3EHCA

Crystal structure of a snoal-like polyketide cyclase (atu3018) from agrobacterium tumefaciens str. c58 at 2.12 a resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
127
structure length
127
Chain Sequence
b'MQTLNDIYLAYLDSLNHQAFDELGTFVDDNVEHNGRPFGLSGYRDMLVKDFADIPDLRFEAEILVSDATRLAARLFFDCTPKSIFMDLPVNGRRVQFCEHVFYDFEQAKIRRVWSVLDKVAIERQLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SnoaL-like polyketide cyclase
publication title Crystal structure of SnoaL-like polyketide cyclase (17741376) from AGROBACTERIUM TUMEFACIENS str. C58 (Dupont) at 2.12 A resolution
rcsb
source organism Agrobacterium tumefaciens str. c58
molecule tags Unknown function
total genus 38
structure length 127
sequence length 127
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07366 SnoaL SnoaL-like polyketide cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ehcA00
3CU3A 2JQ5A 1DMNA 1ZX2A 3DMCA 5AEUB 1GS3A 1OHOA 4HKVB 4R9KA 2Z77A 5KP4A 3ER7A 1W02A 4FCJA 5KP3A 2XRXB 3JUMA 3SEDA 3NUVA 1K41A 4WYKB 1Q40A 1EG9B 2IMJA 3STDA 2B24B 3KE7A 2GBXB 2RGQA 5JPPA 3DXOA 1OF5B 3F7SA 3RGAA 3G16A 8CHOA 5CK6A 3OWUA 4STDA 5TGNA 1SJWA 3KSPA 2OWPA 1OCVA 3EC9A 2W2CA 2HMOB 5FW5A 3GZYB 2HMLB 3MKIA 1NDOB 3H51A 3FKAA 5AIIA 3CNXA 4MJDA 4RZMA 4I4KA 1W00A 3GWRA 2BMRB 1ULIB 4PEJA 4ORLA 4XDVA 3HX8A 2INXA 3FLJA 3JUNA 4J9AA 3K7CA 3NXJA 1CQSA 3DM8A 1BUQA 4OUQA 3NM2A 3EBYA 2YFJB 3FGYA 4HZ9B 2RCDA 5D81A 1Q40B 3ROBA 3FF0A 3B4PA 1NWWA 4HJLB 3NV0B 3F14A 1GYBA 2CKFB 4HM2B 3MYTA 2A15A 3MG1A 1A2KA 3D9RA 5IG4A 1UUWB 3ECFA 1JN5A 4U13A 2HMMB 1HKXA 2F86B 3OV4A 4HM4B 3MHEA 5EVHA 5AEWB 4L7KA 3KKGA 4XB5A 3EX9A 3SOYA 3HK4A 1O7HB 5CF1A 3F8XA 3IPTA 3BB9A 1WQLB 1ASKA 1E3VA 1O7NB 3F9SA 3UJMA 3MG3A 4HM0B 5D82A 2HMNB 1O7WB 2B1XB 3OWYA 4X2HA 1JB4A 1JKGB 1IDPA 5KP1A 5CXOA 1U5OA 5IG0A 5D83A 4R1KA 5CLKA 2Z76A 1EA2A 2R4IA 3Q90A 3S5CA 3MG2A 1JN5B 3LZAA 5IG3A 2I9WA 5DRVA 1C7HA 5G2GA 4K1UA 3T8UA 1OUNA 1GY6A 2BMOB 3GRDA 1NU3A 3CNMA 1OGZA 3CPOA 2XSOB 1QMAA 4FCMA 3RGRA 3MSOA 2XR8B 4H3UA 2RFRA 3GZBA 4HM1B 2PZVA 5IENA 3UNLA 1STDA 2GEYA 3NBRA 5CF2A 5HGRA 4XBYA 3EN1B 3GZXB 1DMQA 1DMMA 1W6YA 1E3RA 3EF8A 2HMJB 3K0ZA 1O7MB 4OVMA 3SOAA 3EBTA 1ZO2A 5AIGA 3GZRA 3A76A 4L8PA 4XBTA 2Z7AA 3JUPA 3HZPA 3F8HA 1O7PB 1OPYA 1QJGA 4XBXA 4HM3B 1TUHA 4K1VA 1Z1SA 3T8NA 1ISKA 3VSYA 1ULJB 4HM8B 2XSHB 3KZTA 4IIAA 1GY7A 4GB5A 3G8ZA 3M8CA 3OX9A 3B8LA 4KVHA 4XDWA 2BNGA 2GEXA 1VZZA 5IEOA 5IG5A 4XM4A 3FH1A 3G0KA 1TP6A 2HMKB 3NV0A 3F40A 3EHCA 4HM7B 3H3HA 3EQQB 7STDA 2YFIB 5IF6A 2QIYA 5JPUA 2F99A 1GY5A 5DREA 1OHPA 6STDA 3FZWA 4CDLA 4L8OA 3EJVA 3F7XA 4HM6B 1E97A 2GBWB 5IEPA 3JUOA 3VGNA 4HM5B 4LGQA 1JB2A 3I0YA 1OH0A 5AI1A 2STDA 2F98A 1OGXA 3FF2A 5AIFA 3WMDA 5BXQA 4X2OA 4LEHA 3B4OA 5STDA 3JUQA 3FSDA 4WYKA 4HZBB 1UUVB 2BMQB 3OXAA 1OF5A 2CHCA 4R9LA 1JKGA 5BVBA 4WP5A 3LYGA 3BLZA 2GXFA 4HVNA 3EN8A 4LMIA 4Q53A 1W01A 4J8TA 5AIHA 2YFLB 2K54A 3DUKA 1JB5A 5IERA 1S5AA 4WWUC 1Q42A 4N3VA 3E99A 3DZLA 1O7GB 2UX0A 1OHSA 1AR0A 3OWSA 2QGUA 3NHXA 3B7CA
chains in the Genus database with same CATH superfamily
1YI23 3CU3A 3WODG 5G1LA 2JQ5A 1RLSA 1I70A 1ZX2A 3AHWA 3DMCA 5AEUB 1GS3A 1OHOA 4HKVB 1SQWA 4R9KA 1W4NA 2Z77A 2K0MA 4EV5A 5KP4A 3ER7A 1UCKA 1W02A 2IUKA 1YGEA 4FCJA 5KP3A 4MMZB 2GU1A 2XRXB 3JUMA 3SEDA 3NBBA 3NUVA 3CME3 7GSPA 1K41A 1W6GA 4WYKB 1Q40A 3PYJA 1EG9B 2ML5A 4R80A 2IMJA 3KN4A 3RDEA 3G713 3STDA 1DYUA 2B24B 4I5QA 3KE7A 2GBXB 2RGQA 3D3LA 3DXOA 1OF5B 5JPPA 3EE1A 3F7SA 4WFOA 3CCR3 1BAOA 1MNLA 5JBSA 3LTBA 2BHMA 5EQLA 4O8SA 2CFWA 3RGAA 2ZL8A 4KT3B 1NB3I 3G16A 8CHOA 5CK6A 2K3DA 1X1UA 3NBJA 3NQZA 3OWUA 3K9MC 4STDA 5TGNA 1SJWA 3N54B 2V1LA 3HIGA 3KSPA 2OWPA 4IT7A 1OCVA 2FNQA 2CK3H 2CX1A 2XFSA 1WMPA 1A2PA 3BNBA 3EC9A 2CWTA 2W2CA 4ILFA 1HZ1A 2HMOB 5FW5A 2CIUA 2P0XA 3KSED 3ZG5A 2CWUA 1GOVA 3CC23 1BNIA 1D6YA 2UUGC 3GZYB 1GD4A 1G96A 1R4CA 2HMLB 3MKIA 1NDOB 1RSNA 3H51A 3FKAA 5AIIA 8RNTA 3CNXA 4MJDA 1D6UA 1MGWA 4RZMA 1M1K4 4FR9A 1W00A 1IT7A 1QAKA 3GWRA 2YX9A 4I4KA 2BMRB 2KRTA 1ULIB 4N6MA 3X42A 4BIRA 1ZS7A 1JJ22 1BSEA 3LT9A 1KD14 4PEJA 1IQ8A 2LYXA 4ORLA 4XDVA 3SLUA 3HX8A 4J5GA 1RDSA 2INXA 3FLJA 1BSAA 3JUNA 3PS8A 4MMYB 4J9AA 3BNEA 3K7CA 3NXJA 2F4YA 1CQSA 1A2VA 2C10A 2CFGA 3DM8A 4K61A 4LYLB 1VQ83 1W7CA 1BUQA 4OUQA 1TIJA 3EBYA 3DGNA 3NM2A 3D4AA 1ROAA 3CCU3 2YFJB 3FGYA 4HZ9B 1GMQA 2RCDA 2Q07A 3RNTA 3CCM3 1G02A 3LT8A 5LC6A 5G1KA 3G6E3 9RNTA 3HI7A 1EEJA 4BL2A 1BGSA 1BNJA 1LOWA 4FCZA 4R4KA 1RCLA 5D81A 1YIJ3 1RKYA 1RN7A 3CC73 1Q40B 5BIRA 3ROBA 3FF0A 3BNCA 1Q7HA 4OK0A 1VQO3 3B4PA 1RCKA 2CH9A 1NWWA 3LXUX 4AKYA 1F8NA 1Q814 4HJLB 1MGRA 1ROVA 3FG3A 3NV0B 3F14A 1UUGB 4AEQA 1GYBA 2BIRA 1RGHA 2CKFB 2WOFA 4HM2B 1FGRA 1LOVA 4GL6A 5FGOA 1VQM3 1B2UA 4JF8A 1BRKA 4MEIA 1BRIA 1DVCA 3MYTA 2A15A 1VQ63 2W6JH 3MG1A 4KZ1A 5M18A 2W0QA 1A2KA 1BANA 2IYJA 3OWSA 1RRHA 3D9RA 5IG4A 1BNEA 1UUWB 2E2VA 4IPBA 2OTJ3 3ECFA 3V99A 4EBGA 1JN5A 2H0IA 4U13A 2HMMB 4J5KA 1N8R4 1HKXA 2F86B 3OV4A 3X3XA 1MWUA 4HM4B 3MHEA 5EVHA 4BTWA 1N5PA 5AEWB 1RMSA 1YIT3 3N9HA 4L7KA 4CCVA 1JBRA 1BUJA 3KKGA 1BNFA 1D6ZA 3D79A 5LC7A 1VQQA 1V74A 2CG0A 1VQ73 1T3BA 3DH2A 2CG1A 3CCJ3 3QK9A 1YJW3 3TDGA 2Y74A 1BU4A 2C11A 4KFEA 3BU4A 3EX9A 4XB5A 4HBRA 3NM7A 1FUSA 2D42A 1FGQA 3UB1A 4BTYA 4CPKA 3SOYA 3T0UA 1EQKA 2KF5A 3HK4A 2OTL3 3G4S3 1RNBA 3CCL3 5BXQA 1O7HB 5CF1A 3F8XA 2H0GA 3MPHA 1LQGC 1SPUA 1AV4A 1X1YA 1WQLB 1GD3A 2W56A 3BB9A 3IPTA 1ASKA 1N9JA 2FGTA 1VQL3 1RGGA 1FZUA 1HU9A 2WGOA 1E3VA 1MWRA 1O7NB 1RN1A 3A5EA 1DETA 3F9SA 3MG3A 4HM0B 4FMBA 2HMNB 1IT8A 5D82A 1JBTA 1B3SA 1W2ZA 1O7WB 1BRNL 2B1XB 3OWYA 4HOHA 3KFQC 4X2HA 3S28A 1I0VA 1JB4A 1PFPA 1JKGB 1IDPA 3X3ZA 3VF1A 5KP1A 1A90A 1B2MA 1JV2B 5CXOA 1U5OA 3LTCA 5IG0A 1FGTA 3JVCA 4RNZA 3WOFB 5D83A 4R1KA 1UW1A 5CLKA 1KSIA 1U8CB 1MWSA 2Z76A 1EA2A 4N6V0 2R4IA 3Q90A 1IQYA 2CFDA 5M1AA 2IUJA 1QALA 1I3FA 3S5CA 3SX1A 3MG2A 1YVBI 3DGMA 1JN5B 3LZAA 5IG3A 3D5GA 2I9WA 5DRVA 5M19A 1KC84 1N9EA 3DGOA 1I0XA 3ZG0A 1VQ43 2AAEA 2XGNA 1CYVA 2CX0A 1C7HA 3NX0A 5G2GA 3UL5A 4NHFA 3DGLA 1BRGA 1LRAA 4K1UA 3T8UA 2O3OA 2OOVA 1OUNA 3OW22 5A0OB 3BIRA 3LTDA 1UCIA 1GY6A 1IVVA 2BMOB 2E2UA 1IV7A 1BOXA 1BSCA 3GRDA 2BO9B 4EC6A 2BT3A 2P05A 2SARA 1RHLA 3V92A 1GMRA 3PGBA 1NU3A 1I2FA 2OQEA 3S67A 3CNMA 3WDGB 1OGZA 3CPOA 2XSOB 1QMAA 4FCMA 3RGRA 2OOVC 2CW9A 3PXMA 2W56B 1WTHA 3MSOA 4LZIA 1PYLA 4LSOA 1FUWA 4O02B 2XR8B 4HAAA 4H3UA 6RNTA 1FW7A 2KAAA 4BL3A 3Q3FA 1AVLA 4NPBA 1YJ93 2RFRA 4FMAA 1UGHI 2OQEC 3GZBA 2W04A 1BNRA 1I3IA 3SXXA 1DE3A 3AMOA 5HOHA 2HOHA 1KWIA 1T2IA 2KF4A 2P0MA 4HM1B 2PZVA 2RBIA 2WGQA 5IENA 2ML6A 3UNLA 1STDA 2ZA4A 1YVSA 1WNHA 2GEYA 3NBRA 3X41A 5CF2A 1VQ93 5HGRA 3AGNA 1JNQA 1LNIA 4XBYA 3EN1B 3PZWA 3CCV3 3GZXB 3IJEB 1FGOA 1VQ53 3WHOA 1DMQA 1STFI 1DMMA 1QVF2 1KQS2 1W6YA 1B27A 1RNTA 1E3RA 2WOHA 3EF8A 1PU4A 2XH9A 2Z6BA 2HMJB 3K0ZA 1VQK3 1UI7A 1IV9A 1O7MB 4OVMA 1S723 3SOAA 1LVNA 3CXC2 1FGMA 3EBTA 3KIIA 3LOYA 1ZO2A 5AIGA 3Q1CA 1EKMA 3WA3A 1VQP3 5ELUA 1C54A 1MWTA 4O3VA 3GZRA 1W2B2 4N6LA 3A76A 3GAXA 2KXGA 2BU4A 4L8PA 4N6NB 4XBTA 1SIIA 2P38A 1I2GA 1B21A 4G1MB 2WO0A 1YHQ3 1X1WA 3CPW2 1QAFA 2Z7AA 4GHOA 1AVKA 1UDII 2XFTA 3PCRA 4MMXB 5AYRB 2OCTA 1US1A 3HOHA 1Q9EA 3JUPA 1NO3A 4K90B 3HZPA 1BVIA 1IK3A 1RGLA 1Y4KA 2RSXA 3F8HA 1O7PB 3X3YA 3N8BA 1FYSA 1OPYA 2L4VA 1QJGA 4KFDA 1VQN3 1BRHA 4XBXA 1NJI4 4HM3B 2AADA 2F5MA 2W03A 3PCSA 1TUHA 1IVWA 4K1VA 1Z1SA 3T8NA 1N5HA 1ISKA 1TFOA 3I553 2XF3A 1TRPA 1HYFA 1L5GB 3VSYA 1I2EA 3Q2PA 1CH0A 1M9GA 1JZOA 1ULJB 3CCQ3 4WHAA 3UL6A 2XGLA 4HM8B 5I97A 4GSPA 2XSHB 1BRSA 5ELJA 2C4BA 4AKZA 1WMOA 1T5YA 2O9UX 3S29A 4BU4A 3KZTA 4IIAA 1GY7A 1W5ZA 2IY2A 2ZDJA 1FA3A 4GB5A 1BSBA 3G8ZA 3M8CA 3OX9A 3B8LA 4KVHA 4XDWA 1R4YA 1RJOA 1UI8A 2KF6A 2BNGA 2GEXA 1T2HA 3L0RA 1N8QA 1K734 2LQVA 1IVUA 1GMPA 1VZZA 2FXTA 3DY5A 4RNTA 1SARA 5IEOA 5IG5A 1TRQA 2CWVA 1M904 4XM4A 3FH1A 3G0KA 1TP6A 2HMKB 3NV0A 2QA43 1W6CA 1SIHA 2Y73A 3EHCA 3F40A 1LOXA 3CCS3 2QEX3 4HM7B 4ZM8A 2R41A 3H3HA 1J2BA 1GSPA 3EQQB 3CC43 7STDA 4EW5A 3GSPA 4EXRA 1RN4A 2YFIB 1K28A 3D5IA 1BNGA 5IF6A 3MWZA 2QIYA 4N6OB 1RGAA 1DVDA 1UGIA 3QRDA 3ALAA 5JPUA 2F99A 5BU4A 1GY5A 3FG4A 1Q824 5DREA 1OHPA 1BRJA 6STDA 1OACA 4N6UA 1TTOA 5IW9A 3FZWA 1RGKA 3AHSA 1G0TA 1JZDA 1AY7A 4L8OA 3U97A 4CDLA 1A67A 3LTAA 3EJVA 3F7XA 4FMCA 1YJN3 3LMLA 3X40A 2KCDA 3SVAA 3I563 2RNTA 1B2SA 1GOUA 1ZGXA 3CD63 1Q864 2UGIA 1MOLA 2W9QA 4HM6B 2IA7A 1LOYA 2F5WA 7RNTA 2KF3A 1E97A 1FUTA 1LQMB 1TFKA 2GBWB 3AGOA 5IEPA 3JUOA 1M1XB 4JRFA 3VGNA 2E2TA 3NQYA 4TX4A 3IMAB 1AQZA 4HM5B 3CMA3 4LGQA 1JB2A 3I0YA 1OH0A 2ZHXB 3BNDA 5AI1A 1B20A 3HIIA 3LH4A 2STDA 2GSPA 1BNSA 1YNVX 1OGXA 2F98A 1EUIC 1GOYA 1TJDA 3FF2A 5AIFA 3WMDA 1BSDA 4BTXA 1IQXA 2MF7A 4HYZA 4X2OA 1BIRA 4EV2A 4LEHA 2MC8A 1JBSA 1PY3A 1NB5I 2M7OA 2SBLA 3B4OA 2CFLA 5STDA 1RRLA 6GSPA 3JUQA 1IVXA 2XEPA 3FSDA 4WYKA 4HZBB 4QWTA 1UUVB 1LXEA 4NREA 3K5TA 1RGFA 3DGYA 4FMDA 2BMQB 3WOEB 3O8YA 3OXAA 1OF5A 4EYCA 2CHCA 3FG1A 2W9PA 4R9LA 1JKGA 1V58A 2GU3A 4RNYA 3URPA 1CEWI 2D1WA 1CYUA 1YGWA 2CFKA 1IYYA 3SYUA 3ZFZA 5BVBA 1RTUA 4WP5A 2F56A 2L1SA 1B2ZA 1JRQA 1IU7A 3LYGA 3BLZA 2GXFA 4KFFA 4HVNA 1LNHA 1Q7Y4 3EN8A 2PNCA 3EB8A 3K63A 4LMIA 1I8VA 4Q53A 3V98A 1V57A 1QVG2 1W01A 4J8TA 1RGCA 5AIHA 4N6TA 4CJNA 2J8XB 2JDIH 2YFLB 3FCSB 3J7Yd 2K54A 3DUKA 1JB5A 5IERA 1S5AA 2CC3A 4WWUC 1B2XA 1Q42A 4N3VA 3E99A 3U1WA 3CCE3 3S27A 1K9M4 3DZLA 3KCHA 4H61A 3WR2A 2H0HA 1X1XA 5GSPA 1TU5A 1K8A4 1WMNA 4RBNA 1NNVA 1O7GB 1UCLA 5EEOA 1UCJA 3WA2X 2UX0A 3UJMA 4O2HA 4DKIA 5AYSC 1OHSA 1AR0A 1RGEA 5RNTA 1DMNA 2QGUA 3AMOB 3NHXA 2P09A 3B7CA
chains in the Genus database with same CATH topology
1YI23 3CU3A 3WODG 2JQ5A 1ZX2A 3DMCA 5AEUB 1GS3A 1OHOA 4HKVB 1SQWA 4R9KA 1W4NA 2Z77A 2K0MA 4EV5A 5KP4A 3ER7A 1W02A 2IUKA 1YGEA 4FCJA 5KP3A 4MMZB 2GU1A 2XRXB 3JUMA 3SEDA 3NBBA 3NUVA 3CME3 1K41A 1W6GA 4WYKB 1Q40A 3PYJA 1EG9B 2ML5A 4R80A 2IMJA 3KN4A 3RDEA 3G713 3STDA 1DYUA 2B24B 3KE7A 2GBXB 2RGQA 3D3LA 3DXOA 1OF5B 5JPPA 3EE1A 3F7SA 4WFOA 3CCR3 1MNLA 5JBSA 3LTBA 2BHMA 4O8SA 2CFWA 3RGAA 2ZL8A 1NB3I 3G16A 8CHOA 5CK6A 3NBJA 3OWUA 3NQZA 3K9MC 4STDA 5TGNA 1SJWA 3N54B 2V1LA 3HIGA 3KSPA 2OWPA 4IT7A 1OCVA 2FNQA 2CK3H 2XFSA 3BNBA 1WMPA 3EC9A 1M1K4 2CWTA 2W2CA 2HMOB 5FW5A 2CIUA 2P0XA 3KSED 2CWUA 3CC23 1D6YA 3GZYB 1GD4A 1G96A 1R4CA 2HMLB 3MKIA 1NDOB 3H51A 3FKAA 5AIIA 3CNXA 4MJDA 1D6UA 4RZMA 4FR9A 1W00A 1IT7A 1QAKA 3GWRA 2YX9A 4I4KA 2BMRB 2KRTA 1ULIB 4N6MA 3X42A 1JJ22 3LT9A 1KD14 4PEJA 1IQ8A 2LYXA 4ORLA 4XDVA 3SLUA 3HX8A 2INXA 3FLJA 3JUNA 3PS8A 4MMYB 4J9AA 3BNEA 3K7CA 3NXJA 1CQSA 1A2VA 2C10A 2CFGA 3DM8A 4K61A 1VQ83 1W7CA 1BUQA 4OUQA 1TIJA 3EBYA 3DGNA 3NM2A 1ROAA 3CCU3 2YFJB 3FGYA 4HZ9B 2RCDA 2Q07A 3CCM3 3LT8A 5LC6A 3G6E3 3HI7A 5D81A 4R4KA 4FCZA 1YIJ3 1RKYA 1RN7A 3CC73 1Q40B 3ROBA 3FF0A 3BNCA 4OK0A 1VQO3 3B4PA 2CH9A 1NWWA 3LXUX 4AKYA 1F8NA 4HJLB 1ROVA 3FG3A 3NV0B 3F14A 4AEQA 1GYBA 2WOFA 2CKFB 5FGOA 4HM2B 1FGRA 4GL6A 1VQM3 4JF8A 4MEIA 1DVCA 3MYTA 2A15A 1VQ63 2W6JH 3MG1A 4KZ1A 2W0QA 1A2KA 3OWSA 1RRHA 3D9RA 5IG4A 1UUWB 2E2VA 4IPBA 2OTJ3 3ECFA 3V99A 4EBGA 1JN5A 4U13A 2HMMB 1N8R4 1HKXA 2F86B 3OV4A 3X3XA 4HM4B 3MHEA 5EVHA 4BTWA 1N5PA 5AEWB 1YIT3 3N9HA 4L7KA 4CCVA 3KKGA 1D6ZA 5LC7A 1V74A 2CG0A 1VQ73 2CG1A 3QK9A 1YJW3 3TDGA 2Y74A 2C11A 4KFEA 4XB5A 3EX9A 4HBRA 3NM7A 3UB1A 2D42A 1FGQA 4BTYA 3SOYA 3T0UA 1EQKA 3HK4A 2OTL3 3G4S3 3CCL3 1O7HB 5CF1A 3F8XA 3MPHA 1SPUA 3IPTA 1AV4A 2W56A 1WQLB 1GD3A 3BB9A 1ASKA 1N9JA 2FGTA 1VQL3 1HU9A 2WGOA 1E3VA 1O7NB 3F9SA 5EQLA 3UJMA 3MG3A 4HM0B 4FMBA 2HMNB 1IT8A 5D82A 1O7WB 1W2ZA 2B1XB 3OWYA 3S28A 3KFQC 4X2HA 1JB4A 1PFPA 1JKGB 1IDPA 3X3ZA 3VF1A 5KP1A 1A90A 1JV2B 5CXOA 1U5OA 3LTCA 5IG0A 1FGTA 3JVCA 4RNZA 3WOFB 5D83A 4R1KA 1UW1A 5CLKA 1KSIA 1U8CB 2Z76A 1EA2A 4N6V0 2R4IA 3Q90A 1IQYA 2CFDA 2IUJA 1QALA 3S5CA 3SX1A 3MG2A 1YVBI 3DGMA 1JN5B 3LZAA 5IG3A 2I9WA 5DRVA 1KC84 1N9EA 3DGOA 1VQ43 2XGNA 1CYVA 1C7HA 3NX0A 5G2GA 3UL5A 4NHFA 3DGLA 4K1UA 3T8UA 2O3OA 2OOVA 1OUNA 5A0OB 3LTDA 1GY6A 1IVVA 2BMOB 2E2UA 1IV7A 3GRDA 2BO9B 4EC6A 2BT3A 2P05A 3V92A 3PGBA 1NU3A 2OQEA 3S67A 3CNMA 3WDGB 1OGZA 3CPOA 2XSOB 1QMAA 4FCMA 3RGRA 2OOVC 2CW9A 3PXMA 2W56B 1WTHA 3MSOA 4LZIA 4LSOA 1FUWA 4O02B 2XR8B 4H3UA 1AVLA 1YJ93 2RFRA 4FMAA 2OQEC 3GZBA 2W04A 3SXXA 3AMOA 1KWIA 2P0MA 4HM1B 2PZVA 5IENA 2WGQA 2ML6A 3UNLA 1STDA 2GEYA 1WNHA 3X41A 3NBRA 5CF2A 1VQ93 5HGRA 4XBYA 1JNQA 3EN1B 3PZWA 3CCV3 3GZXB 3IJEB 1FGOA 1VQ53 1DMQA 1STFI 1DMMA 1QVF2 1KQS2 1W6YA 1E3RA 2WOHA 3EF8A 1PU4A 2XH9A 2Z6BA 2HMJB 3K0ZA 1VQK3 1UI7A 1IV9A 1O7MB 4OVMA 1S723 3SOAA 1LVNA 3CXC2 1FGMA 3EBTA 3KIIA 3LOYA 1ZO2A 5AIGA 3Q1CA 1EKMA 3WA3A 1VQP3 5ELUA 4O3VA 3GZRA 1W2B2 4N6LA 3A76A 3GAXA 2KXGA 4L8PA 4N6NB 4XBTA 1SIIA 2P38A 4G1MB 1YHQ3 2WO0A 3CPW2 1QAFA 2Z7AA 1AVKA 2XFTA 3PCRA 4MMXB 5AYRB 2OCTA 1US1A 3JUPA 1NO3A 4K90B 3HZPA 1IK3A 1Y4KA 2RSXA 3F8HA 1O7PB 3X3YA 3N8BA 2L4VA 1OPYA 1QJGA 4KFDA 1VQN3 4XBXA 1NJI4 4HM3B 2W03A 3PCSA 1TUHA 1IVWA 4K1VA 1Z1SA 3T8NA 1N5HA 1ISKA 1TFOA 3I553 2XF3A 3VSYA 1L5GB 3Q2PA 1M9GA 1ULJB 3CCQ3 4WHAA 3UL6A 2XGLA 4HM8B 5I97A 2XSHB 5ELJA 4AKZA 1WMOA 1T5YA 2O9UX 3S29A 3KZTA 4IIAA 1GY7A 1W5ZA 2ZDJA 1FA3A 4GB5A 3G8ZA 3M8CA 3OX9A 3B8LA 4KVHA 4XDWA 1RJOA 1UI8A 2BNGA 2GEXA 3L0RA 1N8QA 1K734 2LQVA 1IVUA 1VZZA 2FXTA 5IEOA 3DY5A 5IG5A 2CWVA 1M904 4XM4A 3FH1A 3G0KA 1TP6A 2HMKB 3NV0A 2QA43 1W6CA 1SIHA 2Y73A 3EHCA 3F40A 1LOXA 3CCS3 2QEX3 4HM7B 4ZM8A 3H3HA 1J2BA 3EQQB 3CC43 7STDA 4EXRA 2YFIB 1K28A 5IF6A 3MWZA 2QIYA 4N6OB 1DVDA 3QRDA 3ALAA 5JPUA 2F99A 1Q824 1GY5A 3FG4A 5DREA 1OHPA 6STDA 1OACA 4N6UA 5IW9A 3FZWA 3U97A 4CDLA 4L8OA 1A67A 3LTAA 3EJVA 3F7XA 4FMCA 1YJN3 3LMLA 3X40A 2KCDA 3SVAA 3I563 3CD63 1Q864 1MOLA 2W9QA 4HM6B 2IA7A 1E97A 2GBWB 5IEPA 1TFKA 3JUOA 1M1XB 4JRFA 3VGNA 2E2TA 3NQYA 4TX4A 3IMAB 4HM5B 3CMA3 4LGQA 1JB2A 3I0YA 1OH0A 3BNDA 5AI1A 3HIIA 3LH4A 2STDA 2F98A 1OGXA 3FF2A 5AIFA 4BTXA 3WMDA 5BXQA 4EV2A 3CCJ3 1IQXA 2MF7A 4HYZA 4X2OA 3OW22 1Q814 4LEHA 2MC8A 1NB5I 2M7OA 2SBLA 3B4OA 2CFLA 5STDA 1RRLA 3JUQA 1IVXA 2XEPA 3FSDA 4WYKA 4HZBB 4QWTA 1UUVB 1LXEA 4NREA 3K5TA 4FMDA 2BMQB 3WOEB 3O8YA 3OXAA 1OF5A 4EYCA 2CHCA 3FG1A 2W9PA 4R9LA 1JKGA 2GU3A 4RNYA 1CEWI 2D1WA 1CYUA 2CFKA 5BVBA 4WP5A 1JRQA 1IU7A 3LYGA 3BLZA 2GXFA 4KFFA 4HVNA 1LNHA 1Q7Y4 3EN8A 2PNCA 3EB8A 3K63A 4LMIA 3V98A 4Q53A 1QVG2 1W01A 4J8TA 5AIHA 4N6TA 2JDIH 2YFLB 3FCSB 3J7Yd 2K54A 3DUKA 1JB5A 5IERA 1S5AA 2CC3A 4WWUC 1Q42A 4N3VA 3E99A 3U1WA 3CCE3 3S27A 1K9M4 3DZLA 4H61A 1TU5A 1K8A4 1WMNA 4RBNA 1O7GB 5EEOA 3WA2X 2UX0A 4O2HA 5AYSC 1OHSA 1AR0A 1DMNA 2QGUA 3AMOB 3NHXA 2P09A 3B7CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CU3 A;  2JQ5 A;  1DMN A;  1ZX2 A;  3DMC A;  5AEU B;  1GS3 A;  1OHO A;  4HKV B;  4R9K A;  2Z77 A;  5KP4 A;  3ER7 A;  1W02 A;  4FCJ A;  5KP3 A;  2XRX B;  3JUM A;  3SED A;  3NUV A;  1K41 A;  4WYK B;  1Q40 A;  1EG9 B;  2IMJ A;  3STD A;  2B24 B;  3KE7 A;  2GBX B;  2RGQ A;  5JPP A;  3DXO A;  1OF5 B;  3F7S A;  3RGA A;  3G16 A;  8CHO A;  5CK6 A;  3OWU A;  4STD A;  5TGN A;  1SJW A;  3KSP A;  2OWP A;  1OCV A;  3EC9 A;  2W2C A;  2HMO B;  5FW5 A;  3GZY B;  2HML B;  3MKI A;  1NDO B;  3H51 A;  3FKA A;  5AII A;  3CNX A;  4MJD A;  4RZM A;  4I4K A;  1W00 A;  3GWR A;  2BMR B;  1ULI B;  4PEJ A;  4ORL A;  4XDV A;  3HX8 A;  2INX A;  3FLJ A;  3JUN A;  4J9A A;  3K7C A;  3NXJ A;  1CQS A;  3DM8 A;  1BUQ A;  4OUQ A;  3NM2 A;  3EBY A;  2YFJ B;  3FGY A;  4HZ9 B;  2RCD A;  5D81 A;  1Q40 B;  3ROB A;  3FF0 A;  3B4P A;  1NWW A;  4HJL B;  3NV0 B;  3F14 A;  1GYB A;  2CKF B;  4HM2 B;  3MYT A;  2A15 A;  3MG1 A;  1A2K A;  3D9R A;  5IG4 A;  1UUW B;  3ECF A;  1JN5 A;  4U13 A;  2HMM B;  1HKX A;  2F86 B;  3OV4 A;  4HM4 B;  3MHE A;  5EVH A;  5AEW B;  4L7K A;  3KKG A;  4XB5 A;  3EX9 A;  3SOY A;  3HK4 A;  1O7H B;  5CF1 A;  3F8X A;  3IPT A;  3BB9 A;  1WQL B;  1ASK A;  1E3V A;  1O7N B;  3F9S A;  3UJM A;  3MG3 A;  4HM0 B;  5D82 A;  2HMN B;  1O7W B;  2B1X B;  3OWY A;  4X2H A;  1JB4 A;  1JKG B;  1IDP A;  5KP1 A;  5CXO A;  1U5O A;  5IG0 A;  5D83 A;  4R1K A;  5CLK A;  2Z76 A;  1EA2 A;  2R4I A;  3Q90 A;  3S5C A;  3MG2 A;  1JN5 B;  3LZA A;  5IG3 A;  2I9W A;  5DRV A;  1C7H A;  5G2G A;  4K1U A;  3T8U A;  1OUN A;  1GY6 A;  2BMO B;  3GRD A;  1NU3 A;  3CNM A;  1OGZ A;  3CPO A;  2XSO B;  1QMA A;  4FCM A;  3RGR A;  3MSO A;  2XR8 B;  4H3U A;  2RFR A;  3GZB A;  4HM1 B;  2PZV A;  5IEN A;  3UNL A;  1STD A;  2GEY A;  3NBR A;  5CF2 A;  5HGR A;  4XBY A;  3EN1 B;  3GZX B;  1DMQ A;  1DMM A;  1W6Y A;  1E3R A;  3EF8 A;  2HMJ B;  3K0Z A;  1O7M B;  4OVM A;  3SOA A;  3EBT A;  1ZO2 A;  5AIG A;  3GZR A;  3A76 A;  4L8P A;  4XBT A;  2Z7A A;  3JUP A;  3HZP A;  3F8H A;  1O7P B;  1OPY A;  1QJG A;  4XBX A;  4HM3 B;  1TUH A;  4K1V A;  1Z1S A;  3T8N A;  1ISK A;  3VSY A;  1ULJ B;  4HM8 B;  2XSH B;  3KZT A;  4IIA A;  1GY7 A;  4GB5 A;  3G8Z A;  3M8C A;  3OX9 A;  3B8L A;  4KVH A;  4XDW A;  2BNG A;  2GEX A;  1VZZ A;  5IEO A;  5IG5 A;  4XM4 A;  3FH1 A;  3G0K A;  1TP6 A;  2HMK B;  3NV0 A;  3F40 A;  3EHC A;  4HM7 B;  3H3H A;  3EQQ B;  7STD A;  2YFI B;  5IF6 A;  2QIY A;  5JPU A;  2F99 A;  1GY5 A;  5DRE A;  1OHP A;  6STD A;  3FZW A;  4CDL A;  4L8O A;  3EJV A;  3F7X A;  4HM6 B;  1E97 A;  2GBW B;  5IEP A;  3JUO A;  3VGN A;  4HM5 B;  4LGQ A;  1JB2 A;  3I0Y A;  1OH0 A;  5AI1 A;  2STD A;  2F98 A;  1OGX A;  3FF2 A;  5AIF A;  3WMD A;  5BXQ A;  4X2O A;  4LEH A;  3B4O A;  5STD A;  3JUQ A;  3FSD A;  4WYK A;  4HZB B;  1UUV B;  2BMQ B;  3OXA A;  1OF5 A;  2CHC A;  4R9L A;  1JKG A;  5BVB A;  4WP5 A;  3LYG A;  3BLZ A;  2GXF A;  4HVN A;  3EN8 A;  4LMI A;  4Q53 A;  1W01 A;  4J8T A;  5AIH A;  2YFL B;  2K54 A;  3DUK A;  1JB5 A;  5IER A;  1S5A A;  4WWU C;  1Q42 A;  4N3V A;  3E99 A;  3DZL A;  1O7G B;  2UX0 A;  1OHS A;  1AR0 A;  3OWS A;  2QGU A;  3NHX A;  3B7C A; 
#chains in the Genus database with same CATH topology
 1YI2 3;  3CU3 A;  3WOD G;  5G1L A;  2JQ5 A;  1RLS A;  1I70 A;  1ZX2 A;  3AHW A;  3DMC A;  5AEU B;  1GS3 A;  1OHO A;  4HKV B;  1SQW A;  4R9K A;  1W4N A;  2Z77 A;  2K0M A;  4EV5 A;  5KP4 A;  3ER7 A;  1UCK A;  1W02 A;  2IUK A;  1YGE A;  4FCJ A;  5KP3 A;  4MMZ B;  2GU1 A;  2XRX B;  3JUM A;  3SED A;  3NBB A;  3NUV A;  3CME 3;  7GSP A;  1K41 A;  1W6G A;  4WYK B;  1Q40 A;  3PYJ A;  1EG9 B;  2ML5 A;  4R80 A;  2IMJ A;  3KN4 A;  3RDE A;  3G71 3;  3STD A;  1DYU A;  2B24 B;  4I5Q A;  3KE7 A;  2GBX B;  2RGQ A;  3D3L A;  3DXO A;  1OF5 B;  5JPP A;  3EE1 A;  3F7S A;  4WFO A;  3CCR 3;  1BAO A;  1MNL A;  5JBS A;  3LTB A;  2BHM A;  5EQL A;  4O8S A;  2CFW A;  3RGA A;  2ZL8 A;  4KT3 B;  1NB3 I;  3G16 A;  8CHO A;  5CK6 A;  2K3D A;  1X1U A;  3NBJ A;  3NQZ A;  3OWU A;  3K9M C;  4STD A;  5TGN A;  1SJW A;  3N54 B;  2V1L A;  3HIG A;  3KSP A;  2OWP A;  4IT7 A;  1OCV A;  2FNQ A;  2CK3 H;  2CX1 A;  2XFS A;  1WMP A;  1A2P A;  3BNB A;  3EC9 A;  2CWT A;  2W2C A;  4ILF A;  1HZ1 A;  2HMO B;  5FW5 A;  2CIU A;  2P0X A;  3KSE D;  3ZG5 A;  2CWU A;  1GOV A;  3CC2 3;  1BNI A;  1D6Y A;  2UUG C;  3GZY B;  1GD4 A;  1G96 A;  1R4C A;  2HML B;  3MKI A;  1NDO B;  1RSN A;  3H51 A;  3FKA A;  5AII A;  8RNT A;  3CNX A;  4MJD A;  1D6U A;  1MGW A;  4RZM A;  1M1K 4;  4FR9 A;  1W00 A;  1IT7 A;  1QAK A;  3GWR A;  2YX9 A;  4I4K A;  2BMR B;  2KRT A;  1ULI B;  4N6M A;  3X42 A;  4BIR A;  1ZS7 A;  1JJ2 2;  1BSE A;  3LT9 A;  1KD1 4;  4PEJ A;  1IQ8 A;  2LYX A;  4ORL A;  4XDV A;  3SLU A;  3HX8 A;  4J5G A;  1RDS A;  2INX A;  3FLJ A;  1BSA A;  3JUN A;  3PS8 A;  4MMY B;  4J9A A;  3BNE A;  3K7C A;  3NXJ A;  2F4Y A;  1CQS A;  1A2V A;  2C10 A;  2CFG A;  3DM8 A;  4K61 A;  4LYL B;  1VQ8 3;  1W7C A;  1BUQ A;  4OUQ A;  1TIJ A;  3EBY A;  3DGN A;  3NM2 A;  3D4A A;  1ROA A;  3CCU 3;  2YFJ B;  3FGY A;  4HZ9 B;  1GMQ A;  2RCD A;  2Q07 A;  3RNT A;  3CCM 3;  1G02 A;  3LT8 A;  5LC6 A;  5G1K A;  3G6E 3;  9RNT A;  3HI7 A;  1EEJ A;  4BL2 A;  1BGS A;  1BNJ A;  1LOW A;  4FCZ A;  4R4K A;  1RCL A;  5D81 A;  1YIJ 3;  1RKY A;  1RN7 A;  3CC7 3;  1Q40 B;  5BIR A;  3ROB A;  3FF0 A;  3BNC A;  1Q7H A;  4OK0 A;  1VQO 3;  3B4P A;  1RCK A;  2CH9 A;  1NWW A;  3LXU X;  4AKY A;  1F8N A;  1Q81 4;  4HJL B;  1MGR A;  1ROV A;  3FG3 A;  3NV0 B;  3F14 A;  1UUG B;  4AEQ A;  1GYB A;  2BIR A;  1RGH A;  2CKF B;  2WOF A;  4HM2 B;  1FGR A;  1LOV A;  4GL6 A;  5FGO A;  1VQM 3;  1B2U A;  4JF8 A;  1BRK A;  4MEI A;  1BRI A;  1DVC A;  3MYT A;  2A15 A;  1VQ6 3;  2W6J H;  3MG1 A;  4KZ1 A;  5M18 A;  2W0Q A;  1A2K A;  1BAN A;  2IYJ A;  3OWS A;  1RRH A;  3D9R A;  5IG4 A;  1BNE A;  1UUW B;  2E2V A;  4IPB A;  2OTJ 3;  3ECF A;  3V99 A;  4EBG A;  1JN5 A;  2H0I A;  4U13 A;  2HMM B;  4J5K A;  1N8R 4;  1HKX A;  2F86 B;  3OV4 A;  3X3X A;  1MWU A;  4HM4 B;  3MHE A;  5EVH A;  4BTW A;  1N5P A;  5AEW B;  1RMS A;  1YIT 3;  3N9H A;  4L7K A;  4CCV A;  1JBR A;  1BUJ A;  3KKG A;  1BNF A;  1D6Z A;  3D79 A;  5LC7 A;  1VQQ A;  1V74 A;  2CG0 A;  1VQ7 3;  1T3B A;  3DH2 A;  2CG1 A;  3CCJ 3;  3QK9 A;  1YJW 3;  3TDG A;  2Y74 A;  1BU4 A;  2C11 A;  4KFE A;  3BU4 A;  3EX9 A;  4XB5 A;  4HBR A;  3NM7 A;  1FUS A;  2D42 A;  1FGQ A;  3UB1 A;  4BTY A;  4CPK A;  3SOY A;  3T0U A;  1EQK A;  2KF5 A;  3HK4 A;  2OTL 3;  3G4S 3;  1RNB A;  3CCL 3;  5BXQ A;  1O7H B;  5CF1 A;  3F8X A;  2H0G A;  3MPH A;  1LQG C;  1SPU A;  1AV4 A;  1X1Y A;  1WQL B;  1GD3 A;  2W56 A;  3BB9 A;  3IPT A;  1ASK A;  1N9J A;  2FGT A;  1VQL 3;  1RGG A;  1FZU A;  1HU9 A;  2WGO A;  1E3V A;  1MWR A;  1O7N B;  1RN1 A;  3A5E A;  1DET A;  3F9S A;  3MG3 A;  4HM0 B;  4FMB A;  2HMN B;  1IT8 A;  5D82 A;  1JBT A;  1B3S A;  1W2Z A;  1O7W B;  1BRN L;  2B1X B;  3OWY A;  4HOH A;  3KFQ C;  4X2H A;  3S28 A;  1I0V A;  1JB4 A;  1PFP A;  1JKG B;  1IDP A;  3X3Z A;  3VF1 A;  5KP1 A;  1A90 A;  1B2M A;  1JV2 B;  5CXO A;  1U5O A;  3LTC A;  5IG0 A;  1FGT A;  3JVC A;  4RNZ A;  3WOF B;  5D83 A;  4R1K A;  1UW1 A;  5CLK A;  1KSI A;  1U8C B;  1MWS A;  2Z76 A;  1EA2 A;  4N6V 0;  2R4I A;  3Q90 A;  1IQY A;  2CFD A;  5M1A A;  2IUJ A;  1QAL A;  1I3F A;  3S5C A;  3SX1 A;  3MG2 A;  1YVB I;  3DGM A;  1JN5 B;  3LZA A;  5IG3 A;  3D5G A;  2I9W A;  5DRV A;  5M19 A;  1KC8 4;  1N9E A;  3DGO A;  1I0X A;  3ZG0 A;  1VQ4 3;  2AAE A;  2XGN A;  1CYV A;  2CX0 A;  1C7H A;  3NX0 A;  5G2G A;  3UL5 A;  4NHF A;  3DGL A;  1BRG A;  1LRA A;  4K1U A;  3T8U A;  2O3O A;  2OOV A;  1OUN A;  3OW2 2;  5A0O B;  3BIR A;  3LTD A;  1UCI A;  1GY6 A;  1IVV A;  2BMO B;  2E2U A;  1IV7 A;  1BOX A;  1BSC A;  3GRD A;  2BO9 B;  4EC6 A;  2BT3 A;  2P05 A;  2SAR A;  1RHL A;  3V92 A;  1GMR A;  3PGB A;  1NU3 A;  1I2F A;  2OQE A;  3S67 A;  3CNM A;  3WDG B;  1OGZ A;  3CPO A;  2XSO B;  1QMA A;  4FCM A;  3RGR A;  2OOV C;  2CW9 A;  3PXM A;  2W56 B;  1WTH A;  3MSO A;  4LZI A;  1PYL A;  4LSO A;  1FUW A;  4O02 B;  2XR8 B;  4HAA A;  4H3U A;  6RNT A;  1FW7 A;  2KAA A;  4BL3 A;  3Q3F A;  1AVL A;  4NPB A;  1YJ9 3;  2RFR A;  4FMA A;  1UGH I;  2OQE C;  3GZB A;  2W04 A;  1BNR A;  1I3I A;  3SXX A;  1DE3 A;  3AMO A;  5HOH A;  2HOH A;  1KWI A;  1T2I A;  2KF4 A;  2P0M A;  4HM1 B;  2PZV A;  2RBI A;  2WGQ A;  5IEN A;  2ML6 A;  3UNL A;  1STD A;  2ZA4 A;  1YVS A;  1WNH A;  2GEY A;  3NBR A;  3X41 A;  5CF2 A;  1VQ9 3;  5HGR A;  3AGN A;  1JNQ A;  1LNI A;  4XBY A;  3EN1 B;  3PZW A;  3CCV 3;  3GZX B;  3IJE B;  1FGO A;  1VQ5 3;  3WHO A;  1DMQ A;  1STF I;  1DMM A;  1QVF 2;  1KQS 2;  1W6Y A;  1B27 A;  1RNT A;  1E3R A;  2WOH A;  3EF8 A;  1PU4 A;  2XH9 A;  2Z6B A;  2HMJ B;  3K0Z A;  1VQK 3;  1UI7 A;  1IV9 A;  1O7M B;  4OVM A;  1S72 3;  3SOA A;  1LVN A;  3CXC 2;  1FGM A;  3EBT A;  3KII A;  3LOY A;  1ZO2 A;  5AIG A;  3Q1C A;  1EKM A;  3WA3 A;  1VQP 3;  5ELU A;  1C54 A;  1MWT A;  4O3V A;  3GZR A;  1W2B 2;  4N6L A;  3A76 A;  3GAX A;  2KXG A;  2BU4 A;  4L8P A;  4N6N B;  4XBT A;  1SII A;  2P38 A;  1I2G A;  1B21 A;  4G1M B;  2WO0 A;  1YHQ 3;  1X1W A;  3CPW 2;  1QAF A;  2Z7A A;  4GHO A;  1AVK A;  1UDI I;  2XFT A;  3PCR A;  4MMX B;  5AYR B;  2OCT A;  1US1 A;  3HOH A;  1Q9E A;  3JUP A;  1NO3 A;  4K90 B;  3HZP A;  1BVI A;  1IK3 A;  1RGL A;  1Y4K A;  2RSX A;  3F8H A;  1O7P B;  3X3Y A;  3N8B A;  1FYS A;  1OPY A;  2L4V A;  1QJG A;  4KFD A;  1VQN 3;  1BRH A;  4XBX A;  1NJI 4;  4HM3 B;  2AAD A;  2F5M A;  2W03 A;  3PCS A;  1TUH A;  1IVW A;  4K1V A;  1Z1S A;  3T8N A;  1N5H A;  1ISK A;  1TFO A;  3I55 3;  2XF3 A;  1TRP A;  1HYF A;  1L5G B;  3VSY A;  1I2E A;  3Q2P A;  1CH0 A;  1M9G A;  1JZO A;  1ULJ B;  3CCQ 3;  4WHA A;  3UL6 A;  2XGL A;  4HM8 B;  5I97 A;  4GSP A;  2XSH B;  1BRS A;  5ELJ A;  2C4B A;  4AKZ A;  1WMO A;  1T5Y A;  2O9U X;  3S29 A;  4BU4 A;  3KZT A;  4IIA A;  1GY7 A;  1W5Z A;  2IY2 A;  2ZDJ A;  1FA3 A;  4GB5 A;  1BSB A;  3G8Z A;  3M8C A;  3OX9 A;  3B8L A;  4KVH A;  4XDW A;  1R4Y A;  1RJO A;  1UI8 A;  2KF6 A;  2BNG A;  2GEX A;  1T2H A;  3L0R A;  1N8Q A;  1K73 4;  2LQV A;  1IVU A;  1GMP A;  1VZZ A;  2FXT A;  3DY5 A;  4RNT A;  1SAR A;  5IEO A;  5IG5 A;  1TRQ A;  2CWV A;  1M90 4;  4XM4 A;  3FH1 A;  3G0K A;  1TP6 A;  2HMK B;  3NV0 A;  2QA4 3;  1W6C A;  1SIH A;  2Y73 A;  3EHC A;  3F40 A;  1LOX A;  3CCS 3;  2QEX 3;  4HM7 B;  4ZM8 A;  2R41 A;  3H3H A;  1J2B A;  1GSP A;  3EQQ B;  3CC4 3;  7STD A;  4EW5 A;  3GSP A;  4EXR A;  1RN4 A;  2YFI B;  1K28 A;  3D5I A;  1BNG A;  5IF6 A;  3MWZ A;  2QIY A;  4N6O B;  1RGA A;  1DVD A;  1UGI A;  3QRD A;  3ALA A;  5JPU A;  2F99 A;  5BU4 A;  1GY5 A;  3FG4 A;  1Q82 4;  5DRE A;  1OHP A;  1BRJ A;  6STD A;  1OAC A;  4N6U A;  1TTO A;  5IW9 A;  3FZW A;  1RGK A;  3AHS A;  1G0T A;  1JZD A;  1AY7 A;  4L8O A;  3U97 A;  4CDL A;  1A67 A;  3LTA A;  3EJV A;  3F7X A;  4FMC A;  1YJN 3;  3LML A;  3X40 A;  2KCD A;  3SVA A;  3I56 3;  2RNT A;  1B2S A;  1GOU A;  1ZGX A;  3CD6 3;  1Q86 4;  2UGI A;  1MOL A;  2W9Q A;  4HM6 B;  2IA7 A;  1LOY A;  2F5W A;  7RNT A;  2KF3 A;  1E97 A;  1FUT A;  1LQM B;  1TFK A;  2GBW B;  3AGO A;  5IEP A;  3JUO A;  1M1X B;  4JRF A;  3VGN A;  2E2T A;  3NQY A;  4TX4 A;  3IMA B;  1AQZ A;  4HM5 B;  3CMA 3;  4LGQ A;  1JB2 A;  3I0Y A;  1OH0 A;  2ZHX B;  3BND A;  5AI1 A;  1B20 A;  3HII A;  3LH4 A;  2STD A;  2GSP A;  1BNS A;  1YNV X;  1OGX A;  2F98 A;  1EUI C;  1GOY A;  1TJD A;  3FF2 A;  5AIF A;  3WMD A;  1BSD A;  4BTX A;  1IQX A;  2MF7 A;  4HYZ A;  4X2O A;  1BIR A;  4EV2 A;  4LEH A;  2MC8 A;  1JBS A;  1PY3 A;  1NB5 I;  2M7O A;  2SBL A;  3B4O A;  2CFL A;  5STD A;  1RRL A;  6GSP A;  3JUQ A;  1IVX A;  2XEP A;  3FSD A;  4WYK A;  4HZB B;  4QWT A;  1UUV B;  1LXE A;  4NRE A;  3K5T A;  1RGF A;  3DGY A;  4FMD A;  2BMQ B;  3WOE B;  3O8Y A;  3OXA A;  1OF5 A;  4EYC A;  2CHC A;  3FG1 A;  2W9P A;  4R9L A;  1JKG A;  1V58 A;  2GU3 A;  4RNY A;  3URP A;  1CEW I;  2D1W A;  1CYU A;  1YGW A;  2CFK A;  1IYY A;  3SYU A;  3ZFZ A;  5BVB A;  1RTU A;  4WP5 A;  2F56 A;  2L1S A;  1B2Z A;  1JRQ A;  1IU7 A;  3LYG A;  3BLZ A;  2GXF A;  4KFF A;  4HVN A;  1LNH A;  1Q7Y 4;  3EN8 A;  2PNC A;  3EB8 A;  3K63 A;  4LMI A;  1I8V A;  4Q53 A;  3V98 A;  1V57 A;  1QVG 2;  1W01 A;  4J8T A;  1RGC A;  5AIH A;  4N6T A;  4CJN A;  2J8X B;  2JDI H;  2YFL B;  3FCS B;  3J7Y d;  2K54 A;  3DUK A;  1JB5 A;  5IER A;  1S5A A;  2CC3 A;  4WWU C;  1B2X A;  1Q42 A;  4N3V A;  3E99 A;  3U1W A;  3CCE 3;  3S27 A;  1K9M 4;  3DZL A;  3KCH A;  4H61 A;  3WR2 A;  2H0H A;  1X1X A;  5GSP A;  1TU5 A;  1K8A 4;  1WMN A;  4RBN A;  1NNV A;  1O7G B;  1UCL A;  5EEO A;  1UCJ A;  3WA2 X;  2UX0 A;  3UJM A;  4O2H A;  4DKI A;  5AYS C;  1OHS A;  1AR0 A;  1RGE A;  5RNT A;  1DMN A;  2QGU A;  3AMO B;  3NHX A;  2P09 A;  3B7C A; 
#chains in the Genus database with same CATH homology
 1YI2 3;  3CU3 A;  3WOD G;  2JQ5 A;  1ZX2 A;  3DMC A;  5AEU B;  1GS3 A;  1OHO A;  4HKV B;  1SQW A;  4R9K A;  1W4N A;  2Z77 A;  2K0M A;  4EV5 A;  5KP4 A;  3ER7 A;  1W02 A;  2IUK A;  1YGE A;  4FCJ A;  5KP3 A;  4MMZ B;  2GU1 A;  2XRX B;  3JUM A;  3SED A;  3NBB A;  3NUV A;  3CME 3;  1K41 A;  1W6G A;  4WYK B;  1Q40 A;  3PYJ A;  1EG9 B;  2ML5 A;  4R80 A;  2IMJ A;  3KN4 A;  3RDE A;  3G71 3;  3STD A;  1DYU A;  2B24 B;  3KE7 A;  2GBX B;  2RGQ A;  3D3L A;  3DXO A;  1OF5 B;  5JPP A;  3EE1 A;  3F7S A;  4WFO A;  3CCR 3;  1MNL A;  5JBS A;  3LTB A;  2BHM A;  4O8S A;  2CFW A;  3RGA A;  2ZL8 A;  1NB3 I;  3G16 A;  8CHO A;  5CK6 A;  3NBJ A;  3OWU A;  3NQZ A;  3K9M C;  4STD A;  5TGN A;  1SJW A;  3N54 B;  2V1L A;  3HIG A;  3KSP A;  2OWP A;  4IT7 A;  1OCV A;  2FNQ A;  2CK3 H;  2XFS A;  3BNB A;  1WMP A;  3EC9 A;  1M1K 4;  2CWT A;  2W2C A;  2HMO B;  5FW5 A;  2CIU A;  2P0X A;  3KSE D;  2CWU A;  3CC2 3;  1D6Y A;  3GZY B;  1GD4 A;  1G96 A;  1R4C A;  2HML B;  3MKI A;  1NDO B;  3H51 A;  3FKA A;  5AII A;  3CNX A;  4MJD A;  1D6U A;  4RZM A;  4FR9 A;  1W00 A;  1IT7 A;  1QAK A;  3GWR A;  2YX9 A;  4I4K A;  2BMR B;  2KRT A;  1ULI B;  4N6M A;  3X42 A;  1JJ2 2;  3LT9 A;  1KD1 4;  4PEJ A;  1IQ8 A;  2LYX A;  4ORL A;  4XDV A;  3SLU A;  3HX8 A;  2INX A;  3FLJ A;  3JUN A;  3PS8 A;  4MMY B;  4J9A A;  3BNE A;  3K7C A;  3NXJ A;  1CQS A;  1A2V A;  2C10 A;  2CFG A;  3DM8 A;  4K61 A;  1VQ8 3;  1W7C A;  1BUQ A;  4OUQ A;  1TIJ A;  3EBY A;  3DGN A;  3NM2 A;  1ROA A;  3CCU 3;  2YFJ B;  3FGY A;  4HZ9 B;  2RCD A;  2Q07 A;  3CCM 3;  3LT8 A;  5LC6 A;  3G6E 3;  3HI7 A;  5D81 A;  4R4K A;  4FCZ A;  1YIJ 3;  1RKY A;  1RN7 A;  3CC7 3;  1Q40 B;  3ROB A;  3FF0 A;  3BNC A;  4OK0 A;  1VQO 3;  3B4P A;  2CH9 A;  1NWW A;  3LXU X;  4AKY A;  1F8N A;  4HJL B;  1ROV A;  3FG3 A;  3NV0 B;  3F14 A;  4AEQ A;  1GYB A;  2WOF A;  2CKF B;  5FGO A;  4HM2 B;  1FGR A;  4GL6 A;  1VQM 3;  4JF8 A;  4MEI A;  1DVC A;  3MYT A;  2A15 A;  1VQ6 3;  2W6J H;  3MG1 A;  4KZ1 A;  2W0Q A;  1A2K A;  3OWS A;  1RRH A;  3D9R A;  5IG4 A;  1UUW B;  2E2V A;  4IPB A;  2OTJ 3;  3ECF A;  3V99 A;  4EBG A;  1JN5 A;  4U13 A;  2HMM B;  1N8R 4;  1HKX A;  2F86 B;  3OV4 A;  3X3X A;  4HM4 B;  3MHE A;  5EVH A;  4BTW A;  1N5P A;  5AEW B;  1YIT 3;  3N9H A;  4L7K A;  4CCV A;  3KKG A;  1D6Z A;  5LC7 A;  1V74 A;  2CG0 A;  1VQ7 3;  2CG1 A;  3QK9 A;  1YJW 3;  3TDG A;  2Y74 A;  2C11 A;  4KFE A;  4XB5 A;  3EX9 A;  4HBR A;  3NM7 A;  3UB1 A;  2D42 A;  1FGQ A;  4BTY A;  3SOY A;  3T0U A;  1EQK A;  3HK4 A;  2OTL 3;  3G4S 3;  3CCL 3;  1O7H B;  5CF1 A;  3F8X A;  3MPH A;  1SPU A;  3IPT A;  1AV4 A;  2W56 A;  1WQL B;  1GD3 A;  3BB9 A;  1ASK A;  1N9J A;  2FGT A;  1VQL 3;  1HU9 A;  2WGO A;  1E3V A;  1O7N B;  3F9S A;  5EQL A;  3UJM A;  3MG3 A;  4HM0 B;  4FMB A;  2HMN B;  1IT8 A;  5D82 A;  1O7W B;  1W2Z A;  2B1X B;  3OWY A;  3S28 A;  3KFQ C;  4X2H A;  1JB4 A;  1PFP A;  1JKG B;  1IDP A;  3X3Z A;  3VF1 A;  5KP1 A;  1A90 A;  1JV2 B;  5CXO A;  1U5O A;  3LTC A;  5IG0 A;  1FGT A;  3JVC A;  4RNZ A;  3WOF B;  5D83 A;  4R1K A;  1UW1 A;  5CLK A;  1KSI A;  1U8C B;  2Z76 A;  1EA2 A;  4N6V 0;  2R4I A;  3Q90 A;  1IQY A;  2CFD A;  2IUJ A;  1QAL A;  3S5C A;  3SX1 A;  3MG2 A;  1YVB I;  3DGM A;  1JN5 B;  3LZA A;  5IG3 A;  2I9W A;  5DRV A;  1KC8 4;  1N9E A;  3DGO A;  1VQ4 3;  2XGN A;  1CYV A;  1C7H A;  3NX0 A;  5G2G A;  3UL5 A;  4NHF A;  3DGL A;  4K1U A;  3T8U A;  2O3O A;  2OOV A;  1OUN A;  5A0O B;  3LTD A;  1GY6 A;  1IVV A;  2BMO B;  2E2U A;  1IV7 A;  3GRD A;  2BO9 B;  4EC6 A;  2BT3 A;  2P05 A;  3V92 A;  3PGB A;  1NU3 A;  2OQE A;  3S67 A;  3CNM A;  3WDG B;  1OGZ A;  3CPO A;  2XSO B;  1QMA A;  4FCM A;  3RGR A;  2OOV C;  2CW9 A;  3PXM A;  2W56 B;  1WTH A;  3MSO A;  4LZI A;  4LSO A;  1FUW A;  4O02 B;  2XR8 B;  4H3U A;  1AVL A;  1YJ9 3;  2RFR A;  4FMA A;  2OQE C;  3GZB A;  2W04 A;  3SXX A;  3AMO A;  1KWI A;  2P0M A;  4HM1 B;  2PZV A;  5IEN A;  2WGQ A;  2ML6 A;  3UNL A;  1STD A;  2GEY A;  1WNH A;  3X41 A;  3NBR A;  5CF2 A;  1VQ9 3;  5HGR A;  4XBY A;  1JNQ A;  3EN1 B;  3PZW A;  3CCV 3;  3GZX B;  3IJE B;  1FGO A;  1VQ5 3;  1DMQ A;  1STF I;  1DMM A;  1QVF 2;  1KQS 2;  1W6Y A;  1E3R A;  2WOH A;  3EF8 A;  1PU4 A;  2XH9 A;  2Z6B A;  2HMJ B;  3K0Z A;  1VQK 3;  1UI7 A;  1IV9 A;  1O7M B;  4OVM A;  1S72 3;  3SOA A;  1LVN A;  3CXC 2;  1FGM A;  3EBT A;  3KII A;  3LOY A;  1ZO2 A;  5AIG A;  3Q1C A;  1EKM A;  3WA3 A;  1VQP 3;  5ELU A;  4O3V A;  3GZR A;  1W2B 2;  4N6L A;  3A76 A;  3GAX A;  2KXG A;  4L8P A;  4N6N B;  4XBT A;  1SII A;  2P38 A;  4G1M B;  1YHQ 3;  2WO0 A;  3CPW 2;  1QAF A;  2Z7A A;  1AVK A;  2XFT A;  3PCR A;  4MMX B;  5AYR B;  2OCT A;  1US1 A;  3JUP A;  1NO3 A;  4K90 B;  3HZP A;  1IK3 A;  1Y4K A;  2RSX A;  3F8H A;  1O7P B;  3X3Y A;  3N8B A;  2L4V A;  1OPY A;  1QJG A;  4KFD A;  1VQN 3;  4XBX A;  1NJI 4;  4HM3 B;  2W03 A;  3PCS A;  1TUH A;  1IVW A;  4K1V A;  1Z1S A;  3T8N A;  1N5H A;  1ISK A;  1TFO A;  3I55 3;  2XF3 A;  3VSY A;  1L5G B;  3Q2P A;  1M9G A;  1ULJ B;  3CCQ 3;  4WHA A;  3UL6 A;  2XGL A;  4HM8 B;  5I97 A;  2XSH B;  5ELJ A;  4AKZ A;  1WMO A;  1T5Y A;  2O9U X;  3S29 A;  3KZT A;  4IIA A;  1GY7 A;  1W5Z A;  2ZDJ A;  1FA3 A;  4GB5 A;  3G8Z A;  3M8C A;  3OX9 A;  3B8L A;  4KVH A;  4XDW A;  1RJO A;  1UI8 A;  2BNG A;  2GEX A;  3L0R A;  1N8Q A;  1K73 4;  2LQV A;  1IVU A;  1VZZ A;  2FXT A;  5IEO A;  3DY5 A;  5IG5 A;  2CWV A;  1M90 4;  4XM4 A;  3FH1 A;  3G0K A;  1TP6 A;  2HMK B;  3NV0 A;  2QA4 3;  1W6C A;  1SIH A;  2Y73 A;  3EHC A;  3F40 A;  1LOX A;  3CCS 3;  2QEX 3;  4HM7 B;  4ZM8 A;  3H3H A;  1J2B A;  3EQQ B;  3CC4 3;  7STD A;  4EXR A;  2YFI B;  1K28 A;  5IF6 A;  3MWZ A;  2QIY A;  4N6O B;  1DVD A;  3QRD A;  3ALA A;  5JPU A;  2F99 A;  1Q82 4;  1GY5 A;  3FG4 A;  5DRE A;  1OHP A;  6STD A;  1OAC A;  4N6U A;  5IW9 A;  3FZW A;  3U97 A;  4CDL A;  4L8O A;  1A67 A;  3LTA A;  3EJV A;  3F7X A;  4FMC A;  1YJN 3;  3LML A;  3X40 A;  2KCD A;  3SVA A;  3I56 3;  3CD6 3;  1Q86 4;  1MOL A;  2W9Q A;  4HM6 B;  2IA7 A;  1E97 A;  2GBW B;  5IEP A;  1TFK A;  3JUO A;  1M1X B;  4JRF A;  3VGN A;  2E2T A;  3NQY A;  4TX4 A;  3IMA B;  4HM5 B;  3CMA 3;  4LGQ A;  1JB2 A;  3I0Y A;  1OH0 A;  3BND A;  5AI1 A;  3HII A;  3LH4 A;  2STD A;  2F98 A;  1OGX A;  3FF2 A;  5AIF A;  4BTX A;  3WMD A;  5BXQ A;  4EV2 A;  3CCJ 3;  1IQX A;  2MF7 A;  4HYZ A;  4X2O A;  3OW2 2;  1Q81 4;  4LEH A;  2MC8 A;  1NB5 I;  2M7O A;  2SBL A;  3B4O A;  2CFL A;  5STD A;  1RRL A;  3JUQ A;  1IVX A;  2XEP A;  3FSD A;  4WYK A;  4HZB B;  4QWT A;  1UUV B;  1LXE A;  4NRE A;  3K5T A;  4FMD A;  2BMQ B;  3WOE B;  3O8Y A;  3OXA A;  1OF5 A;  4EYC A;  2CHC A;  3FG1 A;  2W9P A;  4R9L A;  1JKG A;  2GU3 A;  4RNY A;  1CEW I;  2D1W A;  1CYU A;  2CFK A;  5BVB A;  4WP5 A;  1JRQ A;  1IU7 A;  3LYG A;  3BLZ A;  2GXF A;  4KFF A;  4HVN A;  1LNH A;  1Q7Y 4;  3EN8 A;  2PNC A;  3EB8 A;  3K63 A;  4LMI A;  3V98 A;  4Q53 A;  1QVG 2;  1W01 A;  4J8T A;  5AIH A;  4N6T A;  2JDI H;  2YFL B;  3FCS B;  3J7Y d;  2K54 A;  3DUK A;  1JB5 A;  5IER A;  1S5A A;  2CC3 A;  4WWU C;  1Q42 A;  4N3V A;  3E99 A;  3U1W A;  3CCE 3;  3S27 A;  1K9M 4;  3DZL A;  4H61 A;  1TU5 A;  1K8A 4;  1WMN A;  4RBN A;  1O7G B;  5EEO A;  3WA2 X;  2UX0 A;  4O2H A;  5AYS C;  1OHS A;  1AR0 A;  1DMN A;  2QGU A;  3AMO B;  3NHX A;  2P09 A;  3B7C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...