRA 3DY5A 2W9QA 1A67A 1DE3A 1T2IA 1TRPA 4XBXA 2LYXA 3AGOA 2KAAA 3SYUA 3IJEB 1UUVB 2W0QA 4FMBA 4EV5A 3H3HA 2C10A 3K63A 4TX4A 1BSEA 1BSAA 1O7NB 4J9AA 3BU4A 3D79A 3DGNA 3X41A 2IY2A 4IIAA 2ML5A 1FGRA 1YJN3 1BANA 1DMQA 3NBJA 3PXMA 3KSED 4FMDA 3GZYB 1VQ73 1JB4A 1IQXA 3S5CA 1VQK3 4FMAA 4EXRA 1V74A 3X42A 1BVIA 1JB2A 2L4VA 3KKGA 4K1UA 3ZG0A 5AEWB 2QEX3 4X2HA 1DETA 3DM8A 6STDA 2CFLA 1IQYA 5IENA 3X3YA 1UGHI 2R4IA 4L8OA 3BLZA 1F8NA 3JVCA 2E2VA 3SVAA 4I5QA 1VQN3 2K0MA 2WOHA 3IMAB 2W6JH 4GB5A 1RRHA 2V1LA 1Q40B 2GEYA 3F8XA 1UCKA 3L0RA 3S29A 5IERA 5BU4A 1CYUA 3DH2A 1KQS2 1T5YA 2HMNB 2QIYA 4XM4A 1RJOA 3BNEA 2HMLB 1LVNA 2FNQA 1RRLA 4MEIA 4N6LA 3LTCA 1SPUA 2WGOA 2GBXB 3QK9A 4XDVA 3IPTA 1X1YA 1U8CB 3JUPA 2CFWA 2O9UX 3U1WA 3CCJ3 1Q864 1RNTA 3LXUX 1I3IA 1YJW3 1PYLA 1OHOA 1AY7A 2W56B 3DZLA 1DVCA 4BTWA 1IT8A 4KZ1A 5HOHA 1GMRA 1UW1A 5AYSC 5BVBA 1DMNA 1ULJB 3RGAA 1BIRA 5DRVA 3AMOB 3CXC2 3F7XA 1OPYA 4HOHA 2GBWB 3G4S3 3HI7A 2R41A 1HU9A 1E3RA 1FYSA 1V58A 4O2HA 4WFOA 7GSPA 1IV7A 4OK0A 5G2GA 1L5GB 3T8UA 4BL3A 1IV9A 4BL2A 3I0YA 4BIRA 1RGCA 1IDPA 3HX8A 5IG3A 1DVDA 1N9JA 2PZVA 2CIUA 1LXEA 1HZ1A 3CNMA 1HKXA 2GU1A 1IT7A 3G8ZA 2XFSA 5CK6A 4N6TA 2F4YA 1NDOB 3FKAA 4KFEA 5CF2A 3KZTA 3DGMA 4FMCA 4QWTA 1SIHA 1ZGXA 1W00A 5FW5A 3CPOA 4K61A 4AKZA 4R4KA 1SQWA 2MC8A 2B24B 4N6UA 4K90B 3KCHA 2CWTA 2XR8B 4KT3B 1BSCA 4RBNA 4NREA 1O7WB 5AEUB 3CCR3 4XB5A 1ISKA 2XH9A 1GD4A 3LYGA 1FGTA 4WP5A 3I553 1US1A 2HMOB 3T8NA 1LQGC 3Q1CA 3UL6A 5D81A 1MWUA 1YGWA 5I97A 3PYJA 2Z7AA 4XBTA 3WR2A 1JBSA 1SIIA 1O7HB 1CQSA 1OF5B 1YIJ3 1AR0A 3S27A 4K1VA 4LGQA 1A90A 3GRDA 1QAFA 3AMOA 5D83A 4LZIA 1X1WA 5IG5A 3CCE3 5G1LA 3DUKA 3RNTA 2STDA 4FR9A 4BU4A 4RZMA 1AVLA 1N5PA 1BRJA 2CHCA 1RKYA 1BUJA 5ELUA 1B2XA 2Z76A 2HOHA 4KFDA 4LEHA 1NB5I 1VZZA 1IVXA 1JNQA 2C11A 3F9SA 1T2HA 1C54A 3EN8A 1BOXA 1I8VA 2MF7A 3FZWA 3HOHA 3LMLA 2K54A 1AVKA 3NM2A 1VQQA 3OWYA 1RGGA 1W2ZA 1OHPA 1UGIA 4RNTA 5CLKA 5M1AA 3K5TA 1B2UA 1JZOA 1BU4A 3UNLA 3TDGA 5IW9A 1N8R4 2XRXB 2P38A 4HAAA 1Q42A 1BNSA 1KD14 4I4KA 1RNBA 1IU7A 3BNDA 3DGLA 1RDSA 4CPKA 1W6CA 1J2BA 4R1KA 3JUNA 1TFOA 5TGNA 2P09A 3LT9A 3ER7A 1BRIA 3FSDA 4N6MA 3MG3A 3ALAA 4NHFA 1BNFA 3F40A 3HZPA 2ZA4A 3BNCA 4KFFA 2IUJA 2RGQA 1LOYA 1ROVA 3MHEA 4GHOA 1VQP3 1JV2B 1ASKA 1OGXA 1RN7A 3WA3A 1B2MA 3E99A 4HM3B 1SJWA 1YHQ3 4STDA 1D6YA 5AI1A 3CCQ3 1OHSA 2BMQB 3A5EA 3EE1A 4NPBA 1RN1A 3OV4A 5IG4A 3A76A 1WMOA 1BRGA 4HJLB 1PY3A 1TTOA 3V99A 3CC73 2BU4A 1V57A 2IMJA 2KXGA 3ECFA 2RCDA 4HM6B 1VQ43 4EW5A 1YGEA 4EBGA 5AIHA 2HMJB 2LQVA 2OOVC 3CCU3 2RSXA 4IT7A 4ILFA 2BIRA 3ROBA 1Q814 4CDLA 2I9WA 3FF0A 1Y4KA 3JUOA 3NQZA 1A2VA 3D5IA 1MOLA 3SEDA 1EUIC 1WQLB 3CCM3 5IF6A 1IVWA 3HIGA 2RBIA 1GOYA 1GY6A 1RHLA 3F8HA 1S5AA 2CFGA 2CX1A 2OOVA 2ZDJA 1QMAA 5G1KA 2CC3A
chains in the Genus database with same CATH topology
3DGYA 1I0XA 2F4YA 1BNGA 3AHWA 3AGNA 1RCLA 1RCKA 1I2GA 1BAOA 1B2ZA 1ZGXA 2KF5A 1CH0A 2RNTA 1YVSA 3AHSA 3KCHA 1BSCA 1BRSA 6RNTA 1BNIA 3Q3FA 1B21A 1RLSA 2C4BA 1YGWA 3WR2A 1BNJA 1JBSA 1RMSA 1MGWA 7RNTA 1RGHA 1SARA 1RGKA 2AAEA 1I3FA 1YNVX 6GSPA 5GSPA 1X1UA 1X1WA 1RGLA 1HYFA 3RNTA 1UCLA 4BU4A 2F5WA 1MGRA 1UCJA 1BRJA 1JBRA 1GSPA 1R4YA 1I70A 1X1XA 1DE3A 1BUJA 1T2IA 1B2XA 1TRPA 2HOHA 1B2SA 2KAAA 3AGOA 3SYUA 1LOVA 1C54A 1BGSA 1T2HA 1RN4A 1BOXA 1I8VA 3HOHA 1RGEA 1BSEA 1RGGA 4RNTA 1BSAA 1G02A 2F5MA 3BU4A 1B2UA 1BU4A 1B27A 1BANA 4HAAA 1RSNA 1I2FA 1BNSA 3URPA 1BSBA 1RNBA 1LOWA 1RDSA 4J5KA 1BVIA 1AQZA 2KF6A 3D4AA 5RNTA 1DETA 1BRIA 1LRAA 5BIRA 1BSDA 1BNFA 2ZA4A 1FW7A 1LOYA 1RGFA 4GHOA 4GSPA 1RTUA 1B2MA 1UCKA 5BU4A 3DH2A 2SARA 1B3SA 3WHOA 3GSPA 2GSPA 3A5EA 1UCIA 1RN1A 1I0VA 1BNRA 1FUSA 1BRGA 1LNIA 1PY3A 1X1YA 1BRNL 3D5GA 1BRKA 1RNTA 1TTOA 2BU4A 1I3IA 1A2PA 1IYYA 1PYLA 1Q9EA 1AY7A 1GOUA 1GMQA 9RNTA 5HOHA 1GMRA 3BIRA 1BRHA 1BIRA 2BIRA 4HOHA 1GOVA 1B20A 2F56A 8RNTA 1FYSA 1FUTA 2AADA 7GSPA 3D5IA 4J5GA 1JBTA 4BIRA 1RGCA 1GMPA 1TRQA 2KF3A 1BNEA 1GOYA 1HZ1A 1FZUA 1RHLA 2RBIA 1I2EA 1RGAA 2KF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DGY A;  1I0X A;  2F4Y A;  1BNG A;  3AHW A;  3AGN A;  1RCL A;  1RCK A;  1I2G A;  1BAO A;  1B2Z A;  1ZGX A;  2KF5 A;  1CH0 A;  2RNT A;  1YVS A;  3AHS A;  3KCH A;  1BSC A;  1BRS A;  6RNT A;  1BNI A;  3Q3F A;  1B21 A;  1RLS A;  2C4B A;  1YGW A;  3WR2 A;  1BNJ A;  1JBS A;  1RMS A;  1MGW A;  7RNT A;  1RGH A;  1SAR A;  1RGK A;  2AAE A;  1I3F A;  1YNV X;  6GSP A;  5GSP A;  1X1U A;  1X1W A;  1RGL A;  1HYF A;  3RNT A;  1UCL A;  4BU4 A;  2F5W A;  1MGR A;  1UCJ A;  1BRJ A;  1JBR A;  1GSP A;  1R4Y A;  1I70 A;  1X1X A;  1DE3 A;  1BUJ A;  1T2I A;  1B2X A;  1TRP A;  2HOH A;  1B2S A;  2KAA A;  3AGO A;  3SYU A;  1LOV A;  1C54 A;  1BGS A;  1T2H A;  1RN4 A;  1BOX A;  1I8V A;  3HOH A;  1RGE A;  1BSE A;  1RGG A;  4RNT A;  1BSA A;  1G02 A;  2F5M A;  3BU4 A;  1B2U A;  1BU4 A;  1B27 A;  1BAN A;  4HAA A;  1RSN A;  1I2F A;  1BNS A;  3URP A;  1BSB A;  1RNB A;  1LOW A;  1RDS A;  4J5K A;  1BVI A;  1AQZ A;  2KF6 A;  3D4A A;  5RNT A;  1DET A;  1BRI A;  1LRA A;  5BIR A;  1BSD A;  1BNF A;  2ZA4 A;  1FW7 A;  1LOY A;  1RGF A;  4GHO A;  4GSP A;  1RTU A;  1B2M A;  1UCK A;  5BU4 A;  3DH2 A;  2SAR A;  1B3S A;  3WHO A;  3GSP A;  2GSP A;  3A5E A;  1UCI A;  1RN1 A;  1I0V A;  1BNR A;  1FUS A;  1BRG A;  1LNI A;  1PY3 A;  1X1Y A;  1BRN L;  3D5G A;  1BRK A;  1RNT A;  1TTO A;  2BU4 A;  1I3I A;  1A2P A;  1IYY A;  1PYL A;  1Q9E A;  1AY7 A;  1GOU A;  1GMQ A;  9RNT A;  5HOH A;  1GMR A;  3BIR A;  1BRH A;  1BIR A;  2BIR A;  4HOH A;  1GOV A;  1B20 A;  2F56 A;  8RNT A;  1FYS A;  1FUT A;  2AAD A;  7GSP A;  3D5I A;  4J5G A;  1JBT A;  4BIR A;  1RGC A;  1GMP A;  1TRQ A;  2KF3 A;  1BNE A;  1GOY A;  1HZ1 A;  1FZU A;  1RHL A;  2RBI A;  1I2E A;  1RGA A;  2KF4 A; 
#chains in the Genus database with same CATH topology
 2IUK A;  1I0X A;  3V92 A;  5AII A;  1BNG A;  3AHW A;  1ZS7 A;  3AGN A;  4MMZ B;  1ROA A;  3EF8 A;  4AEQ A;  1B2Z A;  4WYK B;  1CH0 A;  2JQ5 A;  3VGN A;  3KE7 A;  2RNT A;  5KP3 A;  1E97 A;  4EYC A;  1OUN A;  1W02 A;  1K28 A;  3PZW A;  3DMC A;  4MMX B;  1QVG 2;  1FUW A;  3KII A;  3NM7 A;  2E2U A;  3Q3F A;  3FCS B;  3I56 3;  3CMA 3;  3PS8 A;  1C7H A;  2D1W A;  1GYB A;  4WWU C;  3OW2 2;  5IEP A;  2KRT A;  2B1X B;  2CK3 H;  7RNT A;  1MWR A;  3GZX B;  3MYT A;  1SAR A;  2OTJ 3;  3CC2 3;  2AAE A;  1YNV X;  2A15 A;  3HII A;  6GSP A;  1TU5 A;  3X40 A;  1X1U A;  1KWI A;  3LTB A;  1HYF A;  4XBY A;  1A2K A;  5CF1 A;  2F5W A;  1Q40 A;  2OCT A;  1JB5 A;  1TFK A;  4HBR A;  1EA2 A;  1YVB I;  4HM2 B;  1I70 A;  1X1X A;  1GD3 A;  3CCV 3;  1B2S A;  1IQ8 A;  5EQL A;  1ZO2 A;  2BNG A;  2FXT A;  1Q82 4;  1BGS A;  1RN4 A;  3N54 B;  1WMP A;  1Q7H A;  3JUQ A;  3X3Z A;  1EKM A;  2KCD A;  2O3O A;  2YFI B;  2F5M A;  4N6V 0;  7STD A;  1B27 A;  1RSN A;  2IYJ A;  4WYK A;  3CPW 2;  1I2F A;  2W56 A;  1GS3 A;  3WOD G;  2CX0 A;  1W6Y A;  1BSB A;  4R9L A;  4FCM A;  2OTL 3;  2Z6B A;  1LOW A;  1S72 3;  2XGL A;  1W2B 2;  4J5K A;  2OQE C;  4R80 A;  3UJM A;  2BMO B;  2KF6 A;  5RNT A;  3SX1 A;  1JN5 B;  4BTX A;  1LRA A;  1ZX2 A;  1E3V A;  3OWS A;  1BSD A;  3EN1 B;  1M1K 4;  3LOY A;  1STD A;  2Y73 A;  1FGO A;  4ZM8 A;  2Y74 A;  3DXO A;  4GSP A;  4MMY B;  3CCS 3;  2GEX A;  3SOY A;  4MJD A;  3D3L A;  3O8Y A;  1W6G A;  2SAR A;  2UGI A;  4BTY A;  2OQE A;  5M18 A;  3BB9 A;  3WHO A;  3MG1 A;  1KC8 4;  4L7K A;  3N9H A;  3LH4 A;  3LTD A;  1FUS A;  1LNI A;  4HM5 B;  3B4P A;  1BRK A;  2H0G A;  3D5G A;  1G96 A;  3GZR A;  4HYZ A;  3V98 A;  2D42 A;  1IYY A;  2IA7 A;  3CCL 3;  4IPB A;  3UB1 A;  1EEJ A;  1GOU A;  2BT3 A;  2M7O A;  3M8C A;  3FLJ A;  9RNT A;  3NUV A;  3RGR A;  2QA4 3;  3BIR A;  1BRH A;  1N5H A;  1FGM A;  3FG3 A;  3QRD A;  1YJ9 3;  3MKI A;  3KFQ C;  4O02 B;  1NB3 I;  4FCZ A;  5FGO A;  1N9E A;  3SXX A;  1VQO 3;  2H0H A;  2HMK B;  2AAD A;  1FUT A;  3G0K A;  3KN4 A;  3MG2 A;  4J5G A;  1OF5 A;  1GY7 A;  3EHC A;  1JBT A;  1GMP A;  2UUG C;  3NXJ A;  2CG0 A;  1TRQ A;  2KF3 A;  4KVH A;  3LT8 A;  1FZU A;  4ORL A;  1BUQ A;  1I2E A;  1PFP A;  2GXF A;  1W4N A;  1RGA A;  1VQL 3;  2KF4 A;  1D6Z A;  3DGY A;  3F7S A;  1VQM 3;  1UUG B;  4H3U A;  3WOE B;  2INX A;  1EG9 B;  2CWV A;  1IVU A;  1UDI I;  5IEO A;  3FF2 A;  3MWZ A;  2KF5 A;  3Q90 A;  4EC6 A;  3B8L A;  5CXO A;  5JBS A;  1D6U A;  3PGB A;  1QVF 2;  2BO9 B;  1YVS A;  4R9K A;  1YIT 3;  1BRS A;  3T0U A;  2J8X B;  3EJV A;  3U97 A;  2ML6 A;  3CNX A;  1BNI A;  2BMR B;  2JDI H;  4G1M B;  5KP4 A;  3OXA A;  1B21 A;  1RLS A;  4FCJ A;  4N3V A;  2C4B A;  1MWT A;  2E2T A;  3PCR A;  1FGQ A;  1BNJ A;  3GWR A;  3FG1 A;  1QJG A;  1W5Z A;  4HVN A;  4CJN A;  1MGW A;  1W01 A;  4OUQ A;  2XGN A;  1RGH A;  2BHM A;  1RGK A;  2UX0 A;  1NU3 A;  5GSP A;  3NV0 B;  1UCL A;  5EVH A;  1MGR A;  1UCJ A;  1DYU A;  4HM7 B;  4HM8 B;  1R4Y A;  1CYV A;  1JRQ A;  2CH9 A;  3CD6 3;  5JPU A;  3GAX A;  4HM4 B;  2XFT A;  3CC4 3;  5STD A;  1LOV A;  1VQ5 3;  3SLU A;  1RGE A;  2CFD A;  1G02 A;  4N6O B;  3LZA A;  3FG4 A;  1OCV A;  3JUM A;  1UUW B;  1O7M B;  3GZB A;  3LTA A;  4LMI A;  2XEP A;  4CCV A;  1MNL A;  1KSI A;  1DMM A;  5ELJ A;  2W2C A;  3URP A;  3NBB A;  3NHX A;  1LQM B;  3ZG5 A;  4J8T A;  2F86 B;  2YFJ B;  1IVV A;  1TIJ A;  4JRF A;  5HGR A;  1WNH A;  3STD A;  1O7G B;  1K73 4;  1YI2 3;  3B4O A;  2F98 A;  3FH1 A;  3ZFZ A;  1AQZ A;  3D4A A;  3D9R A;  3S67 A;  4OVM A;  1MWS A;  3Q2P A;  2WOF A;  5BIR A;  1NNV A;  4EV2 A;  5AIG A;  1FW7 A;  3VSY A;  2QGU A;  2L1S A;  3FGY A;  1RGF A;  1RTU A;  3NBR A;  2W03 A;  1VQ6 3;  2ZHX B;  3BNB A;  1B3S A;  1K8A 4;  4HZB B;  3GSP A;  3CME 3;  2GSP A;  1OAC A;  1CEW I;  3WOF B;  1UCI A;  5M19 A;  1I0V A;  3SOA A;  3NV0 A;  2CWU A;  1T3B A;  1BNR A;  1ULI B;  1EQK A;  1M1X B;  2HMM B;  4HZ9 B;  1BRN L;  1LNH A;  5AYR B;  3N8B A;  3VF1 A;  1M9G A;  1A2P A;  1NO3 A;  1STF I;  1UI7 A;  3PCS A;  3G71 3;  4AKY A;  1M90 4;  3NX0 A;  1Q9E A;  4HM1 B;  3MPH A;  4U13 A;  1GMQ A;  4RNZ A;  3CU3 A;  5LC7 A;  2GU3 A;  4XDW A;  2P05 A;  4DKI A;  3EX9 A;  1OGZ A;  2Q07 A;  1FA3 A;  1NJI 4;  1W7C A;  4PEJ A;  5EEO A;  1GOV A;  1B20 A;  1JKG B;  1VQ8 3;  2F56 A;  4O8S A;  2OWP A;  1Z1S A;  2CKF B;  8RNT A;  4WHA A;  4H61 A;  5D82 A;  2FGT A;  5KP1 A;  2RFR A;  1K41 A;  1LOX A;  5JPP A;  3K9M C;  3WMD A;  3NQY A;  3X3X A;  1IK3 A;  3HK4 A;  3B7C A;  2CFK A;  3EC9 A;  1R4C A;  1WTH A;  1BNE A;  1NWW A;  2YX9 A;  5A0O B;  3WDG B;  1JJ2 2;  1JZD A;  3UL5 A;  4L8P A;  1AV4 A;  3OWU A;  3EBT A;  4JF8 A;  1RCL A;  1RCK A;  1I2G A;  3EQQ B;  1BAO A;  4O3V A;  3RDE A;  5AIF A;  2YFL B;  2F99 A;  5LC6 A;  3G6E 3;  1K9M 4;  2CW9 A;  2WO0 A;  3F14 A;  2P0M A;  2WGQ A;  1U5O A;  2SBL A;  1WMN A;  1G0T A;  2XSO B;  3AHS A;  1Q7Y 4;  5IG0 A;  4HM0 B;  3K0Z A;  3H51 A;  1PU4 A;  6RNT A;  2ZL8 A;  3OX9 A;  3EB8 A;  2H0I A;  1TUH A;  3KSP A;  3K7C A;  8CHO A;  1GY5 A;  3DGO A;  3G16 A;  5DRE A;  3WA2 X;  1OH0 A;  3S28 A;  1N8Q A;  1QAL A;  4Q53 A;  1RMS A;  4RNY A;  2W04 A;  3J7Y d;  3EBY A;  4GL6 A;  2PNC A;  2K3D A;  4N6N B;  1JN5 A;  1I3F A;  4LSO A;  2W9P A;  1O7P B;  2Z77 A;  1TJD A;  1RGL A;  4LYL B;  4X2O A;  2CG1 A;  2XSH B;  1TP6 A;  5BXQ A;  1JKG A;  1QAK A;  2XF3 A;  3MSO A;  4HKV B;  1UI8 A;  2P0X A;  1VQ9 3;  1GSP A;  1JBR A;  3DY5 A;  2W9Q A;  1A67 A;  1DE3 A;  1T2I A;  1TRP A;  4XBX A;  2LYX A;  3AGO A;  2KAA A;  3SYU A;  3IJE B;  1UUV B;  2W0Q A;  4FMB A;  4EV5 A;  3H3H A;  2C10 A;  3K63 A;  4TX4 A;  1BSE A;  1BSA A;  1O7N B;  4J9A A;  3BU4 A;  3D79 A;  3DGN A;  3X41 A;  2IY2 A;  4IIA A;  2ML5 A;  1FGR A;  1YJN 3;  1BAN A;  1DMQ A;  3NBJ A;  3PXM A;  3KSE D;  4FMD A;  3GZY B;  1VQ7 3;  1JB4 A;  1IQX A;  3S5C A;  1VQK 3;  4FMA A;  4EXR A;  1V74 A;  3X42 A;  1BVI A;  1JB2 A;  2L4V A;  3KKG A;  4K1U A;  3ZG0 A;  5AEW B;  2QEX 3;  4X2H A;  1DET A;  3DM8 A;  6STD A;  2CFL A;  1IQY A;  5IEN A;  3X3Y A;  1UGH I;  2R4I A;  4L8O A;  3BLZ A;  1F8N A;  3JVC A;  2E2V A;  3SVA A;  4I5Q A;  1VQN 3;  2K0M A;  2WOH A;  3IMA B;  2W6J H;  4GB5 A;  1RRH A;  2V1L A;  1Q40 B;  2GEY A;  3F8X A;  1UCK A;  3L0R A;  3S29 A;  5IER A;  5BU4 A;  1CYU A;  3DH2 A;  1KQS 2;  1T5Y A;  2HMN B;  2QIY A;  4XM4 A;  1RJO A;  3BNE A;  2HML B;  1LVN A;  2FNQ A;  1RRL A;  4MEI A;  4N6L A;  3LTC A;  1SPU A;  2WGO A;  2GBX B;  3QK9 A;  4XDV A;  3IPT A;  1X1Y A;  1U8C B;  3JUP A;  2CFW A;  2O9U X;  3U1W A;  3CCJ 3;  1Q86 4;  1RNT A;  3LXU X;  1I3I A;  1YJW 3;  1PYL A;  1OHO A;  1AY7 A;  2W56 B;  3DZL A;  1DVC A;  4BTW A;  1IT8 A;  4KZ1 A;  5HOH A;  1GMR A;  1UW1 A;  5AYS C;  5BVB A;  1DMN A;  1ULJ B;  3RGA A;  1BIR A;  5DRV A;  3AMO B;  3CXC 2;  3F7X A;  1OPY A;  4HOH A;  2GBW B;  3G4S 3;  3HI7 A;  2R41 A;  1HU9 A;  1E3R A;  1FYS A;  1V58 A;  4O2H A;  4WFO A;  7GSP A;  1IV7 A;  4OK0 A;  5G2G A;  1L5G B;  3T8U A;  4BL3 A;  1IV9 A;  4BL2 A;  3I0Y A;  4BIR A;  1RGC A;  1IDP A;  3HX8 A;  5IG3 A;  1DVD A;  1N9J A;  2PZV A;  2CIU A;  1LXE A;  1HZ1 A;  3CNM A;  1HKX A;  2GU1 A;  1IT7 A;  3G8Z A;  2XFS A;  5CK6 A;  4N6T A;  2F4Y A;  1NDO B;  3FKA A;  4KFE A;  5CF2 A;  3KZT A;  3DGM A;  4FMC A;  4QWT A;  1SIH A;  1ZGX A;  1W00 A;  5FW5 A;  3CPO A;  4K61 A;  4AKZ A;  4R4K A;  1SQW A;  2MC8 A;  2B24 B;  4N6U A;  4K90 B;  3KCH A;  2CWT A;  2XR8 B;  4KT3 B;  1BSC A;  4RBN A;  4NRE A;  1O7W B;  5AEU B;  3CCR 3;  4XB5 A;  1ISK A;  2XH9 A;  1GD4 A;  3LYG A;  1FGT A;  4WP5 A;  3I55 3;  1US1 A;  2HMO B;  3T8N A;  1LQG C;  3Q1C A;  3UL6 A;  5D81 A;  1MWU A;  1YGW A;  5I97 A;  3PYJ A;  2Z7A A;  4XBT A;  3WR2 A;  1JBS A;  1SII A;  1O7H B;  1CQS A;  1OF5 B;  1YIJ 3;  1AR0 A;  3S27 A;  4K1V A;  4LGQ A;  1A90 A;  3GRD A;  1QAF A;  3AMO A;  5D83 A;  4LZI A;  1X1W A;  5IG5 A;  3CCE 3;  5G1L A;  3DUK A;  3RNT A;  2STD A;  4FR9 A;  4BU4 A;  4RZM A;  1AVL A;  1N5P A;  1BRJ A;  2CHC A;  1RKY A;  1BUJ A;  5ELU A;  1B2X A;  2Z76 A;  2HOH A;  4KFD A;  4LEH A;  1NB5 I;  1VZZ A;  1IVX A;  1JNQ A;  2C11 A;  3F9S A;  1T2H A;  1C54 A;  3EN8 A;  1BOX A;  1I8V A;  2MF7 A;  3FZW A;  3HOH A;  3LML A;  2K54 A;  1AVK A;  3NM2 A;  1VQQ A;  3OWY A;  1RGG A;  1W2Z A;  1OHP A;  1UGI A;  4RNT A;  5CLK A;  5M1A A;  3K5T A;  1B2U A;  1JZO A;  1BU4 A;  3UNL A;  3TDG A;  5IW9 A;  1N8R 4;  2XRX B;  2P38 A;  4HAA A;  1Q42 A;  1BNS A;  1KD1 4;  4I4K A;  1RNB A;  1IU7 A;  3BND A;  3DGL A;  1RDS A;  4CPK A;  1W6C A;  1J2B A;  4R1K A;  3JUN A;  1TFO A;  5TGN A;  2P09 A;  3LT9 A;  3ER7 A;  1BRI A;  3FSD A;  4N6M A;  3MG3 A;  3ALA A;  4NHF A;  1BNF A;  3F40 A;  3HZP A;  2ZA4 A;  3BNC A;  4KFF A;  2IUJ A;  2RGQ A;  1LOY A;  1ROV A;  3MHE A;  4GHO A;  1VQP 3;  1JV2 B;  1ASK A;  1OGX A;  1RN7 A;  3WA3 A;  1B2M A;  3E99 A;  4HM3 B;  1SJW A;  1YHQ 3;  4STD A;  1D6Y A;  5AI1 A;  3CCQ 3;  1OHS A;  2BMQ B;  3A5E A;  3EE1 A;  4NPB A;  1RN1 A;  3OV4 A;  5IG4 A;  3A76 A;  1WMO A;  1BRG A;  4HJL B;  1PY3 A;  1TTO A;  3V99 A;  3CC7 3;  2BU4 A;  1V57 A;  2IMJ A;  2KXG A;  3ECF A;  2RCD A;  4HM6 B;  1VQ4 3;  4EW5 A;  1YGE A;  4EBG A;  5AIH A;  2HMJ B;  2LQV A;  2OOV C;  3CCU 3;  2RSX A;  4IT7 A;  4ILF A;  2BIR A;  3ROB A;  1Q81 4;  4CDL A;  2I9W A;  3FF0 A;  1Y4K A;  3JUO A;  3NQZ A;  1A2V A;  3D5I A;  1MOL A;  3SED A;  1EUI C;  1WQL B;  3CCM 3;  5IF6 A;  1IVW A;  3HIG A;  2RBI A;  1GOY A;  1GY6 A;  1RHL A;  3F8H A;  1S5A A;  2CFG A;  2CX1 A;  2OOV A;  2ZDJ A;  1QMA A;  5G1K A;  2CC3 A; 
#chains in the Genus database with same CATH homology
 3DGY A;  1I0X A;  2F4Y A;  1BNG A;  3AHW A;  3AGN A;  1RCL A;  1RCK A;  1I2G A;  1BAO A;  1B2Z A;  1ZGX A;  2KF5 A;  1CH0 A;  2RNT A;  1YVS A;  3AHS A;  3KCH A;  1BSC A;  1BRS A;  6RNT A;  1BNI A;  3Q3F A;  1B21 A;  1RLS A;  2C4B A;  1YGW A;  3WR2 A;  1BNJ A;  1JBS A;  1RMS A;  1MGW A;  7RNT A;  1RGH A;  1SAR A;  1RGK A;  2AAE A;  1I3F A;  1YNV X;  6GSP A;  5GSP A;  1X1U A;  1X1W A;  1RGL A;  1HYF A;  3RNT A;  1UCL A;  4BU4 A;  2F5W A;  1MGR A;  1UCJ A;  1BRJ A;  1JBR A;  1GSP A;  1R4Y A;  1I70 A;  1X1X A;  1DE3 A;  1BUJ A;  1T2I A;  1B2X A;  1TRP A;  2HOH A;  1B2S A;  2KAA A;  3AGO A;  3SYU A;  1LOV A;  1C54 A;  1BGS A;  1T2H A;  1RN4 A;  1BOX A;  1I8V A;  3HOH A;  1RGE A;  1BSE A;  1RGG A;  4RNT A;  1BSA A;  1G02 A;  2F5M A;  3BU4 A;  1B2U A;  1BU4 A;  1B27 A;  1BAN A;  4HAA A;  1RSN A;  1I2F A;  1BNS A;  3URP A;  1BSB A;  1RNB A;  1LOW A;  1RDS A;  4J5K A;  1BVI A;  1AQZ A;  2KF6 A;  3D4A A;  5RNT A;  1DET A;  1BRI A;  1LRA A;  5BIR A;  1BSD A;  1BNF A;  2ZA4 A;  1FW7 A;  1LOY A;  1RGF A;  4GHO A;  4GSP A;  1RTU A;  1B2M A;  1UCK A;  5BU4 A;  3DH2 A;  2SAR A;  1B3S A;  3WHO A;  3GSP A;  2GSP A;  3A5E A;  1UCI A;  1RN1 A;  1I0V A;  1BNR A;  1FUS A;  1BRG A;  1LNI A;  1PY3 A;  1X1Y A;  1BRN L;  3D5G A;  1BRK A;  1RNT A;  1TTO A;  2BU4 A;  1I3I A;  1A2P A;  1IYY A;  1PYL A;  1Q9E A;  1AY7 A;  1GOU A;  1GMQ A;  9RNT A;  5HOH A;  1GMR A;  3BIR A;  1BRH A;  1BIR A;  2BIR A;  4HOH A;  1GOV A;  1B20 A;  2F56 A;  8RNT A;  1FYS A;  1FUT A;  2AAD A;  7GSP A;  3D5I A;  4J5G A;  1JBT A;  4BIR A;  1RGC A;  1GMP A;  1TRQ A;  2KF3 A;  1BNE A;  1GOY A;  1HZ1 A;  1FZU A;  1RHL A;  2RBI A;  1I2E A;  1RGA A;  2KF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...