3G713

Co-crystal structure of bruceantin bound to the large ribosomal subunit
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
total genus 13
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2009-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3g71300
3CCJ3 1VQ73 1VQ53 3CCM3 1NJI4 3CCE3 1KQS2 2QA43 3CCQ3 3CCL3 3I553 1YJ93 3CCS3 1W2B2 1Q864 2OTL3 1VQL3 2QEX3 3CME3 3G6E3 1YI23 3CC43 1K8A4 3I563 1Q7Y4 1M904 1S723 1VQ63 1K9M4 1Q814 3CXC2 3OW22 1YJW3 1Q824 1K734 2OTJ3 1KD14 1KC84 1JJ22 1YJN3 3CC23 1QVG2 1QVF2 1VQN3 3CCR3 1YHQ3 1VQO3 1YIJ3 1N8R4 3CC73 1VQ43 1VQ83 3G4S3 3CCV3 3CMA3 3CCU3 1M1K4 1VQK3 1VQP3 3CPW2 3CD63 1VQ93 3G713 1YIT3 1VQM3
chains in the Genus database with same CATH superfamily
3GZXB 3CCJ3 1PYLA 3OWSA 4BU4A 2OQEC 1JBRA 2Z76A 5LC7A 1CYVA 1O7NB 1PU4A 3CCQ3 2QA43 3X41A 1RGAA 4IPBA 1IQXA 1W6GA 4EYCA 5DRVA 2RCDA 3MYTA 5IEOA 3AHWA 7GSPA 4X2OA 2CH9A 4HM3B 3DMCA 4LMIA 1BRNL 1VQ63 1YGWA 4FMCA 4XB5A 3STDA 1J2BA 1FGRA 1GMQA 2ML5A 2YFLB 5G1LA 3JUPA 3F14A 4WHAA 3KSED 4NHFA 1VQO3 4X2HA 3BNCA 4XM4A 4RNTA 3CC73 3LOYA 3HIGA 3CMA3 1RCLA 3WHOA 1JBTA 3T8NA 1OF5B 5IW9A 3DGYA 1RTUA 3GZBA 4WYKA 1R4YA 3UJMA 1X1YA 4QWTA 5M19A 2Z77A 2RGQA 1ZS7A 1BIRA 2P0XA 3D3LA 5TGNA 3BIRA 4BTXA 1RRLA 4KZ1A 2BMOB 1RJOA 2CFWA 3E99A 1OGXA 3F40A 3K9MC 4HM1B 5IG0A 3AGNA 4N3VA 2O9UX 4EW5A 1T3BA 3N54B 1Y4KA 2OQEA 1BSEA 3WODG 3X42A 3LT8A 2YX9A 1YJW3 3NHXA 1W6YA 1O7HB 3FZWA 4WWUC 3JUNA 2HMLB 1UUGB 1UCJA 1A90A 2HMKB 4FCZA 3G4S3 2XSHB 2W04A 2Q07A 5AYRB 4ILFA 2AADA 3MPHA 1EUIC 3FSDA 4EC6A 3WDGB 1YIT3 1RGEA 2E2UA 1VQ73 5KP1A 2LQVA 4HZ9B 3CCM3 1A2PA 3Q1CA 1G96A 2P05A 3FH1A 4OVMA 5LC6A 1BVIA 1LNHA 2H0GA 5A0OB 1W00A 4BTYA 1UUWB 2FGTA 2E2TA 1YI23 2BU4A 1M904 3UB1A 1JN5A 2CFKA 2XFSA 5EQLA 4PEJA 3F8XA 4RBNA 2KRTA 3F7SA 3WA3A 3AGOA 4N6MA 2ZL8A 1B2XA 1Q7HA 3EHCA 4N6LA 4XBTA 1RLSA 3D9RA 4FMBA 2HMNB 1BANA 5CK6A 2CIUA 3LTDA 1Q40B 3KN4A 2BIRA 1BRJA 1AR0A 1W01A 3D4AA 1VQ93 1DE3A 1RGLA 1GY6A 1YNVX 2W9PA 1TRQA 1Q814 3EQQB 1RGCA 4XDVA 1G02A 1W2B2 2P0MA 2STDA 1JKGB 3GRDA 2XSOB 1NO3A 4HM7B 2XRXB 3JUQA 4KT3B 2QGUA 2C10A 3KZTA 3K5TA 3DGLA 1MNLA 1BRGA 1GMPA 3G16A 3B8LA 1LQGC 1MWTA 3EB8A 1TRPA 2V1LA 3FKAA 3M8CA 4HKVB 4ORLA 1GOYA 1OGZA 3OV4A 5CXOA 4CJNA 1NB5I 1MGWA 3EC9A 3NQZA 1JV2B 2B1XB 2K3DA 5JBSA 1GOUA 1CH0A 3F8HA 2ZDJA 1W2ZA 3IJEB 5KP3A 1N8R4 1FUTA 1I0VA 1VQ43 1VQ83 3VF1A 1OCVA 4N6UA 3NM7A 7STDA 3WOFB 1IV9A 2BMRB 1VQP3 1B21A 2GU1A 3LH4A 3V98A 3AMOA 5AEWB 1BNIA 4EV2A 1GD4A 1M1XB 2CWTA 2GU3A 1IT8A 4MEIA 4XDWA 1RSNA 3X3YA 4K90B 1I8VA 4N6TA 5IERA 3GAXA 4BL3A 3CCL3 2J8XB 1MWUA 2XEPA 3G0KA 3LT9A 5IF6A 2RBIA 1HU9A 3NXJA 3S27A 1GY7A 3N8BA 2GEYA 3OWYA 4L8OA 4WFOA 2R41A 1X1WA 2RFRA 5BU4A 1S723 1BNSA 3B7CA 4HVNA 5I97A 4KFEA 1KD14 1E3RA 3X40A 5AIFA 1NDOB 4BL2A 1BRSA 2XH9A 4BIRA 2CX0A 3S29A 4RNZA 1U5OA 3LTCA 2W6JH 3EN1B 1HYFA 5FGOA 3Q2PA 2H0IA 1C7HA 1WMOA 3F9SA 5JPPA 3CPW2 3H3HA 3DUKA 2PZVA 3NX0A 4FMDA 1X1XA 4IIAA 1SIHA 1GY5A 1IQYA 2IY2A 2CWVA 1LQMB 2Z7AA 3FGYA 3KKGA 5FW5A 3CME3 1DYUA 2GEXA 5HOHA 3KIIA 4IT7A 4JF8A 3PYJA 4CPKA 1OF5A 3NM2A 1RN7A 2W56B 1Z1SA 5IG3A 1A67A 1W6CA 1EQKA 3T8UA 5STDA 2P38A 1BSBA 2L4VA 1MWSA 5RNTA 2ML6A 1ZX2A 2H0HA 3OW22 3LMLA 1QVF2 1VQN3 1CYUA 1T5YA 1PFPA 1QJGA 3NBJA 2F5WA 1DMNA 3LZAA 1VQQA 1HKXA 4WP5A 3DM8A 1GS3A 3I0YA 3FLJA 3CPOA 2F98A 1OHOA 4HM2B 5GSPA 1VZZA 1JB5A 3DH2A 3DXOA 3FG4A 3EN8A 3OX9A 4HZBB 1YJ93 3KSPA 4GHOA 3LYGA 4HBRA 5ELJA 2IYJA 3EBYA 3MG2A 1W7CA 1V58A 4MMXB 3EBTA 3PZWA 3SXXA 2CG0A 4LEHA 1A2KA 3K7CA 1QMAA 1UI7A 2LYXA 3DGNA 3RGRA 3NV0B 3PCRA 5IEPA 2HMJB 1N9EA 2A15A 1ROVA 3MSOA 3DZLA 1WTHA 1W02A 4O3VA 1BRHA 2KF5A 4G1MB 2BNGA 5CLKA 5IG4A 4R80A 1GOVA 3RGAA 1B27A 1VQ53 2O3OA 3S28A 5DREA 3HIIA 1Q40A 1BAOA 3CCS3 2AAEA 1I3FA 1M9GA 5ELUA 5AIGA 3MHEA 3O8YA 4GL6A 1AVKA 3NBBA 1T2HA 3IPTA 4TX4A 5IG5A 1YVSA 3S67A 1JKGA 3NUVA 3UL6A 2CK3H 4L8PA 1BSAA 4MMZB 1JJ22 2WOHA 4N6NB 1BOXA 1IVUA 1RNBA 3MG3A 1BRIA 3ZFZA 1ZGXA 1TIJA 3BU4A 2SARA 2BHMA 1RRHA 1O7WB 4AEQA 1FGOA 1RDSA 2IMJA 4RZMA 2GXFA 3OWUA 1R4CA 1WMPA 4GSPA 3BNBA 6STDA 1VQL3 3HZPA 2D42A 6RNTA 3LTAA 3Q3FA 1Q7Y4 1I3IA 2PNCA 2YFIB 1IV7A 3D5IA 5M1AA 2BMQB 5KP4A 4I5QA 1UGHI 3CXC2 1SJWA 3N9HA 2KF6A 2OTJ3 1CEWI 2KF3A 2CHCA 2IUJA 1B3SA 4ZM8A 2Y73A 3J7Yd 3ALAA 1JNQA 2MF7A 3HK4A 4AKZA 2F4YA 4OUQA 1I2EA 1EA2A 3MG1A 2IUKA 1MOLA 4K1UA 1N5HA 3GZRA 4HM0B 1JRQA 4K1VA 5D82A 1UCLA 4MMYB 1OACA 1NJI4 1RGFA 2XGLA 1O7PB 2W2CA 1Q864 2OTL3 5CF2A 4OK0A 3S5CA 1AVLA 1T2IA 2OOVC 4XBXA 1BNGA 1DMQA 1BUJA 2B24B 1FGQA 1N5PA 2I9WA 4CCVA 4R9KA 5D81A 3NQYA 1D6YA 1TJDA 4MJDA 1AQZA 1OH0A 2JQ5A 1QVG2 3UL5A 4J9AA 1I2GA 1BGSA 1KSIA 4XBYA 4BTWA 3SEDA 1GYBA 4EBGA 5CF1A 1ISKA 1W5ZA 3CCV3 3B4OA 4LSOA 3WA2X 5BXQA 3CCU3 3IMAB 1NU3A 1FA3A 1N8QA 1PY3A 3HOHA 1F8NA 3G713 1JZOA 3X3ZA 1LNIA 1LVNA 1K28A 1OPYA 1O7MB 1BU4A 1FGMA 1UCKA 4L7KA 4R1KA 3ZG5A 2OWPA 2K0MA 1RKYA 3ECFA 2UGIA 1LOXA 2KXGA 8CHOA 3A76A 5G1KA 2UUGC 1LOWA 2R4IA 3LTBA 1K8A4 2RNTA 1WMNA 1K9M4 1KWIA 1GMRA 1ULJB 3CU3A 1B2UA 3AMOB 1LRAA 3AHSA 4N6OB 1RGHA 3FCSB 4O02B 1K734 2HMOB 4HAAA 1KC84 2XFTA 1TFOA 1UGIA 2JDIH 2OOVA 3JUMA 3H51A 1YGEA 3GWRA 1I0XA 1QAFA 3DGMA 2F5MA 2FNQA 3ER7A 1IVXA 1I70A 1E97A 4CDLA 2ZHXB 3A5EA 5IENA 4GB5A 2C11A 2OCTA 3NV0A 4U13A 2WGOA 1LOYA 2MC8A 1B2ZA 4N6V0 1RN4A 1FYSA 5AIHA 3Q90A 3B4PA 5M18A 3CCE3 3QRDA 2INXA 3BB9A 2GBWB 3MKIA 2QEX3 1UUVB 3SOAA 5AI1A 4FMAA 4K61A 3G6E3 1QALA 1W4NA 3BNDA 3SX1A 3FG3A 4JRFA 3WOEB 3K0ZA 1IYYA 4HM8B 2CX1A 1TTOA 4HYZA 1NB3I 1OHPA 3DY5A 4LGQA 5BIRA 1QAKA 1LOVA 1BNJA 1JB4A 1Q824 2C4BA 2E2VA 1C54A 2SBLA 3PGBA 3SLUA 1YHQ3 1ASKA 3CNXA 1UCIA 4HJLB 3EF8A 5HGRA 7RNTA 3CNMA 3X3XA 1RCKA 2P09A 1L5GB 1TP6A 3K63A 1N9JA 1OUNA 2CFLA 3I553 3SYUA 1RHLA 4EV5A 4Q53A 2CFDA 1B20A 1IVWA 4O8SA 1O7GB 5AYSC 2W03A 1A2VA 1ROAA 1FGTA 2GBXB 4H3UA 3NBRA 2BT3A 4EXRA 3FG1A 4HM4B 3FF0A 4HOHA 4O2HA 2M7OA 3PS8A 4J5GA 3L0RA 2IA7A 1NWWA 4HM5B 2W9QA 2CKFB 4WYKB 3CC23 3RNTA 1IU7A 3CCR3 1YIJ3 5JPUA 1BRKA 2WGQA 3DGOA 1FUWA 1SARA 3TDGA 1G0TA 1STDA 4I4KA 4AKYA 2F99A 2WOFA 2XR8B 1GSPA 2W0QA 2KCDA 1B2MA 1HZ1A 1US1A 2CFGA 1JZDA 4LYLB 1RGGA 3WR2A 1DETA 1Q9EA 1RMSA 2FXTA 3GZYB 3JUOA 4KVHA 5BVBA 3EJVA 2L1SA 8RNTA 1DMMA 4FCMA 2XGNA 1BNRA 1X1UA 3V99A 3UNLA 3KFQC 1IK3A 3V92A 1JBSA 1RN1A 1BNFA 1FW7A 3F7XA 1CQSA 5EEOA 4LZIA 3D5GA 3ROBA 5D83A 3GSPA 2QIYA 4R4KA 1M1K4 2Y74A 3EX9A 2K54A 5EVHA 1VQK3 1I2FA 1IT7A 4R9LA 4FR9A 4STDA 5G2GA 4FCJA 3PXMA 1NNVA 2YFJB 1SQWA 1JN5B 1KQS2 1SPUA 3FF2A 1BNEA 1D6ZA 3EE1A 1OHSA 2HOHA 2BO9B 3URPA 1MGRA 1JB2A 1GD3A 1LXEA 1TFKA 2F56A 3PCSA 4H61A 3CC43 1DVDA 1IDPA 3SVAA 1EG9B 1ZO2A 4HM6B 2D1WA 1BUQA 1FUSA 3D79A 3QK9A 3U1WA 1B2SA 2Z6BA 1YJN3 1E3VA 2RSXA 1WQLB 2W56A 3G8ZA 1Q42A 4DKIA 1IQ8A 1SIIA 3KCHA 1TU5A 2GSPA 1K41A 1RGKA 1FZUA 6GSPA 3CD63 4J8TA 3OXAA 1VQM3 5AEUB 1EEJA 3LXUX 2HMMB 5AIIA 1AY7A 3VSYA 1UI8A 3JVCA 1BSCA 1STFI 4NREA 1BSDA 1AV4A 4RNYA 4NPBA 3SOYA 3BLZA 3RDEA 3T0UA 3ZG0A 1WNHA 2WO0A 4J5KA 4KFFA 1UDII 2CC3A 1ULIB 3WMDA 3I563 1YVBI 1UW1A 1D6UA 1U8CB 3MWZA 1V74A 3U97A 1TUHA 1V57A 2CWUA 2KAAA 2CG1A 3HI7A 3VGNA 3BNEA 3KE7A 1RNTA 2F86B 2UX0A 1DVCA 2KF4A 3HX8A 1MWRA 9RNTA 2ZA4A 2XF3A 1IVVA 2CW9A 1EKMA 4KFDA 1S5AA
chains in the Genus database with same CATH topology
3GZXB 3CCJ3 3OWSA 2OQEC 2Z76A 5LC7A 1CYVA 1O7NB 1PU4A 3CCQ3 2QA43 3X41A 4IPBA 1IQXA 1W6GA 4EYCA 5DRVA 2RCDA 3MYTA 5IEOA 4X2OA 2CH9A 4HM3B 3DMCA 4LMIA 1VQ63 4FMCA 4XB5A 3STDA 1J2BA 1FGRA 2ML5A 2YFLB 3JUPA 3F14A 4WHAA 3KSED 4NHFA 1VQO3 4X2HA 3BNCA 4XM4A 3CC73 3LOYA 3HIGA 3CMA3 3T8NA 1OF5B 5IW9A 3GZBA 4WYKA 3UJMA 4QWTA 2Z77A 2RGQA 2P0XA 3D3LA 5TGNA 4BTXA 1RRLA 4KZ1A 2BMOB 1RJOA 2CFWA 3E99A 1OGXA 3F40A 3K9MC 4HM1B 5IG0A 4N3VA 2O9UX 3N54B 1Y4KA 2OQEA 3WODG 3X42A 3LT8A 2YX9A 1YJW3 3NHXA 1W6YA 1O7HB 3FZWA 4WWUC 3JUNA 2HMLB 1A90A 2HMKB 4FCZA 3G4S3 2XSHB 2W04A 2Q07A 5AYRB 3MPHA 4EC6A 3FSDA 1YIT3 3WDGB 2E2UA 1VQ73 5KP1A 2LQVA 4HZ9B 3CCM3 3Q1CA 1G96A 2P05A 3FH1A 4OVMA 5LC6A 1LNHA 5A0OB 1W00A 4BTYA 1UUWB 2FGTA 2E2TA 1YI23 1M904 3UB1A 1JN5A 2CFKA 2XFSA 5EQLA 4PEJA 3F8XA 4RBNA 2KRTA 3F7SA 3WA3A 4N6MA 2ZL8A 3EHCA 4N6LA 4XBTA 3D9RA 4FMBA 2HMNB 5CK6A 2CIUA 3LTDA 1Q40B 3KN4A 1AR0A 1W01A 1VQ93 1GY6A 2W9PA 1Q814 3EQQB 4XDVA 1W2B2 2P0MA 2STDA 1JKGB 3GRDA 2XSOB 1NO3A 4HM7B 2XRXB 3JUQA 2QGUA 2C10A 3KZTA 3K5TA 3DGLA 1MNLA 3G16A 3B8LA 3EB8A 3FKAA 2V1LA 4ORLA 3M8CA 4HKVB 1OGZA 3OV4A 5CXOA 1NB5I 3EC9A 3NQZA 1JV2B 2B1XB 5JBSA 3F8HA 3IJEB 2ZDJA 1W2ZA 5KP3A 1N8R4 1VQ43 1VQ83 3VF1A 1OCVA 4N6UA 3NM7A 7STDA 3WOFB 1IV9A 2BMRB 1VQP3 2GU1A 3LH4A 3V98A 3AMOA 5AEWB 4EV2A 2GU3A 2CWTA 1GD4A 1M1XB 1IT8A 4MEIA 4XDWA 3X3YA 4K90B 4N6TA 5IERA 3GAXA 3CCL3 2XEPA 3G0KA 3LT9A 5IF6A 1HU9A 3NXJA 3S27A 1GY7A 3N8BA 2GEYA 3OWYA 4L8OA 4WFOA 2RFRA 1S723 3B7CA 4HVNA 5I97A 4KFEA 1KD14 1E3RA 3X40A 5AIFA 1NDOB 2XH9A 3S29A 4RNZA 1U5OA 3LTCA 2W6JH 3EN1B 5FGOA 3Q2PA 3CPW2 1C7HA 1WMOA 3F9SA 5JPPA 3H3HA 3DUKA 2PZVA 3NX0A 4FMDA 4IIAA 1SIHA 1GY5A 1IQYA 2Z7AA 2CWVA 3FGYA 3KKGA 5FW5A 3CME3 1DYUA 2GEXA 3KIIA 4IT7A 4JF8A 3PYJA 1OF5A 3NM2A 1RN7A 2W56B 1Z1SA 5IG3A 1A67A 1W6CA 1EQKA 3T8UA 5STDA 2P38A 2L4VA 2ML6A 1ZX2A 3OW22 3LMLA 1QVF2 1VQN3 1CYUA 1T5YA 1PFPA 1QJGA 3NBJA 1DMNA 3LZAA 1HKXA 4WP5A 3DM8A 1GS3A 3I0YA 3FLJA 3CPOA 2F98A 1OHOA 4HM2B 1VZZA 1JB5A 3OX9A 3DXOA 3FG4A 3EN8A 4HZBB 1YJ93 3KSPA 3LYGA 4HBRA 5ELJA 3EBYA 3MG2A 1W7CA 4MMXB 3EBTA 3PZWA 3SXXA 2CG0A 4LEHA 1A2KA 3K7CA 1QMAA 1UI7A 2LYXA 3DGNA 3RGRA 3NV0B 3PCRA 5IEPA 2HMJB 1N9EA 2A15A 1ROVA 3MSOA 3DZLA 1WTHA 1W02A 4O3VA 4G1MB 5CLKA 2BNGA 5IG4A 4R80A 3RGAA 1VQ53 2O3OA 3S28A 5DREA 3HIIA 1Q40A 3CCS3 1M9GA 5ELUA 5AIGA 3MHEA 3O8YA 4GL6A 1AVKA 3NBBA 3IPTA 5IG5A 4TX4A 3S67A 1JKGA 3NUVA 3UL6A 2CK3H 4L8PA 4MMZB 1JJ22 2WOHA 4N6NB 1IVUA 3MG3A 1TIJA 2BHMA 1RRHA 1O7WB 4AEQA 1FGOA 2IMJA 4RZMA 2GXFA 3OWUA 1R4CA 1WMPA 3BNBA 6STDA 1VQL3 3HZPA 2D42A 3LTAA 1Q7Y4 2YFIB 2PNCA 1IV7A 2BMQB 5KP4A 3CXC2 1SJWA 3N9HA 2OTJ3 1CEWI 2CHCA 2IUJA 4ZM8A 2Y73A 3J7Yd 3ALAA 1JNQA 2MF7A 3HK4A 4AKZA 4OUQA 1EA2A 3MG1A 2IUKA 1MOLA 4K1UA 1N5HA 3GZRA 4HM0B 1JRQA 4K1VA 5D82A 4MMYB 1OACA 1NJI4 2XGLA 1O7PB 2W2CA 1Q864 2OTL3 5CF2A 4OK0A 3S5CA 1AVLA 2OOVC 4XBXA 1DMQA 2B24B 1FGQA 1N5PA 2I9WA 4CCVA 4R9KA 5D81A 3NQYA 1D6YA 4MJDA 1OH0A 2JQ5A 1QVG2 3UL5A 4J9AA 4XBYA 1KSIA 4BTWA 4EBGA 1ISKA 3SEDA 1GYBA 5CF1A 1W5ZA 3CCV3 3B4OA 4LSOA 3WA2X 5BXQA 3CCU3 3IMAB 1NU3A 1FA3A 1N8QA 1F8NA 3G713 3X3ZA 1LVNA 1K28A 1OPYA 1O7MB 1FGMA 4L7KA 4R1KA 2OWPA 2K0MA 1RKYA 3ECFA 1LOXA 2KXGA 8CHOA 3A76A 3LTBA 2R4IA 1K8A4 1WMNA 1K9M4 1KWIA 1ULJB 3CU3A 3AMOB 4N6OB 1K734 3FCSB 4O02B 2HMOB 1KC84 2XFTA 1TFOA 2JDIH 2OOVA 3JUMA 3H51A 1YGEA 3GWRA 1QAFA 3DGMA 2FNQA 3ER7A 1IVXA 1E97A 4CDLA 5IENA 4GB5A 2C11A 2OCTA 3NV0A 4U13A 2WGOA 2MC8A 4N6V0 5AIHA 3CCE3 3Q90A 3B4PA 3QRDA 2INXA 3BB9A 2GBWB 3MKIA 2QEX3 1UUVB 3SOAA 5AI1A 4FMAA 4K61A 3G6E3 1QALA 1W4NA 3BNDA 3SX1A 3FG3A 4JRFA 3WOEB 3K0ZA 4HM8B 4HYZA 1NB3I 1OHPA 3DY5A 4LGQA 1QAKA 1Q824 1JB4A 2E2VA 2SBLA 3PGBA 3SLUA 1YHQ3 1ASKA 3CNXA 4HJLB 5HGRA 3EF8A 3CNMA 3X3XA 2P09A 1L5GB 1TP6A 3K63A 1N9JA 1OUNA 2CFLA 3I553 4EV5A 4Q53A 2CFDA 1IVWA 4O8SA 1O7GB 5AYSC 2W03A 1A2VA 1ROAA 1FGTA 2GBXB 4H3UA 3NBRA 2BT3A 4EXRA 3FG1A 4HM4B 3FF0A 4O2HA 2M7OA 3PS8A 3L0RA 2IA7A 1NWWA 4HM5B 2W9QA 2CKFB 4WYKB 3CC23 1IU7A 3CCR3 1YIJ3 5JPUA 2WGQA 3DGOA 1FUWA 3TDGA 1STDA 4I4KA 4AKYA 2F99A 2WOFA 2XR8B 2W0QA 2KCDA 1US1A 2CFGA 3GZYB 2FXTA 3JUOA 4KVHA 5BVBA 3EJVA 1DMMA 4FCMA 2XGNA 3V99A 3UNLA 3KFQC 1IK3A 3V92A 3F7XA 1CQSA 5EEOA 4LZIA 3ROBA 5D83A 2QIYA 4R4KA 1M1K4 2Y74A 3EX9A 2K54A 5EVHA 1VQK3 1IT7A 4R9LA 4FR9A 4STDA 5G2GA 4FCJA 3PXMA 2YFJB 1SQWA 1JN5B 1KQS2 1SPUA 3FF2A 1D6ZA 3EE1A 1OHSA 2BO9B 1JB2A 1GD3A 1LXEA 1TFKA 3PCSA 3CC43 4H61A 1DVDA 1IDPA 3SVAA 1EG9B 1ZO2A 4HM6B 2D1WA 1BUQA 3QK9A 3U1WA 2Z6BA 1YJN3 1E3VA 2RSXA 1WQLB 2W56A 3G8ZA 1Q42A 1IQ8A 1SIIA 1TU5A 1K41A 3CD63 4J8TA 3OXAA 1VQM3 5AEUB 3LXUX 2HMMB 5AIIA 3VSYA 1UI8A 3JVCA 1STFI 4NREA 1AV4A 4RNYA 3SOYA 3BLZA 3RDEA 3T0UA 1WNHA 2WO0A 3I563 4KFFA 2CC3A 1ULIB 3WMDA 1YVBI 1UW1A 1D6UA 1U8CB 3MWZA 1V74A 3U97A 1TUHA 2CWUA 2CG1A 3HI7A 3VGNA 3BNEA 3KE7A 2F86B 2UX0A 1DVCA 3HX8A 4KFDA 2XF3A 1IVVA 2CW9A 1EKMA 1S5AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCJ 3;  1VQ7 3;  1VQ5 3;  3CCM 3;  1NJI 4;  3CCE 3;  1KQS 2;  2QA4 3;  3CCQ 3;  3CCL 3;  3I55 3;  1YJ9 3;  3CCS 3;  1W2B 2;  1Q86 4;  2OTL 3;  1VQL 3;  2QEX 3;  3CME 3;  3G6E 3;  1YI2 3;  3CC4 3;  1K8A 4;  3I56 3;  1Q7Y 4;  1M90 4;  1S72 3;  1VQ6 3;  1K9M 4;  1Q81 4;  3CXC 2;  3OW2 2;  1YJW 3;  1Q82 4;  1K73 4;  2OTJ 3;  1KD1 4;  1KC8 4;  1JJ2 2;  1YJN 3;  3CC2 3;  1QVG 2;  1QVF 2;  1VQN 3;  3CCR 3;  1YHQ 3;  1VQO 3;  1YIJ 3;  1N8R 4;  3CC7 3;  1VQ4 3;  1VQ8 3;  3G4S 3;  3CCV 3;  3CMA 3;  3CCU 3;  1M1K 4;  1VQK 3;  1VQP 3;  3CPW 2;  3CD6 3;  1VQ9 3;  3G71 3;  1YIT 3;  1VQM 3; 
#chains in the Genus database with same CATH topology
 3GZX B;  3CCJ 3;  1PYL A;  3OWS A;  4BU4 A;  2OQE C;  1JBR A;  2Z76 A;  5LC7 A;  1CYV A;  1O7N B;  1PU4 A;  3CCQ 3;  2QA4 3;  3X41 A;  1RGA A;  4IPB A;  1IQX A;  1W6G A;  4EYC A;  5DRV A;  2RCD A;  3MYT A;  5IEO A;  3AHW A;  7GSP A;  4X2O A;  2CH9 A;  4HM3 B;  3DMC A;  4LMI A;  1BRN L;  1VQ6 3;  1YGW A;  4FMC A;  4XB5 A;  3STD A;  1J2B A;  1FGR A;  1GMQ A;  2ML5 A;  2YFL B;  5G1L A;  3JUP A;  3F14 A;  4WHA A;  3KSE D;  4NHF A;  1VQO 3;  4X2H A;  3BNC A;  4XM4 A;  4RNT A;  3CC7 3;  3LOY A;  3HIG A;  3CMA 3;  1RCL A;  3WHO A;  1JBT A;  3T8N A;  1OF5 B;  5IW9 A;  3DGY A;  1RTU A;  3GZB A;  4WYK A;  1R4Y A;  3UJM A;  1X1Y A;  4QWT A;  5M19 A;  2Z77 A;  2RGQ A;  1ZS7 A;  1BIR A;  2P0X A;  3D3L A;  5TGN A;  3BIR A;  4BTX A;  1RRL A;  4KZ1 A;  2BMO B;  1RJO A;  2CFW A;  3E99 A;  1OGX A;  3F40 A;  3K9M C;  4HM1 B;  5IG0 A;  3AGN A;  4N3V A;  2O9U X;  4EW5 A;  1T3B A;  3N54 B;  1Y4K A;  2OQE A;  1BSE A;  3WOD G;  3X42 A;  3LT8 A;  2YX9 A;  1YJW 3;  3NHX A;  1W6Y A;  1O7H B;  3FZW A;  4WWU C;  3JUN A;  2HML B;  1UUG B;  1UCJ A;  1A90 A;  2HMK B;  4FCZ A;  3G4S 3;  2XSH B;  2W04 A;  2Q07 A;  5AYR B;  4ILF A;  2AAD A;  3MPH A;  1EUI C;  3FSD A;  4EC6 A;  3WDG B;  1YIT 3;  1RGE A;  2E2U A;  1VQ7 3;  5KP1 A;  2LQV A;  4HZ9 B;  3CCM 3;  1A2P A;  3Q1C A;  1G96 A;  2P05 A;  3FH1 A;  4OVM A;  5LC6 A;  1BVI A;  1LNH A;  2H0G A;  5A0O B;  1W00 A;  4BTY A;  1UUW B;  2FGT A;  2E2T A;  1YI2 3;  2BU4 A;  1M90 4;  3UB1 A;  1JN5 A;  2CFK A;  2XFS A;  5EQL A;  4PEJ A;  3F8X A;  4RBN A;  2KRT A;  3F7S A;  3WA3 A;  3AGO A;  4N6M A;  2ZL8 A;  1B2X A;  1Q7H A;  3EHC A;  4N6L A;  4XBT A;  1RLS A;  3D9R A;  4FMB A;  2HMN B;  1BAN A;  5CK6 A;  2CIU A;  3LTD A;  1Q40 B;  3KN4 A;  2BIR A;  1BRJ A;  1AR0 A;  1W01 A;  3D4A A;  1VQ9 3;  1DE3 A;  1RGL A;  1GY6 A;  1YNV X;  2W9P A;  1TRQ A;  1Q81 4;  3EQQ B;  1RGC A;  4XDV A;  1G02 A;  1W2B 2;  2P0M A;  2STD A;  1JKG B;  3GRD A;  2XSO B;  1NO3 A;  4HM7 B;  2XRX B;  3JUQ A;  4KT3 B;  2QGU A;  2C10 A;  3KZT A;  3K5T A;  3DGL A;  1MNL A;  1BRG A;  1GMP A;  3G16 A;  3B8L A;  1LQG C;  1MWT A;  3EB8 A;  1TRP A;  2V1L A;  3FKA A;  3M8C A;  4HKV B;  4ORL A;  1GOY A;  1OGZ A;  3OV4 A;  5CXO A;  4CJN A;  1NB5 I;  1MGW A;  3EC9 A;  3NQZ A;  1JV2 B;  2B1X B;  2K3D A;  5JBS A;  1GOU A;  1CH0 A;  3F8H A;  2ZDJ A;  1W2Z A;  3IJE B;  5KP3 A;  1N8R 4;  1FUT A;  1I0V A;  1VQ4 3;  1VQ8 3;  3VF1 A;  1OCV A;  4N6U A;  3NM7 A;  7STD A;  3WOF B;  1IV9 A;  2BMR B;  1VQP 3;  1B21 A;  2GU1 A;  3LH4 A;  3V98 A;  3AMO A;  5AEW B;  1BNI A;  4EV2 A;  1GD4 A;  1M1X B;  2CWT A;  2GU3 A;  1IT8 A;  4MEI A;  4XDW A;  1RSN A;  3X3Y A;  4K90 B;  1I8V A;  4N6T A;  5IER A;  3GAX A;  4BL3 A;  3CCL 3;  2J8X B;  1MWU A;  2XEP A;  3G0K A;  3LT9 A;  5IF6 A;  2RBI A;  1HU9 A;  3NXJ A;  3S27 A;  1GY7 A;  3N8B A;  2GEY A;  3OWY A;  4L8O A;  4WFO A;  2R41 A;  1X1W A;  2RFR A;  5BU4 A;  1S72 3;  1BNS A;  3B7C A;  4HVN A;  5I97 A;  4KFE A;  1KD1 4;  1E3R A;  3X40 A;  5AIF A;  1NDO B;  4BL2 A;  1BRS A;  2XH9 A;  4BIR A;  2CX0 A;  3S29 A;  4RNZ A;  1U5O A;  3LTC A;  2W6J H;  3EN1 B;  1HYF A;  5FGO A;  3Q2P A;  2H0I A;  1C7H A;  1WMO A;  3F9S A;  5JPP A;  3CPW 2;  3H3H A;  3DUK A;  2PZV A;  3NX0 A;  4FMD A;  1X1X A;  4IIA A;  1SIH A;  1GY5 A;  1IQY A;  2IY2 A;  2CWV A;  1LQM B;  2Z7A A;  3FGY A;  3KKG A;  5FW5 A;  3CME 3;  1DYU A;  2GEX A;  5HOH A;  3KII A;  4IT7 A;  4JF8 A;  3PYJ A;  4CPK A;  1OF5 A;  3NM2 A;  1RN7 A;  2W56 B;  1Z1S A;  5IG3 A;  1A67 A;  1W6C A;  1EQK A;  3T8U A;  5STD A;  2P38 A;  1BSB A;  2L4V A;  1MWS A;  5RNT A;  2ML6 A;  1ZX2 A;  2H0H A;  3OW2 2;  3LML A;  1QVF 2;  1VQN 3;  1CYU A;  1T5Y A;  1PFP A;  1QJG A;  3NBJ A;  2F5W A;  1DMN A;  3LZA A;  1VQQ A;  1HKX A;  4WP5 A;  3DM8 A;  1GS3 A;  3I0Y A;  3FLJ A;  3CPO A;  2F98 A;  1OHO A;  4HM2 B;  5GSP A;  1VZZ A;  1JB5 A;  3DH2 A;  3DXO A;  3FG4 A;  3EN8 A;  3OX9 A;  4HZB B;  1YJ9 3;  3KSP A;  4GHO A;  3LYG A;  4HBR A;  5ELJ A;  2IYJ A;  3EBY A;  3MG2 A;  1W7C A;  1V58 A;  4MMX B;  3EBT A;  3PZW A;  3SXX A;  2CG0 A;  4LEH A;  1A2K A;  3K7C A;  1QMA A;  1UI7 A;  2LYX A;  3DGN A;  3RGR A;  3NV0 B;  3PCR A;  5IEP A;  2HMJ B;  1N9E A;  2A15 A;  1ROV A;  3MSO A;  3DZL A;  1WTH A;  1W02 A;  4O3V A;  1BRH A;  2KF5 A;  4G1M B;  2BNG A;  5CLK A;  5IG4 A;  4R80 A;  1GOV A;  3RGA A;  1B27 A;  1VQ5 3;  2O3O A;  3S28 A;  5DRE A;  3HII A;  1Q40 A;  1BAO A;  3CCS 3;  2AAE A;  1I3F A;  1M9G A;  5ELU A;  5AIG A;  3MHE A;  3O8Y A;  4GL6 A;  1AVK A;  3NBB A;  1T2H A;  3IPT A;  4TX4 A;  5IG5 A;  1YVS A;  3S67 A;  1JKG A;  3NUV A;  3UL6 A;  2CK3 H;  4L8P A;  1BSA A;  4MMZ B;  1JJ2 2;  2WOH A;  4N6N B;  1BOX A;  1IVU A;  1RNB A;  3MG3 A;  1BRI A;  3ZFZ A;  1ZGX A;  1TIJ A;  3BU4 A;  2SAR A;  2BHM A;  1RRH A;  1O7W B;  4AEQ A;  1FGO A;  1RDS A;  2IMJ A;  4RZM A;  2GXF A;  3OWU A;  1R4C A;  1WMP A;  4GSP A;  3BNB A;  6STD A;  1VQL 3;  3HZP A;  2D42 A;  6RNT A;  3LTA A;  3Q3F A;  1Q7Y 4;  1I3I A;  2PNC A;  2YFI B;  1IV7 A;  3D5I A;  5M1A A;  2BMQ B;  5KP4 A;  4I5Q A;  1UGH I;  3CXC 2;  1SJW A;  3N9H A;  2KF6 A;  2OTJ 3;  1CEW I;  2KF3 A;  2CHC A;  2IUJ A;  1B3S A;  4ZM8 A;  2Y73 A;  3J7Y d;  3ALA A;  1JNQ A;  2MF7 A;  3HK4 A;  4AKZ A;  2F4Y A;  4OUQ A;  1I2E A;  1EA2 A;  3MG1 A;  2IUK A;  1MOL A;  4K1U A;  1N5H A;  3GZR A;  4HM0 B;  1JRQ A;  4K1V A;  5D82 A;  1UCL A;  4MMY B;  1OAC A;  1NJI 4;  1RGF A;  2XGL A;  1O7P B;  2W2C A;  1Q86 4;  2OTL 3;  5CF2 A;  4OK0 A;  3S5C A;  1AVL A;  1T2I A;  2OOV C;  4XBX A;  1BNG A;  1DMQ A;  1BUJ A;  2B24 B;  1FGQ A;  1N5P A;  2I9W A;  4CCV A;  4R9K A;  5D81 A;  3NQY A;  1D6Y A;  1TJD A;  4MJD A;  1AQZ A;  1OH0 A;  2JQ5 A;  1QVG 2;  3UL5 A;  4J9A A;  1I2G A;  1BGS A;  1KSI A;  4XBY A;  4BTW A;  3SED A;  1GYB A;  4EBG A;  5CF1 A;  1ISK A;  1W5Z A;  3CCV 3;  3B4O A;  4LSO A;  3WA2 X;  5BXQ A;  3CCU 3;  3IMA B;  1NU3 A;  1FA3 A;  1N8Q A;  1PY3 A;  3HOH A;  1F8N A;  3G71 3;  1JZO A;  3X3Z A;  1LNI A;  1LVN A;  1K28 A;  1OPY A;  1O7M B;  1BU4 A;  1FGM A;  1UCK A;  4L7K A;  4R1K A;  3ZG5 A;  2OWP A;  2K0M A;  1RKY A;  3ECF A;  2UGI A;  1LOX A;  2KXG A;  8CHO A;  3A76 A;  5G1K A;  2UUG C;  1LOW A;  2R4I A;  3LTB A;  1K8A 4;  2RNT A;  1WMN A;  1K9M 4;  1KWI A;  1GMR A;  1ULJ B;  3CU3 A;  1B2U A;  3AMO B;  1LRA A;  3AHS A;  4N6O B;  1RGH A;  3FCS B;  4O02 B;  1K73 4;  2HMO B;  4HAA A;  1KC8 4;  2XFT A;  1TFO A;  1UGI A;  2JDI H;  2OOV A;  3JUM A;  3H51 A;  1YGE A;  3GWR A;  1I0X A;  1QAF A;  3DGM A;  2F5M A;  2FNQ A;  3ER7 A;  1IVX A;  1I70 A;  1E97 A;  4CDL A;  2ZHX B;  3A5E A;  5IEN A;  4GB5 A;  2C11 A;  2OCT A;  3NV0 A;  4U13 A;  2WGO A;  1LOY A;  2MC8 A;  1B2Z A;  4N6V 0;  1RN4 A;  1FYS A;  5AIH A;  3Q90 A;  3B4P A;  5M18 A;  3CCE 3;  3QRD A;  2INX A;  3BB9 A;  2GBW B;  3MKI A;  2QEX 3;  1UUV B;  3SOA A;  5AI1 A;  4FMA A;  4K61 A;  3G6E 3;  1QAL A;  1W4N A;  3BND A;  3SX1 A;  3FG3 A;  4JRF A;  3WOE B;  3K0Z A;  1IYY A;  4HM8 B;  2CX1 A;  1TTO A;  4HYZ A;  1NB3 I;  1OHP A;  3DY5 A;  4LGQ A;  5BIR A;  1QAK A;  1LOV A;  1BNJ A;  1JB4 A;  1Q82 4;  2C4B A;  2E2V A;  1C54 A;  2SBL A;  3PGB A;  3SLU A;  1YHQ 3;  1ASK A;  3CNX A;  1UCI A;  4HJL B;  3EF8 A;  5HGR A;  7RNT A;  3CNM A;  3X3X A;  1RCK A;  2P09 A;  1L5G B;  1TP6 A;  3K63 A;  1N9J A;  1OUN A;  2CFL A;  3I55 3;  3SYU A;  1RHL A;  4EV5 A;  4Q53 A;  2CFD A;  1B20 A;  1IVW A;  4O8S A;  1O7G B;  5AYS C;  2W03 A;  1A2V A;  1ROA A;  1FGT A;  2GBX B;  4H3U A;  3NBR A;  2BT3 A;  4EXR A;  3FG1 A;  4HM4 B;  3FF0 A;  4HOH A;  4O2H A;  2M7O A;  3PS8 A;  4J5G A;  3L0R A;  2IA7 A;  1NWW A;  4HM5 B;  2W9Q A;  2CKF B;  4WYK B;  3CC2 3;  3RNT A;  1IU7 A;  3CCR 3;  1YIJ 3;  5JPU A;  1BRK A;  2WGQ A;  3DGO A;  1FUW A;  1SAR A;  3TDG A;  1G0T A;  1STD A;  4I4K A;  4AKY A;  2F99 A;  2WOF A;  2XR8 B;  1GSP A;  2W0Q A;  2KCD A;  1B2M A;  1HZ1 A;  1US1 A;  2CFG A;  1JZD A;  4LYL B;  1RGG A;  3WR2 A;  1DET A;  1Q9E A;  1RMS A;  2FXT A;  3GZY B;  3JUO A;  4KVH A;  5BVB A;  3EJV A;  2L1S A;  8RNT A;  1DMM A;  4FCM A;  2XGN A;  1BNR A;  1X1U A;  3V99 A;  3UNL A;  3KFQ C;  1IK3 A;  3V92 A;  1JBS A;  1RN1 A;  1BNF A;  1FW7 A;  3F7X A;  1CQS A;  5EEO A;  4LZI A;  3D5G A;  3ROB A;  5D83 A;  3GSP A;  2QIY A;  4R4K A;  1M1K 4;  2Y74 A;  3EX9 A;  2K54 A;  5EVH A;  1VQK 3;  1I2F A;  1IT7 A;  4R9L A;  4FR9 A;  4STD A;  5G2G A;  4FCJ A;  3PXM A;  1NNV A;  2YFJ B;  1SQW A;  1JN5 B;  1KQS 2;  1SPU A;  3FF2 A;  1BNE A;  1D6Z A;  3EE1 A;  1OHS A;  2HOH A;  2BO9 B;  3URP A;  1MGR A;  1JB2 A;  1GD3 A;  1LXE A;  1TFK A;  2F56 A;  3PCS A;  4H61 A;  3CC4 3;  1DVD A;  1IDP A;  3SVA A;  1EG9 B;  1ZO2 A;  4HM6 B;  2D1W A;  1BUQ A;  1FUS A;  3D79 A;  3QK9 A;  3U1W A;  1B2S A;  2Z6B A;  1YJN 3;  1E3V A;  2RSX A;  1WQL B;  2W56 A;  3G8Z A;  1Q42 A;  4DKI A;  1IQ8 A;  1SII A;  3KCH A;  1TU5 A;  2GSP A;  1K41 A;  1RGK A;  1FZU A;  6GSP A;  3CD6 3;  4J8T A;  3OXA A;  1VQM 3;  5AEU B;  1EEJ A;  3LXU X;  2HMM B;  5AII A;  1AY7 A;  3VSY A;  1UI8 A;  3JVC A;  1BSC A;  1STF I;  4NRE A;  1BSD A;  1AV4 A;  4RNY A;  4NPB A;  3SOY A;  3BLZ A;  3RDE A;  3T0U A;  3ZG0 A;  1WNH A;  2WO0 A;  4J5K A;  4KFF A;  1UDI I;  2CC3 A;  1ULI B;  3WMD A;  3I56 3;  1YVB I;  1UW1 A;  1D6U A;  1U8C B;  3MWZ A;  1V74 A;  3U97 A;  1TUH A;  1V57 A;  2CWU A;  2KAA A;  2CG1 A;  3HI7 A;  3VGN A;  3BNE A;  3KE7 A;  1RNT A;  2F86 B;  2UX0 A;  1DVC A;  2KF4 A;  3HX8 A;  1MWR A;  9RNT A;  2ZA4 A;  2XF3 A;  1IVV A;  2CW9 A;  1EKM A;  4KFD A;  1S5A A; 
#chains in the Genus database with same CATH homology
 3GZX B;  3CCJ 3;  3OWS A;  2OQE C;  2Z76 A;  5LC7 A;  1CYV A;  1O7N B;  1PU4 A;  3CCQ 3;  2QA4 3;  3X41 A;  4IPB A;  1IQX A;  1W6G A;  4EYC A;  5DRV A;  2RCD A;  3MYT A;  5IEO A;  4X2O A;  2CH9 A;  4HM3 B;  3DMC A;  4LMI A;  1VQ6 3;  4FMC A;  4XB5 A;  3STD A;  1J2B A;  1FGR A;  2ML5 A;  2YFL B;  3JUP A;  3F14 A;  4WHA A;  3KSE D;  4NHF A;  1VQO 3;  4X2H A;  3BNC A;  4XM4 A;  3CC7 3;  3LOY A;  3HIG A;  3CMA 3;  3T8N A;  1OF5 B;  5IW9 A;  3GZB A;  4WYK A;  3UJM A;  4QWT A;  2Z77 A;  2RGQ A;  2P0X A;  3D3L A;  5TGN A;  4BTX A;  1RRL A;  4KZ1 A;  2BMO B;  1RJO A;  2CFW A;  3E99 A;  1OGX A;  3F40 A;  3K9M C;  4HM1 B;  5IG0 A;  4N3V A;  2O9U X;  3N54 B;  1Y4K A;  2OQE A;  3WOD G;  3X42 A;  3LT8 A;  2YX9 A;  1YJW 3;  3NHX A;  1W6Y A;  1O7H B;  3FZW A;  4WWU C;  3JUN A;  2HML B;  1A90 A;  2HMK B;  4FCZ A;  3G4S 3;  2XSH B;  2W04 A;  2Q07 A;  5AYR B;  3MPH A;  4EC6 A;  3FSD A;  1YIT 3;  3WDG B;  2E2U A;  1VQ7 3;  5KP1 A;  2LQV A;  4HZ9 B;  3CCM 3;  3Q1C A;  1G96 A;  2P05 A;  3FH1 A;  4OVM A;  5LC6 A;  1LNH A;  5A0O B;  1W00 A;  4BTY A;  1UUW B;  2FGT A;  2E2T A;  1YI2 3;  1M90 4;  3UB1 A;  1JN5 A;  2CFK A;  2XFS A;  5EQL A;  4PEJ A;  3F8X A;  4RBN A;  2KRT A;  3F7S A;  3WA3 A;  4N6M A;  2ZL8 A;  3EHC A;  4N6L A;  4XBT A;  3D9R A;  4FMB A;  2HMN B;  5CK6 A;  2CIU A;  3LTD A;  1Q40 B;  3KN4 A;  1AR0 A;  1W01 A;  1VQ9 3;  1GY6 A;  2W9P A;  1Q81 4;  3EQQ B;  4XDV A;  1W2B 2;  2P0M A;  2STD A;  1JKG B;  3GRD A;  2XSO B;  1NO3 A;  4HM7 B;  2XRX B;  3JUQ A;  2QGU A;  2C10 A;  3KZT A;  3K5T A;  3DGL A;  1MNL A;  3G16 A;  3B8L A;  3EB8 A;  3FKA A;  2V1L A;  4ORL A;  3M8C A;  4HKV B;  1OGZ A;  3OV4 A;  5CXO A;  1NB5 I;  3EC9 A;  3NQZ A;  1JV2 B;  2B1X B;  5JBS A;  3F8H A;  3IJE B;  2ZDJ A;  1W2Z A;  5KP3 A;  1N8R 4;  1VQ4 3;  1VQ8 3;  3VF1 A;  1OCV A;  4N6U A;  3NM7 A;  7STD A;  3WOF B;  1IV9 A;  2BMR B;  1VQP 3;  2GU1 A;  3LH4 A;  3V98 A;  3AMO A;  5AEW B;  4EV2 A;  2GU3 A;  2CWT A;  1GD4 A;  1M1X B;  1IT8 A;  4MEI A;  4XDW A;  3X3Y A;  4K90 B;  4N6T A;  5IER A;  3GAX A;  3CCL 3;  2XEP A;  3G0K A;  3LT9 A;  5IF6 A;  1HU9 A;  3NXJ A;  3S27 A;  1GY7 A;  3N8B A;  2GEY A;  3OWY A;  4L8O A;  4WFO A;  2RFR A;  1S72 3;  3B7C A;  4HVN A;  5I97 A;  4KFE A;  1KD1 4;  1E3R A;  3X40 A;  5AIF A;  1NDO B;  2XH9 A;  3S29 A;  4RNZ A;  1U5O A;  3LTC A;  2W6J H;  3EN1 B;  5FGO A;  3Q2P A;  3CPW 2;  1C7H A;  1WMO A;  3F9S A;  5JPP A;  3H3H A;  3DUK A;  2PZV A;  3NX0 A;  4FMD A;  4IIA A;  1SIH A;  1GY5 A;  1IQY A;  2Z7A A;  2CWV A;  3FGY A;  3KKG A;  5FW5 A;  3CME 3;  1DYU A;  2GEX A;  3KII A;  4IT7 A;  4JF8 A;  3PYJ A;  1OF5 A;  3NM2 A;  1RN7 A;  2W56 B;  1Z1S A;  5IG3 A;  1A67 A;  1W6C A;  1EQK A;  3T8U A;  5STD A;  2P38 A;  2L4V A;  2ML6 A;  1ZX2 A;  3OW2 2;  3LML A;  1QVF 2;  1VQN 3;  1CYU A;  1T5Y A;  1PFP A;  1QJG A;  3NBJ A;  1DMN A;  3LZA A;  1HKX A;  4WP5 A;  3DM8 A;  1GS3 A;  3I0Y A;  3FLJ A;  3CPO A;  2F98 A;  1OHO A;  4HM2 B;  1VZZ A;  1JB5 A;  3OX9 A;  3DXO A;  3FG4 A;  3EN8 A;  4HZB B;  1YJ9 3;  3KSP A;  3LYG A;  4HBR A;  5ELJ A;  3EBY A;  3MG2 A;  1W7C A;  4MMX B;  3EBT A;  3PZW A;  3SXX A;  2CG0 A;  4LEH A;  1A2K A;  3K7C A;  1QMA A;  1UI7 A;  2LYX A;  3DGN A;  3RGR A;  3NV0 B;  3PCR A;  5IEP A;  2HMJ B;  1N9E A;  2A15 A;  1ROV A;  3MSO A;  3DZL A;  1WTH A;  1W02 A;  4O3V A;  4G1M B;  5CLK A;  2BNG A;  5IG4 A;  4R80 A;  3RGA A;  1VQ5 3;  2O3O A;  3S28 A;  5DRE A;  3HII A;  1Q40 A;  3CCS 3;  1M9G A;  5ELU A;  5AIG A;  3MHE A;  3O8Y A;  4GL6 A;  1AVK A;  3NBB A;  3IPT A;  5IG5 A;  4TX4 A;  3S67 A;  1JKG A;  3NUV A;  3UL6 A;  2CK3 H;  4L8P A;  4MMZ B;  1JJ2 2;  2WOH A;  4N6N B;  1IVU A;  3MG3 A;  1TIJ A;  2BHM A;  1RRH A;  1O7W B;  4AEQ A;  1FGO A;  2IMJ A;  4RZM A;  2GXF A;  3OWU A;  1R4C A;  1WMP A;  3BNB A;  6STD A;  1VQL 3;  3HZP A;  2D42 A;  3LTA A;  1Q7Y 4;  2YFI B;  2PNC A;  1IV7 A;  2BMQ B;  5KP4 A;  3CXC 2;  1SJW A;  3N9H A;  2OTJ 3;  1CEW I;  2CHC A;  2IUJ A;  4ZM8 A;  2Y73 A;  3J7Y d;  3ALA A;  1JNQ A;  2MF7 A;  3HK4 A;  4AKZ A;  4OUQ A;  1EA2 A;  3MG1 A;  2IUK A;  1MOL A;  4K1U A;  1N5H A;  3GZR A;  4HM0 B;  1JRQ A;  4K1V A;  5D82 A;  4MMY B;  1OAC A;  1NJI 4;  2XGL A;  1O7P B;  2W2C A;  1Q86 4;  2OTL 3;  5CF2 A;  4OK0 A;  3S5C A;  1AVL A;  2OOV C;  4XBX A;  1DMQ A;  2B24 B;  1FGQ A;  1N5P A;  2I9W A;  4CCV A;  4R9K A;  5D81 A;  3NQY A;  1D6Y A;  4MJD A;  1OH0 A;  2JQ5 A;  1QVG 2;  3UL5 A;  4J9A A;  4XBY A;  1KSI A;  4BTW A;  4EBG A;  1ISK A;  3SED A;  1GYB A;  5CF1 A;  1W5Z A;  3CCV 3;  3B4O A;  4LSO A;  3WA2 X;  5BXQ A;  3CCU 3;  3IMA B;  1NU3 A;  1FA3 A;  1N8Q A;  1F8N A;  3G71 3;  3X3Z A;  1LVN A;  1K28 A;  1OPY A;  1O7M B;  1FGM A;  4L7K A;  4R1K A;  2OWP A;  2K0M A;  1RKY A;  3ECF A;  1LOX A;  2KXG A;  8CHO A;  3A76 A;  3LTB A;  2R4I A;  1K8A 4;  1WMN A;  1K9M 4;  1KWI A;  1ULJ B;  3CU3 A;  3AMO B;  4N6O B;  1K73 4;  3FCS B;  4O02 B;  2HMO B;  1KC8 4;  2XFT A;  1TFO A;  2JDI H;  2OOV A;  3JUM A;  3H51 A;  1YGE A;  3GWR A;  1QAF A;  3DGM A;  2FNQ A;  3ER7 A;  1IVX A;  1E97 A;  4CDL A;  5IEN A;  4GB5 A;  2C11 A;  2OCT A;  3NV0 A;  4U13 A;  2WGO A;  2MC8 A;  4N6V 0;  5AIH A;  3CCE 3;  3Q90 A;  3B4P A;  3QRD A;  2INX A;  3BB9 A;  2GBW B;  3MKI A;  2QEX 3;  1UUV B;  3SOA A;  5AI1 A;  4FMA A;  4K61 A;  3G6E 3;  1QAL A;  1W4N A;  3BND A;  3SX1 A;  3FG3 A;  4JRF A;  3WOE B;  3K0Z A;  4HM8 B;  4HYZ A;  1NB3 I;  1OHP A;  3DY5 A;  4LGQ A;  1QAK A;  1Q82 4;  1JB4 A;  2E2V A;  2SBL A;  3PGB A;  3SLU A;  1YHQ 3;  1ASK A;  3CNX A;  4HJL B;  5HGR A;  3EF8 A;  3CNM A;  3X3X A;  2P09 A;  1L5G B;  1TP6 A;  3K63 A;  1N9J A;  1OUN A;  2CFL A;  3I55 3;  4EV5 A;  4Q53 A;  2CFD A;  1IVW A;  4O8S A;  1O7G B;  5AYS C;  2W03 A;  1A2V A;  1ROA A;  1FGT A;  2GBX B;  4H3U A;  3NBR A;  2BT3 A;  4EXR A;  3FG1 A;  4HM4 B;  3FF0 A;  4O2H A;  2M7O A;  3PS8 A;  3L0R A;  2IA7 A;  1NWW A;  4HM5 B;  2W9Q A;  2CKF B;  4WYK B;  3CC2 3;  1IU7 A;  3CCR 3;  1YIJ 3;  5JPU A;  2WGQ A;  3DGO A;  1FUW A;  3TDG A;  1STD A;  4I4K A;  4AKY A;  2F99 A;  2WOF A;  2XR8 B;  2W0Q A;  2KCD A;  1US1 A;  2CFG A;  3GZY B;  2FXT A;  3JUO A;  4KVH A;  5BVB A;  3EJV A;  1DMM A;  4FCM A;  2XGN A;  3V99 A;  3UNL A;  3KFQ C;  1IK3 A;  3V92 A;  3F7X A;  1CQS A;  5EEO A;  4LZI A;  3ROB A;  5D83 A;  2QIY A;  4R4K A;  1M1K 4;  2Y74 A;  3EX9 A;  2K54 A;  5EVH A;  1VQK 3;  1IT7 A;  4R9L A;  4FR9 A;  4STD A;  5G2G A;  4FCJ A;  3PXM A;  2YFJ B;  1SQW A;  1JN5 B;  1KQS 2;  1SPU A;  3FF2 A;  1D6Z A;  3EE1 A;  1OHS A;  2BO9 B;  1JB2 A;  1GD3 A;  1LXE A;  1TFK A;  3PCS A;  3CC4 3;  4H61 A;  1DVD A;  1IDP A;  3SVA A;  1EG9 B;  1ZO2 A;  4HM6 B;  2D1W A;  1BUQ A;  3QK9 A;  3U1W A;  2Z6B A;  1YJN 3;  1E3V A;  2RSX A;  1WQL B;  2W56 A;  3G8Z A;  1Q42 A;  1IQ8 A;  1SII A;  1TU5 A;  1K41 A;  3CD6 3;  4J8T A;  3OXA A;  1VQM 3;  5AEU B;  3LXU X;  2HMM B;  5AII A;  3VSY A;  1UI8 A;  3JVC A;  1STF I;  4NRE A;  1AV4 A;  4RNY A;  3SOY A;  3BLZ A;  3RDE A;  3T0U A;  1WNH A;  2WO0 A;  3I56 3;  4KFF A;  2CC3 A;  1ULI B;  3WMD A;  1YVB I;  1UW1 A;  1D6U A;  1U8C B;  3MWZ A;  1V74 A;  3U97 A;  1TUH A;  2CWU A;  2CG1 A;  3HI7 A;  3VGN A;  3BNE A;  3KE7 A;  2F86 B;  2UX0 A;  1DVC A;  3HX8 A;  4KFD A;  2XF3 A;  1IVV A;  2CW9 A;  1EKM A;  1S5A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...