3EHCA

Crystal structure of a snoal-like polyketide cyclase (atu3018) from agrobacterium tumefaciens str. c58 at 2.12 a resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
127
structure length
127
Chain Sequence
MQTLNDIYLAYLDSLNHQAFDELGTFVDDNVEHNGRPFGLSGYRDMLVKDFADIPDLRFEAEILVSDATRLAARLFFDCTPKSIFMDLPVNGRRVQFCEHVFYDFEQAKIRRVWSVLDKVAIERQLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords SnoaL-like polyketide cyclase
publication title Crystal structure of SnoaL-like polyketide cyclase (17741376) from AGROBACTERIUM TUMEFACIENS str. C58 (Dupont) at 2.12 A resolution
rcsb
source organism Agrobacterium tumefaciens str. c58
total genus 38
structure length 127
sequence length 127
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07366 SnoaL SnoaL-like polyketide cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ehcA00
4HJLB 5IEPA 4RZMA 2HMNB 3GZBA 1SJWA 1TP6A 2XRXB 5AIHA 5AI1A 3HX8A 1ZO2A 3HZPA 5CF2A 4ORLA 1E3RA 4R9LA 1GYBA 5JPPA 1OPYA 3F7SA 3Q90A 4CDLA 3DZLA 3FZWA 3FLJA 2RCDA 3G8ZA 3EJVA 3NV0A 4XDWA 3S5CA 1GY6A 1GY7A 1O7MB 3KE7A 3EQQB 5KP3A 1OUNA 3STDA 4IIAA 3FGYA 3JUOA 5IERA 2I9WA 2XSOB 3B4PA 4HM4B 4HM2B 3ECFA 3RGRA 1UUVB 1OF5B 1S5AA 4XDVA 7STDA 1JKGB 2K54A 3F7XA 2A15A 1GS3A 3F9SA 1K41A 4LMIA 1OF5A 2R4IA 4H3UA 1JKGA 2HMLB 3EN1B 2F98A 2XR8B 1Q40B 4HVNA 3EN8A 3LZAA 5IF6A 3VSYA 3CNXA 3K0ZA 3B7CA 3WMDA 1NWWA 1Q42A 1Q40A 1QMAA 4XB5A 3MHEA 1W01A 2B24B 1JB5A 3DUKA 1NU3A 3MSOA 4K1VA 2YFIB 3SOYA 2B1XB 4OVMA 3MG1A 1OHPA 4HM3B 2QIYA 3GZYB 4K1UA 3DMCA 4L7KA 3HK4A 3GWRA 3EX9A 1GY5A 5D81A 1DMMA 3EF8A 3MG2A 3D9RA 1HKXA 3FKAA 1O7HB 1DMQA 2GXFA 3ROBA 1Z1SA 4WP5A 5EVHA 3FSDA 2BNGA 1O7PB 1JB2A 2UX0A 4LEHA 3UJMA 3NV0B 2CKFB 4PEJA 4WWUC 1STDA 3ER7A 3KKGA 3EBYA 3FF0A 1OGZA 1UUWB 4WYKA 3SEDA 1O7WB 2F86B 1OHOA 2BMQB 1ULIB 3BLZA 2BMRB 3IPTA 5BXQA 5AIIA 4MJDA 1VZZA 3NM2A 3G16A 3GZXB 1C7HA 2YFJB 5FW5A 2HMJB 3NBRA 1OGXA 3T8UA 3CNMA 3NHXA 3G0KA 4OUQA 2GBXB 3K7CA 4HM6B 8CHOA 5D83A 3F14A 3MKIA 2STDA 3H51A 3I0YA 5IEOA 3GRDA 4HM1B 5AIFA 2Z7AA 3OV4A 5JPUA 3OX9A 2GEYA 4N3VA 3JUPA 3EBTA 5CLKA 1ASKA 2BMOB 1W00A 3KZTA 4Q53A 3UNLA 1NDOB 4HZBB 3T8NA 6STDA 4KVHA 3FH1A 1ISKA 2F99A 2HMKB 2HMMB 2JQ5A 3E99A 5HGRA 4X2HA 2W2CA 2PZVA 3B4OA 3F8XA 4XM4A 5DRVA 4L8PA 2INXA 1JN5A 5STDA 4L8OA 5CF1A 4J9AA 1E97A 2GEXA 1E3VA 1TUHA 5BVBA 5IENA 2CHCA 1EA2A 5TGNA 3LYGA 3JUNA 4R1KA 4WYKB 1U5OA 1OCVA 5IG5A 4R9KA 3OXAA 4XBTA 4I4KA 3CPOA 5IG4A 2RFRA 4XBXA 1OHSA 4STDA 2XSHB 3F8HA 1O7GB 3EC9A 5DREA 4LGQA 4HM8B 2Z77A 2IMJA 3BB9A 5KP1A 5KP4A 3KSPA 1A2KA 3CU3A 5CXOA 4U13A 2HMOB 4HM7B 1BUQA 3OWUA 3EHCA 4FCJA 3DXOA 1IDPA 3JUMA 2Z76A 5CK6A 3GZRA 5AEUB 4HKVB 3B8LA 3FF2A 2YFLB 3DM8A 5IG3A 1DMNA 1JB4A 1OH0A 3MG3A 4XBYA 1W6YA 4GB5A 3JUQA 3OWSA 1CQSA 4HM5B 1QJGA 3VGNA 1ZX2A 3H3HA 4FCMA 5AIGA 5AEWB 2RGQA 1WQLB 1W02A 5IG0A 3F40A 3M8CA 3RGAA 1ULJB 5G2GA 4J8TA 3NXJA 1AR0A 1JN5B 4X2OA 1EG9B 2QGUA 3SOAA 3MYTA 3NUVA 4HZ9B 1O7NB 4HM0B 3OWYA 2GBWB 5D82A 2OWPA 3A76A
chains in the Genus database with same CATH superfamily
1AV4A 1GD4A 3NX0A 4HJLB 1RCKA 2CWUA 1YHQ3 1BANA 3T0UA 2M7OA 1GMPA 2SARA 1M1XB 5IEPA 4FMDA 4RZMA 1MWRA 2HMNB 5GSPA 3CCQ3 3GZBA 3CPW2 1I0XA 2KF5A 3PCSA 7GSPA 2XGLA 1SJWA 1TP6A 1YIT3 3NQYA 1QVG2 2XRXB 3CCU3 3PYJA 5AIHA 5AI1A 1LQGC 2KAAA 3HX8A 3LTCA 1MNLA 3G713 1PYLA 1G96A 2CWTA 1ZO2A 3NM7A 3QRDA 5M19A 1BNIA 1X1WA 4IT7A 3HZPA 1A2VA 1W2ZA 5CF2A 2P09A 2FGTA 4ORLA 1E3RA 1Y4KA 2F5MA 3KCHA 4R9LA 1GYBA 5JPPA 1OPYA 1SIIA 4N6NB 5G1KA 3F7SA 3OW22 1I0VA 3Q90A 3N8BA 4O8SA 3DZLA 3FG3A 2CFWA 1EEJA 4CDLA 1UW1A 1Q824 1ROVA 3FZWA 1CYUA 1B27A 1WNHA 2D42A 3FLJA 2RCDA 1DVDA 3G8ZA 3EJVA 3NV0A 3K9MC 2XFTA 1BRIA 4K61A 4RNYA 4XDWA 1UCKA 2H0IA 3S5CA 1GY6A 1DYUA 1GY7A 2BO9B 1O7MB 1V57A 3EQQB 2KCDA 1OUNA 3KE7A 4RNZA 3D79A 4WHAA 5KP3A 1L5GB 1AQZA 3STDA 2H0HA 4ILFA 2P0XA 1BRNL 1BAOA 4IIAA 3FGYA 1GSPA 1PFPA 3JUOA 3X41A 5IERA 2I9WA 2XSOB 2WOFA 4KZ1A 4EXRA 3B4PA 4HM4B 4HM2B 3ECFA 1BIRA 3RGRA 1BSAA 3CC43 4RBNA 1UUVB 1OF5B 3WA3A 1S5AA 3FG4A 4XDVA 1RN4A 7STDA 1KD14 1JKGB 2K54A 3F7XA 1TIJA 1GOYA 1IVXA 2A15A 1GS3A 3F9SA 1VQN3 3DY5A 1IU7A 1K41A 1LXEA 2OOVA 1B21A 1YNVX 3DGLA 4LMIA 4LYLB 3CME3 1OF5A 1IK3A 5AYSC 1GOUA 3SLUA 5EEOA 1Q814 2R4IA 4H3UA 4N6UA 1N5HA 1JKGA 2HMLB 1IYYA 1IVVA 2O3OA 3D3LA 3LT9A 1RDSA 4KFDA 3CMA3 1AVLA 3EN1B 3BNBA 1JNQA 2F98A 2XR8B 1VQ73 1BNJA 1IQ8A 4K90B 1Q40B 4HVNA 1JBTA 3EN8A 1VQQA 3LZAA 3VSYA 5IF6A 3CNXA 3K0ZA 3B7CA 4BTWA 1VQ53 3WMDA 2OQEA 4WFOA 1NNVA 1NWWA 1EKMA 1Q42A 3LMLA 1FZUA 1Q40A 1M1K4 2LYXA 1K8A4 4EYCA 1QMAA 3HIGA 4XB5A 3MHEA 3PGBA 1W01A 1LOVA 1VQL3 1S723 2B24B 2CW9A 1JB5A 1IV9A 3DUKA 1NU3A 2OCTA 3LTAA 2R41A 3MSOA 3LTBA 2WOHA 4K1VA 1HYFA 2YFIB 1RCLA 1SARA 3SOYA 2B1XB 1JBRA 4OVMA 3SYUA 4EV2A 1OHPA 3MG1A 4HBRA 1B2ZA 1WMPA 4HM3B 1I2GA 2OOVC 3V98A 2QIYA 3NBBA 1UCJA 2E2TA 3GZYB 4K1UA 3DMCA 4L7KA 2CFLA 5I97A 1RTUA 3HK4A 3LT8A 3GWRA 3CC73 3Q3FA 3ALAA 3EX9A 1DE3A 3HI7A 1G0TA 1JRQA 1VQM3 2FNQA 3X3XA 1RRLA 3CCR3 1GY5A 1I70A 4CPKA 5D81A 1GMQA 1BNSA 4NREA 2OQEC 2PNCA 1TRQA 2F56A 3LH4A 1DMMA 4LSOA 1BRSA 1YGEA 3EF8A 2D1WA 2LQVA 3L0RA 1MOLA 1LOXA 2ML6A 3MG2A 1FUWA 2BT3A 3D5IA 2UGIA 3D9RA 1HKXA 5FGOA 1FGTA 3FKAA 3TDGA 1O7HB 1DMQA 3I553 1B3SA 2KXGA 2GXFA 1V74A 1UUGB 3NBJA 6GSPA 2XH9A 3ROBA 3RNTA 3BIRA 4EBGA 1LRAA 5IW9A 1Z1SA 2YX9A 4NHFA 4WP5A 5EVHA 3FSDA 4BU4A 3JVCA 1QAKA 1W7CA 1W5ZA 2BNGA 4MEIA 6RNTA 3O8YA 1T5YA 3MPHA 4BTYA 1HZ1A 1O7PB 1B2UA 4O02B 1JB2A 2UX0A 2BU4A 4TX4A 4LEHA 3UJMA 3AHSA 3NV0B 4GHOA 4IPBA 3MWZA 2W56B 1LOWA 2K0MA 3WOEB 2CKFB 2W04A 2J8XB 4PEJA 4QWTA 4WWUC 4AKYA 1BNRA 1BGSA 1STDA 3ER7A 1IVWA 2Y74A 3G4S3 3AMOB 2XFSA 1LVNA 1KC84 3KKGA 3EBYA 2W0QA 2W56A 1YGWA 1VQ93 3PXMA 1BUJA 2AADA 3FF0A 1BSCA 3N9HA 1OGZA 1TRPA 4FMAA 5BU4A 1MWSA 4MMXB 1BSEA 1PY3A 3AMOA 5BIRA 3KFQC 1R4YA 2W9QA 3J7Yd 1RGFA 1UUWB 1RLSA 1W4NA 2F5WA 4WYKA 1K734 4O3VA 1JV2B 1O7WB 1T2IA 3SEDA 1RGKA 2F86B 2KF4A 1OHOA 3EB8A 1NB3I 3K5TA 2BMQB 4H61A 1ULIB 2MF7A 1WTHA 3BLZA 2QA43 3QK9A 1M904 3V99A 1HU9A 2BMRB 3X3YA 1G02A 1TJDA 3IPTA 5BXQA 1MWUA 1R4CA 2W03A 1Q864 1RMSA 2CG1A 4HOHA 5AIIA 1BNFA 1VQP3 1I3IA 1RSNA 4MJDA 1BSDA 1VZZA 1RHLA 2E2UA 3URPA 3FCSB 3NM2A 3G16A 2ML5A 3GZXB 3PZWA 1C7HA 2YFJB 5FW5A 2HMJB 1Q9EA 1RGHA 2F4YA 3NBRA 1OGXA 2Q07A 3HOHA 1UCLA 3S29A 3CNMA 3T8UA 4J5KA 3ZFZA 3NHXA 3G0KA 3U97A 5ELJA 4OUQA 1QALA 1UGHI 1X1XA 2GBXB 3K7CA 3DGYA 3A5EA 4HM6B 1NB5I 1X1YA 3CXC2 1MGRA 8CHOA 5G1LA 5D83A 1WMNA 3F14A 3WDGB 9RNTA 5JBSA 1A67A 1IT8A 1FGQA 1NO3A 3V92A 3MKIA 2IY2A 3LXUX 3GAXA 1N8QA 1CH0A 2STDA 2ZA4A 1FGOA 3H51A 3I0YA 5IEOA 1K9M4 2KF3A 3WHOA 1Q7Y4 4EV5A 3CCM3 1YVBI 2RNTA 3GRDA 1US1A 2IYJA 2XEPA 4HM1B 2Z7AA 3OV4A 3PS8A 5AIFA 5JPUA 3OX9A 2GEYA 1RN1A 1BNEA 1CYVA 3LTDA 3DGNA 4N3VA 3JUPA 1TTOA 1KSIA 3EBTA 2O9UX 5CLKA 1ASKA 1ZGXA 4CJNA 1I8VA 1MGWA 1W2B2 1YJ93 2BMOB 1JZOA 1W00A 1Q7HA 3SXXA 3WODG 4BL2A 1YJN3 2ZDJA 3KSED 3KZTA 4Q53A 2E2VA 2K3DA 3UNLA 3ZG0A 2QEX3 2W9PA 2W6JH 1NDOB 4HZBB 1TFOA 4N6OB 2CH9A 3T8NA 6STDA 4KVHA 3FH1A 4J5GA 1ISKA 2F99A 1UGIA 2RSXA 1N8R4 1RNTA 1DETA 1V58A 2HMKB 1BU4A 1RJOA 3BNCA 4MMYB 4N6LA 4N6MA 2HMMB 2JQ5A 3E99A 3S67A 5HGRA 2P05A 2WO0A 2CX1A 4FMBA 1RNBA 3IJEB 1A90A 1VQK3 4X2HA 3S28A 2W2CA 2PZVA 1FW7A 3EE1A 1IQYA 3B4OA 1YIJ3 3F8XA 3SVAA 1YJW3 4XM4A 2FXTA 4DKIA 1WMOA 2L4VA 5DRVA 4L8PA 2Y73A 3X3ZA 4AEQA 2INXA 1JN5A 2CFKA 3CCJ3 4LZIA 3PCRA 4I5QA 4O2HA 1VQO3 4HYZA 5STDA 4L8OA 1I2FA 2GU1A 3G6E3 3VF1A 1LOYA 5CF1A 4J9AA 1E97A 2GEXA 1RKYA 2Z6BA 1LQMB 7RNTA 1E3VA 1A2PA 1TUHA 1FGMA 8RNTA 5BVBA 1X1UA 5IENA 2CHCA 1ZS7A 2P38A 1FYSA 3WA2X 1EUIC 1EA2A 1SPUA 4MMZB 4N6V0 3N54B 5ELUA 5TGNA 3LYGA 4BL3A 1IV7A 1UCIA 3JUNA 5M1AA 4R1KA 4WYKB 1EQKA 2IUJA 1B2SA 3UB1A 1LNHA 2GU3A 1YVSA 1RN7A 3WOFB 1RGLA 1U5OA 1OCVA 5IG5A 1BRJA 1RGEA 2V1LA 1RGAA 1C54A 1OACA 4R9KA 3OXAA 4HAAA 1AY7A 1RGCA 4KT3B 4KFFA 4XBTA 4GSPA 2OTL3 3CPOA 4I4KA 5IG4A 2CFGA 4G1MB 2RFRA 3SX1A 1BVIA 5HOHA 3K63A 4XBXA 1OHSA 4N6TA 1IQXA 2C10A 1U8CB 4STDA 2XSHB 2CK3H 3F8HA 3U1WA 1J2BA 1D6UA 1FUTA 1O7GB 3EC9A 4OK0A 5DREA 4R80A 1B2MA 1PU4A 2GSPA 2C4BA 4LGQA 4HM8B 3DGMA 2Z77A 3RDEA 2WGOA 1STFI 2IMJA 3BB9A 1VQ43 2BHMA 2IA7A 3BNDA 5LC7A 2AAEA 5KP1A 5KP4A 2CWVA 1VQ83 1K28A 1RRHA 4FMCA 1D6ZA 1SIHA 5RNTA 1JBSA 3KSPA 3CCS3 2HOHA 3D4AA 1QVF2 1BSBA 2ZL8A 3IMAB 2OTJ3 1A2KA 3FG1A 1KQS2 1RGGA 1UDII 3CU3A 1N9JA 4U13A 1MWTA 2HMOB 4HM7B 5CXOA 5AYRB 1BUQA 3OWUA 3EHCA 4FCJA 3DXOA 1IDPA 1IT7A 1BRHA 2SBLA 2CC3A 3AGNA 2Z76A 1TFKA 3JUMA 5CK6A 3CC23 1N5PA 2XF3A 3GZRA 1W6CA 5LC6A 1LNIA 5AEUB 3UL6A 3NQZA 4HKVB 4RNTA 2MC8A 3B8LA 3BNEA 4CCVA 3Q1CA 3FF2A 1B2XA 2YFLB 2RBIA 3X42A 3X40A 1D6YA 3CD63 2XGNA 1AVKA 2JDIH 3DM8A 3GSPA 5IG3A 1TU5A 1KWIA 5M18A 1JB4A 1DMNA 1GOVA 1FUSA 1OH0A 3BU4A 1QAFA 3MG3A 4ZM8A 4XBYA 4GL6A 3DGOA 1T2HA 3D5GA 3Q2PA 1JZDA 4BTXA 1W6YA 2WGQA 1FGRA 2CX0A 1GMRA 3DH2A 1GD3A 5A0OB 4GB5A 5EQLA 1JJ22 3WR2A 2CG0A 1BOXA 3AGOA 3JUQA 4JRFA 2UUGC 2IUKA 3UL5A 1VQ63 3OWSA 1CQSA 3ZG5A 2H0GA 4HM5B 1QJGA 3VGNA 1UI8A 1ZX2A 3H3HA 4FCMA 2KRTA 1NJI4 1UI7A 5AIGA 1N9EA 4EW5A 1B20A 1FA3A 4EC6A 2KF6A 2C11A 4JF8A 4KFEA 5AEWB 3CCE3 4FCZA 2RGQA 1WQLB 3KIIA 1YI23 1W02A 5IG0A 4R4KA 3F40A 3M8CA 4FR9A 3RGAA 1ULJB 5G2GA 4J8TA 3NXJA 1AR0A 2P0MA 1BNGA 1JN5B 3AHWA 2BIRA 3I563 4X2OA 3CCV3 2ZHXB 1EG9B 1T3BA 3LOYA 1DVCA 2QGUA 4AKZA 4NPBA 3SOAA 3CCL3 1ROAA 3KN4A 3S27A 4BIRA 3MYTA 3NUVA 1BRKA 4HZ9B 2CFDA 2CIUA 1O7NB 1I3FA 1M9GA 4HM0B 1I2EA 3HIIA 3OWYA 1SQWA 2GBWB 5D82A 1W6GA 1F8NA 2L1SA 1BRGA 2OWPA 3A76A 1CEWI 1IVUA
chains in the Genus database with same CATH topology
1AV4A 1GD4A 3NX0A 4HJLB 1YHQ3 2CWUA 3T0UA 2M7OA 1M1XB 5IEPA 4FMDA 4RZMA 3CCQ3 2HMNB 3GZBA 3CPW2 3PCSA 2XGLA 1SJWA 1TP6A 1YIT3 3NQYA 1QVG2 2XRXB 3CCU3 3PYJA 5AIHA 5AI1A 3HX8A 3LTCA 3G713 1MNLA 1G96A 2CWTA 1ZO2A 3NM7A 3QRDA 4IT7A 3HZPA 1A2VA 1W2ZA 5CF2A 2P09A 2FGTA 4ORLA 1E3RA 1Y4KA 4R9LA 1GYBA 5JPPA 1OPYA 1SIIA 4N6NB 3F7SA 3OW22 3Q90A 3N8BA 4O8SA 3DZLA 3FG3A 2CFWA 4CDLA 1UW1A 1Q824 1ROVA 3FZWA 1CYUA 1WNHA 2D42A 3FLJA 2RCDA 1DVDA 3G8ZA 3EJVA 3NV0A 3K9MC 2XFTA 4K61A 4RNYA 4XDWA 3S5CA 1GY6A 1DYUA 1GY7A 2BO9B 1O7MB 3KE7A 3EQQB 2KCDA 1OUNA 4RNZA 4WHAA 5KP3A 1L5GB 3STDA 2P0XA 4IIAA 3FGYA 1PFPA 3JUOA 3X41A 5IERA 2I9WA 2XSOB 2WOFA 4KZ1A 4EXRA 3B4PA 4HM4B 4HM2B 3ECFA 3RGRA 3CC43 4RBNA 1UUVB 1OF5B 3WA3A 1S5AA 3FG4A 4XDVA 7STDA 1KD14 1JKGB 2K54A 3F7XA 1TIJA 1IVXA 2A15A 1GS3A 3F9SA 1VQN3 3DY5A 1IU7A 1K41A 1LXEA 2OOVA 3DGLA 4LMIA 3CME3 1OF5A 1IK3A 5AYSC 3SLUA 5EEOA 1Q814 2R4IA 4H3UA 4N6UA 1N5HA 1JKGA 2HMLB 1IVVA 2O3OA 3D3LA 3LT9A 4KFDA 3CMA3 1AVLA 3EN1B 3BNBA 1JNQA 2F98A 2XR8B 1VQ73 1IQ8A 4K90B 1Q40B 4HVNA 3EN8A 3LZAA 5IF6A 3VSYA 3CNXA 3K0ZA 3B7CA 4BTWA 1VQ53 3WMDA 2OQEA 4WFOA 1NWWA 1EKMA 1Q42A 3LMLA 1Q40A 1M1K4 2LYXA 1K8A4 4EYCA 1QMAA 3HIGA 4XB5A 3MHEA 3PGBA 1W01A 1VQL3 1S723 2B24B 2CW9A 1JB5A 1IV9A 3DUKA 1NU3A 2OCTA 3LTAA 3MSOA 3LTBA 2WOHA 4K1VA 2YFIB 3SOYA 2B1XB 4OVMA 4EV2A 1OHPA 3MG1A 4HBRA 1WMPA 4HM3B 2OOVC 3V98A 2QIYA 3NBBA 2E2TA 3GZYB 4K1UA 3DMCA 4L7KA 2CFLA 5I97A 3HK4A 3LT8A 3GWRA 3CC73 3ALAA 3EX9A 3HI7A 1JRQA 1VQM3 2FNQA 3X3XA 1RRLA 3CCR3 1GY5A 5D81A 4NREA 2OQEC 2PNCA 3LH4A 1DMMA 4LSOA 1YGEA 3EF8A 2D1WA 2LQVA 3L0RA 1MOLA 1LOXA 2ML6A 3MG2A 1FUWA 2BT3A 3D9RA 1HKXA 5FGOA 1FGTA 3FKAA 3TDGA 1O7HB 1DMQA 3I553 2KXGA 2GXFA 1V74A 3NBJA 2XH9A 3ROBA 4EBGA 5IW9A 1Z1SA 2YX9A 4NHFA 4WP5A 5EVHA 3FSDA 3JVCA 1QAKA 1W7CA 1W5ZA 2BNGA 4MEIA 3O8YA 1T5YA 3MPHA 4BTYA 1O7PB 4O02B 1JB2A 2UX0A 4TX4A 4LEHA 3UJMA 3NV0B 4IPBA 3MWZA 2W56B 2K0MA 3WOEB 2CKFB 2W04A 4PEJA 4QWTA 4WWUC 4AKYA 1STDA 3ER7A 1IVWA 2Y74A 3G4S3 3AMOB 2XFSA 1LVNA 1KC84 3KKGA 3EBYA 2W0QA 2W56A 1VQ93 3PXMA 3FF0A 3N9HA 1OGZA 4FMAA 4MMXB 3AMOA 3J7Yd 3KFQC 2W9QA 1UUWB 1W4NA 4WYKA 1K734 4O3VA 1JV2B 1O7WB 3SEDA 2F86B 1OHOA 3EB8A 1NB3I 3K5TA 2BMQB 4H61A 1ULIB 2MF7A 1WTHA 3BLZA 2QA43 3QK9A 1M904 3V99A 1HU9A 2BMRB 3X3YA 3IPTA 5BXQA 1R4CA 2W03A 1Q864 2CG1A 5AIIA 1VQP3 4MJDA 1VZZA 2E2UA 3FCSB 3NM2A 3G16A 2ML5A 3GZXB 3PZWA 1C7HA 2YFJB 5FW5A 2HMJB 3NBRA 3S29A 1OGXA 2Q07A 3T8UA 3CNMA 3NHXA 3G0KA 3U97A 5ELJA 4OUQA 1QALA 2GBXB 3K7CA 4HM6B 1NB5I 3CXC2 8CHOA 5D83A 1WMNA 3F14A 3WDGB 5JBSA 1A67A 1IT8A 1FGQA 1NO3A 3V92A 3MKIA 3LXUX 3GAXA 1N8QA 2STDA 1FGOA 3H51A 3I0YA 5IEOA 1K9M4 1Q7Y4 4EV5A 3CCM3 1YVBI 3GRDA 1US1A 2XEPA 4HM1B 2Z7AA 3OV4A 3PS8A 5AIFA 5JPUA 3OX9A 2GEYA 1CYVA 3LTDA 3DGNA 4N3VA 3JUPA 1KSIA 3EBTA 2O9UX 5CLKA 1ASKA 1W2B2 1YJ93 2BMOB 1W00A 3SXXA 3WODG 1YJN3 2ZDJA 3KSED 3KZTA 4Q53A 2E2VA 2QEX3 3UNLA 2W9PA 2W6JH 1NDOB 4HZBB 1TFOA 4N6OB 2CH9A 3T8NA 6STDA 4KVHA 3FH1A 1ISKA 2F99A 2RSXA 1N8R4 2HMKB 3BNCA 4MMYB 1RJOA 4N6LA 4N6MA 2HMMB 2JQ5A 3E99A 3S67A 5HGRA 2P05A 2WO0A 4FMBA 1A90A 3IJEB 1VQK3 4X2HA 3S28A 2W2CA 2PZVA 3EE1A 1IQYA 3B4OA 1YIJ3 3F8XA 3SVAA 1YJW3 4XM4A 2FXTA 1WMOA 2L4VA 5DRVA 4L8PA 2Y73A 3X3ZA 4AEQA 2INXA 1JN5A 2CFKA 3CCJ3 4LZIA 3PCRA 4O2HA 1VQO3 4HYZA 5STDA 4L8OA 3G6E3 2GU1A 3VF1A 5CF1A 4J9AA 1E97A 2GEXA 1RKYA 2Z6BA 1E3VA 1TUHA 1FGMA 5BVBA 5IENA 2CHCA 2P38A 3WA2X 1SPUA 1EA2A 4N6V0 4MMZB 3N54B 5ELUA 5TGNA 3LYGA 1IV7A 3JUNA 4R1KA 4WYKB 1EQKA 2IUJA 3UB1A 1LNHA 2GU3A 1RN7A 3WOFB 1U5OA 1OCVA 5IG5A 2V1LA 1OACA 4R9KA 3OXAA 4KFFA 4XBTA 2OTL3 3CPOA 4I4KA 5IG4A 2CFGA 4G1MB 2RFRA 3SX1A 3K63A 4XBXA 1OHSA 4N6TA 1IQXA 2C10A 1U8CB 4STDA 2XSHB 2CK3H 3F8HA 3U1WA 1J2BA 1D6UA 1O7GB 3EC9A 4OK0A 5DREA 4R80A 1PU4A 4LGQA 4HM8B 3DGMA 2Z77A 3RDEA 2WGOA 1STFI 2IMJA 3BB9A 1VQ43 2BHMA 2IA7A 3BNDA 5LC7A 5KP1A 5KP4A 2CWVA 1VQ83 1K28A 1RRHA 4FMCA 1D6ZA 1SIHA 3KSPA 3CCS3 1QVF2 2ZL8A 3IMAB 2OTJ3 1A2KA 3FG1A 1KQS2 3CU3A 1N9JA 4U13A 2HMOB 4HM7B 5CXOA 5AYRB 1BUQA 3OWUA 3EHCA 4FCJA 3DXOA 1IDPA 1IT7A 2SBLA 2CC3A 3JUMA 2Z76A 1TFKA 5CK6A 3CC23 1N5PA 2XF3A 3GZRA 1W6CA 5LC6A 5AEUB 3UL6A 3NQZA 4HKVB 2MC8A 3B8LA 3BNEA 4CCVA 3Q1CA 3FF2A 2YFLB 3X42A 3X40A 1D6YA 3CD63 2XGNA 1AVKA 2JDIH 3DM8A 5IG3A 1TU5A 1KWIA 1JB4A 1DMNA 1OH0A 3MG3A 1QAFA 4ZM8A 4XBYA 4GL6A 3DGOA 3Q2PA 4BTXA 1W6YA 2WGQA 1FGRA 5A0OB 1JJ22 1GD3A 4GB5A 5EQLA 2CG0A 3JUQA 4JRFA 2IUKA 3UL5A 1VQ63 3OWSA 1CQSA 4HM5B 1QJGA 3VGNA 1UI8A 1ZX2A 3H3HA 4FCMA 2KRTA 1NJI4 1UI7A 5AIGA 1N9EA 1FA3A 4EC6A 2C11A 4JF8A 4KFEA 5AEWB 3CCE3 4FCZA 2RGQA 1WQLB 3KIIA 1YI23 1W02A 5IG0A 4R4KA 3F40A 3M8CA 4FR9A 3RGAA 1ULJB 5G2GA 4J8TA 3NXJA 1AR0A 2P0MA 1JN5B 3I563 4X2OA 3CCV3 1EG9B 3LOYA 1DVCA 2QGUA 4AKZA 3SOAA 3CCL3 1ROAA 3KN4A 3S27A 3MYTA 3NUVA 4HZ9B 2CFDA 2CIUA 1O7NB 1M9GA 4HM0B 3HIIA 3OWYA 1SQWA 2GBWB 5D82A 1W6GA 1F8NA 2OWPA 3A76A 1CEWI 1IVUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HJL B;  5IEP A;  4RZM A;  2HMN B;  3GZB A;  1SJW A;  1TP6 A;  2XRX B;  5AIH A;  5AI1 A;  3HX8 A;  1ZO2 A;  3HZP A;  5CF2 A;  4ORL A;  1E3R A;  4R9L A;  1GYB A;  5JPP A;  1OPY A;  3F7S A;  3Q90 A;  4CDL A;  3DZL A;  3FZW A;  3FLJ A;  2RCD A;  3G8Z A;  3EJV A;  3NV0 A;  4XDW A;  3S5C A;  1GY6 A;  1GY7 A;  1O7M B;  3KE7 A;  3EQQ B;  5KP3 A;  1OUN A;  3STD A;  4IIA A;  3FGY A;  3JUO A;  5IER A;  2I9W A;  2XSO B;  3B4P A;  4HM4 B;  4HM2 B;  3ECF A;  3RGR A;  1UUV B;  1OF5 B;  1S5A A;  4XDV A;  7STD A;  1JKG B;  2K54 A;  3F7X A;  2A15 A;  1GS3 A;  3F9S A;  1K41 A;  4LMI A;  1OF5 A;  2R4I A;  4H3U A;  1JKG A;  2HML B;  3EN1 B;  2F98 A;  2XR8 B;  1Q40 B;  4HVN A;  3EN8 A;  3LZA A;  5IF6 A;  3VSY A;  3CNX A;  3K0Z A;  3B7C A;  3WMD A;  1NWW A;  1Q42 A;  1Q40 A;  1QMA A;  4XB5 A;  3MHE A;  1W01 A;  2B24 B;  1JB5 A;  3DUK A;  1NU3 A;  3MSO A;  4K1V A;  2YFI B;  3SOY A;  2B1X B;  4OVM A;  3MG1 A;  1OHP A;  4HM3 B;  2QIY A;  3GZY B;  4K1U A;  3DMC A;  4L7K A;  3HK4 A;  3GWR A;  3EX9 A;  1GY5 A;  5D81 A;  1DMM A;  3EF8 A;  3MG2 A;  3D9R A;  1HKX A;  3FKA A;  1O7H B;  1DMQ A;  2GXF A;  3ROB A;  1Z1S A;  4WP5 A;  5EVH A;  3FSD A;  2BNG A;  1O7P B;  1JB2 A;  2UX0 A;  4LEH A;  3UJM A;  3NV0 B;  2CKF B;  4PEJ A;  4WWU C;  1STD A;  3ER7 A;  3KKG A;  3EBY A;  3FF0 A;  1OGZ A;  1UUW B;  4WYK A;  3SED A;  1O7W B;  2F86 B;  1OHO A;  2BMQ B;  1ULI B;  3BLZ A;  2BMR B;  3IPT A;  5BXQ A;  5AII A;  4MJD A;  1VZZ A;  3NM2 A;  3G16 A;  3GZX B;  1C7H A;  2YFJ B;  5FW5 A;  2HMJ B;  3NBR A;  1OGX A;  3T8U A;  3CNM A;  3NHX A;  3G0K A;  4OUQ A;  2GBX B;  3K7C A;  4HM6 B;  8CHO A;  5D83 A;  3F14 A;  3MKI A;  2STD A;  3H51 A;  3I0Y A;  5IEO A;  3GRD A;  4HM1 B;  5AIF A;  2Z7A A;  3OV4 A;  5JPU A;  3OX9 A;  2GEY A;  4N3V A;  3JUP A;  3EBT A;  5CLK A;  1ASK A;  2BMO B;  1W00 A;  3KZT A;  4Q53 A;  3UNL A;  1NDO B;  4HZB B;  3T8N A;  6STD A;  4KVH A;  3FH1 A;  1ISK A;  2F99 A;  2HMK B;  2HMM B;  2JQ5 A;  3E99 A;  5HGR A;  4X2H A;  2W2C A;  2PZV A;  3B4O A;  3F8X A;  4XM4 A;  5DRV A;  4L8P A;  2INX A;  1JN5 A;  5STD A;  4L8O A;  5CF1 A;  4J9A A;  1E97 A;  2GEX A;  1E3V A;  1TUH A;  5BVB A;  5IEN A;  2CHC A;  1EA2 A;  5TGN A;  3LYG A;  3JUN A;  4R1K A;  4WYK B;  1U5O A;  1OCV A;  5IG5 A;  4R9K A;  3OXA A;  4XBT A;  4I4K A;  3CPO A;  5IG4 A;  2RFR A;  4XBX A;  1OHS A;  4STD A;  2XSH B;  3F8H A;  1O7G B;  3EC9 A;  5DRE A;  4LGQ A;  4HM8 B;  2Z77 A;  2IMJ A;  3BB9 A;  5KP1 A;  5KP4 A;  3KSP A;  1A2K A;  3CU3 A;  5CXO A;  4U13 A;  2HMO B;  4HM7 B;  1BUQ A;  3OWU A;  3EHC A;  4FCJ A;  3DXO A;  1IDP A;  3JUM A;  2Z76 A;  5CK6 A;  3GZR A;  5AEU B;  4HKV B;  3B8L A;  3FF2 A;  2YFL B;  3DM8 A;  5IG3 A;  1DMN A;  1JB4 A;  1OH0 A;  3MG3 A;  4XBY A;  1W6Y A;  4GB5 A;  3JUQ A;  3OWS A;  1CQS A;  4HM5 B;  1QJG A;  3VGN A;  1ZX2 A;  3H3H A;  4FCM A;  5AIG A;  5AEW B;  2RGQ A;  1WQL B;  1W02 A;  5IG0 A;  3F40 A;  3M8C A;  3RGA A;  1ULJ B;  5G2G A;  4J8T A;  3NXJ A;  1AR0 A;  1JN5 B;  4X2O A;  1EG9 B;  2QGU A;  3SOA A;  3MYT A;  3NUV A;  4HZ9 B;  1O7N B;  4HM0 B;  3OWY A;  2GBW B;  5D82 A;  2OWP A;  3A76 A; 
#chains in the Genus database with same CATH topology
 1AV4 A;  1GD4 A;  3NX0 A;  4HJL B;  1RCK A;  2CWU A;  1YHQ 3;  1BAN A;  3T0U A;  2M7O A;  1GMP A;  2SAR A;  1M1X B;  5IEP A;  4FMD A;  4RZM A;  1MWR A;  2HMN B;  5GSP A;  3CCQ 3;  3GZB A;  3CPW 2;  1I0X A;  2KF5 A;  3PCS A;  7GSP A;  2XGL A;  1SJW A;  1TP6 A;  1YIT 3;  3NQY A;  1QVG 2;  2XRX B;  3CCU 3;  3PYJ A;  5AIH A;  5AI1 A;  1LQG C;  2KAA A;  3HX8 A;  3LTC A;  1MNL A;  3G71 3;  1PYL A;  1G96 A;  2CWT A;  1ZO2 A;  3NM7 A;  3QRD A;  5M19 A;  1BNI A;  1X1W A;  4IT7 A;  3HZP A;  1A2V A;  1W2Z A;  5CF2 A;  2P09 A;  2FGT A;  4ORL A;  1E3R A;  1Y4K A;  2F5M A;  3KCH A;  4R9L A;  1GYB A;  5JPP A;  1OPY A;  1SII A;  4N6N B;  5G1K A;  3F7S A;  3OW2 2;  1I0V A;  3Q90 A;  3N8B A;  4O8S A;  3DZL A;  3FG3 A;  2CFW A;  1EEJ A;  4CDL A;  1UW1 A;  1Q82 4;  1ROV A;  3FZW A;  1CYU A;  1B27 A;  1WNH A;  2D42 A;  3FLJ A;  2RCD A;  1DVD A;  3G8Z A;  3EJV A;  3NV0 A;  3K9M C;  2XFT A;  1BRI A;  4K61 A;  4RNY A;  4XDW A;  1UCK A;  2H0I A;  3S5C A;  1GY6 A;  1DYU A;  1GY7 A;  2BO9 B;  1O7M B;  1V57 A;  3EQQ B;  2KCD A;  1OUN A;  3KE7 A;  4RNZ A;  3D79 A;  4WHA A;  5KP3 A;  1L5G B;  1AQZ A;  3STD A;  2H0H A;  4ILF A;  2P0X A;  1BRN L;  1BAO A;  4IIA A;  3FGY A;  1GSP A;  1PFP A;  3JUO A;  3X41 A;  5IER A;  2I9W A;  2XSO B;  2WOF A;  4KZ1 A;  4EXR A;  3B4P A;  4HM4 B;  4HM2 B;  3ECF A;  1BIR A;  3RGR A;  1BSA A;  3CC4 3;  4RBN A;  1UUV B;  1OF5 B;  3WA3 A;  1S5A A;  3FG4 A;  4XDV A;  1RN4 A;  7STD A;  1KD1 4;  1JKG B;  2K54 A;  3F7X A;  1TIJ A;  1GOY A;  1IVX A;  2A15 A;  1GS3 A;  3F9S A;  1VQN 3;  3DY5 A;  1IU7 A;  1K41 A;  1LXE A;  2OOV A;  1B21 A;  1YNV X;  3DGL A;  4LMI A;  4LYL B;  3CME 3;  1OF5 A;  1IK3 A;  5AYS C;  1GOU A;  3SLU A;  5EEO A;  1Q81 4;  2R4I A;  4H3U A;  4N6U A;  1N5H A;  1JKG A;  2HML B;  1IYY A;  1IVV A;  2O3O A;  3D3L A;  3LT9 A;  1RDS A;  4KFD A;  3CMA 3;  1AVL A;  3EN1 B;  3BNB A;  1JNQ A;  2F98 A;  2XR8 B;  1VQ7 3;  1BNJ A;  1IQ8 A;  4K90 B;  1Q40 B;  4HVN A;  1JBT A;  3EN8 A;  1VQQ A;  3LZA A;  3VSY A;  5IF6 A;  3CNX A;  3K0Z A;  3B7C A;  4BTW A;  1VQ5 3;  3WMD A;  2OQE A;  4WFO A;  1NNV A;  1NWW A;  1EKM A;  1Q42 A;  3LML A;  1FZU A;  1Q40 A;  1M1K 4;  2LYX A;  1K8A 4;  4EYC A;  1QMA A;  3HIG A;  4XB5 A;  3MHE A;  3PGB A;  1W01 A;  1LOV A;  1VQL 3;  1S72 3;  2B24 B;  2CW9 A;  1JB5 A;  1IV9 A;  3DUK A;  1NU3 A;  2OCT A;  3LTA A;  2R41 A;  3MSO A;  3LTB A;  2WOH A;  4K1V A;  1HYF A;  2YFI B;  1RCL A;  1SAR A;  3SOY A;  2B1X B;  1JBR A;  4OVM A;  3SYU A;  4EV2 A;  1OHP A;  3MG1 A;  4HBR A;  1B2Z A;  1WMP A;  4HM3 B;  1I2G A;  2OOV C;  3V98 A;  2QIY A;  3NBB A;  1UCJ A;  2E2T A;  3GZY B;  4K1U A;  3DMC A;  4L7K A;  2CFL A;  5I97 A;  1RTU A;  3HK4 A;  3LT8 A;  3GWR A;  3CC7 3;  3Q3F A;  3ALA A;  3EX9 A;  1DE3 A;  3HI7 A;  1G0T A;  1JRQ A;  1VQM 3;  2FNQ A;  3X3X A;  1RRL A;  3CCR 3;  1GY5 A;  1I70 A;  4CPK A;  5D81 A;  1GMQ A;  1BNS A;  4NRE A;  2OQE C;  2PNC A;  1TRQ A;  2F56 A;  3LH4 A;  1DMM A;  4LSO A;  1BRS A;  1YGE A;  3EF8 A;  2D1W A;  2LQV A;  3L0R A;  1MOL A;  1LOX A;  2ML6 A;  3MG2 A;  1FUW A;  2BT3 A;  3D5I A;  2UGI A;  3D9R A;  1HKX A;  5FGO A;  1FGT A;  3FKA A;  3TDG A;  1O7H B;  1DMQ A;  3I55 3;  1B3S A;  2KXG A;  2GXF A;  1V74 A;  1UUG B;  3NBJ A;  6GSP A;  2XH9 A;  3ROB A;  3RNT A;  3BIR A;  4EBG A;  1LRA A;  5IW9 A;  1Z1S A;  2YX9 A;  4NHF A;  4WP5 A;  5EVH A;  3FSD A;  4BU4 A;  3JVC A;  1QAK A;  1W7C A;  1W5Z A;  2BNG A;  4MEI A;  6RNT A;  3O8Y A;  1T5Y A;  3MPH A;  4BTY A;  1HZ1 A;  1O7P B;  1B2U A;  4O02 B;  1JB2 A;  2UX0 A;  2BU4 A;  4TX4 A;  4LEH A;  3UJM A;  3AHS A;  3NV0 B;  4GHO A;  4IPB A;  3MWZ A;  2W56 B;  1LOW A;  2K0M A;  3WOE B;  2CKF B;  2W04 A;  2J8X B;  4PEJ A;  4QWT A;  4WWU C;  4AKY A;  1BNR A;  1BGS A;  1STD A;  3ER7 A;  1IVW A;  2Y74 A;  3G4S 3;  3AMO B;  2XFS A;  1LVN A;  1KC8 4;  3KKG A;  3EBY A;  2W0Q A;  2W56 A;  1YGW A;  1VQ9 3;  3PXM A;  1BUJ A;  2AAD A;  3FF0 A;  1BSC A;  3N9H A;  1OGZ A;  1TRP A;  4FMA A;  5BU4 A;  1MWS A;  4MMX B;  1BSE A;  1PY3 A;  3AMO A;  5BIR A;  3KFQ C;  1R4Y A;  2W9Q A;  3J7Y d;  1RGF A;  1UUW B;  1RLS A;  1W4N A;  2F5W A;  4WYK A;  1K73 4;  4O3V A;  1JV2 B;  1O7W B;  1T2I A;  3SED A;  1RGK A;  2F86 B;  2KF4 A;  1OHO A;  3EB8 A;  1NB3 I;  3K5T A;  2BMQ B;  4H61 A;  1ULI B;  2MF7 A;  1WTH A;  3BLZ A;  2QA4 3;  3QK9 A;  1M90 4;  3V99 A;  1HU9 A;  2BMR B;  3X3Y A;  1G02 A;  1TJD A;  3IPT A;  5BXQ A;  1MWU A;  1R4C A;  2W03 A;  1Q86 4;  1RMS A;  2CG1 A;  4HOH A;  5AII A;  1BNF A;  1VQP 3;  1I3I A;  1RSN A;  4MJD A;  1BSD A;  1VZZ A;  1RHL A;  2E2U A;  3URP A;  3FCS B;  3NM2 A;  3G16 A;  2ML5 A;  3GZX B;  3PZW A;  1C7H A;  2YFJ B;  5FW5 A;  2HMJ B;  1Q9E A;  1RGH A;  2F4Y A;  3NBR A;  1OGX A;  2Q07 A;  3HOH A;  1UCL A;  3S29 A;  3CNM A;  3T8U A;  4J5K A;  3ZFZ A;  3NHX A;  3G0K A;  3U97 A;  5ELJ A;  4OUQ A;  1QAL A;  1UGH I;  1X1X A;  2GBX B;  3K7C A;  3DGY A;  3A5E A;  4HM6 B;  1NB5 I;  1X1Y A;  3CXC 2;  1MGR A;  8CHO A;  5G1L A;  5D83 A;  1WMN A;  3F14 A;  3WDG B;  9RNT A;  5JBS A;  1A67 A;  1IT8 A;  1FGQ A;  1NO3 A;  3V92 A;  3MKI A;  2IY2 A;  3LXU X;  3GAX A;  1N8Q A;  1CH0 A;  2STD A;  2ZA4 A;  1FGO A;  3H51 A;  3I0Y A;  5IEO A;  1K9M 4;  2KF3 A;  3WHO A;  1Q7Y 4;  4EV5 A;  3CCM 3;  1YVB I;  2RNT A;  3GRD A;  1US1 A;  2IYJ A;  2XEP A;  4HM1 B;  2Z7A A;  3OV4 A;  3PS8 A;  5AIF A;  5JPU A;  3OX9 A;  2GEY A;  1RN1 A;  1BNE A;  1CYV A;  3LTD A;  3DGN A;  4N3V A;  3JUP A;  1TTO A;  1KSI A;  3EBT A;  2O9U X;  5CLK A;  1ASK A;  1ZGX A;  4CJN A;  1I8V A;  1MGW A;  1W2B 2;  1YJ9 3;  2BMO B;  1JZO A;  1W00 A;  1Q7H A;  3SXX A;  3WOD G;  4BL2 A;  1YJN 3;  2ZDJ A;  3KSE D;  3KZT A;  4Q53 A;  2E2V A;  2K3D A;  3UNL A;  3ZG0 A;  2QEX 3;  2W9P A;  2W6J H;  1NDO B;  4HZB B;  1TFO A;  4N6O B;  2CH9 A;  3T8N A;  6STD A;  4KVH A;  3FH1 A;  4J5G A;  1ISK A;  2F99 A;  1UGI A;  2RSX A;  1N8R 4;  1RNT A;  1DET A;  1V58 A;  2HMK B;  1BU4 A;  1RJO A;  3BNC A;  4MMY B;  4N6L A;  4N6M A;  2HMM B;  2JQ5 A;  3E99 A;  3S67 A;  5HGR A;  2P05 A;  2WO0 A;  2CX1 A;  4FMB A;  1RNB A;  3IJE B;  1A90 A;  1VQK 3;  4X2H A;  3S28 A;  2W2C A;  2PZV A;  1FW7 A;  3EE1 A;  1IQY A;  3B4O A;  1YIJ 3;  3F8X A;  3SVA A;  1YJW 3;  4XM4 A;  2FXT A;  4DKI A;  1WMO A;  2L4V A;  5DRV A;  4L8P A;  2Y73 A;  3X3Z A;  4AEQ A;  2INX A;  1JN5 A;  2CFK A;  3CCJ 3;  4LZI A;  3PCR A;  4I5Q A;  4O2H A;  1VQO 3;  4HYZ A;  5STD A;  4L8O A;  1I2F A;  2GU1 A;  3G6E 3;  3VF1 A;  1LOY A;  5CF1 A;  4J9A A;  1E97 A;  2GEX A;  1RKY A;  2Z6B A;  1LQM B;  7RNT A;  1E3V A;  1A2P A;  1TUH A;  1FGM A;  8RNT A;  5BVB A;  1X1U A;  5IEN A;  2CHC A;  1ZS7 A;  2P38 A;  1FYS A;  3WA2 X;  1EUI C;  1EA2 A;  1SPU A;  4MMZ B;  4N6V 0;  3N54 B;  5ELU A;  5TGN A;  3LYG A;  4BL3 A;  1IV7 A;  1UCI A;  3JUN A;  5M1A A;  4R1K A;  4WYK B;  1EQK A;  2IUJ A;  1B2S A;  3UB1 A;  1LNH A;  2GU3 A;  1YVS A;  1RN7 A;  3WOF B;  1RGL A;  1U5O A;  1OCV A;  5IG5 A;  1BRJ A;  1RGE A;  2V1L A;  1RGA A;  1C54 A;  1OAC A;  4R9K A;  3OXA A;  4HAA A;  1AY7 A;  1RGC A;  4KT3 B;  4KFF A;  4XBT A;  4GSP A;  2OTL 3;  3CPO A;  4I4K A;  5IG4 A;  2CFG A;  4G1M B;  2RFR A;  3SX1 A;  1BVI A;  5HOH A;  3K63 A;  4XBX A;  1OHS A;  4N6T A;  1IQX A;  2C10 A;  1U8C B;  4STD A;  2XSH B;  2CK3 H;  3F8H A;  3U1W A;  1J2B A;  1D6U A;  1FUT A;  1O7G B;  3EC9 A;  4OK0 A;  5DRE A;  4R80 A;  1B2M A;  1PU4 A;  2GSP A;  2C4B A;  4LGQ A;  4HM8 B;  3DGM A;  2Z77 A;  3RDE A;  2WGO A;  1STF I;  2IMJ A;  3BB9 A;  1VQ4 3;  2BHM A;  2IA7 A;  3BND A;  5LC7 A;  2AAE A;  5KP1 A;  5KP4 A;  2CWV A;  1VQ8 3;  1K28 A;  1RRH A;  4FMC A;  1D6Z A;  1SIH A;  5RNT A;  1JBS A;  3KSP A;  3CCS 3;  2HOH A;  3D4A A;  1QVF 2;  1BSB A;  2ZL8 A;  3IMA B;  2OTJ 3;  1A2K A;  3FG1 A;  1KQS 2;  1RGG A;  1UDI I;  3CU3 A;  1N9J A;  4U13 A;  1MWT A;  2HMO B;  4HM7 B;  5CXO A;  5AYR B;  1BUQ A;  3OWU A;  3EHC A;  4FCJ A;  3DXO A;  1IDP A;  1IT7 A;  1BRH A;  2SBL A;  2CC3 A;  3AGN A;  2Z76 A;  1TFK A;  3JUM A;  5CK6 A;  3CC2 3;  1N5P A;  2XF3 A;  3GZR A;  1W6C A;  5LC6 A;  1LNI A;  5AEU B;  3UL6 A;  3NQZ A;  4HKV B;  4RNT A;  2MC8 A;  3B8L A;  3BNE A;  4CCV A;  3Q1C A;  3FF2 A;  1B2X A;  2YFL B;  2RBI A;  3X42 A;  3X40 A;  1D6Y A;  3CD6 3;  2XGN A;  1AVK A;  2JDI H;  3DM8 A;  3GSP A;  5IG3 A;  1TU5 A;  1KWI A;  5M18 A;  1JB4 A;  1DMN A;  1GOV A;  1FUS A;  1OH0 A;  3BU4 A;  1QAF A;  3MG3 A;  4ZM8 A;  4XBY A;  4GL6 A;  3DGO A;  1T2H A;  3D5G A;  3Q2P A;  1JZD A;  4BTX A;  1W6Y A;  2WGQ A;  1FGR A;  2CX0 A;  1GMR A;  3DH2 A;  1GD3 A;  5A0O B;  4GB5 A;  5EQL A;  1JJ2 2;  3WR2 A;  2CG0 A;  1BOX A;  3AGO A;  3JUQ A;  4JRF A;  2UUG C;  2IUK A;  3UL5 A;  1VQ6 3;  3OWS A;  1CQS A;  3ZG5 A;  2H0G A;  4HM5 B;  1QJG A;  3VGN A;  1UI8 A;  1ZX2 A;  3H3H A;  4FCM A;  2KRT A;  1NJI 4;  1UI7 A;  5AIG A;  1N9E A;  4EW5 A;  1B20 A;  1FA3 A;  4EC6 A;  2KF6 A;  2C11 A;  4JF8 A;  4KFE A;  5AEW B;  3CCE 3;  4FCZ A;  2RGQ A;  1WQL B;  3KII A;  1YI2 3;  1W02 A;  5IG0 A;  4R4K A;  3F40 A;  3M8C A;  4FR9 A;  3RGA A;  1ULJ B;  5G2G A;  4J8T A;  3NXJ A;  1AR0 A;  2P0M A;  1BNG A;  1JN5 B;  3AHW A;  2BIR A;  3I56 3;  4X2O A;  3CCV 3;  2ZHX B;  1EG9 B;  1T3B A;  3LOY A;  1DVC A;  2QGU A;  4AKZ A;  4NPB A;  3SOA A;  3CCL 3;  1ROA A;  3KN4 A;  3S27 A;  4BIR A;  3MYT A;  3NUV A;  1BRK A;  4HZ9 B;  2CFD A;  2CIU A;  1O7N B;  1I3F A;  1M9G A;  4HM0 B;  1I2E A;  3HII A;  3OWY A;  1SQW A;  2GBW B;  5D82 A;  1W6G A;  1F8N A;  2L1S A;  1BRG A;  2OWP A;  3A76 A;  1CEW I;  1IVU A; 
#chains in the Genus database with same CATH homology
 1AV4 A;  1GD4 A;  3NX0 A;  4HJL B;  1YHQ 3;  2CWU A;  3T0U A;  2M7O A;  1M1X B;  5IEP A;  4FMD A;  4RZM A;  3CCQ 3;  2HMN B;  3GZB A;  3CPW 2;  3PCS A;  2XGL A;  1SJW A;  1TP6 A;  1YIT 3;  3NQY A;  1QVG 2;  2XRX B;  3CCU 3;  3PYJ A;  5AIH A;  5AI1 A;  3HX8 A;  3LTC A;  3G71 3;  1MNL A;  1G96 A;  2CWT A;  1ZO2 A;  3NM7 A;  3QRD A;  4IT7 A;  3HZP A;  1A2V A;  1W2Z A;  5CF2 A;  2P09 A;  2FGT A;  4ORL A;  1E3R A;  1Y4K A;  4R9L A;  1GYB A;  5JPP A;  1OPY A;  1SII A;  4N6N B;  3F7S A;  3OW2 2;  3Q90 A;  3N8B A;  4O8S A;  3DZL A;  3FG3 A;  2CFW A;  4CDL A;  1UW1 A;  1Q82 4;  1ROV A;  3FZW A;  1CYU A;  1WNH A;  2D42 A;  3FLJ A;  2RCD A;  1DVD A;  3G8Z A;  3EJV A;  3NV0 A;  3K9M C;  2XFT A;  4K61 A;  4RNY A;  4XDW A;  3S5C A;  1GY6 A;  1DYU A;  1GY7 A;  2BO9 B;  1O7M B;  3KE7 A;  3EQQ B;  2KCD A;  1OUN A;  4RNZ A;  4WHA A;  5KP3 A;  1L5G B;  3STD A;  2P0X A;  4IIA A;  3FGY A;  1PFP A;  3JUO A;  3X41 A;  5IER A;  2I9W A;  2XSO B;  2WOF A;  4KZ1 A;  4EXR A;  3B4P A;  4HM4 B;  4HM2 B;  3ECF A;  3RGR A;  3CC4 3;  4RBN A;  1UUV B;  1OF5 B;  3WA3 A;  1S5A A;  3FG4 A;  4XDV A;  7STD A;  1KD1 4;  1JKG B;  2K54 A;  3F7X A;  1TIJ A;  1IVX A;  2A15 A;  1GS3 A;  3F9S A;  1VQN 3;  3DY5 A;  1IU7 A;  1K41 A;  1LXE A;  2OOV A;  3DGL A;  4LMI A;  3CME 3;  1OF5 A;  1IK3 A;  5AYS C;  3SLU A;  5EEO A;  1Q81 4;  2R4I A;  4H3U A;  4N6U A;  1N5H A;  1JKG A;  2HML B;  1IVV A;  2O3O A;  3D3L A;  3LT9 A;  4KFD A;  3CMA 3;  1AVL A;  3EN1 B;  3BNB A;  1JNQ A;  2F98 A;  2XR8 B;  1VQ7 3;  1IQ8 A;  4K90 B;  1Q40 B;  4HVN A;  3EN8 A;  3LZA A;  5IF6 A;  3VSY A;  3CNX A;  3K0Z A;  3B7C A;  4BTW A;  1VQ5 3;  3WMD A;  2OQE A;  4WFO A;  1NWW A;  1EKM A;  1Q42 A;  3LML A;  1Q40 A;  1M1K 4;  2LYX A;  1K8A 4;  4EYC A;  1QMA A;  3HIG A;  4XB5 A;  3MHE A;  3PGB A;  1W01 A;  1VQL 3;  1S72 3;  2B24 B;  2CW9 A;  1JB5 A;  1IV9 A;  3DUK A;  1NU3 A;  2OCT A;  3LTA A;  3MSO A;  3LTB A;  2WOH A;  4K1V A;  2YFI B;  3SOY A;  2B1X B;  4OVM A;  4EV2 A;  1OHP A;  3MG1 A;  4HBR A;  1WMP A;  4HM3 B;  2OOV C;  3V98 A;  2QIY A;  3NBB A;  2E2T A;  3GZY B;  4K1U A;  3DMC A;  4L7K A;  2CFL A;  5I97 A;  3HK4 A;  3LT8 A;  3GWR A;  3CC7 3;  3ALA A;  3EX9 A;  3HI7 A;  1JRQ A;  1VQM 3;  2FNQ A;  3X3X A;  1RRL A;  3CCR 3;  1GY5 A;  5D81 A;  4NRE A;  2OQE C;  2PNC A;  3LH4 A;  1DMM A;  4LSO A;  1YGE A;  3EF8 A;  2D1W A;  2LQV A;  3L0R A;  1MOL A;  1LOX A;  2ML6 A;  3MG2 A;  1FUW A;  2BT3 A;  3D9R A;  1HKX A;  5FGO A;  1FGT A;  3FKA A;  3TDG A;  1O7H B;  1DMQ A;  3I55 3;  2KXG A;  2GXF A;  1V74 A;  3NBJ A;  2XH9 A;  3ROB A;  4EBG A;  5IW9 A;  1Z1S A;  2YX9 A;  4NHF A;  4WP5 A;  5EVH A;  3FSD A;  3JVC A;  1QAK A;  1W7C A;  1W5Z A;  2BNG A;  4MEI A;  3O8Y A;  1T5Y A;  3MPH A;  4BTY A;  1O7P B;  4O02 B;  1JB2 A;  2UX0 A;  4TX4 A;  4LEH A;  3UJM A;  3NV0 B;  4IPB A;  3MWZ A;  2W56 B;  2K0M A;  3WOE B;  2CKF B;  2W04 A;  4PEJ A;  4QWT A;  4WWU C;  4AKY A;  1STD A;  3ER7 A;  1IVW A;  2Y74 A;  3G4S 3;  3AMO B;  2XFS A;  1LVN A;  1KC8 4;  3KKG A;  3EBY A;  2W0Q A;  2W56 A;  1VQ9 3;  3PXM A;  3FF0 A;  3N9H A;  1OGZ A;  4FMA A;  4MMX B;  3AMO A;  3J7Y d;  3KFQ C;  2W9Q A;  1UUW B;  1W4N A;  4WYK A;  1K73 4;  4O3V A;  1JV2 B;  1O7W B;  3SED A;  2F86 B;  1OHO A;  3EB8 A;  1NB3 I;  3K5T A;  2BMQ B;  4H61 A;  1ULI B;  2MF7 A;  1WTH A;  3BLZ A;  2QA4 3;  3QK9 A;  1M90 4;  3V99 A;  1HU9 A;  2BMR B;  3X3Y A;  3IPT A;  5BXQ A;  1R4C A;  2W03 A;  1Q86 4;  2CG1 A;  5AII A;  1VQP 3;  4MJD A;  1VZZ A;  2E2U A;  3FCS B;  3NM2 A;  3G16 A;  2ML5 A;  3GZX B;  3PZW A;  1C7H A;  2YFJ B;  5FW5 A;  2HMJ B;  3NBR A;  3S29 A;  1OGX A;  2Q07 A;  3T8U A;  3CNM A;  3NHX A;  3G0K A;  3U97 A;  5ELJ A;  4OUQ A;  1QAL A;  2GBX B;  3K7C A;  4HM6 B;  1NB5 I;  3CXC 2;  8CHO A;  5D83 A;  1WMN A;  3F14 A;  3WDG B;  5JBS A;  1A67 A;  1IT8 A;  1FGQ A;  1NO3 A;  3V92 A;  3MKI A;  3LXU X;  3GAX A;  1N8Q A;  2STD A;  1FGO A;  3H51 A;  3I0Y A;  5IEO A;  1K9M 4;  1Q7Y 4;  4EV5 A;  3CCM 3;  1YVB I;  3GRD A;  1US1 A;  2XEP A;  4HM1 B;  2Z7A A;  3OV4 A;  3PS8 A;  5AIF A;  5JPU A;  3OX9 A;  2GEY A;  1CYV A;  3LTD A;  3DGN A;  4N3V A;  3JUP A;  1KSI A;  3EBT A;  2O9U X;  5CLK A;  1ASK A;  1W2B 2;  1YJ9 3;  2BMO B;  1W00 A;  3SXX A;  3WOD G;  1YJN 3;  2ZDJ A;  3KSE D;  3KZT A;  4Q53 A;  2E2V A;  2QEX 3;  3UNL A;  2W9P A;  2W6J H;  1NDO B;  4HZB B;  1TFO A;  4N6O B;  2CH9 A;  3T8N A;  6STD A;  4KVH A;  3FH1 A;  1ISK A;  2F99 A;  2RSX A;  1N8R 4;  2HMK B;  3BNC A;  4MMY B;  1RJO A;  4N6L A;  4N6M A;  2HMM B;  2JQ5 A;  3E99 A;  3S67 A;  5HGR A;  2P05 A;  2WO0 A;  4FMB A;  1A90 A;  3IJE B;  1VQK 3;  4X2H A;  3S28 A;  2W2C A;  2PZV A;  3EE1 A;  1IQY A;  3B4O A;  1YIJ 3;  3F8X A;  3SVA A;  1YJW 3;  4XM4 A;  2FXT A;  1WMO A;  2L4V A;  5DRV A;  4L8P A;  2Y73 A;  3X3Z A;  4AEQ A;  2INX A;  1JN5 A;  2CFK A;  3CCJ 3;  4LZI A;  3PCR A;  4O2H A;  1VQO 3;  4HYZ A;  5STD A;  4L8O A;  3G6E 3;  2GU1 A;  3VF1 A;  5CF1 A;  4J9A A;  1E97 A;  2GEX A;  1RKY A;  2Z6B A;  1E3V A;  1TUH A;  1FGM A;  5BVB A;  5IEN A;  2CHC A;  2P38 A;  3WA2 X;  1SPU A;  1EA2 A;  4N6V 0;  4MMZ B;  3N54 B;  5ELU A;  5TGN A;  3LYG A;  1IV7 A;  3JUN A;  4R1K A;  4WYK B;  1EQK A;  2IUJ A;  3UB1 A;  1LNH A;  2GU3 A;  1RN7 A;  3WOF B;  1U5O A;  1OCV A;  5IG5 A;  2V1L A;  1OAC A;  4R9K A;  3OXA A;  4KFF A;  4XBT A;  2OTL 3;  3CPO A;  4I4K A;  5IG4 A;  2CFG A;  4G1M B;  2RFR A;  3SX1 A;  3K63 A;  4XBX A;  1OHS A;  4N6T A;  1IQX A;  2C10 A;  1U8C B;  4STD A;  2XSH B;  2CK3 H;  3F8H A;  3U1W A;  1J2B A;  1D6U A;  1O7G B;  3EC9 A;  4OK0 A;  5DRE A;  4R80 A;  1PU4 A;  4LGQ A;  4HM8 B;  3DGM A;  2Z77 A;  3RDE A;  2WGO A;  1STF I;  2IMJ A;  3BB9 A;  1VQ4 3;  2BHM A;  2IA7 A;  3BND A;  5LC7 A;  5KP1 A;  5KP4 A;  2CWV A;  1VQ8 3;  1K28 A;  1RRH A;  4FMC A;  1D6Z A;  1SIH A;  3KSP A;  3CCS 3;  1QVF 2;  2ZL8 A;  3IMA B;  2OTJ 3;  1A2K A;  3FG1 A;  1KQS 2;  3CU3 A;  1N9J A;  4U13 A;  2HMO B;  4HM7 B;  5CXO A;  5AYR B;  1BUQ A;  3OWU A;  3EHC A;  4FCJ A;  3DXO A;  1IDP A;  1IT7 A;  2SBL A;  2CC3 A;  3JUM A;  2Z76 A;  1TFK A;  5CK6 A;  3CC2 3;  1N5P A;  2XF3 A;  3GZR A;  1W6C A;  5LC6 A;  5AEU B;  3UL6 A;  3NQZ A;  4HKV B;  2MC8 A;  3B8L A;  3BNE A;  4CCV A;  3Q1C A;  3FF2 A;  2YFL B;  3X42 A;  3X40 A;  1D6Y A;  3CD6 3;  2XGN A;  1AVK A;  2JDI H;  3DM8 A;  5IG3 A;  1TU5 A;  1KWI A;  1JB4 A;  1DMN A;  1OH0 A;  3MG3 A;  1QAF A;  4ZM8 A;  4XBY A;  4GL6 A;  3DGO A;  3Q2P A;  4BTX A;  1W6Y A;  2WGQ A;  1FGR A;  5A0O B;  1JJ2 2;  1GD3 A;  4GB5 A;  5EQL A;  2CG0 A;  3JUQ A;  4JRF A;  2IUK A;  3UL5 A;  1VQ6 3;  3OWS A;  1CQS A;  4HM5 B;  1QJG A;  3VGN A;  1UI8 A;  1ZX2 A;  3H3H A;  4FCM A;  2KRT A;  1NJI 4;  1UI7 A;  5AIG A;  1N9E A;  1FA3 A;  4EC6 A;  2C11 A;  4JF8 A;  4KFE A;  5AEW B;  3CCE 3;  4FCZ A;  2RGQ A;  1WQL B;  3KII A;  1YI2 3;  1W02 A;  5IG0 A;  4R4K A;  3F40 A;  3M8C A;  4FR9 A;  3RGA A;  1ULJ B;  5G2G A;  4J8T A;  3NXJ A;  1AR0 A;  2P0M A;  1JN5 B;  3I56 3;  4X2O A;  3CCV 3;  1EG9 B;  3LOY A;  1DVC A;  2QGU A;  4AKZ A;  3SOA A;  3CCL 3;  1ROA A;  3KN4 A;  3S27 A;  3MYT A;  3NUV A;  4HZ9 B;  2CFD A;  2CIU A;  1O7N B;  1M9G A;  4HM0 B;  3HII A;  3OWY A;  1SQW A;  2GBW B;  5D82 A;  1W6G A;  1F8N A;  2OWP A;  3A76 A;  1CEW I;  1IVU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...