3EHCA

Crystal structure of a snoal-like polyketide cyclase (atu3018) from agrobacterium tumefaciens str. c58 at 2.12 a resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
127
structure length
127
Chain Sequence
MQTLNDIYLAYLDSLNHQAFDELGTFVDDNVEHNGRPFGLSGYRDMLVKDFADIPDLRFEAEILVSDATRLAARLFFDCTPKSIFMDLPVNGRRVQFCEHVFYDFEQAKIRRVWSVLDKVAIERQLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of SnoaL-like polyketide cyclase (17741376) from AGROBACTERIUM TUMEFACIENS str. C58 (Dupont) at 2.12 A resolution
rcsb
source organism Agrobacterium tumefaciens str. c58
molecule tags Unknown function
molecule keywords SnoaL-like polyketide cyclase
total genus 38
structure length 127
sequence length 127
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07366 SnoaL SnoaL-like polyketide cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ehcA00
5IG5A 1E3VA 2Z77A 3GZXB 5JPUA 1OUNA 3H3HA 4GB5A 2CHCA 1DMMA 5IG3A 4Q53A 1GY7A 1QMAA 2HMLB 3OWUA 3FKAA 1ULJB 1EA2A 1NDOB 3MKIA 4R1KA 1Q40B 1ULIB 1W01A 2GEYA 2RCDA 1OPYA 3F40A 3F7XA 1W6YA 2W2CA 1UUWB 4IIAA 4XB5A 1OGZA 1OGXA 1JB4A 3EC9A 4HVNA 3UJMA 5KP1A 4J8TA 5TGNA 4HM2B 3SEDA 5IF6A 1EG9B 2IMJA 4WP5A 5BVBA 1OH0A 3I0YA 4L7KA 3S5CA 1TP6A 2INXA 3CPOA 3JUMA 5AIIA 4J9AA 4WWUC 4RZMA 1TUHA 1U5OA 2XRXB 3D9RA 4CDLA 3ECFA 3GRDA 1JKGA 3JUOA 5IEOA 3EHCA 2HMKB 4I4KA 4XBTA 3MHEA 1CQSA 5CK6A 1OHPA 3B4PA 4HM5B 1GY5A 4L8OA 4L8PA 4OUQA 4X2OA 5CXOA 4HM1B 1O7HB 3DMCA 1WQLB 3DUKA 5IERA 1OF5B 1SJWA 4HJLB 1UUVB 3NUVA 5D82A 3F14A 2GBXB 3SOYA 4WYKB 1JB5A 5HGRA 4HKVB 4XBYA 4R9KA 1JN5B 5CLKA 1E97A 2YFIB 5FW5A 1C7HA 3EQQB 2RGQA 1NWWA 3JUQA 3OWYA 3ER7A 2YFJB 4HM4B 3FH1A 4LEHA 3H51A 4XBXA 1Z1SA 3G8ZA 3DZLA 2PZVA 3KZTA 4OVMA 5D81A 3MYTA 5KP3A 5CF1A 3T8UA 2GXFA 4FCJA 2RFRA 4HM6B 3B8LA 3MG3A 2BMRB 2B24B 5G2GA 1OHSA 3GWRA 3OX9A 3GZBA 3SOAA 2F86B 3OV4A 1ISKA 1O7PB 2GBWB 5BXQA 2YFLB 1ZX2A 1IDPA 3Q90A 4HZBB 4STDA 2STDA 3RGAA 3F7SA 4KVHA 1DMQA 4R9LA 4PEJA 3BLZA 3FSDA 3FF2A 4H3UA 4LGQA 3EN8A 3KE7A 3LZAA 3G0KA 4MJDA 3EBTA 3T8NA 3OWSA 1E3RA 7STDA 3HX8A 2HMJB 4XDWA 2XSOB 4HM3B 2Z7AA 3EBYA 5IEPA 3F8HA 4K1VA 3NV0A 5DRVA 3MG2A 2B1XB 1GS3A 1NU3A 2BMQB 3CNMA 1VZZA 2CKFB 2HMNB 3E99A 3NBRA 1O7WB 5AIGA 5AIHA 1A2KA 2Z76A 1O7MB 3FGYA 1OHOA 4HM0B 5CF2A 5JPPA 3B7CA 3EX9A 3K0ZA 3FF0A 4XM4A 1K41A 3FLJA 2A15A 4WYKA 1W00A 3G16A 1Q40A 1W02A 3FZWA 1ZO2A 3M8CA 1ASKA 3KKGA 3IPTA 2I9WA 1O7GB 4LMIA 5IENA 2F99A 4XDVA 1BUQA 5AI1A 1AR0A 3ROBA 4U13A 3HK4A 3DM8A 2HMOB 4HZ9B 3BB9A 1JB2A 3F9SA 2GEXA 4FCMA 3F8XA 4N3VA 2OWPA 5AIFA 2XR8B 1HKXA 6STDA 5IG0A 3MG1A 5AEUB 3B4OA 3EF8A 2R4IA 3GZYB 3JUNA 1JKGB 2JQ5A 2QGUA 3K7CA 2BMOB 2HMMB 3MSOA 3UNLA 5KP4A 5D83A 2XSHB 2QIYA 5IG4A 5DREA 3A76A 1GY6A 3CNXA 4K1UA 1DMNA 1O7NB 3JUPA 1GYBA 1OF5A 3EJVA 3NM2A 4HM8B 4X2HA 3EN1B 4ORLA 5STDA 2F98A 3RGRA 5AEWB 3NXJA 8CHOA 1Q42A 3STDA 3KSPA 1STDA 3LYGA 3NHXA 3NV0B 3HZPA 1OCVA 2K54A 1JN5A 4HM7B 1S5AA 3VGNA 3CU3A 2UX0A 2BNGA 3DXOA 5EVHA 3VSYA 3WMDA 3GZRA 3OXAA 1QJGA
chains in the Genus database with same CATH superfamily
2O3OA 1OUNA 4GB5A 2CG0A 3BNDA 3D3LA 1GY7A 2HMLB 1UCLA 1K8A4 1ULJB 1CYUA 2Q07A 3D5IA 1C54A 5M19A 3PXMA 4R1KA 1FGMA 1W01A 1BSBA 4H61A 3SXXA 5AYRB 2C11A 3CCQ3 1W6YA 2W2CA 1UCKA 1UUWB 1FA3A 1OGZA 1LRAA 5KP1A 1D6ZA 1LOXA 2BHMA 5JBSA 1OH0A 2ZA4A 3I0YA 4IPBA 1TU5A 1QALA 4JRFA 1X1UA 2OQEA 4CDLA 4N6MA 1LQMB 3LT9A 1A2PA 1FGQA 5AIFA 1OHPA 5FW5A 4L8PA 1BSCA 5CXOA 1VQ63 4JF8A 2H0HA 3AMOB 1SJWA 1IV9A 1UDII 3NUVA 3OW22 1N9JA 1Q824 4GSPA 2CFDA 1YHQ3 2PNCA 4HKVB 3NBBA 3K9MC 4R9KA 3EQQB 1NWWA 1T2IA 2CWVA 3ER7A 2YFJB 4HM4B 3FH1A 1YGEA 3LTAA 5D81A 1GD3A 2PZVA 4N6TA 4OVMA 5CF1A 1YIT3 3T8UA 2IYJA 3B8LA 5RNTA 3EB8A 3MG3A 1OHSA 2CK3H 1VQO3 3D4AA 1I70A 3KIIA 1QVG2 2GU3A 1IQYA 3OV4A 3J7Yd 2ML6A 1HYFA 5BXQA 1V57A 1IDPA 4HZBB 2QA43 3F7SA 3BLZA 5HOHA 3FSDA 3FF2A 1RCKA 4NREA 3BNBA 1I3FA 3T8NA 1RKYA 3OWSA 1I0XA 2H0GA 3ZG5A 1VQK3 1JJ22 1LNHA 1RGFA 3MG2A 1AQZA 1YGWA 2K3DA 2KF6A 3NBRA 5AIGA 2KRTA 1BOXA 1A2KA 2IUJA 2IUKA 1VQ43 1RN1A 2OOVC 3BIRA 1BGSA 1LOVA 1ZGXA 1GD4A 2F5MA 1SIIA 3X42A 1RNBA 1I2FA 2AAEA 4BIRA 1JBTA 1EEJA 4WYKA 1W00A 3G16A 3AHWA 1MOLA 3VF1A 3Q3FA 1Y4KA 1TJDA 4AKZA 1QAFA 1K734 1OACA 2KF3A 2ML5A 2I9WA 1FW7A 2XFSA 1RRLA 4KT3B 5AI1A 3D79A 3CCV3 2HMOB 1BNSA 4OK0A 3NBJA 3UB1A 3KN4A 5IW9A 3MG1A 4EXRA 1WMOA 1F8NA 3EF8A 3GZYB 3K7CA 4NHFA 1JKGB 1BSDA 1BSEA 5D83A 4IT7A 1GY6A 1MNLA 1TTOA 3ALAA 2LYXA 3CCS3 1YI23 1O7NB 1UGHI 3EJVA 1ROVA 3NM2A 4HM8B 3PS8A 5STDA 3RGRA 5BU4A 2FXTA 1RCLA 1RRHA 3STDA 3WA3A 4R80A 1STDA 1NO3A 4RNYA 3HIGA 3HZPA 1OCVA 3NV0B 3UL6A 4CJNA 2CX0A 1W5ZA 1NB3I 3S28A 3GZRA 3S27A 5JPUA 2M7OA 3H3HA 1DMMA 1US1A 1B2UA 1GOUA 1SARA 2CIUA 3K63A 3OWUA 4N6LA 1KD14 2C4BA 1I8VA 1NDOB 4GHOA 2GEYA 1GSPA 5CK6A 2RCDA 4IIAA 4XB5A 1JRQA 1BSAA 6GSPA 4J8TA 4MEIA 1EG9B 1IT8A 2IMJA 3DH2A 4WP5A 1RN4A 1L5GB 1B27A 4WHAA 3X41A 1CYVA 4RZMA 3CCJ3 3LTCA 3QK9A 4BL3A 4CCVA 1M904 3CD63 3WODG 5IEOA 3CMA3 5M1AA 4HM5B 1GY5A 3IMAB 1R4YA 1RGCA 1O7HB 1W6GA 1WQLB 1TFOA 3DMCA 3DUKA 3NQYA 1ZS7A 4HJLB 2CFKA 3N54B 2KAAA 3F14A 3CC73 1RLSA 3SVAA 1MWRA 1MGWA 3KSED 3SX1A 5HGRA 3RNTA 2E2UA 1JZOA 3FG1A 5LC7A 1E97A 1KWIA 1JBRA 3S29A 4MMYB 1W2ZA 1RGGA 4XBXA 3H51A 1RTUA 2E2TA 2FGTA 3FG4A 1YIJ3 5KP3A 3UL5A 2W04A 3O8YA 2WOFA 2B24B 3OX9A 3GZBA 3SOAA 4HOHA 2XH9A 1ISKA 4J5GA 2YFLB 2KF4A 4G1MB 3KFQC 3ZG0A 1VQM3 2KF5A 1DMQA 1JZDA 4PEJA 4O02B 3PYJA 1MWUA 4H3UA 2BT3A 3G0KA 4MJDA 1VQ83 3HI7A 3G713 1LNIA 5ELUA 1E3RA 1V74A 3L0RA 3BNCA 3HX8A 4KZ1A 2OTJ3 2XSOB 2K0MA 2Z7AA 3EBYA 4HM3B 1WMPA 1G0TA 4BTXA 1J2BA 5DRVA 2W0QA 3E99A 4LZIA 2W6JH 5TGNA 3AGOA 1O7WB 2Z76A 1BRGA 1O7MB 1OHOA 2P0MA 2F4YA 1YVSA 2CC3A 3K0ZA 1Q814 1BAOA 1BVIA 1BNRA 1NB5I 4FCZA 1UI8A 2R41A 3DGNA 1GMPA 1BUJA 1HU9A 2CFLA 2L4VA 3CCR3 1JNQA 3PZWA 2OOVA 1K9M4 1O7GB 2KXGA 1QVF2 1B2MA 2CWTA 1AR0A 1RN7A 3DGYA 1I2GA 3DM8A 1RDSA 3F9SA 1BNGA 3BU4A 1N5PA 3F8XA 1RGLA 4FCMA 2OWPA 1BRNL 2L1SA 1HKXA 2XR8B 2Y73A 6STDA 2R4IA 3N9HA 4KFDA 2QGUA 3CC43 4N6OB 3UNLA 4GL6A 1IVVA 4KFFA 5DREA 1UCIA 4K1UA 3CNXA 2D42A 1RGHA 3BNEA 4FMBA 3RDEA 1KQS2 2OTL3 1WMNA 1IVWA 1RGKA 3LOYA 2F98A 1NJI4 3X40A 1NNVA 1BNIA 3KSPA 4LSOA 1IQ8A 1FGRA 3LYGA 4EYCA 3NHXA 4HM7B 3WR2A 3IJEB 4BU4A 3VGNA 3CU3A 1FZUA 2BNGA 4EC6A 1A90A 5IG5A 4BL2A 1BIRA 2CHCA 1PFPA 3CME3 1QMAA 3FKAA 2ZHXB 1EA2A 1G02A 3MKIA 1Q40B 1ULIB 1T2HA 2CH9A 3F40A 1OPYA 3F7XA 4FMDA 1OGXA 4HVNA 3KCHA 4RNTA 1MWTA 5IF6A 2XGNA 1RGAA 4AKYA 1N8QA 1W4NA 1Q9EA 4CPKA 1KC84 1SQWA 2CW9A 4L7KA 2WO0A 1U8CB 3CPOA 1FUWA 3JUMA 3CXC2 4J9AA 1TUHA 1U5OA 1PYLA 2XRXB 1BNJA 1X1XA 1S723 3ECFA 3GRDA 1JKGA 2KCDA 3EHCA 1CEWI 4XBTA 1FUSA 3MHEA 9RNTA 2MF7A 4LYLB 4RNZA 3S5CA 1UW1A 4X2OA 3DY5A 1A67A 1LXEA 4EV2A 1OF5B 3CPW2 3LT8A 2BU4A 3SOYA 1N9EA 1JB5A 1I3IA 1D6YA 5CLKA 3SLUA 4MMZB 1CH0A 3X3ZA 1C7HA 3WA2X 1VQQA 4EBGA 2P0XA 1MGRA 5BIRA 3K5TA 3GAXA 1Z1SA 3G8ZA 3HIIA 2F5WA 3DZLA 3KZTA 3MPHA 2GXFA 1RNTA 4FCJA 2H0IA 4HM6B 3U97A 5G2GA 2J8XB 1W6CA 3GWRA 4EW5A 4HAAA 2F86B 7RNTA 1O7PB 2W56A 1HZ1A 2GU1A 1VQP3 3X3YA 3Q90A 1EUIC 3RGAA 3WOEB 1Q864 3FG3A 1DE3A 4R9LA 1TFKA 4LGQA 2OQEC 3KE7A 4J5KA 1YNVX 1RHLA 1X1YA 3V98A 3PCRA 5ELJA 7STDA 2HMJB 1W7CA 4MMXB 4XDWA 1IK3A 1JBSA 3QRDA 2RSXA 3F8HA 4K1VA 1EQKA 1IQXA 3MSOA 2BMQB 2F56A 3CNMA 2CKFB 2HMNB 5IERA 1DVCA 1B2XA 1G96A 2CWUA 3FGYA 3LH4A 3V99A 5CF2A 4O2HA 1B2ZA 2Y74A 3B7CA 1IT7A 4RBNA 1M1K4 1Q40A 1ZO2A 1ASKA 1AVKA 3KKGA 5FGOA 4N6V0 1T3BA 2CG1A 2E2VA 1BANA 1STFI 1MWSA 4N6NB 3S67A 1YJW3 3LTDA 3ROBA 4U13A 5A0OB 3N8BA 3Q1CA 3BB9A 1TIJA 2GEXA 1X1WA 4BTWA 1W2B2 1SIHA 5AEUB 5EEOA 1LQGC 2WOHA 1FGTA 1Q7HA 2BMOB 2HMMB 2W9QA 3HOHA 3MWZA 1B3SA 1I0VA 1YVBI 2XEPA 1DMNA 4I5QA 1N5HA 1OF5A 1WTHA 2SBLA 3JUPA 2D1WA 8CHOA 3EN1B 4ORLA 3NXJA 1EKMA 1Q42A 2Z6BA 1ROAA 2C10A 3D5GA 1RMSA 5AYSC 1UGIA 1AVLA 1S5AA 2FNQA 1Q7Y4 1N8R4 2XGLA 2CX1A 3V92A 1GMRA 2IA7A 3DXOA 5EVHA 1SPUA 1UCJA 3VSYA 2BIRA 1DYUA 2ZDJA 1QJGA 1BNFA 1E3VA 2XFTA 2Z77A 3GZXB 3CCM3 1K28A 5IG3A 4Q53A 4QWTA 3WHOA 1FYSA 1M1XB 1LOWA 1B21A 3EE1A 4FMCA 2HOHA 2W56B 2MC8A 1YJN3 3EC9A 1JB4A 3UJMA 4HM2B 3SEDA 1A2VA 2ZL8A 4ZM8A 1UUGB 2GSPA 3PGBA 5BVBA 1M9GA 1TP6A 2INXA 1BRJA 4WWUC 1B20A 3LTBA 3D9RA 5G1KA 3JUOA 3TDGA 1IVXA 1T5YA 2HMKB 3LMLA 4I4KA 2WGQA 1CQSA 3B4PA 4HYZA 4L8OA 4OUQA 1V58A 5AIIA 3CCE3 1DETA 4HM1B 3A5EA 1VQN3 1GMQA 2BO9B 2CFWA 1BU4A 1UUVB 1YJ93 2O9UX 5D82A 4EV5A 2GBXB 4NPBA 4WYKB 3CCL3 2W9PA 1R4CA 2SARA 4XBYA 1RJOA 1JN5B 1JV2B 2YFIB 3GSPA 5I97A 3JUQA 2RGQA 3OWYA 3WMDA 4LEHA 4O8SA 1VQL3 2P09A 1IVUA 3PCSA 3MYTA 4DKIA 2RFRA 3U1WA 2BMRB 1TRQA 1VQ73 1BRIA 1LOYA 1LVNA 1TRPA 2GBWB 1B2SA 1ZX2A 1KSIA 1WNHA 2STDA 4KFEA 2V1LA 4STDA 1VQ53 1BRSA 3NQZA 3EN8A 3I553 3LZAA 3EBTA 2RNTA 3FCSB 3DGLA 5IEPA 3URPA 2UGIA 1UI7A 3NV0A 2CFGA 1GS3A 1GOYA 1NU3A 2B1XB 2P05A 1VZZA 5AIHA 1PY3A 3T0UA 1IYYA 3JVCA 1IV7A 2QEX3 5G1LA 5JPPA 3NX0A 4HM0B 5EQLA 4O3VA 1AY7A 3G4S3 3EX9A 1FGOA 3G6E3 2UUGC 3AMOA 3FF0A 4XM4A 1K41A 4FMAA 1BNEA 3FLJA 2A15A 7GSPA 3DGMA 1DVDA 1W02A 3FZWA 2W03A 1D6UA 3M8CA 5LC6A 4BTYA 3IPTA 4LMIA 4N6UA 3CCU3 5IENA 3NM7A 4WFOA 2LQVA 2F99A 1RGEA 4XDVA 3AGNA 4FR9A 1BUQA 3CC23 3HK4A 4HBRA 3X3XA 4HZ9B 4K61A 5M18A 1JB2A 2RBIA 4N3VA 3Q2PA 1IU7A 1I2EA 2OCTA 5IG0A 3B4OA 2P38A 3JUNA 4KVHA 5KP4A 1AV4A 2JQ5A 4TX4A 3I563 4R4KA 8RNTA 2YX9A 3LXUX 2XSHB 2QIYA 5IG4A 4ILFA 3A76A 1RSNA 3WDGB 4AEQA 3ZFZA 1GYBA 1BRHA 4K90B 4X2HA 1FUTA 5AEWB 3SYUA 1PU4A 5GSPA 1QAKA 3DGOA 6RNTA 1GOVA 2K54A 2WGOA 1JN5A 2XF3A 2AADA 1BRKA 2UX0A 3WOFB 1VQ93 2IY2A 3AHSA 3OXAA 2JDIH
chains in the Genus database with same CATH topology
2O3OA 1OUNA 4GB5A 2CG0A 3BNDA 3D3LA 1GY7A 2HMLB 1K8A4 1ULJB 1CYUA 2Q07A 3PXMA 4R1KA 1FGMA 1W01A 3SXXA 4H61A 3CCQ3 5AYRB 2C11A 1W6YA 2W2CA 1UUWB 1FA3A 1OGZA 5KP1A 1D6ZA 1LOXA 2BHMA 5JBSA 1OH0A 3I0YA 4IPBA 1TU5A 1QALA 4JRFA 2OQEA 4CDLA 4N6MA 3LT9A 1FGQA 5AIFA 1OHPA 5FW5A 4L8PA 5CXOA 1VQ63 4JF8A 3AMOB 1SJWA 1IV9A 3NUVA 3OW22 1N9JA 1Q824 2CFDA 1YHQ3 2PNCA 4HKVB 3NBBA 3K9MC 4R9KA 3EQQB 1NWWA 2CWVA 4HM4B 3ER7A 2YFJB 3FH1A 1YGEA 3LTAA 5D81A 1GD3A 2PZVA 4N6TA 4OVMA 5CF1A 1YIT3 3T8UA 3B8LA 3EB8A 3MG3A 1OHSA 2CK3H 1VQO3 1QVG2 3KIIA 2GU3A 1IQYA 3OV4A 3J7Yd 2ML6A 5BXQA 1IDPA 4HZBB 2QA43 3F7SA 3BLZA 3FSDA 3FF2A 4NREA 3BNBA 1RKYA 3T8NA 3OWSA 1VQK3 1JJ22 1LNHA 3MG2A 3NBRA 5AIGA 2KRTA 2IUJA 1A2KA 2IUKA 1VQ43 2OOVC 1GD4A 3X42A 1SIIA 4WYKA 1W00A 3G16A 1MOLA 3VF1A 1Y4KA 1K734 4AKZA 1QAFA 1OACA 2ML5A 2I9WA 2XFSA 1RRLA 5AI1A 3CCV3 2HMOB 4OK0A 3NBJA 3UB1A 3KN4A 5IW9A 3MG1A 4EXRA 1WMOA 1F8NA 3EF8A 3GZYB 3K7CA 4NHFA 1JKGB 5D83A 4IT7A 1GY6A 1MNLA 3ALAA 3CCS3 2LYXA 1YI23 1O7NB 3NM2A 3EJVA 1ROVA 4HM8B 3PS8A 5STDA 3RGRA 2FXTA 1RRHA 3STDA 3WA3A 4R80A 1STDA 1NO3A 4RNYA 3HIGA 3HZPA 1OCVA 3NV0B 3UL6A 1W5ZA 1NB3I 3S28A 3GZRA 3S27A 5JPUA 2M7OA 3H3HA 1DMMA 1US1A 3K63A 2CIUA 4N6LA 3OWUA 1KD14 1NDOB 2GEYA 5CK6A 2RCDA 4IIAA 4XB5A 1JRQA 4J8TA 4MEIA 1EG9B 1IT8A 2IMJA 4WP5A 1L5GB 4WHAA 3X41A 1CYVA 4RZMA 3CCJ3 3LTCA 3QK9A 4CCVA 1M904 3CD63 3WODG 5IEOA 3CMA3 4HM5B 1GY5A 3IMAB 1O7HB 1W6GA 1WQLB 1TFOA 3DUKA 3DMCA 3NQYA 4HJLB 2CFKA 3N54B 3F14A 3CC73 3SVAA 3SX1A 3KSED 5HGRA 2E2UA 3FG1A 5LC7A 1KWIA 1E97A 3S29A 4MMYB 1W2ZA 4XBXA 3H51A 2E2TA 2FGTA 3FG4A 1YIJ3 5KP3A 3UL5A 2W04A 3O8YA 2WOFA 2B24B 3OX9A 3GZBA 3SOAA 2XH9A 1ISKA 2YFLB 1VQM3 4G1MB 3KFQC 1DMQA 4PEJA 4O02B 3PYJA 4H3UA 2BT3A 3G0KA 4MJDA 1VQ83 3HI7A 3G713 5ELUA 1E3RA 1V74A 3L0RA 3BNCA 3HX8A 4KZ1A 2OTJ3 2XSOB 2K0MA 2Z7AA 3EBYA 4HM3B 1WMPA 4BTXA 1J2BA 5DRVA 2W0QA 3E99A 4LZIA 2W6JH 5TGNA 1O7WB 2Z76A 1O7MB 1OHOA 2P0MA 2CC3A 3K0ZA 1Q814 1NB5I 4FCZA 1UI8A 3DGNA 1HU9A 2CFLA 2L4VA 3CCR3 1JNQA 3PZWA 2OOVA 1K9M4 1O7GB 2KXGA 1QVF2 2CWTA 1AR0A 1RN7A 3DM8A 3F9SA 4FCMA 1N5PA 3F8XA 2OWPA 2XR8B 1HKXA 2Y73A 6STDA 2R4IA 3N9HA 4KFDA 2QGUA 3CC43 4N6OB 3UNLA 4GL6A 1IVVA 4KFFA 5DREA 4K1UA 3CNXA 2D42A 3BNEA 4FMBA 3RDEA 1KQS2 2OTL3 1WMNA 1IVWA 3LOYA 2F98A 1NJI4 3X40A 4LSOA 3KSPA 1IQ8A 1FGRA 3LYGA 4EYCA 3NHXA 4HM7B 3IJEB 3VGNA 3CU3A 2BNGA 4EC6A 1A90A 5IG5A 2CHCA 1PFPA 3CME3 1QMAA 3FKAA 1EA2A 3MKIA 1Q40B 1ULIB 3F40A 2CH9A 3F7XA 1OPYA 4FMDA 1OGXA 4HVNA 5IF6A 2XGNA 4AKYA 1N8QA 1W4NA 1KC84 1SQWA 2CW9A 4L7KA 2WO0A 1U8CB 3CPOA 1FUWA 3JUMA 3CXC2 4J9AA 1TUHA 1U5OA 2XRXB 1S723 3ECFA 3GRDA 1JKGA 2KCDA 3EHCA 1CEWI 4XBTA 3MHEA 2MF7A 4RNZA 3S5CA 1UW1A 4X2OA 3DY5A 1A67A 1LXEA 4EV2A 1OF5B 3CPW2 3LT8A 3SOYA 1N9EA 1JB5A 1D6YA 5CLKA 3SLUA 4MMZB 3X3ZA 1C7HA 3WA2X 4EBGA 2P0XA 3K5TA 3GAXA 1Z1SA 3G8ZA 3HIIA 3DZLA 3MPHA 3KZTA 2GXFA 4FCJA 4HM6B 3U97A 5G2GA 1W6CA 3GWRA 2F86B 1O7PB 2W56A 2GU1A 1VQP3 3X3YA 3Q90A 3WOEB 3RGAA 1Q864 3FG3A 4R9LA 1TFKA 4LGQA 2OQEC 3KE7A 3V98A 7STDA 3PCRA 5ELJA 2HMJB 1W7CA 4MMXB 4XDWA 1IK3A 3QRDA 2RSXA 3F8HA 4K1VA 1EQKA 1IQXA 3MSOA 2BMQB 3CNMA 5IERA 2CKFB 2HMNB 1DVCA 1G96A 3LH4A 2CWUA 3FGYA 3V99A 5CF2A 4O2HA 2Y74A 3B7CA 1IT7A 4RBNA 1M1K4 1Q40A 1ZO2A 1ASKA 1AVKA 3KKGA 5FGOA 4N6V0 2CG1A 2E2VA 1STFI 3S67A 4N6NB 1YJW3 3LTDA 3ROBA 4U13A 5A0OB 3N8BA 3Q1CA 3BB9A 1TIJA 2GEXA 4BTWA 1W2B2 1SIHA 5AEUB 5EEOA 2WOHA 1FGTA 2BMOB 2HMMB 2W9QA 3MWZA 1YVBI 2XEPA 1DMNA 1N5HA 1OF5A 1WTHA 2SBLA 3JUPA 2D1WA 8CHOA 3EN1B 4ORLA 3NXJA 1EKMA 1Q42A 2Z6BA 1ROAA 2C10A 5AYSC 1AVLA 1S5AA 2FNQA 1Q7Y4 1N8R4 2XGLA 3V92A 2IA7A 3DXOA 5EVHA 1SPUA 3VSYA 1DYUA 2ZDJA 2XFTA 1QJGA 1E3VA 2Z77A 3GZXB 3CCM3 1K28A 5IG3A 4Q53A 4QWTA 1M1XB 3EE1A 4FMCA 2MC8A 2W56B 1YJN3 3EC9A 1JB4A 3UJMA 4HM2B 3SEDA 1A2VA 2ZL8A 4ZM8A 5BVBA 3PGBA 1M9GA 1TP6A 2INXA 4WWUC 3LTBA 3D9RA 3JUOA 3TDGA 1IVXA 1T5YA 2HMKB 3LMLA 4I4KA 2WGQA 1CQSA 3B4PA 4HYZA 4L8OA 4OUQA 5AIIA 3CCE3 4HM1B 1VQN3 2BO9B 2CFWA 1YJ93 1UUVB 2O9UX 5D82A 4EV5A 2GBXB 4WYKB 3CCL3 2W9PA 1R4CA 4XBYA 1RJOA 1JN5B 1JV2B 2YFIB 5I97A 3JUQA 2RGQA 3OWYA 3WMDA 4LEHA 4O8SA 1VQL3 2P09A 1IVUA 3PCSA 3MYTA 2RFRA 3U1WA 2BMRB 1VQ73 1LVNA 2GBWB 1ZX2A 1KSIA 1WNHA 2STDA 4KFEA 2V1LA 4STDA 1VQ53 3NQZA 3EN8A 3I553 3LZAA 3EBTA 3FCSB 3DGLA 5IEPA 1UI7A 3NV0A 2CFGA 1GS3A 1NU3A 2B1XB 2P05A 1VZZA 5AIHA 3T0UA 3JVCA 1IV7A 2QEX3 5JPPA 3NX0A 4HM0B 5EQLA 4O3VA 3G4S3 3EX9A 1FGOA 3G6E3 3AMOA 3FF0A 4XM4A 1K41A 4FMAA 3FLJA 2A15A 3DGMA 1DVDA 1W02A 3FZWA 2W03A 1D6UA 3M8CA 5LC6A 4BTYA 3IPTA 4LMIA 4N6UA 3CCU3 5IENA 3NM7A 4WFOA 2LQVA 2F99A 4XDVA 4FR9A 1BUQA 3CC23 3HK4A 4HBRA 3X3XA 4HZ9B 4K61A 1JB2A 4N3VA 3Q2PA 1IU7A 2OCTA 5IG0A 3B4OA 2P38A 3JUNA 4KVHA 5KP4A 1AV4A 2JQ5A 4TX4A 3I563 4R4KA 2YX9A 3LXUX 2XSHB 2QIYA 5IG4A 3A76A 3WDGB 4AEQA 1GYBA 4K90B 4X2HA 5AEWB 1PU4A 1QAKA 3DGOA 2K54A 2WGOA 1JN5A 2XF3A 2UX0A 3WOFB 1VQ93 3OXAA 2JDIH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IG5 A;  1E3V A;  2Z77 A;  3GZX B;  5JPU A;  1OUN A;  3H3H A;  4GB5 A;  2CHC A;  1DMM A;  5IG3 A;  4Q53 A;  1GY7 A;  1QMA A;  2HML B;  3OWU A;  3FKA A;  1ULJ B;  1EA2 A;  1NDO B;  3MKI A;  4R1K A;  1Q40 B;  1ULI B;  1W01 A;  2GEY A;  2RCD A;  1OPY A;  3F40 A;  3F7X A;  1W6Y A;  2W2C A;  1UUW B;  4IIA A;  4XB5 A;  1OGZ A;  1OGX A;  1JB4 A;  3EC9 A;  4HVN A;  3UJM A;  5KP1 A;  4J8T A;  5TGN A;  4HM2 B;  3SED A;  5IF6 A;  1EG9 B;  2IMJ A;  4WP5 A;  5BVB A;  1OH0 A;  3I0Y A;  4L7K A;  3S5C A;  1TP6 A;  2INX A;  3CPO A;  3JUM A;  5AII A;  4J9A A;  4WWU C;  4RZM A;  1TUH A;  1U5O A;  2XRX B;  3D9R A;  4CDL A;  3ECF A;  3GRD A;  1JKG A;  3JUO A;  5IEO A;  3EHC A;  2HMK B;  4I4K A;  4XBT A;  3MHE A;  1CQS A;  5CK6 A;  1OHP A;  3B4P A;  4HM5 B;  1GY5 A;  4L8O A;  4L8P A;  4OUQ A;  4X2O A;  5CXO A;  4HM1 B;  1O7H B;  3DMC A;  1WQL B;  3DUK A;  5IER A;  1OF5 B;  1SJW A;  4HJL B;  1UUV B;  3NUV A;  5D82 A;  3F14 A;  2GBX B;  3SOY A;  4WYK B;  1JB5 A;  5HGR A;  4HKV B;  4XBY A;  4R9K A;  1JN5 B;  5CLK A;  1E97 A;  2YFI B;  5FW5 A;  1C7H A;  3EQQ B;  2RGQ A;  1NWW A;  3JUQ A;  3OWY A;  3ER7 A;  2YFJ B;  4HM4 B;  3FH1 A;  4LEH A;  3H51 A;  4XBX A;  1Z1S A;  3G8Z A;  3DZL A;  2PZV A;  3KZT A;  4OVM A;  5D81 A;  3MYT A;  5KP3 A;  5CF1 A;  3T8U A;  2GXF A;  4FCJ A;  2RFR A;  4HM6 B;  3B8L A;  3MG3 A;  2BMR B;  2B24 B;  5G2G A;  1OHS A;  3GWR A;  3OX9 A;  3GZB A;  3SOA A;  2F86 B;  3OV4 A;  1ISK A;  1O7P B;  2GBW B;  5BXQ A;  2YFL B;  1ZX2 A;  1IDP A;  3Q90 A;  4HZB B;  4STD A;  2STD A;  3RGA A;  3F7S A;  4KVH A;  1DMQ A;  4R9L A;  4PEJ A;  3BLZ A;  3FSD A;  3FF2 A;  4H3U A;  4LGQ A;  3EN8 A;  3KE7 A;  3LZA A;  3G0K A;  4MJD A;  3EBT A;  3T8N A;  3OWS A;  1E3R A;  7STD A;  3HX8 A;  2HMJ B;  4XDW A;  2XSO B;  4HM3 B;  2Z7A A;  3EBY A;  5IEP A;  3F8H A;  4K1V A;  3NV0 A;  5DRV A;  3MG2 A;  2B1X B;  1GS3 A;  1NU3 A;  2BMQ B;  3CNM A;  1VZZ A;  2CKF B;  2HMN B;  3E99 A;  3NBR A;  1O7W B;  5AIG A;  5AIH A;  1A2K A;  2Z76 A;  1O7M B;  3FGY A;  1OHO A;  4HM0 B;  5CF2 A;  5JPP A;  3B7C A;  3EX9 A;  3K0Z A;  3FF0 A;  4XM4 A;  1K41 A;  3FLJ A;  2A15 A;  4WYK A;  1W00 A;  3G16 A;  1Q40 A;  1W02 A;  3FZW A;  1ZO2 A;  3M8C A;  1ASK A;  3KKG A;  3IPT A;  2I9W A;  1O7G B;  4LMI A;  5IEN A;  2F99 A;  4XDV A;  1BUQ A;  5AI1 A;  1AR0 A;  3ROB A;  4U13 A;  3HK4 A;  3DM8 A;  2HMO B;  4HZ9 B;  3BB9 A;  1JB2 A;  3F9S A;  2GEX A;  4FCM A;  3F8X A;  4N3V A;  2OWP A;  5AIF A;  2XR8 B;  1HKX A;  6STD A;  5IG0 A;  3MG1 A;  5AEU B;  3B4O A;  3EF8 A;  2R4I A;  3GZY B;  3JUN A;  1JKG B;  2JQ5 A;  2QGU A;  3K7C A;  2BMO B;  2HMM B;  3MSO A;  3UNL A;  5KP4 A;  5D83 A;  2XSH B;  2QIY A;  5IG4 A;  5DRE A;  3A76 A;  1GY6 A;  3CNX A;  4K1U A;  1DMN A;  1O7N B;  3JUP A;  1GYB A;  1OF5 A;  3EJV A;  3NM2 A;  4HM8 B;  4X2H A;  3EN1 B;  4ORL A;  5STD A;  2F98 A;  3RGR A;  5AEW B;  3NXJ A;  8CHO A;  1Q42 A;  3STD A;  3KSP A;  1STD A;  3LYG A;  3NHX A;  3NV0 B;  3HZP A;  1OCV A;  2K54 A;  1JN5 A;  4HM7 B;  1S5A A;  3VGN A;  3CU3 A;  2UX0 A;  2BNG A;  3DXO A;  5EVH A;  3VSY A;  3WMD A;  3GZR A;  3OXA A;  1QJG A; 
#chains in the Genus database with same CATH topology
 2O3O A;  1OUN A;  4GB5 A;  2CG0 A;  3BND A;  3D3L A;  1GY7 A;  2HML B;  1UCL A;  1K8A 4;  1ULJ B;  1CYU A;  2Q07 A;  3D5I A;  1C54 A;  5M19 A;  3PXM A;  4R1K A;  1FGM A;  1W01 A;  1BSB A;  4H61 A;  3SXX A;  5AYR B;  2C11 A;  3CCQ 3;  1W6Y A;  2W2C A;  1UCK A;  1UUW B;  1FA3 A;  1OGZ A;  1LRA A;  5KP1 A;  1D6Z A;  1LOX A;  2BHM A;  5JBS A;  1OH0 A;  2ZA4 A;  3I0Y A;  4IPB A;  1TU5 A;  1QAL A;  4JRF A;  1X1U A;  2OQE A;  4CDL A;  4N6M A;  1LQM B;  3LT9 A;  1A2P A;  1FGQ A;  5AIF A;  1OHP A;  5FW5 A;  4L8P A;  1BSC A;  5CXO A;  1VQ6 3;  4JF8 A;  2H0H A;  3AMO B;  1SJW A;  1IV9 A;  1UDI I;  3NUV A;  3OW2 2;  1N9J A;  1Q82 4;  4GSP A;  2CFD A;  1YHQ 3;  2PNC A;  4HKV B;  3NBB A;  3K9M C;  4R9K A;  3EQQ B;  1NWW A;  1T2I A;  2CWV A;  3ER7 A;  2YFJ B;  4HM4 B;  3FH1 A;  1YGE A;  3LTA A;  5D81 A;  1GD3 A;  2PZV A;  4N6T A;  4OVM A;  5CF1 A;  1YIT 3;  3T8U A;  2IYJ A;  3B8L A;  5RNT A;  3EB8 A;  3MG3 A;  1OHS A;  2CK3 H;  1VQO 3;  3D4A A;  1I70 A;  3KII A;  1QVG 2;  2GU3 A;  1IQY A;  3OV4 A;  3J7Y d;  2ML6 A;  1HYF A;  5BXQ A;  1V57 A;  1IDP A;  4HZB B;  2QA4 3;  3F7S A;  3BLZ A;  5HOH A;  3FSD A;  3FF2 A;  1RCK A;  4NRE A;  3BNB A;  1I3F A;  3T8N A;  1RKY A;  3OWS A;  1I0X A;  2H0G A;  3ZG5 A;  1VQK 3;  1JJ2 2;  1LNH A;  1RGF A;  3MG2 A;  1AQZ A;  1YGW A;  2K3D A;  2KF6 A;  3NBR A;  5AIG A;  2KRT A;  1BOX A;  1A2K A;  2IUJ A;  2IUK A;  1VQ4 3;  1RN1 A;  2OOV C;  3BIR A;  1BGS A;  1LOV A;  1ZGX A;  1GD4 A;  2F5M A;  1SII A;  3X42 A;  1RNB A;  1I2F A;  2AAE A;  4BIR A;  1JBT A;  1EEJ A;  4WYK A;  1W00 A;  3G16 A;  3AHW A;  1MOL A;  3VF1 A;  3Q3F A;  1Y4K A;  1TJD A;  4AKZ A;  1QAF A;  1K73 4;  1OAC A;  2KF3 A;  2ML5 A;  2I9W A;  1FW7 A;  2XFS A;  1RRL A;  4KT3 B;  5AI1 A;  3D79 A;  3CCV 3;  2HMO B;  1BNS A;  4OK0 A;  3NBJ A;  3UB1 A;  3KN4 A;  5IW9 A;  3MG1 A;  4EXR A;  1WMO A;  1F8N A;  3EF8 A;  3GZY B;  3K7C A;  4NHF A;  1JKG B;  1BSD A;  1BSE A;  5D83 A;  4IT7 A;  1GY6 A;  1MNL A;  1TTO A;  3ALA A;  2LYX A;  3CCS 3;  1YI2 3;  1O7N B;  1UGH I;  3EJV A;  1ROV A;  3NM2 A;  4HM8 B;  3PS8 A;  5STD A;  3RGR A;  5BU4 A;  2FXT A;  1RCL A;  1RRH A;  3STD A;  3WA3 A;  4R80 A;  1STD A;  1NO3 A;  4RNY A;  3HIG A;  3HZP A;  1OCV A;  3NV0 B;  3UL6 A;  4CJN A;  2CX0 A;  1W5Z A;  1NB3 I;  3S28 A;  3GZR A;  3S27 A;  5JPU A;  2M7O A;  3H3H A;  1DMM A;  1US1 A;  1B2U A;  1GOU A;  1SAR A;  2CIU A;  3K63 A;  3OWU A;  4N6L A;  1KD1 4;  2C4B A;  1I8V A;  1NDO B;  4GHO A;  2GEY A;  1GSP A;  5CK6 A;  2RCD A;  4IIA A;  4XB5 A;  1JRQ A;  1BSA A;  6GSP A;  4J8T A;  4MEI A;  1EG9 B;  1IT8 A;  2IMJ A;  3DH2 A;  4WP5 A;  1RN4 A;  1L5G B;  1B27 A;  4WHA A;  3X41 A;  1CYV A;  4RZM A;  3CCJ 3;  3LTC A;  3QK9 A;  4BL3 A;  4CCV A;  1M90 4;  3CD6 3;  3WOD G;  5IEO A;  3CMA 3;  5M1A A;  4HM5 B;  1GY5 A;  3IMA B;  1R4Y A;  1RGC A;  1O7H B;  1W6G A;  1WQL B;  1TFO A;  3DMC A;  3DUK A;  3NQY A;  1ZS7 A;  4HJL B;  2CFK A;  3N54 B;  2KAA A;  3F14 A;  3CC7 3;  1RLS A;  3SVA A;  1MWR A;  1MGW A;  3KSE D;  3SX1 A;  5HGR A;  3RNT A;  2E2U A;  1JZO A;  3FG1 A;  5LC7 A;  1E97 A;  1KWI A;  1JBR A;  3S29 A;  4MMY B;  1W2Z A;  1RGG A;  4XBX A;  3H51 A;  1RTU A;  2E2T A;  2FGT A;  3FG4 A;  1YIJ 3;  5KP3 A;  3UL5 A;  2W04 A;  3O8Y A;  2WOF A;  2B24 B;  3OX9 A;  3GZB A;  3SOA A;  4HOH A;  2XH9 A;  1ISK A;  4J5G A;  2YFL B;  2KF4 A;  4G1M B;  3KFQ C;  3ZG0 A;  1VQM 3;  2KF5 A;  1DMQ A;  1JZD A;  4PEJ A;  4O02 B;  3PYJ A;  1MWU A;  4H3U A;  2BT3 A;  3G0K A;  4MJD A;  1VQ8 3;  3HI7 A;  3G71 3;  1LNI A;  5ELU A;  1E3R A;  1V74 A;  3L0R A;  3BNC A;  3HX8 A;  4KZ1 A;  2OTJ 3;  2XSO B;  2K0M A;  2Z7A A;  3EBY A;  4HM3 B;  1WMP A;  1G0T A;  4BTX A;  1J2B A;  5DRV A;  2W0Q A;  3E99 A;  4LZI A;  2W6J H;  5TGN A;  3AGO A;  1O7W B;  2Z76 A;  1BRG A;  1O7M B;  1OHO A;  2P0M A;  2F4Y A;  1YVS A;  2CC3 A;  3K0Z A;  1Q81 4;  1BAO A;  1BVI A;  1BNR A;  1NB5 I;  4FCZ A;  1UI8 A;  2R41 A;  3DGN A;  1GMP A;  1BUJ A;  1HU9 A;  2CFL A;  2L4V A;  3CCR 3;  1JNQ A;  3PZW A;  2OOV A;  1K9M 4;  1O7G B;  2KXG A;  1QVF 2;  1B2M A;  2CWT A;  1AR0 A;  1RN7 A;  3DGY A;  1I2G A;  3DM8 A;  1RDS A;  3F9S A;  1BNG A;  3BU4 A;  1N5P A;  3F8X A;  1RGL A;  4FCM A;  2OWP A;  1BRN L;  2L1S A;  1HKX A;  2XR8 B;  2Y73 A;  6STD A;  2R4I A;  3N9H A;  4KFD A;  2QGU A;  3CC4 3;  4N6O B;  3UNL A;  4GL6 A;  1IVV A;  4KFF A;  5DRE A;  1UCI A;  4K1U A;  3CNX A;  2D42 A;  1RGH A;  3BNE A;  4FMB A;  3RDE A;  1KQS 2;  2OTL 3;  1WMN A;  1IVW A;  1RGK A;  3LOY A;  2F98 A;  1NJI 4;  3X40 A;  1NNV A;  1BNI A;  3KSP A;  4LSO A;  1IQ8 A;  1FGR A;  3LYG A;  4EYC A;  3NHX A;  4HM7 B;  3WR2 A;  3IJE B;  4BU4 A;  3VGN A;  3CU3 A;  1FZU A;  2BNG A;  4EC6 A;  1A90 A;  5IG5 A;  4BL2 A;  1BIR A;  2CHC A;  1PFP A;  3CME 3;  1QMA A;  3FKA A;  2ZHX B;  1EA2 A;  1G02 A;  3MKI A;  1Q40 B;  1ULI B;  1T2H A;  2CH9 A;  3F40 A;  1OPY A;  3F7X A;  4FMD A;  1OGX A;  4HVN A;  3KCH A;  4RNT A;  1MWT A;  5IF6 A;  2XGN A;  1RGA A;  4AKY A;  1N8Q A;  1W4N A;  1Q9E A;  4CPK A;  1KC8 4;  1SQW A;  2CW9 A;  4L7K A;  2WO0 A;  1U8C B;  3CPO A;  1FUW A;  3JUM A;  3CXC 2;  4J9A A;  1TUH A;  1U5O A;  1PYL A;  2XRX B;  1BNJ A;  1X1X A;  1S72 3;  3ECF A;  3GRD A;  1JKG A;  2KCD A;  3EHC A;  1CEW I;  4XBT A;  1FUS A;  3MHE A;  9RNT A;  2MF7 A;  4LYL B;  4RNZ A;  3S5C A;  1UW1 A;  4X2O A;  3DY5 A;  1A67 A;  1LXE A;  4EV2 A;  1OF5 B;  3CPW 2;  3LT8 A;  2BU4 A;  3SOY A;  1N9E A;  1JB5 A;  1I3I A;  1D6Y A;  5CLK A;  3SLU A;  4MMZ B;  1CH0 A;  3X3Z A;  1C7H A;  3WA2 X;  1VQQ A;  4EBG A;  2P0X A;  1MGR A;  5BIR A;  3K5T A;  3GAX A;  1Z1S A;  3G8Z A;  3HII A;  2F5W A;  3DZL A;  3KZT A;  3MPH A;  2GXF A;  1RNT A;  4FCJ A;  2H0I A;  4HM6 B;  3U97 A;  5G2G A;  2J8X B;  1W6C A;  3GWR A;  4EW5 A;  4HAA A;  2F86 B;  7RNT A;  1O7P B;  2W56 A;  1HZ1 A;  2GU1 A;  1VQP 3;  3X3Y A;  3Q90 A;  1EUI C;  3RGA A;  3WOE B;  1Q86 4;  3FG3 A;  1DE3 A;  4R9L A;  1TFK A;  4LGQ A;  2OQE C;  3KE7 A;  4J5K A;  1YNV X;  1RHL A;  1X1Y A;  3V98 A;  3PCR A;  5ELJ A;  7STD A;  2HMJ B;  1W7C A;  4MMX B;  4XDW A;  1IK3 A;  1JBS A;  3QRD A;  2RSX A;  3F8H A;  4K1V A;  1EQK A;  1IQX A;  3MSO A;  2BMQ B;  2F56 A;  3CNM A;  2CKF B;  2HMN B;  5IER A;  1DVC A;  1B2X A;  1G96 A;  2CWU A;  3FGY A;  3LH4 A;  3V99 A;  5CF2 A;  4O2H A;  1B2Z A;  2Y74 A;  3B7C A;  1IT7 A;  4RBN A;  1M1K 4;  1Q40 A;  1ZO2 A;  1ASK A;  1AVK A;  3KKG A;  5FGO A;  4N6V 0;  1T3B A;  2CG1 A;  2E2V A;  1BAN A;  1STF I;  1MWS A;  4N6N B;  3S67 A;  1YJW 3;  3LTD A;  3ROB A;  4U13 A;  5A0O B;  3N8B A;  3Q1C A;  3BB9 A;  1TIJ A;  2GEX A;  1X1W A;  4BTW A;  1W2B 2;  1SIH A;  5AEU B;  5EEO A;  1LQG C;  2WOH A;  1FGT A;  1Q7H A;  2BMO B;  2HMM B;  2W9Q A;  3HOH A;  3MWZ A;  1B3S A;  1I0V A;  1YVB I;  2XEP A;  1DMN A;  4I5Q A;  1N5H A;  1OF5 A;  1WTH A;  2SBL A;  3JUP A;  2D1W A;  8CHO A;  3EN1 B;  4ORL A;  3NXJ A;  1EKM A;  1Q42 A;  2Z6B A;  1ROA A;  2C10 A;  3D5G A;  1RMS A;  5AYS C;  1UGI A;  1AVL A;  1S5A A;  2FNQ A;  1Q7Y 4;  1N8R 4;  2XGL A;  2CX1 A;  3V92 A;  1GMR A;  2IA7 A;  3DXO A;  5EVH A;  1SPU A;  1UCJ A;  3VSY A;  2BIR A;  1DYU A;  2ZDJ A;  1QJG A;  1BNF A;  1E3V A;  2XFT A;  2Z77 A;  3GZX B;  3CCM 3;  1K28 A;  5IG3 A;  4Q53 A;  4QWT A;  3WHO A;  1FYS A;  1M1X B;  1LOW A;  1B21 A;  3EE1 A;  4FMC A;  2HOH A;  2W56 B;  2MC8 A;  1YJN 3;  3EC9 A;  1JB4 A;  3UJM A;  4HM2 B;  3SED A;  1A2V A;  2ZL8 A;  4ZM8 A;  1UUG B;  2GSP A;  3PGB A;  5BVB A;  1M9G A;  1TP6 A;  2INX A;  1BRJ A;  4WWU C;  1B20 A;  3LTB A;  3D9R A;  5G1K A;  3JUO A;  3TDG A;  1IVX A;  1T5Y A;  2HMK B;  3LML A;  4I4K A;  2WGQ A;  1CQS A;  3B4P A;  4HYZ A;  4L8O A;  4OUQ A;  1V58 A;  5AII A;  3CCE 3;  1DET A;  4HM1 B;  3A5E A;  1VQN 3;  1GMQ A;  2BO9 B;  2CFW A;  1BU4 A;  1UUV B;  1YJ9 3;  2O9U X;  5D82 A;  4EV5 A;  2GBX B;  4NPB A;  4WYK B;  3CCL 3;  2W9P A;  1R4C A;  2SAR A;  4XBY A;  1RJO A;  1JN5 B;  1JV2 B;  2YFI B;  3GSP A;  5I97 A;  3JUQ A;  2RGQ A;  3OWY A;  3WMD A;  4LEH A;  4O8S A;  1VQL 3;  2P09 A;  1IVU A;  3PCS A;  3MYT A;  4DKI A;  2RFR A;  3U1W A;  2BMR B;  1TRQ A;  1VQ7 3;  1BRI A;  1LOY A;  1LVN A;  1TRP A;  2GBW B;  1B2S A;  1ZX2 A;  1KSI A;  1WNH A;  2STD A;  4KFE A;  2V1L A;  4STD A;  1VQ5 3;  1BRS A;  3NQZ A;  3EN8 A;  3I55 3;  3LZA A;  3EBT A;  2RNT A;  3FCS B;  3DGL A;  5IEP A;  3URP A;  2UGI A;  1UI7 A;  3NV0 A;  2CFG A;  1GS3 A;  1GOY A;  1NU3 A;  2B1X B;  2P05 A;  1VZZ A;  5AIH A;  1PY3 A;  3T0U A;  1IYY A;  3JVC A;  1IV7 A;  2QEX 3;  5G1L A;  5JPP A;  3NX0 A;  4HM0 B;  5EQL A;  4O3V A;  1AY7 A;  3G4S 3;  3EX9 A;  1FGO A;  3G6E 3;  2UUG C;  3AMO A;  3FF0 A;  4XM4 A;  1K41 A;  4FMA A;  1BNE A;  3FLJ A;  2A15 A;  7GSP A;  3DGM A;  1DVD A;  1W02 A;  3FZW A;  2W03 A;  1D6U A;  3M8C A;  5LC6 A;  4BTY A;  3IPT A;  4LMI A;  4N6U A;  3CCU 3;  5IEN A;  3NM7 A;  4WFO A;  2LQV A;  2F99 A;  1RGE A;  4XDV A;  3AGN A;  4FR9 A;  1BUQ A;  3CC2 3;  3HK4 A;  4HBR A;  3X3X A;  4HZ9 B;  4K61 A;  5M18 A;  1JB2 A;  2RBI A;  4N3V A;  3Q2P A;  1IU7 A;  1I2E A;  2OCT A;  5IG0 A;  3B4O A;  2P38 A;  3JUN A;  4KVH A;  5KP4 A;  1AV4 A;  2JQ5 A;  4TX4 A;  3I56 3;  4R4K A;  8RNT A;  2YX9 A;  3LXU X;  2XSH B;  2QIY A;  5IG4 A;  4ILF A;  3A76 A;  1RSN A;  3WDG B;  4AEQ A;  3ZFZ A;  1GYB A;  1BRH A;  4K90 B;  4X2H A;  1FUT A;  5AEW B;  3SYU A;  1PU4 A;  5GSP A;  1QAK A;  3DGO A;  6RNT A;  1GOV A;  2K54 A;  2WGO A;  1JN5 A;  2XF3 A;  2AAD A;  1BRK A;  2UX0 A;  3WOF B;  1VQ9 3;  2IY2 A;  3AHS A;  3OXA A;  2JDI H; 
#chains in the Genus database with same CATH homology
 2O3O A;  1OUN A;  4GB5 A;  2CG0 A;  3BND A;  3D3L A;  1GY7 A;  2HML B;  1K8A 4;  1ULJ B;  1CYU A;  2Q07 A;  3PXM A;  4R1K A;  1FGM A;  1W01 A;  3SXX A;  4H61 A;  3CCQ 3;  5AYR B;  2C11 A;  1W6Y A;  2W2C A;  1UUW B;  1FA3 A;  1OGZ A;  5KP1 A;  1D6Z A;  1LOX A;  2BHM A;  5JBS A;  1OH0 A;  3I0Y A;  4IPB A;  1TU5 A;  1QAL A;  4JRF A;  2OQE A;  4CDL A;  4N6M A;  3LT9 A;  1FGQ A;  5AIF A;  1OHP A;  5FW5 A;  4L8P A;  5CXO A;  1VQ6 3;  4JF8 A;  3AMO B;  1SJW A;  1IV9 A;  3NUV A;  3OW2 2;  1N9J A;  1Q82 4;  2CFD A;  1YHQ 3;  2PNC A;  4HKV B;  3NBB A;  3K9M C;  4R9K A;  3EQQ B;  1NWW A;  2CWV A;  4HM4 B;  3ER7 A;  2YFJ B;  3FH1 A;  1YGE A;  3LTA A;  5D81 A;  1GD3 A;  2PZV A;  4N6T A;  4OVM A;  5CF1 A;  1YIT 3;  3T8U A;  3B8L A;  3EB8 A;  3MG3 A;  1OHS A;  2CK3 H;  1VQO 3;  1QVG 2;  3KII A;  2GU3 A;  1IQY A;  3OV4 A;  3J7Y d;  2ML6 A;  5BXQ A;  1IDP A;  4HZB B;  2QA4 3;  3F7S A;  3BLZ A;  3FSD A;  3FF2 A;  4NRE A;  3BNB A;  1RKY A;  3T8N A;  3OWS A;  1VQK 3;  1JJ2 2;  1LNH A;  3MG2 A;  3NBR A;  5AIG A;  2KRT A;  2IUJ A;  1A2K A;  2IUK A;  1VQ4 3;  2OOV C;  1GD4 A;  3X42 A;  1SII A;  4WYK A;  1W00 A;  3G16 A;  1MOL A;  3VF1 A;  1Y4K A;  1K73 4;  4AKZ A;  1QAF A;  1OAC A;  2ML5 A;  2I9W A;  2XFS A;  1RRL A;  5AI1 A;  3CCV 3;  2HMO B;  4OK0 A;  3NBJ A;  3UB1 A;  3KN4 A;  5IW9 A;  3MG1 A;  4EXR A;  1WMO A;  1F8N A;  3EF8 A;  3GZY B;  3K7C A;  4NHF A;  1JKG B;  5D83 A;  4IT7 A;  1GY6 A;  1MNL A;  3ALA A;  3CCS 3;  2LYX A;  1YI2 3;  1O7N B;  3NM2 A;  3EJV A;  1ROV A;  4HM8 B;  3PS8 A;  5STD A;  3RGR A;  2FXT A;  1RRH A;  3STD A;  3WA3 A;  4R80 A;  1STD A;  1NO3 A;  4RNY A;  3HIG A;  3HZP A;  1OCV A;  3NV0 B;  3UL6 A;  1W5Z A;  1NB3 I;  3S28 A;  3GZR A;  3S27 A;  5JPU A;  2M7O A;  3H3H A;  1DMM A;  1US1 A;  3K63 A;  2CIU A;  4N6L A;  3OWU A;  1KD1 4;  1NDO B;  2GEY A;  5CK6 A;  2RCD A;  4IIA A;  4XB5 A;  1JRQ A;  4J8T A;  4MEI A;  1EG9 B;  1IT8 A;  2IMJ A;  4WP5 A;  1L5G B;  4WHA A;  3X41 A;  1CYV A;  4RZM A;  3CCJ 3;  3LTC A;  3QK9 A;  4CCV A;  1M90 4;  3CD6 3;  3WOD G;  5IEO A;  3CMA 3;  4HM5 B;  1GY5 A;  3IMA B;  1O7H B;  1W6G A;  1WQL B;  1TFO A;  3DUK A;  3DMC A;  3NQY A;  4HJL B;  2CFK A;  3N54 B;  3F14 A;  3CC7 3;  3SVA A;  3SX1 A;  3KSE D;  5HGR A;  2E2U A;  3FG1 A;  5LC7 A;  1KWI A;  1E97 A;  3S29 A;  4MMY B;  1W2Z A;  4XBX A;  3H51 A;  2E2T A;  2FGT A;  3FG4 A;  1YIJ 3;  5KP3 A;  3UL5 A;  2W04 A;  3O8Y A;  2WOF A;  2B24 B;  3OX9 A;  3GZB A;  3SOA A;  2XH9 A;  1ISK A;  2YFL B;  1VQM 3;  4G1M B;  3KFQ C;  1DMQ A;  4PEJ A;  4O02 B;  3PYJ A;  4H3U A;  2BT3 A;  3G0K A;  4MJD A;  1VQ8 3;  3HI7 A;  3G71 3;  5ELU A;  1E3R A;  1V74 A;  3L0R A;  3BNC A;  3HX8 A;  4KZ1 A;  2OTJ 3;  2XSO B;  2K0M A;  2Z7A A;  3EBY A;  4HM3 B;  1WMP A;  4BTX A;  1J2B A;  5DRV A;  2W0Q A;  3E99 A;  4LZI A;  2W6J H;  5TGN A;  1O7W B;  2Z76 A;  1O7M B;  1OHO A;  2P0M A;  2CC3 A;  3K0Z A;  1Q81 4;  1NB5 I;  4FCZ A;  1UI8 A;  3DGN A;  1HU9 A;  2CFL A;  2L4V A;  3CCR 3;  1JNQ A;  3PZW A;  2OOV A;  1K9M 4;  1O7G B;  2KXG A;  1QVF 2;  2CWT A;  1AR0 A;  1RN7 A;  3DM8 A;  3F9S A;  4FCM A;  1N5P A;  3F8X A;  2OWP A;  2XR8 B;  1HKX A;  2Y73 A;  6STD A;  2R4I A;  3N9H A;  4KFD A;  2QGU A;  3CC4 3;  4N6O B;  3UNL A;  4GL6 A;  1IVV A;  4KFF A;  5DRE A;  4K1U A;  3CNX A;  2D42 A;  3BNE A;  4FMB A;  3RDE A;  1KQS 2;  2OTL 3;  1WMN A;  1IVW A;  3LOY A;  2F98 A;  1NJI 4;  3X40 A;  4LSO A;  3KSP A;  1IQ8 A;  1FGR A;  3LYG A;  4EYC A;  3NHX A;  4HM7 B;  3IJE B;  3VGN A;  3CU3 A;  2BNG A;  4EC6 A;  1A90 A;  5IG5 A;  2CHC A;  1PFP A;  3CME 3;  1QMA A;  3FKA A;  1EA2 A;  3MKI A;  1Q40 B;  1ULI B;  3F40 A;  2CH9 A;  3F7X A;  1OPY A;  4FMD A;  1OGX A;  4HVN A;  5IF6 A;  2XGN A;  4AKY A;  1N8Q A;  1W4N A;  1KC8 4;  1SQW A;  2CW9 A;  4L7K A;  2WO0 A;  1U8C B;  3CPO A;  1FUW A;  3JUM A;  3CXC 2;  4J9A A;  1TUH A;  1U5O A;  2XRX B;  1S72 3;  3ECF A;  3GRD A;  1JKG A;  2KCD A;  3EHC A;  1CEW I;  4XBT A;  3MHE A;  2MF7 A;  4RNZ A;  3S5C A;  1UW1 A;  4X2O A;  3DY5 A;  1A67 A;  1LXE A;  4EV2 A;  1OF5 B;  3CPW 2;  3LT8 A;  3SOY A;  1N9E A;  1JB5 A;  1D6Y A;  5CLK A;  3SLU A;  4MMZ B;  3X3Z A;  1C7H A;  3WA2 X;  4EBG A;  2P0X A;  3K5T A;  3GAX A;  1Z1S A;  3G8Z A;  3HII A;  3DZL A;  3MPH A;  3KZT A;  2GXF A;  4FCJ A;  4HM6 B;  3U97 A;  5G2G A;  1W6C A;  3GWR A;  2F86 B;  1O7P B;  2W56 A;  2GU1 A;  1VQP 3;  3X3Y A;  3Q90 A;  3WOE B;  3RGA A;  1Q86 4;  3FG3 A;  4R9L A;  1TFK A;  4LGQ A;  2OQE C;  3KE7 A;  3V98 A;  7STD A;  3PCR A;  5ELJ A;  2HMJ B;  1W7C A;  4MMX B;  4XDW A;  1IK3 A;  3QRD A;  2RSX A;  3F8H A;  4K1V A;  1EQK A;  1IQX A;  3MSO A;  2BMQ B;  3CNM A;  5IER A;  2CKF B;  2HMN B;  1DVC A;  1G96 A;  3LH4 A;  2CWU A;  3FGY A;  3V99 A;  5CF2 A;  4O2H A;  2Y74 A;  3B7C A;  1IT7 A;  4RBN A;  1M1K 4;  1Q40 A;  1ZO2 A;  1ASK A;  1AVK A;  3KKG A;  5FGO A;  4N6V 0;  2CG1 A;  2E2V A;  1STF I;  3S67 A;  4N6N B;  1YJW 3;  3LTD A;  3ROB A;  4U13 A;  5A0O B;  3N8B A;  3Q1C A;  3BB9 A;  1TIJ A;  2GEX A;  4BTW A;  1W2B 2;  1SIH A;  5AEU B;  5EEO A;  2WOH A;  1FGT A;  2BMO B;  2HMM B;  2W9Q A;  3MWZ A;  1YVB I;  2XEP A;  1DMN A;  1N5H A;  1OF5 A;  1WTH A;  2SBL A;  3JUP A;  2D1W A;  8CHO A;  3EN1 B;  4ORL A;  3NXJ A;  1EKM A;  1Q42 A;  2Z6B A;  1ROA A;  2C10 A;  5AYS C;  1AVL A;  1S5A A;  2FNQ A;  1Q7Y 4;  1N8R 4;  2XGL A;  3V92 A;  2IA7 A;  3DXO A;  5EVH A;  1SPU A;  3VSY A;  1DYU A;  2ZDJ A;  2XFT A;  1QJG A;  1E3V A;  2Z77 A;  3GZX B;  3CCM 3;  1K28 A;  5IG3 A;  4Q53 A;  4QWT A;  1M1X B;  3EE1 A;  4FMC A;  2MC8 A;  2W56 B;  1YJN 3;  3EC9 A;  1JB4 A;  3UJM A;  4HM2 B;  3SED A;  1A2V A;  2ZL8 A;  4ZM8 A;  5BVB A;  3PGB A;  1M9G A;  1TP6 A;  2INX A;  4WWU C;  3LTB A;  3D9R A;  3JUO A;  3TDG A;  1IVX A;  1T5Y A;  2HMK B;  3LML A;  4I4K A;  2WGQ A;  1CQS A;  3B4P A;  4HYZ A;  4L8O A;  4OUQ A;  5AII A;  3CCE 3;  4HM1 B;  1VQN 3;  2BO9 B;  2CFW A;  1YJ9 3;  1UUV B;  2O9U X;  5D82 A;  4EV5 A;  2GBX B;  4WYK B;  3CCL 3;  2W9P A;  1R4C A;  4XBY A;  1RJO A;  1JN5 B;  1JV2 B;  2YFI B;  5I97 A;  3JUQ A;  2RGQ A;  3OWY A;  3WMD A;  4LEH A;  4O8S A;  1VQL 3;  2P09 A;  1IVU A;  3PCS A;  3MYT A;  2RFR A;  3U1W A;  2BMR B;  1VQ7 3;  1LVN A;  2GBW B;  1ZX2 A;  1KSI A;  1WNH A;  2STD A;  4KFE A;  2V1L A;  4STD A;  1VQ5 3;  3NQZ A;  3EN8 A;  3I55 3;  3LZA A;  3EBT A;  3FCS B;  3DGL A;  5IEP A;  1UI7 A;  3NV0 A;  2CFG A;  1GS3 A;  1NU3 A;  2B1X B;  2P05 A;  1VZZ A;  5AIH A;  3T0U A;  3JVC A;  1IV7 A;  2QEX 3;  5JPP A;  3NX0 A;  4HM0 B;  5EQL A;  4O3V A;  3G4S 3;  3EX9 A;  1FGO A;  3G6E 3;  3AMO A;  3FF0 A;  4XM4 A;  1K41 A;  4FMA A;  3FLJ A;  2A15 A;  3DGM A;  1DVD A;  1W02 A;  3FZW A;  2W03 A;  1D6U A;  3M8C A;  5LC6 A;  4BTY A;  3IPT A;  4LMI A;  4N6U A;  3CCU 3;  5IEN A;  3NM7 A;  4WFO A;  2LQV A;  2F99 A;  4XDV A;  4FR9 A;  1BUQ A;  3CC2 3;  3HK4 A;  4HBR A;  3X3X A;  4HZ9 B;  4K61 A;  1JB2 A;  4N3V A;  3Q2P A;  1IU7 A;  2OCT A;  5IG0 A;  3B4O A;  2P38 A;  3JUN A;  4KVH A;  5KP4 A;  1AV4 A;  2JQ5 A;  4TX4 A;  3I56 3;  4R4K A;  2YX9 A;  3LXU X;  2XSH B;  2QIY A;  5IG4 A;  3A76 A;  3WDG B;  4AEQ A;  1GYB A;  4K90 B;  4X2H A;  5AEW B;  1PU4 A;  1QAK A;  3DGO A;  2K54 A;  2WGO A;  1JN5 A;  2XF3 A;  2UX0 A;  3WOF B;  1VQ9 3;  3OXA A;  2JDI H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...