5DRVA

Crystal structure of the g3bp2 ntf2-like domain in complex with a peptide
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
141
structure length
131
Chain Sequence
SHMVMEKPSPLLVGREFVRQYYTLLNKAPEYLHRFYGRNSSYVHGGVYGQNDIHHKVLSLNFSECHTKIRHVDAHATLSDGVVVQVMGLLSNSGQPERKFMQTFVLAPEGSVPNKFYVHNDMFRYEDEVFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras GTPase-activating protein-binding protein 2
publication title Crystal structure of the G3BP2 NTF2-like domain in complex with a canonical FGDF motif peptide.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 32
structure length 131
sequence length 141
ec nomenclature
pdb deposition date 2015-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5drvA00
3MKIA 4LMIA 5AEUB 2BNGA 4HM8B 4CDLA 3A76A 5BVBA 3CNXA 3KSPA 5DRVA 1TP6A 1ULJB 3KE7A 4WP5A 3WMDA 4IIAA 4WYKA 1O7WB 1GY6A 1OHPA 5IG4A 1A2KA 4XB5A 3EHCA 3KZTA 1O7MB 3EBYA 2Z77A 3G8ZA 1K41A 1DMMA 5KP3A 1BUQA 5IEOA 1NU3A 3FZWA 2BMQB 3JUPA 4I4KA 3MSOA 1GS3A 3NBRA 5CK6A 1E3RA 1ZO2A 3FSDA 2UX0A 2XSOB 2B24B 7STDA 5DREA 5G2GA 3DZLA 5IENA 2QIYA 1O7GB 3B8LA 4GB5A 3MG1A 3F7XA 3VGNA 3G0KA 5BXQA 4XM4A 3G16A 2RGQA 3EF8A 2XSHB 4R1KA 3GZYB 3ECFA 3FF0A 1ASKA 1W02A 2XRXB 1ISKA 3RGAA 1QJGA 3GWRA 4HM6B 1STDA 2Z7AA 3GRDA 4FCMA 4ORLA 5CF1A 3MYTA 1C7HA 1S5AA 2INXA 2STDA 3GZRA 2OWPA 3JUMA 1JN5B 2YFLB 4RZMA 1U5OA 3UJMA 5AIFA 3JUNA 4KVHA 3FLJA 1JKGB 3DXOA 3EX9A 2R4IA 3DMCA 1W6YA 3RGRA 4LGQA 5IG3A 1JB5A 4L7KA 4H3UA 1OF5B 2Z76A 5D81A 3MG2A 5AI1A 3EN1B 4HVNA 1OHOA 3NUVA 4XBXA 5IF6A 3M8CA 5AIHA 4HM1B 3I0YA 3DUKA 1UUVB 1NWWA 2YFJB 3S5CA 4HM0B 3KKGA 3F14A 3CU3A 5FW5A 1GY5A 3CPOA 3VSYA 3NHXA 1O7NB 2W2CA 2RCDA 3H51A 3EQQB 3GZBA 4HJLB 5AIGA 4OUQA 1CQSA 1VZZA 5AIIA 3STDA 5IEPA 1E3VA 1JB2A 1GY7A 1TUHA 2CHCA 5STDA 1DMNA 3MHEA 3UNLA 4J9AA 4X2OA 2RFRA 3NXJA 3EJVA 2GBWB 1OCVA 1JN5A 4LEHA 1AR0A 3IPTA 4K1VA 5IG0A 5D83A 1GYBA 4HM4B 5JPUA 1ULIB 3EC9A 4HM7B 4R9KA 1DMQA 3GZXB 1OF5A 2GEYA 2PZVA 3E99A 3H3HA 3FKAA 3F7SA 1JB4A 1UUWB 3K7CA 3F40A 5CLKA 1OGZA 3NM2A 3SOAA 5IG5A 1NDOB 4X2HA 4XBYA 3NV0B 5CF2A 4HZ9B 1SJWA 3OXAA 4N3VA 2BMRB 1OUNA 3K0ZA 5CXOA 1O7HB 2F99A 3B4PA 5AEWB 1ZX2A 1OGXA 1EA2A 3B7CA 1Q40B 3BLZA 2GEXA 4R9LA 4FCJA 1QMAA 3OWUA 8CHOA 2K54A 4XDWA 2F86B 4HM5B 3OX9A 2B1XB 3F9SA 4MJDA 2HMLB 3OWSA 4STDA 5KP1A 1Z1SA 2IMJA 4PEJA 1EG9B 1W00A 2I9WA 1OH0A 4WYKB 2HMJB 4Q53A 4OVMA 4K1UA 1OHSA 5EVHA 2A15A 3JUQA 2HMNB 4HKVB 3HZPA 5JPPA 3FGYA 4WWUC 1E97A 3B4OA 3SEDA 2F98A 3LZAA 2XR8B 1WQLB 5KP4A 3BB9A 2HMKB 2HMOB 5D82A 4HM2B 2JQ5A 2QGUA 4XBTA 3HX8A 4J8TA 3LYGA 5TGNA 1JKGA 2YFIB 3F8XA 4HM3B 4L8OA 3OWYA 3CNMA 3NV0A 4L8PA 3HK4A 3OV4A 3ER7A 1O7PB 4U13A 3MG3A 6STDA 1HKXA 4HZBB 2CKFB 4XDVA 1W01A 3T8UA 3SOYA 5IERA 3DM8A 2HMMB 3ROBA 1Q40A 3F8HA 1IDPA 3Q90A 2GBXB 3D9RA 3T8NA 3EBTA 3FF2A 3EN8A 2GXFA 1OPYA 3JUOA 5HGRA 3FH1A 1Q42A 2BMOB
chains in the Genus database with same CATH superfamily
1WMOA 1B2UA 3MKIA 2BIRA 4LMIA 5AEUB 2BNGA 4HM8B 4CDLA 3A76A 4KT3B 1LQGC 5BVBA 3CNXA 1RGFA 3LTBA 3V92A 3LH4A 1AV4A 1NB3I 4J5KA 3PZWA 2UGIA 3SVAA 1EEJA 5M18A 4NPBA 3KSPA 5DRVA 1TTOA 4BTWA 1TFOA 1TP6A 2F56A 8RNTA 3DGMA 1ULJB 3KE7A 3HI7A 1LNIA 4WP5A 1YGEA 3CCE3 1UUGB 1CEWI 2C10A 4IIAA 1D6YA 5G1LA 3WMDA 4WYKA 1O7WB 2WGQA 3UB1A 3LTCA 4EV5A 2FGTA 2W9PA 1GY6A 6RNTA 4MMXB 1UGHI 1RGCA 1OHPA 1BNIA 1B2XA 3DGYA 5IG4A 3RNTA 3S28A 3PCSA 3WHOA 1YI23 1YJW3 2ZHXB 1A2KA 1B27A 4XB5A 3EHCA 1T2IA 3X42A 4FCZA 1UDII 3KZTA 1FW7A 1O7MB 3EBYA 1RGLA 4N6TA 1I3FA 2XFSA 1UW1A 3NQYA 1IK3A 2Z77A 4J5GA 3G4S3 2MF7A 2FNQA 3G8ZA 4QWTA 1RLSA 1K41A 1DMMA 1TJDA 2W03A 2OTJ3 2W56B 4RNTA 1BNSA 5KP3A 1FUWA 1BUQA 5IEOA 1BNEA 1R4YA 1IT8A 1NU3A 5BIRA 3N8BA 3SX1A 3G713 3FZWA 4BTYA 9RNTA 2F5WA 3I563 1I2GA 4O02B 3SXXA 1Q814 4N6OB 1IU7A 1EUIC 1L5GB 3Q1CA 1IT7A 1QVF2 2BMQB 3JUPA 3S29A 1YHQ3 2ML6A 4I4KA 3EE1A 3MSOA 1GS3A 3NBRA 3J7Yd 3UL6A 3PCRA 5CK6A 1D6ZA 1E3RA 1MNLA 1RN1A 1ZO2A 3FSDA 2UX0A 3K9MC 1IQ8A 1TRQA 1LQMB 2P09A 3QK9A 3CPW2 5EQLA 2XSOB 2CH9A 3TDGA 1B3SA 2B24B 5BU4A 2IUKA 3A5EA 2CFWA 3CC43 1YNVX 1X1UA 1N9EA 1UGIA 2CFDA 2ZA4A 4AKYA 7STDA 5DREA 3CCL3 4WHAA 5G2GA 3DZLA 3ZFZA 2CX0A 3LT8A 5LC6A 3GSPA 1B2SA 5IENA 2D42A 1NB5I 3CXC2 2CW9A 2QIYA 3G6E3 1O7GB 2KAAA 2M7OA 3B8LA 4GB5A 3U97A 2F4YA 1UCLA 3K63A 3MG1A 3F7XA 4LZIA 5IW9A 2CK3H 1G02A 3VGNA 2GU1A 1EKMA 3CCM3 2CFKA 3G0KA 5BXQA 4XM4A 3UL5A 1GOYA 1RDSA 4OK0A 2W6JH 1A2VA 3X3ZA 2LQVA 5M19A 1B21A 3G16A 1YIJ3 2RGQA 3EF8A 2XSHB 1FUSA 4FMCA 2XGLA 1BU4A 3NM7A 1EQKA 3D3LA 1HU9A 1DYUA 2R41A 1I3IA 3GZYB 4R1KA 3ECFA 4HAAA 3VF1A 5EEOA 3FF0A 1JV2B 3FG4A 1ASKA 1YIT3 1SQWA 3V99A 1HYFA 1W02A 1A2PA 2XRXB 2H0IA 1ISKA 3LOYA 1RGGA 2KRTA 3RGAA 1T3BA 4EBGA 1QJGA 1UI7A 4FMAA 2WGOA 3GWRA 1RHLA 1B20A 4HM6B 1STDA 3BU4A 2Z7AA 2ZDJA 3GRDA 4FCMA 4ORLA 5CF1A 2OCTA 1C7HA 3MYTA 1S5AA 1RTUA 2INXA 2STDA 3BNCA 3V98A 3GZRA 2OWPA 3OW22 3JUMA 1JN5B 1JBRA 1IVUA 4DKIA 2YFLB 4WFOA 1KD14 3O8YA 4RZMA 1U5OA 1RCKA 3UJMA 5AIFA 1RN4A 1FZUA 3Q2PA 1BSBA 2P0MA 2WOHA 3JUNA 1R4CA 1W7CA 4MEIA 1TU5A 1MWTA 4KVHA 3FLJA 1GOVA 1VQ43 1JKGB 3DXOA 2WO0A 3KCHA 3EX9A 4RNZA 1A67A 3KIIA 2XGNA 4ZM8A 2R4IA 4RNYA 3DMCA 3X3XA 1PFPA 1W6YA 5ELUA 3RGRA 3D79A 3PS8A 4LGQA 5IG3A 1IV7A 4N6UA 1FGMA 1JB5A 1N9JA 4L7KA 4EW5A 4H3UA 1K8A4 1OF5B 2W56A 2Z76A 4NHFA 4TX4A 5D81A 2CWVA 1N5PA 1TFKA 2P05A 1G0TA 1VQK3 1VQN3 1CYUA 3MG2A 1BRSA 5AI1A 1RGHA 4N6NB 4RBNA 2Y73A 1V74A 1BSCA 2K0MA 4GSPA 3KFQC 3EN1B 4HVNA 5AYSC 3CC73 1OHOA 1MGWA 3BNBA 3NUVA 4XBXA 5HOHA 3QRDA 3RDEA 1UCKA 4BU4A 5IF6A 1Q9EA 3M8CA 3PGBA 2KCDA 2KF3A 1X1XA 4KFEA 5AIHA 2D1WA 4HM1B 1A90A 1M9GA 1QALA 3I0YA 2JDIH 3BIRA 3DUKA 1T2HA 1UUVB 1NWWA 1NNVA 1GOUA 2KXGA 2YFJB 1RKYA 3GAXA 3S5CA 1Q7Y4 2OTL3 1OACA 4HM0B 2IA7A 3HIIA 3KN4A 4EYCA 3KKGA 3CCV3 3F14A 2AAEA 1AVLA 1DVCA 1I0XA 1FYSA 2W04A 3WDGB 1U8CB 1KC84 5GSPA 3CU3A 5RNTA 5M1AA 5FW5A 1IVWA 2K3DA 1GY5A 2KF6A 1BIRA 2ZL8A 3CPOA 3VSYA 2MC8A 1BRGA 4JRFA 3CCJ3 3AMOB 3NHXA 1HZ1A 1VQ63 3HOHA 3CME3 1O7NB 3AHSA 1M904 1M1XB 2W2CA 2RCDA 3IMAB 3H51A 1S723 1B2MA 1F8NA 2CFGA 2O9UX 3PXMA 3EQQB 3GZBA 4HJLB 4KFDA 5AIGA 1D6UA 4OUQA 1BRIA 7RNTA 1GMQA 1VQ73 1LRAA 2CWTA 1CQSA 2J8XB 1LOWA 1JZDA 1VZZA 3AHWA 5AIIA 2CWUA 2FXTA 1BNJA 3STDA 3D5IA 1KSIA 3S27A 5IEPA 1E3VA 3I553 1JB2A 4N6MA 1BSAA 1GY7A 1TUHA 2CHCA 4GHOA 1LOVA 5STDA 3SLUA 3FCSB 1BRJA 3DH2A 1W6CA 3AGNA 4MMYB 1DMNA 3MHEA 1BNFA 3CCU3 3UNLA 3ALAA 4J9AA 4JF8A 1GMRA 4IT7A 1K734 1RGAA 4X2OA 1JRQA 1BRHA 2SBLA 2RFRA 1BRNL 3NXJA 2H0HA 2GBWB 3EJVA 1OCVA 1JN5A 1RN7A 1V57A 2BHMA 4BIRA 4LEHA 2UUGC 1AR0A 1VQ83 1FGQA 1BSEA 1SPUA 2GU3A 5G1KA 2OQEA 1STFI 1CH0A 3BNDA 4FR9A 3IPTA 3JVCA 1CYVA 4K1VA 1W5ZA 1X1WA 2SARA 3SYUA 1W4NA 3K5TA 1KWIA 5IG0A 2LYXA 1RRLA 2RSXA 3LT9A 4K61A 1MGRA 1FGTA 4LYLB 4N6LA 5D83A 1GYBA 4HM4B 5JPUA 1N8QA 1RRHA 1ULIB 3EC9A 3NX0A 1BAOA 1BSDA 4HM7B 1GSPA 4R9KA 2Z6BA 2F5MA 1DMQA 5I97A 1J2BA 3GZXB 1OF5A 2GEYA 2PZVA 3E99A 3MPHA 2GSPA 1QAFA 3H3HA 3FKAA 3F7SA 1N8R4 1JB4A 1RSNA 1UUWB 3K7CA 3F40A 2XEPA 1GD3A 3WOEB 1I0VA 3CCR3 5CLKA 4BL2A 1OGZA 3IJEB 2L4VA 3NM2A 4R80A 3ZG0A 3SOAA 4H61A 2CX1A 1GMPA 5IG5A 1MWRA 1SIHA 1NDOB 1PU4A 1RGEA 3NQZA 1ZGXA 1YGWA 3LXUX 4X2HA 1VQO3 1JBSA 4XBYA 2IYJA 3L0RA 3HIGA 3NV0B 4I5QA 5CF2A 4HBRA 1FGRA 4HZ9B 1ZS7A 1SJWA 3OXAA 4N3VA 5FGOA 1V58A 2BMRB 1MWUA 1OUNA 2L1SA 1YJN3 3K0ZA 1RGKA 5CXOA 4ILFA 2QEX3 1O7HB 2OQEC 1BNRA 1QAKA 2F99A 3B4PA 3D5GA 4O2HA 1JBTA 2W9QA 5AEWB 2XF3A 2QA43 4EXRA 3AMOA 2Y74A 1W6GA 4O3VA 1ZX2A 1OGXA 1EA2A 3B7CA 1VQQA 1Y4KA 4K90B 1VQM3 2W0QA 1RMSA 1Q40B 1ROVA 1RNBA 2RBIA 3PYJA 3BLZA 2GEXA 1YVSA 2BT3A 2BO9B 2IY2A 3T0UA 1GD4A 1Q864 1KQS2 3LTAA 4R9LA 4LSOA 3URPA 4EV2A 3CMA3 4FCJA 2H0GA 2KF5A 1QMAA 1JJ22 7GSPA 1VQL3 3WA2X 1Q824 3OWUA 4MMZB 1RNTA 8CHOA 4N6V0 2K54A 4XDWA 5A0OB 2F86B 4HM5B 1LOYA 1AQZA 3N9HA 2B1XB 3OX9A 5AYRB 1T5YA 1WMPA 2E2TA 3Q3FA 3CCS3 3D4AA 3F9SA 1VQ53 1SIIA 1NO3A 4G1MB 1IVXA 1W2ZA 2XFTA 1I70A 4FMDA 4BL3A 1DE3A 4NREA 3NBJA 4MJDA 2HMLB 1BGSA 2YX9A 1RCLA 3LTDA 3OWSA 2OOVA 4STDA 2CG1A 5KP1A 1LXEA 1UI8A 2CIUA 1IVVA 1Z1SA 2IMJA 3DY5A 3WOFB 4PEJA 1K9M4 1EG9B 1W00A 2I9WA 4CPKA 1TRPA 2O3OA 1OH0A 1IYYA 4WYKB 2C11A 1PYLA 2HMJB 1DETA 1Q7HA 1G96A 2RNTA 4K1UA 4OVMA 4Q53A 2E2UA 1K28A 1OHSA 1UCIA 3BNEA 5ELJA 3CC23 2HOHA 5EVHA 2A15A 3JUQA 2AADA 2HMNB 4HKVB 3HZPA 1IQXA 3X3YA 1I8VA 3ZG5A 5JPPA 1BOXA 3FGYA 1AVKA 4IPBA 4WWUC 4CJNA 1E97A 1FA3A 3B4OA 5LC7A 3WODG 4AEQA 3SEDA 2C4BA 2F98A 4BTXA 2E2VA 3LZAA 4HYZA 2XR8B 1SARA 3U1WA 1WQLB 5KP4A 3BB9A 2HMKB 3CD63 3LMLA 1WTHA 2PNCA 2V1LA 2HMOB 5D82A 4KZ1A 4HM2B 2JQ5A 4CCVA 3N54B 1TIJA 2P0XA 2QGUA 3AGOA 3NBBA 1WNHA 4XBTA 3HX8A 4J8TA 3DGLA 3LYGA 2IUJA 2BU4A 2XH9A 3DGNA 1JKGA 4HOHA 2P38A 2YFIB 3F8XA 5TGNA 4HM3B 3X41A 2WOFA 1MOLA 4L8OA 3OWYA 3CNMA 3NV0A 3DGOA 1X1YA 1RJOA 4L8PA 4GL6A 3HK4A 6GSPA 2OOVC 3OV4A 3ER7A 1QVG2 2Q07A 1O7PB 4U13A 1FUTA 3MG3A 4EC6A 6STDA 5JBSA 3CCQ3 1PY3A 1JNQA 1W2B2 1VQP3 3X40A 1HKXA 3WR2A 1BNGA 4HZBB 1NJI4 2CKFB 1LOXA 4O8SA 1VQ93 4XDVA 1W01A 3T8UA 2CG0A 3FG3A 3SOYA 4AKZA 1FGOA 3DM8A 1UCJA 5IERA 3S67A 3KSED 2KF4A 1JZOA 1YVBI 2CC3A 1IV9A 2HMMB 4KFFA 1Q40A 4R4KA 3ROBA 3F8HA 1IDPA 1DVDA 3Q90A 1US1A 1N5HA 2GBXB 3D9RA 3T8NA 3WA3A 2CFLA 3EBTA 3FF2A 3EN8A 2GXFA 1IQYA 3FG1A 1B2ZA 1OPYA 4FMBA 3JUOA 3EB8A 5HGRA 1BRKA 1LVNA 1ROAA 2ML5A 1I2FA 1LNHA 1MWSA 3FH1A 1Q42A 1BANA 1M1K4 1BUJA 2BMOB 1I2EA 1YJ93 3MWZA 1C54A 1BVIA 1AY7A 1WMNA
chains in the Genus database with same CATH topology
1WMOA 3MKIA 4LMIA 5AEUB 2BNGA 4HM8B 4CDLA 3A76A 5BVBA 3CNXA 3LTBA 3V92A 3LH4A 1AV4A 1NB3I 3PZWA 3SVAA 3KSPA 5DRVA 4BTWA 1TFOA 1TP6A 3DGMA 1ULJB 3KE7A 3HI7A 4WP5A 1YGEA 3CCE3 1CEWI 2C10A 4IIAA 1D6YA 3WMDA 4WYKA 1O7WB 2WGQA 3UB1A 3LTCA 4EV5A 2FGTA 2W9PA 1GY6A 4MMXB 1OHPA 5IG4A 1YI23 3S28A 3PCSA 1YJW3 1A2KA 4XB5A 3EHCA 3X42A 4FCZA 3KZTA 1O7MB 3EBYA 4N6TA 2XFSA 1UW1A 3NQYA 1IK3A 2Z77A 3G4S3 2MF7A 2FNQA 3G8ZA 4QWTA 2W03A 1K41A 1DMMA 2OTJ3 2W56B 1FUWA 5KP3A 1BUQA 5IEOA 1IT8A 1NU3A 3N8BA 3SX1A 3G713 3FZWA 4BTYA 3I563 1Q814 4O02B 3SXXA 4N6OB 1IU7A 1QVF2 1L5GB 3Q1CA 1IT7A 2BMQB 3JUPA 3S29A 1YHQ3 2ML6A 4I4KA 3EE1A 3MSOA 1GS3A 3NBRA 3J7Yd 3UL6A 3PCRA 5CK6A 1D6ZA 1E3RA 1MNLA 1ZO2A 3FSDA 3K9MC 2UX0A 3QK9A 1IQ8A 3CPW2 2P09A 5EQLA 2XSOB 2CH9A 3TDGA 2B24B 2IUKA 2CFWA 3CC43 7STDA 1N9EA 2CFDA 4AKYA 5DREA 3CCL3 4WHAA 5G2GA 3DZLA 3LT8A 5LC6A 5IENA 2D42A 1NB5I 3CXC2 2CW9A 2QIYA 3G6E3 1O7GB 2M7OA 3B8LA 4GB5A 3U97A 3MG1A 3K63A 4LZIA 5IW9A 3F7XA 2CK3H 3VGNA 2GU1A 1EKMA 3CCM3 2CFKA 3G0KA 5BXQA 4XM4A 3UL5A 4OK0A 2W6JH 1A2VA 3X3ZA 2LQVA 1YIJ3 3G16A 2RGQA 3EF8A 2XSHB 4FMCA 2XGLA 3NM7A 1EQKA 3D3LA 1HU9A 1DYUA 4R1KA 3GZYB 3ECFA 3VF1A 5EEOA 3FF0A 1JV2B 3FG4A 1ASKA 1YIT3 1SQWA 3V99A 1W02A 2XRXB 1ISKA 3LOYA 2KRTA 3RGAA 4EBGA 1QJGA 1UI7A 4FMAA 2WGOA 3GWRA 4HM6B 1STDA 2Z7AA 2ZDJA 3GRDA 4FCMA 4ORLA 5CF1A 2OCTA 1C7HA 3MYTA 1S5AA 2INXA 2STDA 3BNCA 3V98A 3GZRA 2OWPA 3OW22 3JUMA 1JN5B 1IVUA 2YFLB 4WFOA 1KD14 3O8YA 4RZMA 1U5OA 3UJMA 5AIFA 3Q2PA 2P0MA 2WOHA 3JUNA 1R4CA 1W7CA 4MEIA 1TU5A 4KVHA 3FLJA 1VQ43 1JKGB 3DXOA 2WO0A 4RNZA 3EX9A 1A67A 3KIIA 2XGNA 4ZM8A 2R4IA 4RNYA 3DMCA 3X3XA 1PFPA 1W6YA 5ELUA 3RGRA 3PS8A 4LGQA 5IG3A 1IV7A 4N6UA 1FGMA 1JB5A 1N9JA 4L7KA 1K8A4 4H3UA 1OF5B 2W56A 2Z76A 4NHFA 4TX4A 5D81A 2CWVA 1N5PA 1TFKA 2P05A 1VQK3 1VQN3 1CYUA 3MG2A 5AI1A 4N6NB 4RBNA 2Y73A 1V74A 2K0MA 3KFQC 3EN1B 4HVNA 5AYSC 3CC73 1OHOA 3BNBA 3NUVA 4XBXA 3QRDA 3RDEA 5IF6A 3M8CA 3PGBA 2KCDA 4KFEA 5AIHA 1A90A 2D1WA 4HM1B 1M9GA 1QALA 3I0YA 2JDIH 3DUKA 1UUVB 2KXGA 1NWWA 1RKYA 2YFJB 3GAXA 3S5CA 1Q7Y4 2OTL3 1OACA 4HM0B 2IA7A 3HIIA 3KN4A 4EYCA 3KKGA 3CCV3 3F14A 1AVLA 1DVCA 2W04A 3WDGB 1KC84 1U8CB 3CU3A 5FW5A 1IVWA 1GY5A 2ZL8A 3CPOA 3VSYA 2MC8A 3CCJ3 4JRFA 3AMOB 3NHXA 1VQ63 3CME3 1O7NB 1M904 1M1XB 2W2CA 2RCDA 3IMAB 3H51A 1S723 1F8NA 2CFGA 2O9UX 3PXMA 3EQQB 3GZBA 4HJLB 4KFDA 5AIGA 1D6UA 4OUQA 1VQ73 2CWTA 1CQSA 1VZZA 5AIIA 2CWUA 2FXTA 3STDA 3S27A 1KSIA 5IEPA 1E3VA 3I553 1JB2A 4N6MA 1GY7A 1TUHA 2CHCA 5STDA 3SLUA 3FCSB 1W6CA 4MMYB 1DMNA 3MHEA 3CCU3 3UNLA 3ALAA 4J9AA 4JF8A 4IT7A 1K734 4X2OA 1JRQA 2SBLA 2RFRA 3NXJA 3EJVA 2GBWB 1OCVA 1JN5A 1RN7A 1VQ83 2BHMA 4LEHA 1AR0A 1FGQA 1SPUA 2GU3A 2OQEA 1STFI 3BNDA 4FR9A 3IPTA 3JVCA 1CYVA 4K1VA 1W5ZA 1W4NA 3K5TA 1KWIA 5IG0A 2LYXA 1RRLA 2RSXA 3LT9A 4K61A 4N6LA 1FGTA 5D83A 1GYBA 4HM4B 5JPUA 1N8QA 1RRHA 1ULIB 3EC9A 3NX0A 4HM7B 4R9KA 2Z6BA 1DMQA 5I97A 1J2BA 3GZXB 1OF5A 2GEYA 2PZVA 3E99A 3MPHA 1QAFA 3H3HA 3FKAA 3F7SA 1N8R4 1JB4A 1UUWB 3K7CA 3F40A 2XEPA 1GD3A 3WOEB 3CCR3 5CLKA 1OGZA 3IJEB 2L4VA 3NM2A 4R80A 3SOAA 4H61A 5IG5A 1SIHA 1NDOB 1PU4A 3NQZA 4X2HA 3LXUX 1VQO3 4XBYA 3L0RA 3HIGA 3NV0B 5CF2A 4HBRA 1FGRA 4HZ9B 1SJWA 3OXAA 4N3VA 5FGOA 2BMRB 1OUNA 1YJN3 3K0ZA 5CXOA 2QEX3 1O7HB 2OQEC 1QAKA 2F99A 3B4PA 4O2HA 2W9QA 5AEWB 2XF3A 2QA43 4EXRA 3AMOA 2Y74A 1W6GA 4O3VA 1ZX2A 1OGXA 1EA2A 3B7CA 1Y4KA 4K90B 1VQM3 2W0QA 1Q40B 1ROVA 3PYJA 3BLZA 2GEXA 2BT3A 2BO9B 3T0UA 1GD4A 1Q864 1KQS2 3LTAA 4R9LA 4LSOA 4EV2A 3CMA3 4FCJA 1QMAA 1JJ22 1VQL3 3WA2X 1Q824 3OWUA 4MMZB 8CHOA 4N6V0 2K54A 4XDWA 5A0OB 2F86B 4HM5B 3N9HA 2B1XB 3OX9A 5AYRB 1T5YA 1WMPA 2E2TA 3CCS3 3F9SA 1VQ53 1SIIA 1NO3A 4G1MB 1IVXA 1W2ZA 2XFTA 4FMDA 4NREA 3NBJA 4MJDA 2HMLB 2YX9A 3LTDA 3OWSA 2OOVA 4STDA 2CG1A 5KP1A 1LXEA 1UI8A 2CIUA 1IVVA 1Z1SA 2IMJA 3DY5A 3WOFB 4PEJA 1K9M4 1EG9B 1W00A 2I9WA 2O3OA 1OH0A 4WYKB 2C11A 2HMJB 1G96A 4OVMA 4K1UA 4Q53A 2E2UA 1K28A 1OHSA 3BNEA 5ELJA 3CC23 5EVHA 2A15A 3JUQA 2HMNB 4HKVB 3HZPA 1IQXA 3X3YA 5JPPA 3FGYA 1AVKA 4IPBA 4WWUC 1FA3A 1E97A 3B4OA 5LC7A 3WODG 4AEQA 3SEDA 2F98A 4BTXA 2E2VA 3LZAA 4HYZA 2XR8B 3U1WA 1WQLB 5KP4A 3BB9A 2HMKB 3CD63 3LMLA 1WTHA 2PNCA 2V1LA 2HMOB 5D82A 4KZ1A 4HM2B 2JQ5A 4CCVA 3N54B 1TIJA 2P0XA 2QGUA 3NBBA 4XBTA 1WNHA 3HX8A 4J8TA 3DGLA 3LYGA 2IUJA 3DGNA 2XH9A 5TGNA 1JKGA 2P38A 2YFIB 3F8XA 4HM3B 3X41A 2WOFA 1MOLA 4L8OA 3OWYA 3CNMA 3NV0A 3DGOA 1RJOA 4L8PA 4GL6A 3HK4A 2OOVC 3OV4A 3ER7A 1QVG2 2Q07A 1O7PB 4U13A 4EC6A 3MG3A 6STDA 5JBSA 3CCQ3 1JNQA 1W2B2 1VQP3 3X40A 1HKXA 1NJI4 4HZBB 2CKFB 1LOXA 4O8SA 1VQ93 4XDVA 1W01A 3T8UA 2CG0A 3FG3A 3SOYA 4AKZA 1FGOA 3DM8A 5IERA 3S67A 3KSED 1YVBI 2CC3A 1IV9A 2HMMB 4KFFA 1Q40A 4R4KA 3ROBA 3F8HA 1IDPA 1DVDA 3Q90A 1US1A 1N5HA 2GBXB 3D9RA 3T8NA 3WA3A 2CFLA 3EBTA 3FF2A 3EN8A 2GXFA 1IQYA 3FG1A 1OPYA 4FMBA 3JUOA 3EB8A 5HGRA 1LVNA 1ROAA 2ML5A 3FH1A 1Q42A 1M1K4 2BMOB 1YJ93 3MWZA 1LNHA 1WMNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MKI A;  4LMI A;  5AEU B;  2BNG A;  4HM8 B;  4CDL A;  3A76 A;  5BVB A;  3CNX A;  3KSP A;  5DRV A;  1TP6 A;  1ULJ B;  3KE7 A;  4WP5 A;  3WMD A;  4IIA A;  4WYK A;  1O7W B;  1GY6 A;  1OHP A;  5IG4 A;  1A2K A;  4XB5 A;  3EHC A;  3KZT A;  1O7M B;  3EBY A;  2Z77 A;  3G8Z A;  1K41 A;  1DMM A;  5KP3 A;  1BUQ A;  5IEO A;  1NU3 A;  3FZW A;  2BMQ B;  3JUP A;  4I4K A;  3MSO A;  1GS3 A;  3NBR A;  5CK6 A;  1E3R A;  1ZO2 A;  3FSD A;  2UX0 A;  2XSO B;  2B24 B;  7STD A;  5DRE A;  5G2G A;  3DZL A;  5IEN A;  2QIY A;  1O7G B;  3B8L A;  4GB5 A;  3MG1 A;  3F7X A;  3VGN A;  3G0K A;  5BXQ A;  4XM4 A;  3G16 A;  2RGQ A;  3EF8 A;  2XSH B;  4R1K A;  3GZY B;  3ECF A;  3FF0 A;  1ASK A;  1W02 A;  2XRX B;  1ISK A;  3RGA A;  1QJG A;  3GWR A;  4HM6 B;  1STD A;  2Z7A A;  3GRD A;  4FCM A;  4ORL A;  5CF1 A;  3MYT A;  1C7H A;  1S5A A;  2INX A;  2STD A;  3GZR A;  2OWP A;  3JUM A;  1JN5 B;  2YFL B;  4RZM A;  1U5O A;  3UJM A;  5AIF A;  3JUN A;  4KVH A;  3FLJ A;  1JKG B;  3DXO A;  3EX9 A;  2R4I A;  3DMC A;  1W6Y A;  3RGR A;  4LGQ A;  5IG3 A;  1JB5 A;  4L7K A;  4H3U A;  1OF5 B;  2Z76 A;  5D81 A;  3MG2 A;  5AI1 A;  3EN1 B;  4HVN A;  1OHO A;  3NUV A;  4XBX A;  5IF6 A;  3M8C A;  5AIH A;  4HM1 B;  3I0Y A;  3DUK A;  1UUV B;  1NWW A;  2YFJ B;  3S5C A;  4HM0 B;  3KKG A;  3F14 A;  3CU3 A;  5FW5 A;  1GY5 A;  3CPO A;  3VSY A;  3NHX A;  1O7N B;  2W2C A;  2RCD A;  3H51 A;  3EQQ B;  3GZB A;  4HJL B;  5AIG A;  4OUQ A;  1CQS A;  1VZZ A;  5AII A;  3STD A;  5IEP A;  1E3V A;  1JB2 A;  1GY7 A;  1TUH A;  2CHC A;  5STD A;  1DMN A;  3MHE A;  3UNL A;  4J9A A;  4X2O A;  2RFR A;  3NXJ A;  3EJV A;  2GBW B;  1OCV A;  1JN5 A;  4LEH A;  1AR0 A;  3IPT A;  4K1V A;  5IG0 A;  5D83 A;  1GYB A;  4HM4 B;  5JPU A;  1ULI B;  3EC9 A;  4HM7 B;  4R9K A;  1DMQ A;  3GZX B;  1OF5 A;  2GEY A;  2PZV A;  3E99 A;  3H3H A;  3FKA A;  3F7S A;  1JB4 A;  1UUW B;  3K7C A;  3F40 A;  5CLK A;  1OGZ A;  3NM2 A;  3SOA A;  5IG5 A;  1NDO B;  4X2H A;  4XBY A;  3NV0 B;  5CF2 A;  4HZ9 B;  1SJW A;  3OXA A;  4N3V A;  2BMR B;  1OUN A;  3K0Z A;  5CXO A;  1O7H B;  2F99 A;  3B4P A;  5AEW B;  1ZX2 A;  1OGX A;  1EA2 A;  3B7C A;  1Q40 B;  3BLZ A;  2GEX A;  4R9L A;  4FCJ A;  1QMA A;  3OWU A;  8CHO A;  2K54 A;  4XDW A;  2F86 B;  4HM5 B;  3OX9 A;  2B1X B;  3F9S A;  4MJD A;  2HML B;  3OWS A;  4STD A;  5KP1 A;  1Z1S A;  2IMJ A;  4PEJ A;  1EG9 B;  1W00 A;  2I9W A;  1OH0 A;  4WYK B;  2HMJ B;  4Q53 A;  4OVM A;  4K1U A;  1OHS A;  5EVH A;  2A15 A;  3JUQ A;  2HMN B;  4HKV B;  3HZP A;  5JPP A;  3FGY A;  4WWU C;  1E97 A;  3B4O A;  3SED A;  2F98 A;  3LZA A;  2XR8 B;  1WQL B;  5KP4 A;  3BB9 A;  2HMK B;  2HMO B;  5D82 A;  4HM2 B;  2JQ5 A;  2QGU A;  4XBT A;  3HX8 A;  4J8T A;  3LYG A;  5TGN A;  1JKG A;  2YFI B;  3F8X A;  4HM3 B;  4L8O A;  3OWY A;  3CNM A;  3NV0 A;  4L8P A;  3HK4 A;  3OV4 A;  3ER7 A;  1O7P B;  4U13 A;  3MG3 A;  6STD A;  1HKX A;  4HZB B;  2CKF B;  4XDV A;  1W01 A;  3T8U A;  3SOY A;  5IER A;  3DM8 A;  2HMM B;  3ROB A;  1Q40 A;  3F8H A;  1IDP A;  3Q90 A;  2GBX B;  3D9R A;  3T8N A;  3EBT A;  3FF2 A;  3EN8 A;  2GXF A;  1OPY A;  3JUO A;  5HGR A;  3FH1 A;  1Q42 A;  2BMO B; 
#chains in the Genus database with same CATH topology
 1WMO A;  1B2U A;  3MKI A;  2BIR A;  4LMI A;  5AEU B;  2BNG A;  4HM8 B;  4CDL A;  3A76 A;  4KT3 B;  1LQG C;  5BVB A;  3CNX A;  1RGF A;  3LTB A;  3V92 A;  3LH4 A;  1AV4 A;  1NB3 I;  4J5K A;  3PZW A;  2UGI A;  3SVA A;  1EEJ A;  5M18 A;  4NPB A;  3KSP A;  5DRV A;  1TTO A;  4BTW A;  1TFO A;  1TP6 A;  2F56 A;  8RNT A;  3DGM A;  1ULJ B;  3KE7 A;  3HI7 A;  1LNI A;  4WP5 A;  1YGE A;  3CCE 3;  1UUG B;  1CEW I;  2C10 A;  4IIA A;  1D6Y A;  5G1L A;  3WMD A;  4WYK A;  1O7W B;  2WGQ A;  3UB1 A;  3LTC A;  4EV5 A;  2FGT A;  2W9P A;  1GY6 A;  6RNT A;  4MMX B;  1UGH I;  1RGC A;  1OHP A;  1BNI A;  1B2X A;  3DGY A;  5IG4 A;  3RNT A;  3S28 A;  3PCS A;  3WHO A;  1YI2 3;  1YJW 3;  2ZHX B;  1A2K A;  1B27 A;  4XB5 A;  3EHC A;  1T2I A;  3X42 A;  4FCZ A;  1UDI I;  3KZT A;  1FW7 A;  1O7M B;  3EBY A;  1RGL A;  4N6T A;  1I3F A;  2XFS A;  1UW1 A;  3NQY A;  1IK3 A;  2Z77 A;  4J5G A;  3G4S 3;  2MF7 A;  2FNQ A;  3G8Z A;  4QWT A;  1RLS A;  1K41 A;  1DMM A;  1TJD A;  2W03 A;  2OTJ 3;  2W56 B;  4RNT A;  1BNS A;  5KP3 A;  1FUW A;  1BUQ A;  5IEO A;  1BNE A;  1R4Y A;  1IT8 A;  1NU3 A;  5BIR A;  3N8B A;  3SX1 A;  3G71 3;  3FZW A;  4BTY A;  9RNT A;  2F5W A;  3I56 3;  1I2G A;  4O02 B;  3SXX A;  1Q81 4;  4N6O B;  1IU7 A;  1EUI C;  1L5G B;  3Q1C A;  1IT7 A;  1QVF 2;  2BMQ B;  3JUP A;  3S29 A;  1YHQ 3;  2ML6 A;  4I4K A;  3EE1 A;  3MSO A;  1GS3 A;  3NBR A;  3J7Y d;  3UL6 A;  3PCR A;  5CK6 A;  1D6Z A;  1E3R A;  1MNL A;  1RN1 A;  1ZO2 A;  3FSD A;  2UX0 A;  3K9M C;  1IQ8 A;  1TRQ A;  1LQM B;  2P09 A;  3QK9 A;  3CPW 2;  5EQL A;  2XSO B;  2CH9 A;  3TDG A;  1B3S A;  2B24 B;  5BU4 A;  2IUK A;  3A5E A;  2CFW A;  3CC4 3;  1YNV X;  1X1U A;  1N9E A;  1UGI A;  2CFD A;  2ZA4 A;  4AKY A;  7STD A;  5DRE A;  3CCL 3;  4WHA A;  5G2G A;  3DZL A;  3ZFZ A;  2CX0 A;  3LT8 A;  5LC6 A;  3GSP A;  1B2S A;  5IEN A;  2D42 A;  1NB5 I;  3CXC 2;  2CW9 A;  2QIY A;  3G6E 3;  1O7G B;  2KAA A;  2M7O A;  3B8L A;  4GB5 A;  3U97 A;  2F4Y A;  1UCL A;  3K63 A;  3MG1 A;  3F7X A;  4LZI A;  5IW9 A;  2CK3 H;  1G02 A;  3VGN A;  2GU1 A;  1EKM A;  3CCM 3;  2CFK A;  3G0K A;  5BXQ A;  4XM4 A;  3UL5 A;  1GOY A;  1RDS A;  4OK0 A;  2W6J H;  1A2V A;  3X3Z A;  2LQV A;  5M19 A;  1B21 A;  3G16 A;  1YIJ 3;  2RGQ A;  3EF8 A;  2XSH B;  1FUS A;  4FMC A;  2XGL A;  1BU4 A;  3NM7 A;  1EQK A;  3D3L A;  1HU9 A;  1DYU A;  2R41 A;  1I3I A;  3GZY B;  4R1K A;  3ECF A;  4HAA A;  3VF1 A;  5EEO A;  3FF0 A;  1JV2 B;  3FG4 A;  1ASK A;  1YIT 3;  1SQW A;  3V99 A;  1HYF A;  1W02 A;  1A2P A;  2XRX B;  2H0I A;  1ISK A;  3LOY A;  1RGG A;  2KRT A;  3RGA A;  1T3B A;  4EBG A;  1QJG A;  1UI7 A;  4FMA A;  2WGO A;  3GWR A;  1RHL A;  1B20 A;  4HM6 B;  1STD A;  3BU4 A;  2Z7A A;  2ZDJ A;  3GRD A;  4FCM A;  4ORL A;  5CF1 A;  2OCT A;  1C7H A;  3MYT A;  1S5A A;  1RTU A;  2INX A;  2STD A;  3BNC A;  3V98 A;  3GZR A;  2OWP A;  3OW2 2;  3JUM A;  1JN5 B;  1JBR A;  1IVU A;  4DKI A;  2YFL B;  4WFO A;  1KD1 4;  3O8Y A;  4RZM A;  1U5O A;  1RCK A;  3UJM A;  5AIF A;  1RN4 A;  1FZU A;  3Q2P A;  1BSB A;  2P0M A;  2WOH A;  3JUN A;  1R4C A;  1W7C A;  4MEI A;  1TU5 A;  1MWT A;  4KVH A;  3FLJ A;  1GOV A;  1VQ4 3;  1JKG B;  3DXO A;  2WO0 A;  3KCH A;  3EX9 A;  4RNZ A;  1A67 A;  3KII A;  2XGN A;  4ZM8 A;  2R4I A;  4RNY A;  3DMC A;  3X3X A;  1PFP A;  1W6Y A;  5ELU A;  3RGR A;  3D79 A;  3PS8 A;  4LGQ A;  5IG3 A;  1IV7 A;  4N6U A;  1FGM A;  1JB5 A;  1N9J A;  4L7K A;  4EW5 A;  4H3U A;  1K8A 4;  1OF5 B;  2W56 A;  2Z76 A;  4NHF A;  4TX4 A;  5D81 A;  2CWV A;  1N5P A;  1TFK A;  2P05 A;  1G0T A;  1VQK 3;  1VQN 3;  1CYU A;  3MG2 A;  1BRS A;  5AI1 A;  1RGH A;  4N6N B;  4RBN A;  2Y73 A;  1V74 A;  1BSC A;  2K0M A;  4GSP A;  3KFQ C;  3EN1 B;  4HVN A;  5AYS C;  3CC7 3;  1OHO A;  1MGW A;  3BNB A;  3NUV A;  4XBX A;  5HOH A;  3QRD A;  3RDE A;  1UCK A;  4BU4 A;  5IF6 A;  1Q9E A;  3M8C A;  3PGB A;  2KCD A;  2KF3 A;  1X1X A;  4KFE A;  5AIH A;  2D1W A;  4HM1 B;  1A90 A;  1M9G A;  1QAL A;  3I0Y A;  2JDI H;  3BIR A;  3DUK A;  1T2H A;  1UUV B;  1NWW A;  1NNV A;  1GOU A;  2KXG A;  2YFJ B;  1RKY A;  3GAX A;  3S5C A;  1Q7Y 4;  2OTL 3;  1OAC A;  4HM0 B;  2IA7 A;  3HII A;  3KN4 A;  4EYC A;  3KKG A;  3CCV 3;  3F14 A;  2AAE A;  1AVL A;  1DVC A;  1I0X A;  1FYS A;  2W04 A;  3WDG B;  1U8C B;  1KC8 4;  5GSP A;  3CU3 A;  5RNT A;  5M1A A;  5FW5 A;  1IVW A;  2K3D A;  1GY5 A;  2KF6 A;  1BIR A;  2ZL8 A;  3CPO A;  3VSY A;  2MC8 A;  1BRG A;  4JRF A;  3CCJ 3;  3AMO B;  3NHX A;  1HZ1 A;  1VQ6 3;  3HOH A;  3CME 3;  1O7N B;  3AHS A;  1M90 4;  1M1X B;  2W2C A;  2RCD A;  3IMA B;  3H51 A;  1S72 3;  1B2M A;  1F8N A;  2CFG A;  2O9U X;  3PXM A;  3EQQ B;  3GZB A;  4HJL B;  4KFD A;  5AIG A;  1D6U A;  4OUQ A;  1BRI A;  7RNT A;  1GMQ A;  1VQ7 3;  1LRA A;  2CWT A;  1CQS A;  2J8X B;  1LOW A;  1JZD A;  1VZZ A;  3AHW A;  5AII A;  2CWU A;  2FXT A;  1BNJ A;  3STD A;  3D5I A;  1KSI A;  3S27 A;  5IEP A;  1E3V A;  3I55 3;  1JB2 A;  4N6M A;  1BSA A;  1GY7 A;  1TUH A;  2CHC A;  4GHO A;  1LOV A;  5STD A;  3SLU A;  3FCS B;  1BRJ A;  3DH2 A;  1W6C A;  3AGN A;  4MMY B;  1DMN A;  3MHE A;  1BNF A;  3CCU 3;  3UNL A;  3ALA A;  4J9A A;  4JF8 A;  1GMR A;  4IT7 A;  1K73 4;  1RGA A;  4X2O A;  1JRQ A;  1BRH A;  2SBL A;  2RFR A;  1BRN L;  3NXJ A;  2H0H A;  2GBW B;  3EJV A;  1OCV A;  1JN5 A;  1RN7 A;  1V57 A;  2BHM A;  4BIR A;  4LEH A;  2UUG C;  1AR0 A;  1VQ8 3;  1FGQ A;  1BSE A;  1SPU A;  2GU3 A;  5G1K A;  2OQE A;  1STF I;  1CH0 A;  3BND A;  4FR9 A;  3IPT A;  3JVC A;  1CYV A;  4K1V A;  1W5Z A;  1X1W A;  2SAR A;  3SYU A;  1W4N A;  3K5T A;  1KWI A;  5IG0 A;  2LYX A;  1RRL A;  2RSX A;  3LT9 A;  4K61 A;  1MGR A;  1FGT A;  4LYL B;  4N6L A;  5D83 A;  1GYB A;  4HM4 B;  5JPU A;  1N8Q A;  1RRH A;  1ULI B;  3EC9 A;  3NX0 A;  1BAO A;  1BSD A;  4HM7 B;  1GSP A;  4R9K A;  2Z6B A;  2F5M A;  1DMQ A;  5I97 A;  1J2B A;  3GZX B;  1OF5 A;  2GEY A;  2PZV A;  3E99 A;  3MPH A;  2GSP A;  1QAF A;  3H3H A;  3FKA A;  3F7S A;  1N8R 4;  1JB4 A;  1RSN A;  1UUW B;  3K7C A;  3F40 A;  2XEP A;  1GD3 A;  3WOE B;  1I0V A;  3CCR 3;  5CLK A;  4BL2 A;  1OGZ A;  3IJE B;  2L4V A;  3NM2 A;  4R80 A;  3ZG0 A;  3SOA A;  4H61 A;  2CX1 A;  1GMP A;  5IG5 A;  1MWR A;  1SIH A;  1NDO B;  1PU4 A;  1RGE A;  3NQZ A;  1ZGX A;  1YGW A;  3LXU X;  4X2H A;  1VQO 3;  1JBS A;  4XBY A;  2IYJ A;  3L0R A;  3HIG A;  3NV0 B;  4I5Q A;  5CF2 A;  4HBR A;  1FGR A;  4HZ9 B;  1ZS7 A;  1SJW A;  3OXA A;  4N3V A;  5FGO A;  1V58 A;  2BMR B;  1MWU A;  1OUN A;  2L1S A;  1YJN 3;  3K0Z A;  1RGK A;  5CXO A;  4ILF A;  2QEX 3;  1O7H B;  2OQE C;  1BNR A;  1QAK A;  2F99 A;  3B4P A;  3D5G A;  4O2H A;  1JBT A;  2W9Q A;  5AEW B;  2XF3 A;  2QA4 3;  4EXR A;  3AMO A;  2Y74 A;  1W6G A;  4O3V A;  1ZX2 A;  1OGX A;  1EA2 A;  3B7C A;  1VQQ A;  1Y4K A;  4K90 B;  1VQM 3;  2W0Q A;  1RMS A;  1Q40 B;  1ROV A;  1RNB A;  2RBI A;  3PYJ A;  3BLZ A;  2GEX A;  1YVS A;  2BT3 A;  2BO9 B;  2IY2 A;  3T0U A;  1GD4 A;  1Q86 4;  1KQS 2;  3LTA A;  4R9L A;  4LSO A;  3URP A;  4EV2 A;  3CMA 3;  4FCJ A;  2H0G A;  2KF5 A;  1QMA A;  1JJ2 2;  7GSP A;  1VQL 3;  3WA2 X;  1Q82 4;  3OWU A;  4MMZ B;  1RNT A;  8CHO A;  4N6V 0;  2K54 A;  4XDW A;  5A0O B;  2F86 B;  4HM5 B;  1LOY A;  1AQZ A;  3N9H A;  2B1X B;  3OX9 A;  5AYR B;  1T5Y A;  1WMP A;  2E2T A;  3Q3F A;  3CCS 3;  3D4A A;  3F9S A;  1VQ5 3;  1SII A;  1NO3 A;  4G1M B;  1IVX A;  1W2Z A;  2XFT A;  1I70 A;  4FMD A;  4BL3 A;  1DE3 A;  4NRE A;  3NBJ A;  4MJD A;  2HML B;  1BGS A;  2YX9 A;  1RCL A;  3LTD A;  3OWS A;  2OOV A;  4STD A;  2CG1 A;  5KP1 A;  1LXE A;  1UI8 A;  2CIU A;  1IVV A;  1Z1S A;  2IMJ A;  3DY5 A;  3WOF B;  4PEJ A;  1K9M 4;  1EG9 B;  1W00 A;  2I9W A;  4CPK A;  1TRP A;  2O3O A;  1OH0 A;  1IYY A;  4WYK B;  2C11 A;  1PYL A;  2HMJ B;  1DET A;  1Q7H A;  1G96 A;  2RNT A;  4K1U A;  4OVM A;  4Q53 A;  2E2U A;  1K28 A;  1OHS A;  1UCI A;  3BNE A;  5ELJ A;  3CC2 3;  2HOH A;  5EVH A;  2A15 A;  3JUQ A;  2AAD A;  2HMN B;  4HKV B;  3HZP A;  1IQX A;  3X3Y A;  1I8V A;  3ZG5 A;  5JPP A;  1BOX A;  3FGY A;  1AVK A;  4IPB A;  4WWU C;  4CJN A;  1E97 A;  1FA3 A;  3B4O A;  5LC7 A;  3WOD G;  4AEQ A;  3SED A;  2C4B A;  2F98 A;  4BTX A;  2E2V A;  3LZA A;  4HYZ A;  2XR8 B;  1SAR A;  3U1W A;  1WQL B;  5KP4 A;  3BB9 A;  2HMK B;  3CD6 3;  3LML A;  1WTH A;  2PNC A;  2V1L A;  2HMO B;  5D82 A;  4KZ1 A;  4HM2 B;  2JQ5 A;  4CCV A;  3N54 B;  1TIJ A;  2P0X A;  2QGU A;  3AGO A;  3NBB A;  1WNH A;  4XBT A;  3HX8 A;  4J8T A;  3DGL A;  3LYG A;  2IUJ A;  2BU4 A;  2XH9 A;  3DGN A;  1JKG A;  4HOH A;  2P38 A;  2YFI B;  3F8X A;  5TGN A;  4HM3 B;  3X41 A;  2WOF A;  1MOL A;  4L8O A;  3OWY A;  3CNM A;  3NV0 A;  3DGO A;  1X1Y A;  1RJO A;  4L8P A;  4GL6 A;  3HK4 A;  6GSP A;  2OOV C;  3OV4 A;  3ER7 A;  1QVG 2;  2Q07 A;  1O7P B;  4U13 A;  1FUT A;  3MG3 A;  4EC6 A;  6STD A;  5JBS A;  3CCQ 3;  1PY3 A;  1JNQ A;  1W2B 2;  1VQP 3;  3X40 A;  1HKX A;  3WR2 A;  1BNG A;  4HZB B;  1NJI 4;  2CKF B;  1LOX A;  4O8S A;  1VQ9 3;  4XDV A;  1W01 A;  3T8U A;  2CG0 A;  3FG3 A;  3SOY A;  4AKZ A;  1FGO A;  3DM8 A;  1UCJ A;  5IER A;  3S67 A;  3KSE D;  2KF4 A;  1JZO A;  1YVB I;  2CC3 A;  1IV9 A;  2HMM B;  4KFF A;  1Q40 A;  4R4K A;  3ROB A;  3F8H A;  1IDP A;  1DVD A;  3Q90 A;  1US1 A;  1N5H A;  2GBX B;  3D9R A;  3T8N A;  3WA3 A;  2CFL A;  3EBT A;  3FF2 A;  3EN8 A;  2GXF A;  1IQY A;  3FG1 A;  1B2Z A;  1OPY A;  4FMB A;  3JUO A;  3EB8 A;  5HGR A;  1BRK A;  1LVN A;  1ROA A;  2ML5 A;  1I2F A;  1LNH A;  1MWS A;  3FH1 A;  1Q42 A;  1BAN A;  1M1K 4;  1BUJ A;  2BMO B;  1I2E A;  1YJ9 3;  3MWZ A;  1C54 A;  1BVI A;  1AY7 A;  1WMN A; 
#chains in the Genus database with same CATH homology
 1WMO A;  3MKI A;  4LMI A;  5AEU B;  2BNG A;  4HM8 B;  4CDL A;  3A76 A;  5BVB A;  3CNX A;  3LTB A;  3V92 A;  3LH4 A;  1AV4 A;  1NB3 I;  3PZW A;  3SVA A;  3KSP A;  5DRV A;  4BTW A;  1TFO A;  1TP6 A;  3DGM A;  1ULJ B;  3KE7 A;  3HI7 A;  4WP5 A;  1YGE A;  3CCE 3;  1CEW I;  2C10 A;  4IIA A;  1D6Y A;  3WMD A;  4WYK A;  1O7W B;  2WGQ A;  3UB1 A;  3LTC A;  4EV5 A;  2FGT A;  2W9P A;  1GY6 A;  4MMX B;  1OHP A;  5IG4 A;  1YI2 3;  3S28 A;  3PCS A;  1YJW 3;  1A2K A;  4XB5 A;  3EHC A;  3X42 A;  4FCZ A;  3KZT A;  1O7M B;  3EBY A;  4N6T A;  2XFS A;  1UW1 A;  3NQY A;  1IK3 A;  2Z77 A;  3G4S 3;  2MF7 A;  2FNQ A;  3G8Z A;  4QWT A;  2W03 A;  1K41 A;  1DMM A;  2OTJ 3;  2W56 B;  1FUW A;  5KP3 A;  1BUQ A;  5IEO A;  1IT8 A;  1NU3 A;  3N8B A;  3SX1 A;  3G71 3;  3FZW A;  4BTY A;  3I56 3;  1Q81 4;  4O02 B;  3SXX A;  4N6O B;  1IU7 A;  1QVF 2;  1L5G B;  3Q1C A;  1IT7 A;  2BMQ B;  3JUP A;  3S29 A;  1YHQ 3;  2ML6 A;  4I4K A;  3EE1 A;  3MSO A;  1GS3 A;  3NBR A;  3J7Y d;  3UL6 A;  3PCR A;  5CK6 A;  1D6Z A;  1E3R A;  1MNL A;  1ZO2 A;  3FSD A;  3K9M C;  2UX0 A;  3QK9 A;  1IQ8 A;  3CPW 2;  2P09 A;  5EQL A;  2XSO B;  2CH9 A;  3TDG A;  2B24 B;  2IUK A;  2CFW A;  3CC4 3;  7STD A;  1N9E A;  2CFD A;  4AKY A;  5DRE A;  3CCL 3;  4WHA A;  5G2G A;  3DZL A;  3LT8 A;  5LC6 A;  5IEN A;  2D42 A;  1NB5 I;  3CXC 2;  2CW9 A;  2QIY A;  3G6E 3;  1O7G B;  2M7O A;  3B8L A;  4GB5 A;  3U97 A;  3MG1 A;  3K63 A;  4LZI A;  5IW9 A;  3F7X A;  2CK3 H;  3VGN A;  2GU1 A;  1EKM A;  3CCM 3;  2CFK A;  3G0K A;  5BXQ A;  4XM4 A;  3UL5 A;  4OK0 A;  2W6J H;  1A2V A;  3X3Z A;  2LQV A;  1YIJ 3;  3G16 A;  2RGQ A;  3EF8 A;  2XSH B;  4FMC A;  2XGL A;  3NM7 A;  1EQK A;  3D3L A;  1HU9 A;  1DYU A;  4R1K A;  3GZY B;  3ECF A;  3VF1 A;  5EEO A;  3FF0 A;  1JV2 B;  3FG4 A;  1ASK A;  1YIT 3;  1SQW A;  3V99 A;  1W02 A;  2XRX B;  1ISK A;  3LOY A;  2KRT A;  3RGA A;  4EBG A;  1QJG A;  1UI7 A;  4FMA A;  2WGO A;  3GWR A;  4HM6 B;  1STD A;  2Z7A A;  2ZDJ A;  3GRD A;  4FCM A;  4ORL A;  5CF1 A;  2OCT A;  1C7H A;  3MYT A;  1S5A A;  2INX A;  2STD A;  3BNC A;  3V98 A;  3GZR A;  2OWP A;  3OW2 2;  3JUM A;  1JN5 B;  1IVU A;  2YFL B;  4WFO A;  1KD1 4;  3O8Y A;  4RZM A;  1U5O A;  3UJM A;  5AIF A;  3Q2P A;  2P0M A;  2WOH A;  3JUN A;  1R4C A;  1W7C A;  4MEI A;  1TU5 A;  4KVH A;  3FLJ A;  1VQ4 3;  1JKG B;  3DXO A;  2WO0 A;  4RNZ A;  3EX9 A;  1A67 A;  3KII A;  2XGN A;  4ZM8 A;  2R4I A;  4RNY A;  3DMC A;  3X3X A;  1PFP A;  1W6Y A;  5ELU A;  3RGR A;  3PS8 A;  4LGQ A;  5IG3 A;  1IV7 A;  4N6U A;  1FGM A;  1JB5 A;  1N9J A;  4L7K A;  1K8A 4;  4H3U A;  1OF5 B;  2W56 A;  2Z76 A;  4NHF A;  4TX4 A;  5D81 A;  2CWV A;  1N5P A;  1TFK A;  2P05 A;  1VQK 3;  1VQN 3;  1CYU A;  3MG2 A;  5AI1 A;  4N6N B;  4RBN A;  2Y73 A;  1V74 A;  2K0M A;  3KFQ C;  3EN1 B;  4HVN A;  5AYS C;  3CC7 3;  1OHO A;  3BNB A;  3NUV A;  4XBX A;  3QRD A;  3RDE A;  5IF6 A;  3M8C A;  3PGB A;  2KCD A;  4KFE A;  5AIH A;  1A90 A;  2D1W A;  4HM1 B;  1M9G A;  1QAL A;  3I0Y A;  2JDI H;  3DUK A;  1UUV B;  2KXG A;  1NWW A;  1RKY A;  2YFJ B;  3GAX A;  3S5C A;  1Q7Y 4;  2OTL 3;  1OAC A;  4HM0 B;  2IA7 A;  3HII A;  3KN4 A;  4EYC A;  3KKG A;  3CCV 3;  3F14 A;  1AVL A;  1DVC A;  2W04 A;  3WDG B;  1KC8 4;  1U8C B;  3CU3 A;  5FW5 A;  1IVW A;  1GY5 A;  2ZL8 A;  3CPO A;  3VSY A;  2MC8 A;  3CCJ 3;  4JRF A;  3AMO B;  3NHX A;  1VQ6 3;  3CME 3;  1O7N B;  1M90 4;  1M1X B;  2W2C A;  2RCD A;  3IMA B;  3H51 A;  1S72 3;  1F8N A;  2CFG A;  2O9U X;  3PXM A;  3EQQ B;  3GZB A;  4HJL B;  4KFD A;  5AIG A;  1D6U A;  4OUQ A;  1VQ7 3;  2CWT A;  1CQS A;  1VZZ A;  5AII A;  2CWU A;  2FXT A;  3STD A;  3S27 A;  1KSI A;  5IEP A;  1E3V A;  3I55 3;  1JB2 A;  4N6M A;  1GY7 A;  1TUH A;  2CHC A;  5STD A;  3SLU A;  3FCS B;  1W6C A;  4MMY B;  1DMN A;  3MHE A;  3CCU 3;  3UNL A;  3ALA A;  4J9A A;  4JF8 A;  4IT7 A;  1K73 4;  4X2O A;  1JRQ A;  2SBL A;  2RFR A;  3NXJ A;  3EJV A;  2GBW B;  1OCV A;  1JN5 A;  1RN7 A;  1VQ8 3;  2BHM A;  4LEH A;  1AR0 A;  1FGQ A;  1SPU A;  2GU3 A;  2OQE A;  1STF I;  3BND A;  4FR9 A;  3IPT A;  3JVC A;  1CYV A;  4K1V A;  1W5Z A;  1W4N A;  3K5T A;  1KWI A;  5IG0 A;  2LYX A;  1RRL A;  2RSX A;  3LT9 A;  4K61 A;  4N6L A;  1FGT A;  5D83 A;  1GYB A;  4HM4 B;  5JPU A;  1N8Q A;  1RRH A;  1ULI B;  3EC9 A;  3NX0 A;  4HM7 B;  4R9K A;  2Z6B A;  1DMQ A;  5I97 A;  1J2B A;  3GZX B;  1OF5 A;  2GEY A;  2PZV A;  3E99 A;  3MPH A;  1QAF A;  3H3H A;  3FKA A;  3F7S A;  1N8R 4;  1JB4 A;  1UUW B;  3K7C A;  3F40 A;  2XEP A;  1GD3 A;  3WOE B;  3CCR 3;  5CLK A;  1OGZ A;  3IJE B;  2L4V A;  3NM2 A;  4R80 A;  3SOA A;  4H61 A;  5IG5 A;  1SIH A;  1NDO B;  1PU4 A;  3NQZ A;  4X2H A;  3LXU X;  1VQO 3;  4XBY A;  3L0R A;  3HIG A;  3NV0 B;  5CF2 A;  4HBR A;  1FGR A;  4HZ9 B;  1SJW A;  3OXA A;  4N3V A;  5FGO A;  2BMR B;  1OUN A;  1YJN 3;  3K0Z A;  5CXO A;  2QEX 3;  1O7H B;  2OQE C;  1QAK A;  2F99 A;  3B4P A;  4O2H A;  2W9Q A;  5AEW B;  2XF3 A;  2QA4 3;  4EXR A;  3AMO A;  2Y74 A;  1W6G A;  4O3V A;  1ZX2 A;  1OGX A;  1EA2 A;  3B7C A;  1Y4K A;  4K90 B;  1VQM 3;  2W0Q A;  1Q40 B;  1ROV A;  3PYJ A;  3BLZ A;  2GEX A;  2BT3 A;  2BO9 B;  3T0U A;  1GD4 A;  1Q86 4;  1KQS 2;  3LTA A;  4R9L A;  4LSO A;  4EV2 A;  3CMA 3;  4FCJ A;  1QMA A;  1JJ2 2;  1VQL 3;  3WA2 X;  1Q82 4;  3OWU A;  4MMZ B;  8CHO A;  4N6V 0;  2K54 A;  4XDW A;  5A0O B;  2F86 B;  4HM5 B;  3N9H A;  2B1X B;  3OX9 A;  5AYR B;  1T5Y A;  1WMP A;  2E2T A;  3CCS 3;  3F9S A;  1VQ5 3;  1SII A;  1NO3 A;  4G1M B;  1IVX A;  1W2Z A;  2XFT A;  4FMD A;  4NRE A;  3NBJ A;  4MJD A;  2HML B;  2YX9 A;  3LTD A;  3OWS A;  2OOV A;  4STD A;  2CG1 A;  5KP1 A;  1LXE A;  1UI8 A;  2CIU A;  1IVV A;  1Z1S A;  2IMJ A;  3DY5 A;  3WOF B;  4PEJ A;  1K9M 4;  1EG9 B;  1W00 A;  2I9W A;  2O3O A;  1OH0 A;  4WYK B;  2C11 A;  2HMJ B;  1G96 A;  4OVM A;  4K1U A;  4Q53 A;  2E2U A;  1K28 A;  1OHS A;  3BNE A;  5ELJ A;  3CC2 3;  5EVH A;  2A15 A;  3JUQ A;  2HMN B;  4HKV B;  3HZP A;  1IQX A;  3X3Y A;  5JPP A;  3FGY A;  1AVK A;  4IPB A;  4WWU C;  1FA3 A;  1E97 A;  3B4O A;  5LC7 A;  3WOD G;  4AEQ A;  3SED A;  2F98 A;  4BTX A;  2E2V A;  3LZA A;  4HYZ A;  2XR8 B;  3U1W A;  1WQL B;  5KP4 A;  3BB9 A;  2HMK B;  3CD6 3;  3LML A;  1WTH A;  2PNC A;  2V1L A;  2HMO B;  5D82 A;  4KZ1 A;  4HM2 B;  2JQ5 A;  4CCV A;  3N54 B;  1TIJ A;  2P0X A;  2QGU A;  3NBB A;  4XBT A;  1WNH A;  3HX8 A;  4J8T A;  3DGL A;  3LYG A;  2IUJ A;  3DGN A;  2XH9 A;  5TGN A;  1JKG A;  2P38 A;  2YFI B;  3F8X A;  4HM3 B;  3X41 A;  2WOF A;  1MOL A;  4L8O A;  3OWY A;  3CNM A;  3NV0 A;  3DGO A;  1RJO A;  4L8P A;  4GL6 A;  3HK4 A;  2OOV C;  3OV4 A;  3ER7 A;  1QVG 2;  2Q07 A;  1O7P B;  4U13 A;  4EC6 A;  3MG3 A;  6STD A;  5JBS A;  3CCQ 3;  1JNQ A;  1W2B 2;  1VQP 3;  3X40 A;  1HKX A;  1NJI 4;  4HZB B;  2CKF B;  1LOX A;  4O8S A;  1VQ9 3;  4XDV A;  1W01 A;  3T8U A;  2CG0 A;  3FG3 A;  3SOY A;  4AKZ A;  1FGO A;  3DM8 A;  5IER A;  3S67 A;  3KSE D;  1YVB I;  2CC3 A;  1IV9 A;  2HMM B;  4KFF A;  1Q40 A;  4R4K A;  3ROB A;  3F8H A;  1IDP A;  1DVD A;  3Q90 A;  1US1 A;  1N5H A;  2GBX B;  3D9R A;  3T8N A;  3WA3 A;  2CFL A;  3EBT A;  3FF2 A;  3EN8 A;  2GXF A;  1IQY A;  3FG1 A;  1OPY A;  4FMB A;  3JUO A;  3EB8 A;  5HGR A;  1LVN A;  1ROA A;  2ML5 A;  3FH1 A;  1Q42 A;  1M1K 4;  2BMO B;  1YJ9 3;  3MWZ A;  1LNH A;  1WMN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...