3D3LA

The 2.6 a crystal structure of the lipoxygenase domain of human arachidonate 12-lipoxygenase, 12s-type (casp target)
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
487
structure length
451
Chain Sequence
WTLKAGALEMALKRVYTLLSSWNCLEDFDQIFWGQKSALAEKVRQCWQDDELFSYQFLNGANPMLLRRSTSLPSRLVLPSGMEELRAQLEKELQNGSLFEADFILLDGIPAEKQYLAAPLVMLKMEPNGKLQPMVIQIQPPNPSSPTPTLFLPSDPPLAWLLAKSWVRNSDFQLHEIQYHLLNTHLVAEVIAVATMRCLPGLHPIFKFLIPHIRYGGHVQLLRRAAAQLTYCSLCPPDDLADRGLLGLPGALYAHDALRLWEIIARYVEGIVHLFYQRDDIVKGDPELQAWCREITEVGLCQAQDRGFPVSFQSQSQLCHFLTMCVFTCTAQHAAINQGQLDWYAWVPNAPCTMRMPPPTTKEDVTMATVMGSLPDVRQACLQMAISWHLSDMVPLGHHKEKYFSGPKPKAVLNQFRTDLEKLEKEITARNEQLDWPYEYLKPSCIENSVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Arachidonate 12-lipoxygenase, 12S-type
publication title Crystal structure of the lipoxygenase domain of human Arachidonate 12-lipoxygenase, 12S-type.
rcsb
source organism Homo sapiens
total genus 150
structure length 451
sequence length 487
chains with identical sequence B
ec nomenclature ec 1.13.11.31: Arachidonate 12-lipoxygenase.
pdb deposition date 2008-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00305 Lipoxygenase Lipoxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.245.10 Mainly Alpha Up-down Bundle Lipoxygenase-1; domain 5 Lipoxygenase-1; Domain 5 3d3lA01
3.10.450.670 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3d3lA02
1FGTA 3BNEA 3FG3A 1IK3A 1RRHA 1FGRA 3O8YA 2P0MA 1JNQA 3D3LA 3V99A 1NO3A 1ROVA 4NREA 3DY5A 4QWTA 3BNBA 3V92A 3VF1A 1N8QA 3BNCA 1FGMA 1YGEA 1LNHA 3FG1A 3FG4A 1LOXA 1FGOA 1RRLA 2FNQA 4WFOA 1FGQA 3PZWA 1F8NA 2IUJA 1HU9A 3RDEA 3BNDA 2IUKA 5EEOA 2SBLA 3V98A 4WHAA 1Y4KA
chains in the Genus database with same CATH superfamily
3BLZA 1EG9B 2XRXB 4EBGA 1NB5I 3LTDA 3X42A 2MC8A 2GSPA 3WOEB 1JRQA 3AHWA 3K7CA 4N6V0 2RCDA 5KP4A 1O7NB 4N6MA 1I0VA 2XH9A 4N6UA 2OOVA 1AVKA 2ZA4A 3GRDA 2K0MA 1Q42A 1JV2B 2OQEA 1X1YA 4TX4A 1BUQA 5RNTA 4RBNA 3KE7A 1OACA 1E3VA 2FNQA 1MGRA 3S29A 1BSCA 3KIIA 3NX0A 3BU4A 1FUSA 5IG5A 1BNEA 4N3VA 1BSAA 1QAKA 2H0IA 3IJEB 3DXOA 1BRHA 2XFTA 2CWVA 1MWRA 4JF8A 1R4YA 3FGYA 1IV7A 3GAXA 2Z7AA 2PZVA 1UGHI 3LT8A 2Y74A 3B4OA 3GZRA 1B2ZA 2GU1A 3X41A 3F8HA 1UDII 2L1SA 1UGIA 2H0GA 1AQZA 1MWSA 4CCVA 3DGOA 1YHQ3 4AEQA 4R1KA 3GZYB 2CWTA 4AKYA 2W9QA 1VQ63 1DYUA 1LOYA 3URPA 1T2IA 3T8NA 5FGOA 1FGOA 4J5KA 4HM4B 3VSYA 5BIRA 1TUHA 1VQM3 1M9GA 1LNIA 1O7PB 1LOWA 1D6YA 1HKXA 3D79A 3LT9A 3CD63 3ROBA 2GXFA 2CH9A 5LC6A 1RGAA 3WR2A 4O3VA 1GS3A 3B8LA 3CC23 1AY7A 3NBJA 1OHPA 3MWZA 1OGXA 1B2XA 1RLSA 2CG0A 1VQP3 4L7KA 4HM2B 1W6GA 1VQO3 3CCV3 4HJLB 3O8YA 5M1AA 2E2VA 4XBXA 1O7MB 1MWUA 1UCLA 2UX0A 1JBRA 4R80A 1RGFA 3DM8A 1ULIB 1I8VA 3NM7A 4N6LA 3CNMA 1DMQA 1JB2A 1TP6A 4MEIA 2F56A 3MHEA 3CME3 1M1XB 3WOFB 2F5MA 1TRPA 2ZL8A 4STDA 5EQLA 1ZO2A 4EV2A 5M18A 4FMCA 1BIRA 1YJN3 1FUTA 2B1XB 4CJNA 1L5GB 1BSBA 2IUJA 1GOUA 1I70A 3PYJA 2IA7A 3HOHA 1JB4A 4HM5B 3HIIA 5BVBA 1LVNA 1GY6A 1YNVX 2BU4A 2HMLB 3LTBA 5CK6A 3WMDA 1Q7Y4 1Z1SA 3EBTA 5G1KA 2WGOA 3FCSB 5HOHA 1AR0A 3OW22 1Y4KA 1K734 4O02B 1SIIA 3D9RA 3I553 1V58A 1GOYA 3SX1A 3F14A 1OPYA 3DGMA 4HOHA 2H0HA 1VQ73 3X3YA 4EV5A 3DH2A 3MSOA 3PCRA 1YGWA 3MG2A 5JBSA 1KQS2 3HI7A 3LMLA 7RNTA 1N8QA 1IVVA 2P38A 2RGQA 1LOXA 2BIRA 2KF4A 1BNJA 3G0KA 2MF7A 3D5GA 2P05A 4L8PA 2ML6A 2BMRB 5IERA 2D42A 2GU3A 4XBTA 5TGNA 2BMQB 3RDEA 1E3RA 2W6JH 1I2FA 1ASKA 2XSHB 1IVWA 1TIJA 4LMIA 1M904 1K8A4 4HM6B 1I2EA 1BU4A 3Q1CA 3WA3A 1A67A 3UJMA 4KFEA 5EVHA 1I0XA 4FR9A 1BNSA 1BRSA 2K3DA 1HYFA 3MG1A 1RGCA 3EX9A 3E99A 4NREA 3F8XA 5ELJA 2K54A 5D83A 1RN7A 3KKGA 2AADA 1CH0A 3VF1A 5CXOA 3A76A 3DGYA 4FMDA 4BL2A 1M1K4 1FGMA 1YGEA 1Q40A 1V57A 2BHMA 2BMOB 3B4PA 3KN4A 4R9LA 2XGNA 1I3IA 4WFOA 1HZ1A 2CWUA 3CPOA 4HZ9B 3U1WA 4LYLB 4J9AA 3CCJ3 3FF2A 1GMRA 3SLUA 1MGWA 5AEWB 5EEOA 1RJOA 1IQYA 2WO0A 2Y73A 3EQQB 1W02A 2IMJA 4HAAA 3B7CA 1ZS7A 2F99A 5JPUA 1GD4A 2F98A 4OK0A 3J7Yd 1O7GB 3I563 1ZX2A 3JUQA 4HYZA 5IG3A 1BNRA 2Z76A 1LRAA 2LYXA 3LH4A 4H61A 1RRHA 3G6E3 1OGZA 4PEJA 1RN1A 3CCL3 3AMOB 1A2PA 3KSPA 3LZAA 3DUKA 1IT8A 3T0UA 1G02A 3QRDA 1B2MA 3V92A 3UNLA 1TTOA 1VQK3 4XM4A 1LXEA 4RNTA 4KFFA 1N9EA 1W6CA 2W0QA 3EBYA 1GY5A 3UL6A 2WOHA 5IEPA 3WDGB 1SJWA 1F8NA 1JKGB 4EXRA 1ISKA 1LOVA 1BNFA 1T3BA 1EEJA 1G0TA 2CIUA 3NBRA 4FMBA 8CHOA 3SEDA 1CYVA 1IYYA 1PU4A 2KF6A 3S67A 3OXAA 2XFSA 1C7HA 3KSED 3NQZA 1TRQA 4J5GA 5KP1A 3CU3A 2CFKA 2KXGA 1T5YA 2CK3H 1NDOB 1QJGA 1TJDA 3I0YA 2P0XA 1X1UA 2W2CA 5AI1A 3NM2A 2XR8B 2CFLA 4QWTA 2L4VA 1BSEA 3EJVA 5G2GA 3X40A 3F40A 5IW9A 1N8R4 4RNZA 1VQ53 3LTAA 3DMCA 2CW9A 3G713 3CC43 3Q2PA 3H3HA 3MPHA 3OWUA 3IPTA 3K5TA 2KF3A 2A15A 3KZTA 5BXQA 3K0ZA 2OOVC 2BNGA 1UUGB 4CPKA 1JZDA 3JUPA 4NPBA 1B2UA 6RNTA 2KAAA 1R4CA 3L0RA 1KD14 1RCLA 1YVBI 1RNTA 2OWPA 1QALA 2W9PA 3MG3A 3FLJA 1PYLA 4ZM8A 1QVF2 1OF5B 1JZOA 3DZLA 3KCHA 4OVMA 5AIIA 1O7WB 3OX9A 3PCSA 5D81A 1BRNL 3QK9A 2Q07A 2QEX3 3CCQ3 3GSPA 1NO3A 2RFRA 1W2ZA 3LXUX 2W56B 3K9MC 1PY3A 3SVAA 4BL3A 2YX9A 1Q864 2CFDA 1GMPA 1AVLA 3PS8A 2AAEA 2CKFB 4NHFA 3FSDA 4HVNA 3S27A 2HMNB 2KRTA 1SQWA 4K1VA 4HZBB 2SARA 3NBBA 4KZ1A 5CLKA 2WGQA 2YFIB 2O3OA 5ELUA 3SXXA 2D1WA 3ZG5A 3CNXA 1RGHA 1W5ZA 4LGQA 1BRJA 1UUVB 1RKYA 3JUOA 1JJ22 1WMPA 1B2SA 4BTYA 4R4KA 4EYCA 2XEPA 1UI7A 2OCTA 5CF2A 4HM3B 1BAOA 1IK3A 1IU7A 1OHSA 3N9HA 5KP3A 1RMSA 1Q7HA 1QVG2 1EKMA 3EN8A 6STDA 1JNQA 2IYJA 1JB5A 4HKVB 2F86B 4LSOA 1BSDA 4I5QA 4L8OA 3RNTA 2F5WA 3RGRA 1CEWI 3JUMA 3HIGA 4IIAA 1RRLA 4N6OB 4XDVA 1YJW3 3NV0B 1B3SA 5GSPA 1RGKA 3OWYA 4WP5A 3S28A 4LEHA 1BRGA 3ZFZA 1UCIA 1OHOA 1W2B2 1DMMA 4KT3B 1BUJA 3CMA3 3X3XA 1YIJ3 3EC9A 1Q824 1U8CB 2UUGC 5IEOA 2O9UX 4ILFA 5IG0A 1G96A 1I2GA 1LQGC 2FGTA 1KSIA 3D3LA 3V99A 3F7SA 1GYBA 1V74A 3K63A 2PNCA 2C10A 1BRIA 1J2BA 3ECFA 5DRVA 1FA3A 1A2VA 1W7CA 3LOYA 4R9KA 4KFDA 3CCS3 3NQYA 1GMQA 3S5CA 1BANA 3BB9A 4K1UA 4K61A 2CX1A 5DREA 1WTHA 1K41A 4O8SA 3PZWA 3GWRA 2GEXA 4HM8B 2KCDA 3EE1A 4HM0B 3NHXA 1B21A 1K28A 3OWSA 4J8TA 1W00A 2YFJB 1RHLA 1IQ8A 2UGIA 1QAFA 4RZMA 1KWIA 3EHCA 1NU3A 2KF5A 3EN1B 5CF1A 1RGLA 5IENA 2GBXB 1GD3A 4K90B 3LTCA 3CPW2 4WYKB 3AMOA 1STDA 1UW1A 1WNHA 4I4KA 3BIRA 1TU5A 1JBTA 3KFQC 1DVCA 3FF0A 2QGUA 4CDLA 1WMOA 3AGNA 1IVXA 1OUNA 1US1A 4XB5A 4DKIA 3CCE3 2STDA 2INXA 2C4BA 1JKGA 4HBRA 5HGRA 1EUIC 4N6TA 3SYUA 2BO9B 2CFWA 3JVCA 2F4YA 1GSPA 4IT7A 2P0MA 3OV4A 1B27A 5AIHA 3SOAA 1ROVA 2CFGA 1KC84 1LQMB 1X1WA 1WQLB 2E2TA 4U13A 1PFPA 3RGAA 4BU4A 2QIYA 2R4IA 2Z77A 3BNCA 2I9WA 1LNHA 3FG1A 3FG4A 1IT7A 2HMMB 4MMXB 4AKZA 1YJ93 1Q9EA 1MOLA 1N5PA 1I3FA 4KVHA 3HK4A 4X2OA 5AYRB 3A5EA 1TFOA 2OQEC 4H3UA 3WHOA 4WHAA 1A90A 3Q3FA 4OUQA 3ER7A 1RSNA 2R41A 2JDIH 3HZPA 3D4AA 4O2HA 3FG3A 1YI23 1BGSA 2HMOB 2JQ5A 1DMNA 2J8XB 1FZUA 4XDWA 4N6NB 1IQXA 4X2HA 3DY5A 1OF5A 3WA2X 3SOYA 3UB1A 2ZHXB 3GZBA 1GY7A 1VZZA 2RBIA 1UCKA 2CG1A 3MKIA 4GB5A 1OH0A 3GZXB 4RNYA 1DE3A 3DGNA 3AGOA 2W56A 4IPBA 9RNTA 2E2UA 4MJDA 3G4S3 3EF8A 1RDSA 4XBYA 4MMYB 4BTWA 1DVDA 3BNDA 1W4NA 2HOHA 1N5HA 3VGNA 3CC73 3ZG0A 2XGLA 4BIRA 7STDA 4HM1B 3U97A 5JPPA 1JBSA 1C54A 2ZDJA 4EC6A 1FGTA 3FZWA 1MWTA 1Q814 1FUWA 3FH1A 2OTL3 5D82A 1SARA 5AIFA 1IV9A 5I97A 1N9JA 1RNBA 4G1MB 2GEYA 3NXJA 2CC3A 1QMAA 2LQVA 2W03A 3N8BA 2FXTA 3D5IA 1ROAA 2V1LA 2XF3A 1UCJA 4FCZA 1O7HB 3F7XA 3CXC2 1RTUA 2RNTA 3STDA 8RNTA 3ALAA 3CCM3 2OTJ3 2CHCA 4WWUC 1SIHA 3WODG 1VQ83 3G8ZA 3UL5A 1IVUA 2C11A 1AV4A 1EQKA 2IUKA 1NJI4 1E97A 1RCKA 1RGGA 3NV0A 1B20A 3JUNA 6GSPA 3BNEA 1DETA 2XSOB 1U5OA 1BVIA 2P09A 5G1LA 1EA2A 2HMKB 1FGRA 3X3ZA 1VQN3 1FW7A 1BRKA 1ULJB 1VQ93 1RGEA 1SPUA 5FW5A 3BNBA 1A2KA 1MNLA 3NUVA 2HMJB 2GBWB 5IG4A 3PXMA 2RSXA 2M7OA 1X1XA 1YVSA 2BT3A 4GHOA 5AYSC 3M8CA 5M19A 1BNGA 3H51A 4GSPA 1S723 5BU4A 3IMAB 3CCU3 4HM7B 3T8UA 1TFKA 1CQSA 1GOVA 2W04A 1HU9A 1NWWA 3DGLA 4GL6A 5STDA 5A0OB 2QA43 4MMZB 1FYSA 2SBLA 3V98A 1UI8A 2Z6BA 1IDPA 1OCVA 3FKAA 1VQQA 4ORLA 3PGBA 4BTXA 1NB3I 1W6YA 2WOFA 3Q90A 1RN4A 1NNVA 1BNIA 1WMNA 1VQ43 1VQL3 4Q53A 3AHSA 1Q40B 1YIT3 2ML5A 1ZGXA 3N54B 3CCR3 4EW5A 1BOXA 3G16A 5IF6A 2IY2A 4FCMA 5AIGA 1D6ZA 4JRFA 3MYTA 2YFLB 1JN5B 1STFI 1CYUA 5LC7A 3HX8A 1K9M4 1T2HA 3EB8A 1FGQA 2B24B 4WYKA 4FMAA 3LYGA 1JN5A 2CX0A 5AEUB 3F9SA 1S5AA 1D6UA 4LZIA 7GSPA 4FCJA 1UUWB 3TDGA 1W01A
chains in the Genus database with same CATH topology
3BLZA 1EG9B 2XRXB 4EBGA 1NB5I 3LTDA 3X42A 2MC8A 3WOEB 1JRQA 3K7CA 4N6V0 2RCDA 5KP4A 1O7NB 4N6MA 2XH9A 4N6UA 2OOVA 1AVKA 3GRDA 2K0MA 1Q42A 1JV2B 2OQEA 4TX4A 1BUQA 4RBNA 3KE7A 1OACA 1E3VA 2FNQA 3S29A 3KIIA 3NX0A 5IG5A 4N3VA 1QAKA 3IJEB 3DXOA 2XFTA 2CWVA 4JF8A 3FGYA 1IV7A 3GAXA 2Z7AA 2PZVA 3LT8A 2Y74A 3B4OA 3GZRA 2GU1A 3X41A 3F8HA 4CCVA 3DGOA 1YHQ3 4AEQA 4R1KA 3GZYB 2CWTA 4AKYA 2W9QA 1VQ63 1DYUA 3T8NA 5FGOA 1FGOA 3VSYA 4HM4B 1TUHA 1VQM3 1M9GA 1O7PB 1D6YA 1HKXA 3LT9A 3CD63 3ROBA 2GXFA 2CH9A 5LC6A 4O3VA 1GS3A 3B8LA 3CC23 3NBJA 1OHPA 3MWZA 1OGXA 2CG0A 1VQP3 4L7KA 4HM2B 1W6GA 1VQO3 3CCV3 4HJLB 3O8YA 2E2VA 4XBXA 1O7MB 2UX0A 4R80A 3DM8A 1ULIB 3NM7A 4N6LA 3CNMA 1DMQA 1JB2A 1TP6A 4MEIA 3MHEA 3CME3 1M1XB 3WOFB 2ZL8A 4STDA 5EQLA 1ZO2A 4EV2A 4FMCA 1YJN3 2B1XB 1L5GB 2IUJA 3PYJA 2IA7A 1JB4A 4HM5B 3HIIA 5BVBA 1LVNA 1GY6A 2HMLB 5CK6A 3WMDA 3LTBA 1Q7Y4 1Z1SA 3EBTA 3OW22 2WGOA 3FCSB 1AR0A 1Y4KA 1K734 4O02B 1SIIA 3D9RA 3I553 3SX1A 3F14A 1OPYA 3DGMA 1VQ73 3X3YA 4EV5A 3MSOA 3PCRA 3MG2A 5JBSA 1KQS2 3HI7A 3LMLA 1N8QA 1IVVA 2P38A 2RGQA 1LOXA 3G0KA 2MF7A 2P05A 4L8PA 2ML6A 2BMRB 5IERA 2D42A 2GU3A 4XBTA 5TGNA 2BMQB 3RDEA 1E3RA 2W6JH 1ASKA 2XSHB 1IVWA 1TIJA 4LMIA 1M904 1K8A4 4HM6B 3Q1CA 3WA3A 1A67A 3UJMA 4KFEA 5EVHA 4FR9A 3MG1A 3EX9A 3E99A 4NREA 3F8XA 5ELJA 2K54A 5D83A 1RN7A 3KKGA 3VF1A 5CXOA 3A76A 1M1K4 4FMDA 1FGMA 1YGEA 1Q40A 2BHMA 2BMOB 3KN4A 3B4PA 4R9LA 2XGNA 4WFOA 2CWUA 3CPOA 4HZ9B 3U1WA 4J9AA 3CCJ3 3FF2A 3SLUA 5AEWB 5EEOA 1RJOA 1IQYA 2WO0A 2Y73A 3EQQB 1W02A 2IMJA 3B7CA 2F99A 5JPUA 1GD4A 2F98A 4OK0A 3J7Yd 1O7GB 3I563 1ZX2A 3JUQA 4HYZA 5IG3A 2Z76A 3LH4A 2LYXA 4H61A 1RRHA 3G6E3 1OGZA 4PEJA 3CCL3 3AMOB 3KSPA 3LZAA 3DUKA 1IT8A 3T0UA 3QRDA 3V92A 3UNLA 1VQK3 4XM4A 1LXEA 4KFFA 1N9EA 1W6CA 2W0QA 3EBYA 1GY5A 3UL6A 2WOHA 5IEPA 3WDGB 1SJWA 1F8NA 1JKGB 4EXRA 1ISKA 2CIUA 3NBRA 4FMBA 8CHOA 3SEDA 1CYVA 1PU4A 3S67A 3OXAA 2XFSA 1C7HA 3KSED 3NQZA 5KP1A 3CU3A 2CFKA 2KXGA 1T5YA 2CK3H 1NDOB 1QJGA 5AI1A 3I0YA 2P0XA 2W2CA 3NM2A 2XR8B 2CFLA 4QWTA 2L4VA 3EJVA 5G2GA 3X40A 3F40A 5IW9A 1N8R4 4RNZA 1VQ53 3LTAA 3DMCA 2CW9A 3G713 3CC43 3Q2PA 3H3HA 3MPHA 3OWUA 3IPTA 3K5TA 3KZTA 2A15A 5BXQA 3K0ZA 2OOVC 2BNGA 3JUPA 1R4CA 3L0RA 1KD14 1YVBI 2OWPA 1QALA 2W9PA 3MG3A 3FLJA 4ZM8A 1QVF2 1OF5B 3DZLA 5AIIA 4OVMA 1O7WB 3OX9A 3PCSA 5D81A 3QK9A 2Q07A 2QEX3 3CCQ3 1NO3A 2RFRA 1W2ZA 3LXUX 2W56B 3K9MC 3SVAA 2YX9A 1Q864 2CFDA 1AVLA 3PS8A 2CKFB 4NHFA 3FSDA 4HVNA 3S27A 2HMNB 2KRTA 1SQWA 4K1VA 4HZBB 3NBBA 4KZ1A 5CLKA 2WGQA 2YFIB 2O3OA 5ELUA 3SXXA 2D1WA 3CNXA 1W5ZA 4LGQA 1UUVB 1RKYA 3JUOA 1JJ22 1WMPA 4BTYA 4R4KA 4EYCA 2XEPA 1UI7A 2OCTA 5CF2A 4HM3B 1OHSA 1IK3A 1IU7A 3N9HA 5KP3A 1QVG2 1EKMA 3EN8A 6STDA 1JNQA 1JB5A 4HKVB 2F86B 4LSOA 4L8OA 3RGRA 1CEWI 3JUMA 3HIGA 4IIAA 1RRLA 4N6OB 4XDVA 1YJW3 3NV0B 3OWYA 4WP5A 3S28A 4LEHA 1OHOA 1W2B2 1DMMA 3CMA3 3X3XA 1YIJ3 3EC9A 1Q824 1U8CB 5IEOA 2O9UX 5IG0A 1G96A 2FGTA 1KSIA 3D3LA 3V99A 3F7SA 1GYBA 1V74A 3K63A 2PNCA 2C10A 1J2BA 3ECFA 5DRVA 1FA3A 1A2VA 1W7CA 3LOYA 4R9KA 4KFDA 3CCS3 3NQYA 3S5CA 3BB9A 4K1UA 4K61A 5DREA 1WTHA 1K41A 4O8SA 3PZWA 3GWRA 2GEXA 4HM8B 2KCDA 3EE1A 4HM0B 3NHXA 1K28A 3OWSA 4J8TA 1W00A 2YFJB 1IQ8A 1QAFA 4RZMA 1KWIA 3EHCA 1NU3A 3EN1B 5CF1A 5IENA 2GBXB 1GD3A 4K90B 3LTCA 3CPW2 4WYKB 3AMOA 1STDA 1UW1A 1WNHA 4I4KA 1TU5A 3KFQC 1DVCA 3FF0A 2QGUA 4CDLA 1WMOA 1IVXA 1OUNA 1US1A 4XB5A 3CCE3 2STDA 2INXA 1JKGA 4HBRA 5HGRA 4N6TA 2BO9B 2CFWA 3JVCA 4IT7A 2P0MA 3OV4A 5AIHA 3SOAA 1ROVA 2CFGA 1KC84 2E2TA 1WQLB 4U13A 1PFPA 3RGAA 2QIYA 2R4IA 2Z77A 3BNCA 2I9WA 1LNHA 3FG1A 3FG4A 1IT7A 2HMMB 4MMXB 4AKZA 1YJ93 1MOLA 1N5PA 4KVHA 4X2OA 3HK4A 5AYRB 1TFOA 2OQEC 4H3UA 4WHAA 1A90A 4OUQA 3ER7A 4O2HA 2JDIH 3HZPA 1YI23 3FG3A 2HMOB 2JQ5A 1DMNA 4XDWA 4N6NB 1IQXA 4X2HA 3DY5A 1OF5A 3WA2X 3SOYA 3UB1A 3GZBA 1GY7A 1VZZA 2CG1A 3MKIA 4GB5A 1OH0A 3GZXB 4RNYA 3DGNA 4IPBA 2W56A 2E2UA 4MJDA 3G4S3 3EF8A 4XBYA 4MMYB 4BTWA 1DVDA 3BNDA 1W4NA 3VGNA 1N5HA 3CC73 2XGLA 7STDA 4HM1B 3U97A 5JPPA 2ZDJA 4EC6A 1FGTA 3FZWA 1Q814 1FUWA 3FH1A 2OTL3 5D82A 5AIFA 1IV9A 5I97A 1N9JA 4G1MB 2GEYA 3NXJA 2CC3A 1QMAA 2LQVA 2W03A 3N8BA 2FXTA 1ROAA 2V1LA 2XF3A 4FCZA 1O7HB 3F7XA 3CXC2 3STDA 3CCM3 3ALAA 2OTJ3 2CHCA 4WWUC 1SIHA 3WODG 1VQ83 3G8ZA 3UL5A 1IVUA 2C11A 1AV4A 1EQKA 2IUKA 1NJI4 1E97A 3NV0A 3JUNA 3BNEA 2XSOB 1U5OA 2P09A 1EA2A 2HMKB 1FGRA 3X3ZA 1VQN3 1ULJB 1VQ93 1SPUA 5FW5A 3BNBA 1A2KA 1MNLA 3NUVA 2HMJB 2GBWB 5IG4A 3PXMA 2RSXA 2M7OA 2BT3A 5AYSC 3M8CA 3H51A 1S723 3CCU3 3IMAB 4HM7B 3T8UA 1TFKA 1CQSA 3DGLA 2W04A 1HU9A 1NWWA 4GL6A 5STDA 5A0OB 2QA43 4MMZB 2SBLA 3V98A 1UI8A 2Z6BA 1IDPA 1OCVA 3FKAA 4ORLA 3PGBA 4BTXA 1NB3I 1W6YA 2WOFA 3Q90A 1WMNA 1VQ43 1VQL3 4Q53A 1Q40B 1YIT3 2ML5A 3CCR3 3N54B 3G16A 5IF6A 4FCMA 5AIGA 1D6ZA 4JRFA 3MYTA 2YFLB 1JN5B 1STFI 1CYUA 5LC7A 3HX8A 1K9M4 3EB8A 1FGQA 2B24B 4WYKA 4FMAA 3LYGA 1JN5A 5AEUB 3F9SA 1S5AA 1D6UA 4LZIA 4FCJA 1UUWB 3TDGA 1W01A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FGT A;  3BNE A;  3FG3 A;  1IK3 A;  1RRH A;  1FGR A;  3O8Y A;  2P0M A;  1JNQ A;  3D3L A;  3V99 A;  1NO3 A;  1ROV A;  4NRE A;  3DY5 A;  4QWT A;  3BNB A;  3V92 A;  3VF1 A;  1N8Q A;  3BNC A;  1FGM A;  1YGE A;  1LNH A;  3FG1 A;  3FG4 A;  1LOX A;  1FGO A;  1RRL A;  2FNQ A;  4WFO A;  1FGQ A;  3PZW A;  1F8N A;  2IUJ A;  1HU9 A;  3RDE A;  3BND A;  2IUK A;  5EEO A;  2SBL A;  3V98 A;  4WHA A;  1Y4K A; 
#chains in the Genus database with same CATH topology
 3BLZ A;  1EG9 B;  2XRX B;  4EBG A;  1NB5 I;  3LTD A;  3X42 A;  2MC8 A;  2GSP A;  3WOE B;  1JRQ A;  3AHW A;  3K7C A;  4N6V 0;  2RCD A;  5KP4 A;  1O7N B;  4N6M A;  1I0V A;  2XH9 A;  4N6U A;  2OOV A;  1AVK A;  2ZA4 A;  3GRD A;  2K0M A;  1Q42 A;  1JV2 B;  2OQE A;  1X1Y A;  4TX4 A;  1BUQ A;  5RNT A;  4RBN A;  3KE7 A;  1OAC A;  1E3V A;  2FNQ A;  1MGR A;  3S29 A;  1BSC A;  3KII A;  3NX0 A;  3BU4 A;  1FUS A;  5IG5 A;  1BNE A;  4N3V A;  1BSA A;  1QAK A;  2H0I A;  3IJE B;  3DXO A;  1BRH A;  2XFT A;  2CWV A;  1MWR A;  4JF8 A;  1R4Y A;  3FGY A;  1IV7 A;  3GAX A;  2Z7A A;  2PZV A;  1UGH I;  3LT8 A;  2Y74 A;  3B4O A;  3GZR A;  1B2Z A;  2GU1 A;  3X41 A;  3F8H A;  1UDI I;  2L1S A;  1UGI A;  2H0G A;  1AQZ A;  1MWS A;  4CCV A;  3DGO A;  1YHQ 3;  4AEQ A;  4R1K A;  3GZY B;  2CWT A;  4AKY A;  2W9Q A;  1VQ6 3;  1DYU A;  1LOY A;  3URP A;  1T2I A;  3T8N A;  5FGO A;  1FGO A;  4J5K A;  4HM4 B;  3VSY A;  5BIR A;  1TUH A;  1VQM 3;  1M9G A;  1LNI A;  1O7P B;  1LOW A;  1D6Y A;  1HKX A;  3D79 A;  3LT9 A;  3CD6 3;  3ROB A;  2GXF A;  2CH9 A;  5LC6 A;  1RGA A;  3WR2 A;  4O3V A;  1GS3 A;  3B8L A;  3CC2 3;  1AY7 A;  3NBJ A;  1OHP A;  3MWZ A;  1OGX A;  1B2X A;  1RLS A;  2CG0 A;  1VQP 3;  4L7K A;  4HM2 B;  1W6G A;  1VQO 3;  3CCV 3;  4HJL B;  3O8Y A;  5M1A A;  2E2V A;  4XBX A;  1O7M B;  1MWU A;  1UCL A;  2UX0 A;  1JBR A;  4R80 A;  1RGF A;  3DM8 A;  1ULI B;  1I8V A;  3NM7 A;  4N6L A;  3CNM A;  1DMQ A;  1JB2 A;  1TP6 A;  4MEI A;  2F56 A;  3MHE A;  3CME 3;  1M1X B;  3WOF B;  2F5M A;  1TRP A;  2ZL8 A;  4STD A;  5EQL A;  1ZO2 A;  4EV2 A;  5M18 A;  4FMC A;  1BIR A;  1YJN 3;  1FUT A;  2B1X B;  4CJN A;  1L5G B;  1BSB A;  2IUJ A;  1GOU A;  1I70 A;  3PYJ A;  2IA7 A;  3HOH A;  1JB4 A;  4HM5 B;  3HII A;  5BVB A;  1LVN A;  1GY6 A;  1YNV X;  2BU4 A;  2HML B;  3LTB A;  5CK6 A;  3WMD A;  1Q7Y 4;  1Z1S A;  3EBT A;  5G1K A;  2WGO A;  3FCS B;  5HOH A;  1AR0 A;  3OW2 2;  1Y4K A;  1K73 4;  4O02 B;  1SII A;  3D9R A;  3I55 3;  1V58 A;  1GOY A;  3SX1 A;  3F14 A;  1OPY A;  3DGM A;  4HOH A;  2H0H A;  1VQ7 3;  3X3Y A;  4EV5 A;  3DH2 A;  3MSO A;  3PCR A;  1YGW A;  3MG2 A;  5JBS A;  1KQS 2;  3HI7 A;  3LML A;  7RNT A;  1N8Q A;  1IVV A;  2P38 A;  2RGQ A;  1LOX A;  2BIR A;  2KF4 A;  1BNJ A;  3G0K A;  2MF7 A;  3D5G A;  2P05 A;  4L8P A;  2ML6 A;  2BMR B;  5IER A;  2D42 A;  2GU3 A;  4XBT A;  5TGN A;  2BMQ B;  3RDE A;  1E3R A;  2W6J H;  1I2F A;  1ASK A;  2XSH B;  1IVW A;  1TIJ A;  4LMI A;  1M90 4;  1K8A 4;  4HM6 B;  1I2E A;  1BU4 A;  3Q1C A;  3WA3 A;  1A67 A;  3UJM A;  4KFE A;  5EVH A;  1I0X A;  4FR9 A;  1BNS A;  1BRS A;  2K3D A;  1HYF A;  3MG1 A;  1RGC A;  3EX9 A;  3E99 A;  4NRE A;  3F8X A;  5ELJ A;  2K54 A;  5D83 A;  1RN7 A;  3KKG A;  2AAD A;  1CH0 A;  3VF1 A;  5CXO A;  3A76 A;  3DGY A;  4FMD A;  4BL2 A;  1M1K 4;  1FGM A;  1YGE A;  1Q40 A;  1V57 A;  2BHM A;  2BMO B;  3B4P A;  3KN4 A;  4R9L A;  2XGN A;  1I3I A;  4WFO A;  1HZ1 A;  2CWU A;  3CPO A;  4HZ9 B;  3U1W A;  4LYL B;  4J9A A;  3CCJ 3;  3FF2 A;  1GMR A;  3SLU A;  1MGW A;  5AEW B;  5EEO A;  1RJO A;  1IQY A;  2WO0 A;  2Y73 A;  3EQQ B;  1W02 A;  2IMJ A;  4HAA A;  3B7C A;  1ZS7 A;  2F99 A;  5JPU A;  1GD4 A;  2F98 A;  4OK0 A;  3J7Y d;  1O7G B;  3I56 3;  1ZX2 A;  3JUQ A;  4HYZ A;  5IG3 A;  1BNR A;  2Z76 A;  1LRA A;  2LYX A;  3LH4 A;  4H61 A;  1RRH A;  3G6E 3;  1OGZ A;  4PEJ A;  1RN1 A;  3CCL 3;  3AMO B;  1A2P A;  3KSP A;  3LZA A;  3DUK A;  1IT8 A;  3T0U A;  1G02 A;  3QRD A;  1B2M A;  3V92 A;  3UNL A;  1TTO A;  1VQK 3;  4XM4 A;  1LXE A;  4RNT A;  4KFF A;  1N9E A;  1W6C A;  2W0Q A;  3EBY A;  1GY5 A;  3UL6 A;  2WOH A;  5IEP A;  3WDG B;  1SJW A;  1F8N A;  1JKG B;  4EXR A;  1ISK A;  1LOV A;  1BNF A;  1T3B A;  1EEJ A;  1G0T A;  2CIU A;  3NBR A;  4FMB A;  8CHO A;  3SED A;  1CYV A;  1IYY A;  1PU4 A;  2KF6 A;  3S67 A;  3OXA A;  2XFS A;  1C7H A;  3KSE D;  3NQZ A;  1TRQ A;  4J5G A;  5KP1 A;  3CU3 A;  2CFK A;  2KXG A;  1T5Y A;  2CK3 H;  1NDO B;  1QJG A;  1TJD A;  3I0Y A;  2P0X A;  1X1U A;  2W2C A;  5AI1 A;  3NM2 A;  2XR8 B;  2CFL A;  4QWT A;  2L4V A;  1BSE A;  3EJV A;  5G2G A;  3X40 A;  3F40 A;  5IW9 A;  1N8R 4;  4RNZ A;  1VQ5 3;  3LTA A;  3DMC A;  2CW9 A;  3G71 3;  3CC4 3;  3Q2P A;  3H3H A;  3MPH A;  3OWU A;  3IPT A;  3K5T A;  2KF3 A;  2A15 A;  3KZT A;  5BXQ A;  3K0Z A;  2OOV C;  2BNG A;  1UUG B;  4CPK A;  1JZD A;  3JUP A;  4NPB A;  1B2U A;  6RNT A;  2KAA A;  1R4C A;  3L0R A;  1KD1 4;  1RCL A;  1YVB I;  1RNT A;  2OWP A;  1QAL A;  2W9P A;  3MG3 A;  3FLJ A;  1PYL A;  4ZM8 A;  1QVF 2;  1OF5 B;  1JZO A;  3DZL A;  3KCH A;  4OVM A;  5AII A;  1O7W B;  3OX9 A;  3PCS A;  5D81 A;  1BRN L;  3QK9 A;  2Q07 A;  2QEX 3;  3CCQ 3;  3GSP A;  1NO3 A;  2RFR A;  1W2Z A;  3LXU X;  2W56 B;  3K9M C;  1PY3 A;  3SVA A;  4BL3 A;  2YX9 A;  1Q86 4;  2CFD A;  1GMP A;  1AVL A;  3PS8 A;  2AAE A;  2CKF B;  4NHF A;  3FSD A;  4HVN A;  3S27 A;  2HMN B;  2KRT A;  1SQW A;  4K1V A;  4HZB B;  2SAR A;  3NBB A;  4KZ1 A;  5CLK A;  2WGQ A;  2YFI B;  2O3O A;  5ELU A;  3SXX A;  2D1W A;  3ZG5 A;  3CNX A;  1RGH A;  1W5Z A;  4LGQ A;  1BRJ A;  1UUV B;  1RKY A;  3JUO A;  1JJ2 2;  1WMP A;  1B2S A;  4BTY A;  4R4K A;  4EYC A;  2XEP A;  1UI7 A;  2OCT A;  5CF2 A;  4HM3 B;  1BAO A;  1IK3 A;  1IU7 A;  1OHS A;  3N9H A;  5KP3 A;  1RMS A;  1Q7H A;  1QVG 2;  1EKM A;  3EN8 A;  6STD A;  1JNQ A;  2IYJ A;  1JB5 A;  4HKV B;  2F86 B;  4LSO A;  1BSD A;  4I5Q A;  4L8O A;  3RNT A;  2F5W A;  3RGR A;  1CEW I;  3JUM A;  3HIG A;  4IIA A;  1RRL A;  4N6O B;  4XDV A;  1YJW 3;  3NV0 B;  1B3S A;  5GSP A;  1RGK A;  3OWY A;  4WP5 A;  3S28 A;  4LEH A;  1BRG A;  3ZFZ A;  1UCI A;  1OHO A;  1W2B 2;  1DMM A;  4KT3 B;  1BUJ A;  3CMA 3;  3X3X A;  1YIJ 3;  3EC9 A;  1Q82 4;  1U8C B;  2UUG C;  5IEO A;  2O9U X;  4ILF A;  5IG0 A;  1G96 A;  1I2G A;  1LQG C;  2FGT A;  1KSI A;  3D3L A;  3V99 A;  3F7S A;  1GYB A;  1V74 A;  3K63 A;  2PNC A;  2C10 A;  1BRI A;  1J2B A;  3ECF A;  5DRV A;  1FA3 A;  1A2V A;  1W7C A;  3LOY A;  4R9K A;  4KFD A;  3CCS 3;  3NQY A;  1GMQ A;  3S5C A;  1BAN A;  3BB9 A;  4K1U A;  4K61 A;  2CX1 A;  5DRE A;  1WTH A;  1K41 A;  4O8S A;  3PZW A;  3GWR A;  2GEX A;  4HM8 B;  2KCD A;  3EE1 A;  4HM0 B;  3NHX A;  1B21 A;  1K28 A;  3OWS A;  4J8T A;  1W00 A;  2YFJ B;  1RHL A;  1IQ8 A;  2UGI A;  1QAF A;  4RZM A;  1KWI A;  3EHC A;  1NU3 A;  2KF5 A;  3EN1 B;  5CF1 A;  1RGL A;  5IEN A;  2GBX B;  1GD3 A;  4K90 B;  3LTC A;  3CPW 2;  4WYK B;  3AMO A;  1STD A;  1UW1 A;  1WNH A;  4I4K A;  3BIR A;  1TU5 A;  1JBT A;  3KFQ C;  1DVC A;  3FF0 A;  2QGU A;  4CDL A;  1WMO A;  3AGN A;  1IVX A;  1OUN A;  1US1 A;  4XB5 A;  4DKI A;  3CCE 3;  2STD A;  2INX A;  2C4B A;  1JKG A;  4HBR A;  5HGR A;  1EUI C;  4N6T A;  3SYU A;  2BO9 B;  2CFW A;  3JVC A;  2F4Y A;  1GSP A;  4IT7 A;  2P0M A;  3OV4 A;  1B27 A;  5AIH A;  3SOA A;  1ROV A;  2CFG A;  1KC8 4;  1LQM B;  1X1W A;  1WQL B;  2E2T A;  4U13 A;  1PFP A;  3RGA A;  4BU4 A;  2QIY A;  2R4I A;  2Z77 A;  3BNC A;  2I9W A;  1LNH A;  3FG1 A;  3FG4 A;  1IT7 A;  2HMM B;  4MMX B;  4AKZ A;  1YJ9 3;  1Q9E A;  1MOL A;  1N5P A;  1I3F A;  4KVH A;  3HK4 A;  4X2O A;  5AYR B;  3A5E A;  1TFO A;  2OQE C;  4H3U A;  3WHO A;  4WHA A;  1A90 A;  3Q3F A;  4OUQ A;  3ER7 A;  1RSN A;  2R41 A;  2JDI H;  3HZP A;  3D4A A;  4O2H A;  3FG3 A;  1YI2 3;  1BGS A;  2HMO B;  2JQ5 A;  1DMN A;  2J8X B;  1FZU A;  4XDW A;  4N6N B;  1IQX A;  4X2H A;  3DY5 A;  1OF5 A;  3WA2 X;  3SOY A;  3UB1 A;  2ZHX B;  3GZB A;  1GY7 A;  1VZZ A;  2RBI A;  1UCK A;  2CG1 A;  3MKI A;  4GB5 A;  1OH0 A;  3GZX B;  4RNY A;  1DE3 A;  3DGN A;  3AGO A;  2W56 A;  4IPB A;  9RNT A;  2E2U A;  4MJD A;  3G4S 3;  3EF8 A;  1RDS A;  4XBY A;  4MMY B;  4BTW A;  1DVD A;  3BND A;  1W4N A;  2HOH A;  1N5H A;  3VGN A;  3CC7 3;  3ZG0 A;  2XGL A;  4BIR A;  7STD A;  4HM1 B;  3U97 A;  5JPP A;  1JBS A;  1C54 A;  2ZDJ A;  4EC6 A;  1FGT A;  3FZW A;  1MWT A;  1Q81 4;  1FUW A;  3FH1 A;  2OTL 3;  5D82 A;  1SAR A;  5AIF A;  1IV9 A;  5I97 A;  1N9J A;  1RNB A;  4G1M B;  2GEY A;  3NXJ A;  2CC3 A;  1QMA A;  2LQV A;  2W03 A;  3N8B A;  2FXT A;  3D5I A;  1ROA A;  2V1L A;  2XF3 A;  1UCJ A;  4FCZ A;  1O7H B;  3F7X A;  3CXC 2;  1RTU A;  2RNT A;  3STD A;  8RNT A;  3ALA A;  3CCM 3;  2OTJ 3;  2CHC A;  4WWU C;  1SIH A;  3WOD G;  1VQ8 3;  3G8Z A;  3UL5 A;  1IVU A;  2C11 A;  1AV4 A;  1EQK A;  2IUK A;  1NJI 4;  1E97 A;  1RCK A;  1RGG A;  3NV0 A;  1B20 A;  3JUN A;  6GSP A;  3BNE A;  1DET A;  2XSO B;  1U5O A;  1BVI A;  2P09 A;  5G1L A;  1EA2 A;  2HMK B;  1FGR A;  3X3Z A;  1VQN 3;  1FW7 A;  1BRK A;  1ULJ B;  1VQ9 3;  1RGE A;  1SPU A;  5FW5 A;  3BNB A;  1A2K A;  1MNL A;  3NUV A;  2HMJ B;  2GBW B;  5IG4 A;  3PXM A;  2RSX A;  2M7O A;  1X1X A;  1YVS A;  2BT3 A;  4GHO A;  5AYS C;  3M8C A;  5M19 A;  1BNG A;  3H51 A;  4GSP A;  1S72 3;  5BU4 A;  3IMA B;  3CCU 3;  4HM7 B;  3T8U A;  1TFK A;  1CQS A;  1GOV A;  2W04 A;  1HU9 A;  1NWW A;  3DGL A;  4GL6 A;  5STD A;  5A0O B;  2QA4 3;  4MMZ B;  1FYS A;  2SBL A;  3V98 A;  1UI8 A;  2Z6B A;  1IDP A;  1OCV A;  3FKA A;  1VQQ A;  4ORL A;  3PGB A;  4BTX A;  1NB3 I;  1W6Y A;  2WOF A;  3Q90 A;  1RN4 A;  1NNV A;  1BNI A;  1WMN A;  1VQ4 3;  1VQL 3;  4Q53 A;  3AHS A;  1Q40 B;  1YIT 3;  2ML5 A;  1ZGX A;  3N54 B;  3CCR 3;  4EW5 A;  1BOX A;  3G16 A;  5IF6 A;  2IY2 A;  4FCM A;  5AIG A;  1D6Z A;  4JRF A;  3MYT A;  2YFL B;  1JN5 B;  1STF I;  1CYU A;  5LC7 A;  3HX8 A;  1K9M 4;  1T2H A;  3EB8 A;  1FGQ A;  2B24 B;  4WYK A;  4FMA A;  3LYG A;  1JN5 A;  2CX0 A;  5AEU B;  3F9S A;  1S5A A;  1D6U A;  4LZI A;  7GSP A;  4FCJ A;  1UUW B;  3TDG A;  1W01 A; 
#chains in the Genus database with same CATH homology
 3BLZ A;  1EG9 B;  2XRX B;  4EBG A;  1NB5 I;  3LTD A;  3X42 A;  2MC8 A;  3WOE B;  1JRQ A;  3K7C A;  4N6V 0;  2RCD A;  5KP4 A;  1O7N B;  4N6M A;  2XH9 A;  4N6U A;  2OOV A;  1AVK A;  3GRD A;  2K0M A;  1Q42 A;  1JV2 B;  2OQE A;  4TX4 A;  1BUQ A;  4RBN A;  3KE7 A;  1OAC A;  1E3V A;  2FNQ A;  3S29 A;  3KII A;  3NX0 A;  5IG5 A;  4N3V A;  1QAK A;  3IJE B;  3DXO A;  2XFT A;  2CWV A;  4JF8 A;  3FGY A;  1IV7 A;  3GAX A;  2Z7A A;  2PZV A;  3LT8 A;  2Y74 A;  3B4O A;  3GZR A;  2GU1 A;  3X41 A;  3F8H A;  4CCV A;  3DGO A;  1YHQ 3;  4AEQ A;  4R1K A;  3GZY B;  2CWT A;  4AKY A;  2W9Q A;  1VQ6 3;  1DYU A;  3T8N A;  5FGO A;  1FGO A;  3VSY A;  4HM4 B;  1TUH A;  1VQM 3;  1M9G A;  1O7P B;  1D6Y A;  1HKX A;  3LT9 A;  3CD6 3;  3ROB A;  2GXF A;  2CH9 A;  5LC6 A;  4O3V A;  1GS3 A;  3B8L A;  3CC2 3;  3NBJ A;  1OHP A;  3MWZ A;  1OGX A;  2CG0 A;  1VQP 3;  4L7K A;  4HM2 B;  1W6G A;  1VQO 3;  3CCV 3;  4HJL B;  3O8Y A;  2E2V A;  4XBX A;  1O7M B;  2UX0 A;  4R80 A;  3DM8 A;  1ULI B;  3NM7 A;  4N6L A;  3CNM A;  1DMQ A;  1JB2 A;  1TP6 A;  4MEI A;  3MHE A;  3CME 3;  1M1X B;  3WOF B;  2ZL8 A;  4STD A;  5EQL A;  1ZO2 A;  4EV2 A;  4FMC A;  1YJN 3;  2B1X B;  1L5G B;  2IUJ A;  3PYJ A;  2IA7 A;  1JB4 A;  4HM5 B;  3HII A;  5BVB A;  1LVN A;  1GY6 A;  2HML B;  5CK6 A;  3WMD A;  3LTB A;  1Q7Y 4;  1Z1S A;  3EBT A;  3OW2 2;  2WGO A;  3FCS B;  1AR0 A;  1Y4K A;  1K73 4;  4O02 B;  1SII A;  3D9R A;  3I55 3;  3SX1 A;  3F14 A;  1OPY A;  3DGM A;  1VQ7 3;  3X3Y A;  4EV5 A;  3MSO A;  3PCR A;  3MG2 A;  5JBS A;  1KQS 2;  3HI7 A;  3LML A;  1N8Q A;  1IVV A;  2P38 A;  2RGQ A;  1LOX A;  3G0K A;  2MF7 A;  2P05 A;  4L8P A;  2ML6 A;  2BMR B;  5IER A;  2D42 A;  2GU3 A;  4XBT A;  5TGN A;  2BMQ B;  3RDE A;  1E3R A;  2W6J H;  1ASK A;  2XSH B;  1IVW A;  1TIJ A;  4LMI A;  1M90 4;  1K8A 4;  4HM6 B;  3Q1C A;  3WA3 A;  1A67 A;  3UJM A;  4KFE A;  5EVH A;  4FR9 A;  3MG1 A;  3EX9 A;  3E99 A;  4NRE A;  3F8X A;  5ELJ A;  2K54 A;  5D83 A;  1RN7 A;  3KKG A;  3VF1 A;  5CXO A;  3A76 A;  1M1K 4;  4FMD A;  1FGM A;  1YGE A;  1Q40 A;  2BHM A;  2BMO B;  3KN4 A;  3B4P A;  4R9L A;  2XGN A;  4WFO A;  2CWU A;  3CPO A;  4HZ9 B;  3U1W A;  4J9A A;  3CCJ 3;  3FF2 A;  3SLU A;  5AEW B;  5EEO A;  1RJO A;  1IQY A;  2WO0 A;  2Y73 A;  3EQQ B;  1W02 A;  2IMJ A;  3B7C A;  2F99 A;  5JPU A;  1GD4 A;  2F98 A;  4OK0 A;  3J7Y d;  1O7G B;  3I56 3;  1ZX2 A;  3JUQ A;  4HYZ A;  5IG3 A;  2Z76 A;  3LH4 A;  2LYX A;  4H61 A;  1RRH A;  3G6E 3;  1OGZ A;  4PEJ A;  3CCL 3;  3AMO B;  3KSP A;  3LZA A;  3DUK A;  1IT8 A;  3T0U A;  3QRD A;  3V92 A;  3UNL A;  1VQK 3;  4XM4 A;  1LXE A;  4KFF A;  1N9E A;  1W6C A;  2W0Q A;  3EBY A;  1GY5 A;  3UL6 A;  2WOH A;  5IEP A;  3WDG B;  1SJW A;  1F8N A;  1JKG B;  4EXR A;  1ISK A;  2CIU A;  3NBR A;  4FMB A;  8CHO A;  3SED A;  1CYV A;  1PU4 A;  3S67 A;  3OXA A;  2XFS A;  1C7H A;  3KSE D;  3NQZ A;  5KP1 A;  3CU3 A;  2CFK A;  2KXG A;  1T5Y A;  2CK3 H;  1NDO B;  1QJG A;  5AI1 A;  3I0Y A;  2P0X A;  2W2C A;  3NM2 A;  2XR8 B;  2CFL A;  4QWT A;  2L4V A;  3EJV A;  5G2G A;  3X40 A;  3F40 A;  5IW9 A;  1N8R 4;  4RNZ A;  1VQ5 3;  3LTA A;  3DMC A;  2CW9 A;  3G71 3;  3CC4 3;  3Q2P A;  3H3H A;  3MPH A;  3OWU A;  3IPT A;  3K5T A;  3KZT A;  2A15 A;  5BXQ A;  3K0Z A;  2OOV C;  2BNG A;  3JUP A;  1R4C A;  3L0R A;  1KD1 4;  1YVB I;  2OWP A;  1QAL A;  2W9P A;  3MG3 A;  3FLJ A;  4ZM8 A;  1QVF 2;  1OF5 B;  3DZL A;  5AII A;  4OVM A;  1O7W B;  3OX9 A;  3PCS A;  5D81 A;  3QK9 A;  2Q07 A;  2QEX 3;  3CCQ 3;  1NO3 A;  2RFR A;  1W2Z A;  3LXU X;  2W56 B;  3K9M C;  3SVA A;  2YX9 A;  1Q86 4;  2CFD A;  1AVL A;  3PS8 A;  2CKF B;  4NHF A;  3FSD A;  4HVN A;  3S27 A;  2HMN B;  2KRT A;  1SQW A;  4K1V A;  4HZB B;  3NBB A;  4KZ1 A;  5CLK A;  2WGQ A;  2YFI B;  2O3O A;  5ELU A;  3SXX A;  2D1W A;  3CNX A;  1W5Z A;  4LGQ A;  1UUV B;  1RKY A;  3JUO A;  1JJ2 2;  1WMP A;  4BTY A;  4R4K A;  4EYC A;  2XEP A;  1UI7 A;  2OCT A;  5CF2 A;  4HM3 B;  1OHS A;  1IK3 A;  1IU7 A;  3N9H A;  5KP3 A;  1QVG 2;  1EKM A;  3EN8 A;  6STD A;  1JNQ A;  1JB5 A;  4HKV B;  2F86 B;  4LSO A;  4L8O A;  3RGR A;  1CEW I;  3JUM A;  3HIG A;  4IIA A;  1RRL A;  4N6O B;  4XDV A;  1YJW 3;  3NV0 B;  3OWY A;  4WP5 A;  3S28 A;  4LEH A;  1OHO A;  1W2B 2;  1DMM A;  3CMA 3;  3X3X A;  1YIJ 3;  3EC9 A;  1Q82 4;  1U8C B;  5IEO A;  2O9U X;  5IG0 A;  1G96 A;  2FGT A;  1KSI A;  3D3L A;  3V99 A;  3F7S A;  1GYB A;  1V74 A;  3K63 A;  2PNC A;  2C10 A;  1J2B A;  3ECF A;  5DRV A;  1FA3 A;  1A2V A;  1W7C A;  3LOY A;  4R9K A;  4KFD A;  3CCS 3;  3NQY A;  3S5C A;  3BB9 A;  4K1U A;  4K61 A;  5DRE A;  1WTH A;  1K41 A;  4O8S A;  3PZW A;  3GWR A;  2GEX A;  4HM8 B;  2KCD A;  3EE1 A;  4HM0 B;  3NHX A;  1K28 A;  3OWS A;  4J8T A;  1W00 A;  2YFJ B;  1IQ8 A;  1QAF A;  4RZM A;  1KWI A;  3EHC A;  1NU3 A;  3EN1 B;  5CF1 A;  5IEN A;  2GBX B;  1GD3 A;  4K90 B;  3LTC A;  3CPW 2;  4WYK B;  3AMO A;  1STD A;  1UW1 A;  1WNH A;  4I4K A;  1TU5 A;  3KFQ C;  1DVC A;  3FF0 A;  2QGU A;  4CDL A;  1WMO A;  1IVX A;  1OUN A;  1US1 A;  4XB5 A;  3CCE 3;  2STD A;  2INX A;  1JKG A;  4HBR A;  5HGR A;  4N6T A;  2BO9 B;  2CFW A;  3JVC A;  4IT7 A;  2P0M A;  3OV4 A;  5AIH A;  3SOA A;  1ROV A;  2CFG A;  1KC8 4;  2E2T A;  1WQL B;  4U13 A;  1PFP A;  3RGA A;  2QIY A;  2R4I A;  2Z77 A;  3BNC A;  2I9W A;  1LNH A;  3FG1 A;  3FG4 A;  1IT7 A;  2HMM B;  4MMX B;  4AKZ A;  1YJ9 3;  1MOL A;  1N5P A;  4KVH A;  4X2O A;  3HK4 A;  5AYR B;  1TFO A;  2OQE C;  4H3U A;  4WHA A;  1A90 A;  4OUQ A;  3ER7 A;  4O2H A;  2JDI H;  3HZP A;  1YI2 3;  3FG3 A;  2HMO B;  2JQ5 A;  1DMN A;  4XDW A;  4N6N B;  1IQX A;  4X2H A;  3DY5 A;  1OF5 A;  3WA2 X;  3SOY A;  3UB1 A;  3GZB A;  1GY7 A;  1VZZ A;  2CG1 A;  3MKI A;  4GB5 A;  1OH0 A;  3GZX B;  4RNY A;  3DGN A;  4IPB A;  2W56 A;  2E2U A;  4MJD A;  3G4S 3;  3EF8 A;  4XBY A;  4MMY B;  4BTW A;  1DVD A;  3BND A;  1W4N A;  3VGN A;  1N5H A;  3CC7 3;  2XGL A;  7STD A;  4HM1 B;  3U97 A;  5JPP A;  2ZDJ A;  4EC6 A;  1FGT A;  3FZW A;  1Q81 4;  1FUW A;  3FH1 A;  2OTL 3;  5D82 A;  5AIF A;  1IV9 A;  5I97 A;  1N9J A;  4G1M B;  2GEY A;  3NXJ A;  2CC3 A;  1QMA A;  2LQV A;  2W03 A;  3N8B A;  2FXT A;  1ROA A;  2V1L A;  2XF3 A;  4FCZ A;  1O7H B;  3F7X A;  3CXC 2;  3STD A;  3CCM 3;  3ALA A;  2OTJ 3;  2CHC A;  4WWU C;  1SIH A;  3WOD G;  1VQ8 3;  3G8Z A;  3UL5 A;  1IVU A;  2C11 A;  1AV4 A;  1EQK A;  2IUK A;  1NJI 4;  1E97 A;  3NV0 A;  3JUN A;  3BNE A;  2XSO B;  1U5O A;  2P09 A;  1EA2 A;  2HMK B;  1FGR A;  3X3Z A;  1VQN 3;  1ULJ B;  1VQ9 3;  1SPU A;  5FW5 A;  3BNB A;  1A2K A;  1MNL A;  3NUV A;  2HMJ B;  2GBW B;  5IG4 A;  3PXM A;  2RSX A;  2M7O A;  2BT3 A;  5AYS C;  3M8C A;  3H51 A;  1S72 3;  3CCU 3;  3IMA B;  4HM7 B;  3T8U A;  1TFK A;  1CQS A;  3DGL A;  2W04 A;  1HU9 A;  1NWW A;  4GL6 A;  5STD A;  5A0O B;  2QA4 3;  4MMZ B;  2SBL A;  3V98 A;  1UI8 A;  2Z6B A;  1IDP A;  1OCV A;  3FKA A;  4ORL A;  3PGB A;  4BTX A;  1NB3 I;  1W6Y A;  2WOF A;  3Q90 A;  1WMN A;  1VQ4 3;  1VQL 3;  4Q53 A;  1Q40 B;  1YIT 3;  2ML5 A;  3CCR 3;  3N54 B;  3G16 A;  5IF6 A;  4FCM A;  5AIG A;  1D6Z A;  4JRF A;  3MYT A;  2YFL B;  1JN5 B;  1STF I;  1CYU A;  5LC7 A;  3HX8 A;  1K9M 4;  3EB8 A;  1FGQ A;  2B24 B;  4WYK A;  4FMA A;  3LYG A;  1JN5 A;  5AEU B;  3F9S A;  1S5A A;  1D6U A;  4LZI A;  4FCJ A;  1UUW B;  3TDG A;  1W01 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...