5DRVA

Crystal structure of the g3bp2 ntf2-like domain in complex with a peptide
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
141
structure length
131
Chain Sequence
SHMVMEKPSPLLVGREFVRQYYTLLNKAPEYLHRFYGRNSSYVHGGVYGQNDIHHKVLSLNFSECHTKIRHVDAHATLSDGVVVQVMGLLSNSGQPERKFMQTFVLAPEGSVPNKFYVHNDMFRYEDEVFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras GTPase-activating protein-binding protein 2
publication title Crystal structure of the G3BP2 NTF2-like domain in complex with a canonical FGDF motif peptide.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 32
structure length 131
sequence length 141
ec nomenclature
pdb deposition date 2015-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5drvA00
3EF8A 5FW5A 3DMCA 5G2GA 7STDA 4LMIA 3FZWA 1C7HA 4GB5A 5KP1A 3MYTA 2UX0A 3LZAA 1QJGA 2GBWB 3DM8A 1HKXA 2OWPA 2XSOB 1W6YA 2QIYA 4HM5B 2HMLB 1JB5A 3MSOA 4XM4A 3F9SA 4WYKA 1NWWA 1UUWB 3LYGA 4WWUC 3UJMA 1OH0A 4XBXA 6STDA 1OCVA 3F14A 2F99A 3H51A 3OV4A 3EC9A 1TP6A 3G16A 1OF5B 5AIHA 2XRXB 4R9LA 4XBTA 4U13A 1U5OA 3FGYA 2GBXB 3VSYA 4J8TA 3SOAA 2BMRB 5CXOA 4HM7B 1OUNA 2HMOB 3MKIA 1Q40A 3KZTA 5AI1A 3OX9A 1WQLB 1DMQA 3CU3A 2GEXA 1K41A 3GRDA 2HMNB 2BMOB 1W01A 1E97A 3GZRA 5AEWB 4FCJA 3DXOA 1O7MB 4HM3B 4RZMA 1JKGB 4XBYA 3H3HA 3ER7A 4HM4B 3F40A 5AIFA 2R4IA 2XSHB 5JPPA 3HX8A 4J9AA 5IG5A 1O7NB 3CPOA 3DZLA 3B7CA 3FF2A 1SJWA 1OGZA 5HGRA 2BNGA 3ECFA 3EQQB 3FLJA 3HZPA 1S5AA 4HM2B 1OHPA 3OWUA 3FH1A 3EN8A 1BUQA 3F7SA 1JN5B 4HM1B 2K54A 1O7WB 1ULJB 3M8CA 3EBYA 3NHXA 4ORLA 2I9WA 4I4KA 1JB2A 3EJVA 5DRVA 1O7GB 5IG0A 4N3VA 4FCMA 4R1KA 1ZX2A 5CF2A 5IENA 3MG1A 2IMJA 3KKGA 4HJLB 2RFRA 1AR0A 1OPYA 2PZVA 3HK4A 2YFIB 3NBRA 3I0YA 2Z7AA 4HVNA 1E3VA 3EHCA 3S5CA 4XB5A 4OVMA 3GWRA 5IG3A 3BB9A 5D83A 3NV0B 2HMMB 3DUKA 4L7KA 3FF0A 4LEHA 2INXA 1QMAA 4XDWA 5STDA 3G8ZA 3KE7A 3T8UA 2STDA 2XR8B 1NU3A 4L8PA 4HKVB 1JKGA 3E99A 3B4PA 3NM2A 3Q90A 1O7HB 1ISKA 3SEDA 1Z1SA 3K0ZA 1GY7A 3G0KA 3OWSA 5IEPA 2QGUA 4OUQA 4CDLA 4IIAA 2Z77A 3RGRA 4PEJA 5BXQA 3BLZA 5DREA 3NUVA 1TUHA 2JQ5A 4X2OA 1GY6A 3JUPA 3JUQA 1NDOB 1DMNA 1EG9B 3OXAA 3NXJA 3MG2A 1STDA 2GEYA 4HM6B 5IF6A 1JN5A 4MJDA 1IDPA 5IG4A 4X2HA 5AIIA 4HZBB 1ASKA 5IERA 1ULIB 1O7PB 2BMQB 3MG3A 3F8XA 5CLKA 5KP4A 2F98A 3JUOA 3SOYA 2HMJB 1GS3A 1GY5A 1ZO2A 1OHSA 5D82A 4HM0B 1GYBA 4WYKB 5CF1A 1OF5A 2F86B 3B8LA 3D9RA 3B4OA 2CHCA 4H3UA 2A15A 3STDA 5D81A 5KP3A 1CQSA 1E3RA 3NV0A 5IEOA 3K7CA 3A76A 4K1UA 3FSDA 1Q42A 4KVHA 3ROBA 1OGXA 3VGNA 1VZZA 3GZXB 1JB4A 3CNMA 4HZ9B 3KSPA 1OHOA 1W00A 4L8OA 3EX9A 1Q40B 3IPTA 4R9KA 4K1VA 3FKAA 1A2KA 2W2CA 2RGQA 2GXFA 3OWYA 2HMKB 3F7XA 5CK6A 4HM8B 3RGAA 3GZBA 2YFJB 3JUMA 5JPUA 4XDVA 5EVHA 2RCDA 3JUNA 2B1XB 8CHOA 4LGQA 2YFLB 3UNLA 5TGNA 1DMMA 3EBTA 1W02A 3MHEA 3WMDA 3GZYB 4WP5A 2B24B 3EN1B 5BVBA 3T8NA 5AEUB 4Q53A 4STDA 2CKFB 2Z76A 3F8HA 1UUVB 3CNXA 1EA2A 5AIGA
chains in the Genus database with same CATH superfamily
3EF8A 4J5KA 5FW5A 3X3ZA 2Q07A 2BU4A 3DMCA 2AAEA 3S28A 4N6NB 4K61A 5G2GA 1RGGA 7STDA 1RN4A 4LMIA 1RHLA 3FZWA 1RCLA 3X40A 3SVAA 1BNGA 1IVVA 3GSPA 3RDEA 1C7HA 4GB5A 5KP1A 3KSED 3MYTA 1GD3A 2UX0A 1GSPA 2CFKA 3LZAA 3CPW2 1QJGA 5G1LA 3V98A 3CCU3 2GBWB 2ML5A 3DM8A 1HKXA 3DGYA 2OWPA 1VQK3 4DKIA 4EBGA 2XSOB 1IVXA 1FGTA 1FA3A 1W6YA 2QIYA 5AYSC 1KSIA 1GOYA 1PY3A 4HM5B 2HMLB 1FUWA 1JB5A 2HOHA 1A2PA 2CWUA 2V1LA 4HAAA 3MSOA 3KN4A 1LXEA 4XM4A 1C54A 1CH0A 3F9SA 4WYKA 1NWWA 1PYLA 3PGBA 4AKYA 1UUWB 3S27A 4GHOA 5JBSA 2W56A 4AEQA 3LYGA 3K63A 1GOVA 1IYYA 1BIRA 2KXGA 2KRTA 4WWUC 2C10A 1OH0A 3UJMA 3LMLA 2UUGC 4XBXA 6STDA 1W4NA 2CFGA 2E2VA 3FCSB 1OCVA 3F14A 2F99A 2OOVA 1TU5A 1NJI4 1T2HA 4RNZA 1IVUA 1RSNA 1X1UA 4IPBA 4LSOA 3H51A 3NQYA 4EW5A 3CD63 1TIJA 4K90B 3OV4A 1RNTA 3EC9A 3WODG 1BAOA 4NREA 1ZGXA 3NBBA 1K8A4 3OW22 1TP6A 2P0XA 2WO0A 3G16A 4FR9A 1LOYA 2GU3A 1LOXA 2XH9A 3S67A 1BUJA 1I3IA 1OF5B 5AIHA 2XRXB 2AADA 4R9LA 4XBTA 4U13A 2XF3A 2CW9A 1NO3A 1U5OA 3FGYA 3A5EA 1YI23 2CWTA 2GBXB 3VSYA 1STFI 4J8TA 3BNCA 1RRLA 3SOAA 2BMRB 3AGOA 1RMSA 4G1MB 3N9HA 1RTUA 4CJNA 5CXOA 1D6ZA 4HM7B 1OUNA 1AVLA 3FG3A 1DVDA 2HMOB 3MKIA 1Q40A 1Q814 9RNTA 1EEJA 3KZTA 1YIT3 1IT7A 5AI1A 1TRQA 1M9GA 1IQXA 2W9QA 3OX9A 1TTOA 1SIHA 2GU1A 3AMOB 3QK9A 1WQLB 4BIRA 1BSEA 2OTJ3 1M1K4 1DMQA 3I563 1B2UA 5ELUA 1KC84 1YGWA 1DETA 3CU3A 1QVG2 2GEXA 3FG1A 2ZDJA 1K41A 1ROVA 1UDII 3DY5A 1WMNA 3GRDA 2HMNB 2BMOB 1W01A 1GMPA 1E97A 1VQ63 3GZRA 5AEWB 4FCJA 2P38A 2E2TA 2GSPA 2M7OA 1BOXA 1FUSA 1O7MB 3DXOA 4HM3B 1JV2B 1TJDA 5FGOA 4RZMA 1IK3A 3CC23 1JKGB 4XBYA 3H3HA 3UB1A 2FNQA 3ER7A 4HM4B 2IA7A 3F40A 3PCSA 1VQ93 5AIFA 2P09A 2KF4A 3FG4A 3Q1CA 1GOUA 2R4IA 3S29A 2XSHB 5JPPA 5HOHA 3HX8A 4J9AA 4FCZA 5IG5A 1R4CA 1BRKA 1RN7A 2BHMA 3SXXA 1O7NB 1TFOA 1FGOA 2SBLA 3ZFZA 1MNLA 2P0MA 1PFPA 3Q3FA 1BRGA 3CPOA 1LQMB 2JDIH 3N54B 2F56A 3DZLA 3B7CA 3D79A 1K28A 3FF2A 1SJWA 5ELJA 1RN1A 1OGZA 3HIIA 3CCJ3 4O02B 1YIJ3 2CC3A 1UCLA 2BNGA 5HGRA 3U1WA 3URPA 1Q7HA 1N5PA 3ECFA 1BRIA 1AY7A 3EQQB 1B20A 3FLJA 1RRHA 3IJEB 3HZPA 1QAFA 1X1XA 2F4YA 1RJOA 1B27A 1S5AA 4HM2B 1OHPA 4O8SA 3OWUA 2XGNA 4GL6A 3SYUA 3LTDA 3WHOA 1B2SA 1I2GA 3V99A 3HOHA 3FH1A 1DYUA 3EN8A 1CYVA 3DH2A 1DE3A 3BIRA 1BUQA 3F7SA 1JN5B 4HM1B 1T3BA 1V58A 2K54A 4FMCA 4O2HA 4RNYA 3ALAA 3PZWA 1O7WB 1ULJB 3CMA3 2D1WA 2F5MA 3M8CA 1MOLA 1FZUA 1QAKA 1BNFA 3EBYA 1GMQA 1N5HA 3NHXA 2KF3A 1YHQ3 1D6UA 1UUGB 2I9WA 4ORLA 4I4KA 3K5TA 5LC7A 3GAXA 3WOFB 1JB2A 4MMZB 2XGLA 3BNBA 1AVKA 3AHWA 3EJVA 4BTWA 1B21A 1B3SA 5DRVA 4EYCA 2K3DA 1O7GB 5IG0A 2J8XB 4N3VA 4FCMA 4R1KA 1BNIA 2H0GA 1YJ93 3U97A 1A67A 1W2B2 1ZX2A 5CF2A 2KF6A 1JJ22 2RNTA 5IENA 3G4S3 3MG1A 2IMJA 1UI7A 3O8YA 3KKGA 3SX1A 4HJLB 1G96A 2RFRA 2YX9A 1AR0A 4N6UA 3N8BA 5M1AA 1OPYA 1UCKA 3AHSA 1F8NA 3UL5A 1DVCA 1LOVA 2Y74A 5BU4A 3CCS3 2WOHA 2PZVA 3HK4A 3MWZA 3X42A 2YFIB 3NBRA 3I0YA 1ROAA 2Z7AA 3EB8A 4HVNA 3G713 1E3VA 3KCHA 3K9MC 5IW9A 2W56B 3EHCA 3LTAA 1JZDA 3HIGA 1VQL3 5M18A 1SQWA 4RNTA 3S5CA 4XB5A 3AGNA 1W6GA 4N6TA 4OVMA 2LQVA 2IY2A 3J7Yd 3GWRA 2PNCA 1YJW3 1V74A 5IG3A 1N8R4 3BB9A 2W9PA 2H0IA 3NV0B 5D83A 4J5GA 3WR2A 3PS8A 1A90A 4BL3A 4EV5A 3HI7A 4JF8A 2HMMB 1RKYA 3DUKA 1JBTA 3X3XA 1IV7A 1I70A 1V57A 1W5ZA 4L7KA 3FF0A 1B2MA 1LNIA 2OCTA 3AMOA 4LEHA 2INXA 2XFTA 1J2BA 1QMAA 4TX4A 2K0MA 3LXUX 4MMYB 4XDWA 5STDA 1Q9EA 3G8ZA 1GD4A 3CXC2 1KD14 1Y4KA 2OOVC 3KE7A 1I3FA 3T8UA 2STDA 4ILFA 4HOHA 1KQS2 4OK0A 2XR8B 3CCV3 1NU3A 1R4YA 1FYSA 4L8PA 1PU4A 2QA43 4HKVB 2CFLA 1JKGA 1IU7A 1WMPA 3B4PA 3E99A 3NM2A 3Q2PA 3Q90A 1O7HB 3WOEB 3SEDA 1ISKA 2CWVA 1BRSA 1G02A 1RNBA 2O3OA 2OQEC 2ML6A 3LTBA 1Z1SA 2ZHXB 1GY7A 3K0ZA 3G0KA 3OWSA 1IQYA 1VQ53 2CX1A 5IEPA 3CME3 1RGEA 2QGUA 1BNSA 4OUQA 3CC73 4CDLA 3D4AA 4IIAA 4AKZA 5RNTA 1CYUA 3BU4A 7RNTA 2Z77A 3RGRA 4PEJA 1VQ73 2SARA 5BXQA 3RNTA 5GSPA 1IV9A 1IT8A 3BLZA 2MF7A 1RGAA 3NUVA 1I2EA 4IT7A 5DREA 1JRQA 1IVWA 2W0QA 1AV4A 4NHFA 1TUHA 2JQ5A 4H61A 4X2OA 1CEWI 3KIIA 1GY6A 4FMDA 4LYLB 2W6JH 2R41A 3QRDA 3CCL3 1G0TA 5EQLA 2LYXA 4R80A 1VQM3 3JUPA 1N8QA 1EKMA 2Y73A 1NDOB 1WNHA 3JUQA 4RBNA 5A0OB 1IQ8A 1NB3I 1DMNA 1EG9B 4MMXB 1MWSA 2F5WA 3OXAA 3WDGB 3NXJA 3V92A 3CCR3 1BSAA 1M1XB 3MG2A 1STDA 2GEYA 1US1A 4HM6B 5IF6A 4BL2A 8RNTA 1Q864 3ZG0A 3D3LA 1JN5A 3LTCA 3PXMA 1IDPA 1ZS7A 4MJDA 5IG4A 4X2HA 2RBIA 1K734 4LZIA 3I553 5AIIA 2CFDA 4HZBB 5I97A 2QEX3 1T2IA 1FW7A 1I0VA 1ASKA 5M19A 2CX0A 5IERA 1A2VA 1BRHA 1LQGC 1ULIB 1LVNA 1O7PB 1MWUA 2BMQB 2CIUA 2IYJA 1YNVX 2C11A 2W03A 1W2ZA 3MG3A 2BT3A 1FUTA 4BTXA 3F8XA 2KF5A 4EC6A 1Q7Y4 1I0XA 5CLKA 4EV2A 5KP4A 2F98A 3VF1A 3BNDA 3WA3A 3JUOA 4MEIA 3SOYA 2XEPA 3CCQ3 1RGFA 2HMJB 1T5YA 1GS3A 4KFEA 2CH9A 1GY5A 1W7CA 2XFSA 4FMAA 1ZO2A 1OHSA 3D5GA 4HM0B 1GYBA 5D82A 1SIIA 1RGHA 1JBSA 1D6YA 2WOFA 2CK3H 1FGMA 4KFFA 1JNQA 5EEOA 3NX0A 4WYKB 3DGMA 1M904 4CPKA 1HYFA 3CC43 3CCM3 5CF1A 1OF5A 1KWIA 2CG0A 2F86B 1UCJA 3B8LA 4NPBA 1YVSA 1TFKA 1B2XA 1YGEA 3D9RA 3B4OA 2CHCA 4N6OB 4H3UA 1MGRA 1BNJA 2A15A 3LT8A 1HZ1A 2MC8A 3STDA 2ZA4A 5D81A 2C4BA 1VQP3 2D42A 4WHAA 4WFOA 1CQSA 5KP3A 1E3RA 2H0HA 4KZ1A 1BSDA 1L5GB 3X3YA 5BIRA 3NV0A 3LH4A 3MPHA 2IUJA 4EXRA 1RGLA 3IMAB 5IEOA 3K7CA 1MWRA 3NQZA 2UGIA 1BU4A 1BRJA 1FGRA 3A76A 1RCKA 4K1UA 1NNVA 3SLUA 4BU4A 3FSDA 1Q42A 2CFWA 2OQEA 4KVHA 4KFDA 1W6CA 2KAAA 3ROBA 1SARA 4HBRA 1OGXA 1RDSA 2L1SA 3VGNA 1VZZA 3WA2X 1YJN3 3GZXB 1JB4A 3CNMA 1BSCA 1VQQA 3DGNA 4N6V0 2E2UA 1RGKA 4HZ9B 1U8CB 1X1YA 1EUIC 3KSPA 1OHOA 1YVBI 1AQZA 1WTHA 3PYJA 4ZM8A 1Q824 1W00A 1FGQA 1LOWA 4L8OA 1UW1A 3EX9A 5LC6A 1MGWA 4BTYA 2KCDA 1Q40B 3DGLA 3IPTA 4CCVA 4R9KA 4K1VA 1TRPA 3FKAA 3JVCA 4FMBA 1JBRA 1I8VA 1BSBA 1LNHA 1A2KA 4I5QA 3UL6A 1VQ83 2W2CA 2RGQA 1N9EA 1VQ43 2GXFA 1BNEA 3T0UA 3OWYA 2Z6BA 2BO9B 1MWTA 3NBJA 1EQKA 1I2FA 2HMKB 3F7XA 2OTL3 5CK6A 1QVF2 3L0RA 1K9M4 1VQO3 4HM8B 2FXTA 1OACA 3D5IA 3RGAA 2W04A 3CCE3 1RGCA 3GZBA 2YFJB 1NB5I 1VQN3 3JUMA 1BVIA 1UI8A 5JPUA 4XDVA 5EVHA 2RCDA 3JUNA 4QWTA 1BGSA 1GMRA 2ZL8A 2B1XB 1RLSA 4JRFA 8CHOA 4LGQA 5G1KA 1B2ZA 2YFLB 3LOYA 3PCRA 1N9JA 3UNLA 4R4KA 2WGQA 5TGNA 7GSPA 1DMMA 3EE1A 2WGOA 1QALA 2L4VA 4O3VA 4HYZA 3EBTA 1W02A 3MHEA 3NM7A 3LT9A 2CG1A 2O9UX 2FGTA 3BNEA 4N6MA 1LRAA 3WMDA 2BIRA 1UGHI 3GZYB 4GSPA 2B24B 4WP5A 4N6LA 4KT3B 3EN1B 5BVBA 3TDGA 3T8NA 3ZG5A 1UGIA 5AEUB 1S723 5AYRB 4Q53A 1WMOA 2IUKA 4STDA 6RNTA 3G6E3 2CKFB 2Z76A 1BANA 6GSPA 1UCIA 1SPUA 2RSXA 3F8HA 3X41A 1UUVB 3CNXA 1JZOA 1EA2A 1X1WA 3DGOA 5AIGA 1HU9A 1BNRA 3KFQC 2P05A 1BRNL
chains in the Genus database with same CATH topology
3EF8A 5FW5A 3X3ZA 2Q07A 3DMCA 3S28A 4N6NB 4K61A 5G2GA 7STDA 4LMIA 3FZWA 3X40A 3SVAA 1IVVA 3RDEA 1C7HA 4GB5A 5KP1A 3KSED 3MYTA 1GD3A 2UX0A 2CFKA 3LZAA 3CPW2 1QJGA 3V98A 3CCU3 2GBWB 2ML5A 3DM8A 1HKXA 1VQK3 2OWPA 4EBGA 2XSOB 1IVXA 1FGTA 1FA3A 1W6YA 2QIYA 5AYSC 1KSIA 4HM5B 2HMLB 1FUWA 1JB5A 2CWUA 2V1LA 3MSOA 3KN4A 1LXEA 4XM4A 3F9SA 4WYKA 1NWWA 3PGBA 4AKYA 1UUWB 3S27A 5JBSA 2W56A 4AEQA 3LYGA 3K63A 2KXGA 2KRTA 4WWUC 2C10A 1OH0A 3UJMA 3LMLA 4XBXA 6STDA 1W4NA 2CFGA 2E2VA 3FCSB 1OCVA 3F14A 2F99A 2OOVA 1TU5A 1NJI4 4RNZA 1IVUA 4IPBA 4LSOA 3H51A 3NQYA 3CD63 1TIJA 4K90B 3OV4A 3EC9A 3WODG 4NREA 3NBBA 1K8A4 3OW22 1TP6A 2P0XA 2WO0A 3G16A 4FR9A 2GU3A 3S67A 1LOXA 2XH9A 1OF5B 5AIHA 2XRXB 4R9LA 4XBTA 4U13A 2XF3A 2CW9A 1NO3A 1U5OA 3FGYA 1YI23 2CWTA 2GBXB 3VSYA 1STFI 4J8TA 3BNCA 1RRLA 3SOAA 2BMRB 4G1MB 3N9HA 5CXOA 1D6ZA 4HM7B 1OUNA 1AVLA 3FG3A 1DVDA 2HMOB 3MKIA 1Q40A 1Q814 3KZTA 1YIT3 1IT7A 5AI1A 1M9GA 1IQXA 2W9QA 3OX9A 3AMOB 1SIHA 2GU1A 3QK9A 1WQLB 2OTJ3 1M1K4 1DMQA 3I563 5ELUA 1KC84 1QVG2 3CU3A 2GEXA 3FG1A 2ZDJA 1K41A 1ROVA 3DY5A 1WMNA 3GRDA 2HMNB 2BMOB 1W01A 1E97A 1VQ63 3GZRA 5AEWB 4FCJA 2P38A 2E2TA 2M7OA 3DXOA 1O7MB 4HM3B 1JV2B 5FGOA 4RZMA 1IK3A 3CC23 1JKGB 4XBYA 3H3HA 3UB1A 2FNQA 3ER7A 4HM4B 2IA7A 3F40A 3PCSA 1VQ93 5AIFA 2P09A 3FG4A 3Q1CA 2R4IA 3S29A 2XSHB 5JPPA 3HX8A 4J9AA 4FCZA 5IG5A 1R4CA 2BHMA 1RN7A 3SXXA 1O7NB 1TFOA 1FGOA 2SBLA 1MNLA 2P0MA 1PFPA 3CPOA 2JDIH 3N54B 3DZLA 3B7CA 1K28A 3FF2A 1SJWA 5ELJA 1OGZA 3HIIA 3CCJ3 4O02B 1YIJ3 2CC3A 5HGRA 2BNGA 3U1WA 1N5PA 3ECFA 3EQQB 3FLJA 1RRHA 3IJEB 3HZPA 1QAFA 1RJOA 1S5AA 4HM2B 1OHPA 4O8SA 3OWUA 2XGNA 4GL6A 3LTDA 3V99A 3FH1A 1DYUA 3EN8A 1CYVA 1BUQA 3F7SA 1JN5B 4HM1B 4RNYA 2K54A 4O2HA 4FMCA 3ALAA 3PZWA 1O7WB 1ULJB 3CMA3 2D1WA 3M8CA 1MOLA 1QAKA 3EBYA 3NHXA 1N5HA 1YHQ3 1D6UA 4ORLA 2I9WA 4I4KA 3K5TA 5LC7A 3GAXA 3WOFB 1JB2A 4MMZB 2XGLA 3BNBA 1AVKA 4BTWA 3EJVA 5DRVA 4EYCA 1O7GB 5IG0A 4N3VA 4FCMA 4R1KA 1YJ93 3U97A 1A67A 1W2B2 1ZX2A 5CF2A 1JJ22 5IENA 3G4S3 3MG1A 2IMJA 1UI7A 3O8YA 3KKGA 3SX1A 4HJLB 1G96A 2RFRA 2YX9A 1AR0A 4N6UA 3N8BA 1OPYA 1F8NA 3UL5A 1DVCA 2Y74A 3CCS3 2WOHA 2PZVA 3HK4A 3MWZA 3X42A 2YFIB 3NBRA 3I0YA 1ROAA 2Z7AA 3EB8A 4HVNA 3G713 1E3VA 3K9MC 5IW9A 2W56B 3EHCA 3LTAA 3HIGA 1VQL3 1SQWA 3S5CA 4XB5A 1W6GA 4N6TA 4OVMA 2LQVA 3J7Yd 3GWRA 2PNCA 1YJW3 1V74A 5IG3A 1N8R4 3BB9A 2W9PA 5D83A 3NV0B 1A90A 3PS8A 4EV5A 3HI7A 4JF8A 2HMMB 1RKYA 3DUKA 3X3XA 1IV7A 1W5ZA 4L7KA 3FF0A 2OCTA 3AMOA 4LEHA 2INXA 2XFTA 1J2BA 1QMAA 4TX4A 2K0MA 3LXUX 4MMYB 4XDWA 5STDA 3G8ZA 1GD4A 3CXC2 1KD14 1Y4KA 2OOVC 3KE7A 3T8UA 2STDA 1KQS2 4OK0A 2XR8B 3CCV3 1NU3A 2QA43 4L8PA 1PU4A 4HKVB 2CFLA 1JKGA 1IU7A 1WMPA 3B4PA 3E99A 3NM2A 3Q2PA 3Q90A 1O7HB 3WOEB 3SEDA 1ISKA 2CWVA 2O3OA 2OQEC 2ML6A 3LTBA 1Z1SA 3K0ZA 1GY7A 3G0KA 3OWSA 1IQYA 1VQ53 5IEPA 3CME3 2QGUA 4OUQA 3CC73 4CDLA 4IIAA 4AKZA 1CYUA 2Z77A 3RGRA 4PEJA 1VQ73 5BXQA 1IV9A 1IT8A 3BLZA 2MF7A 3NUVA 4IT7A 5DREA 1JRQA 1IVWA 2W0QA 1AV4A 4NHFA 1TUHA 2JQ5A 4H61A 4X2OA 1CEWI 3KIIA 1GY6A 4FMDA 2W6JH 3QRDA 3CCL3 5EQLA 2LYXA 4R80A 1VQM3 3JUPA 1N8QA 1EKMA 2Y73A 1NDOB 1WNHA 3JUQA 4RBNA 5A0OB 1IQ8A 1NB3I 1DMNA 1EG9B 4MMXB 3OXAA 3WDGB 3NXJA 3V92A 3CCR3 1M1XB 3MG2A 1STDA 2GEYA 1US1A 4HM6B 5IF6A 1Q864 3D3LA 1JN5A 3LTCA 3PXMA 1IDPA 4MJDA 5IG4A 4X2HA 1K734 4LZIA 3I553 5AIIA 2CFDA 4HZBB 5I97A 2QEX3 1ASKA 5IERA 1A2VA 1ULIB 1LVNA 1O7PB 2BMQB 2CIUA 2C11A 2W03A 1W2ZA 3MG3A 2BT3A 4BTXA 3F8XA 4EC6A 1Q7Y4 5CLKA 4EV2A 5KP4A 2F98A 3VF1A 3BNDA 3WA3A 3JUOA 4MEIA 3SOYA 2XEPA 3CCQ3 2HMJB 1T5YA 1GS3A 4KFEA 2CH9A 1GY5A 1W7CA 2XFSA 4FMAA 1ZO2A 1OHSA 4HM0B 5D82A 1GYBA 1SIIA 1D6YA 2WOFA 2CK3H 1FGMA 4KFFA 1JNQA 5EEOA 3NX0A 4WYKB 3DGMA 1M904 3CC43 3CCM3 5CF1A 1OF5A 1KWIA 2CG0A 2F86B 3B8LA 1TFKA 1YGEA 3D9RA 3B4OA 2CHCA 4N6OB 4H3UA 2A15A 3LT8A 2MC8A 3STDA 5D81A 1VQP3 2D42A 4WHAA 4WFOA 1CQSA 5KP3A 1E3RA 4KZ1A 1L5GB 3X3YA 3NV0A 3LH4A 3MPHA 2IUJA 4EXRA 3IMAB 5IEOA 3K7CA 3NQZA 1FGRA 3A76A 3SLUA 4K1UA 3FSDA 1Q42A 2CFWA 2OQEA 4KVHA 4KFDA 1W6CA 3ROBA 4HBRA 1OGXA 3VGNA 3WA2X 1YJN3 1VZZA 3GZXB 1JB4A 3CNMA 3DGNA 4N6V0 2E2UA 4HZ9B 1U8CB 3KSPA 1OHOA 1YVBI 1WTHA 3PYJA 4ZM8A 1Q824 1W00A 1FGQA 4L8OA 1UW1A 3EX9A 5LC6A 4BTYA 2KCDA 1Q40B 3DGLA 3IPTA 4CCVA 4R9KA 4K1VA 3JVCA 3FKAA 4FMBA 1LNHA 1A2KA 3UL6A 1VQ83 2W2CA 2RGQA 1N9EA 1VQ43 2GXFA 3T0UA 3OWYA 2Z6BA 2BO9B 3NBJA 1EQKA 2HMKB 3F7XA 2OTL3 5CK6A 1QVF2 3L0RA 1K9M4 1VQO3 4HM8B 2FXTA 1OACA 3RGAA 2W04A 3CCE3 3GZBA 2YFJB 1NB5I 1VQN3 3JUMA 1UI8A 5JPUA 4XDVA 5EVHA 2RCDA 3JUNA 4QWTA 2ZL8A 2B1XB 4JRFA 8CHOA 4LGQA 2YFLB 3PCRA 3LOYA 1N9JA 3UNLA 4R4KA 2WGQA 5TGNA 1DMMA 3EE1A 2WGOA 1QALA 2L4VA 4O3VA 4HYZA 3EBTA 1W02A 3MHEA 3NM7A 3LT9A 2CG1A 2O9UX 2FGTA 3BNEA 4N6MA 3WMDA 3GZYB 4WP5A 2B24B 4N6LA 3EN1B 5BVBA 3TDGA 3T8NA 1S723 5AEUB 5AYRB 4Q53A 1WMOA 2IUKA 4STDA 3G6E3 2CKFB 2Z76A 1SPUA 2RSXA 3F8HA 3X41A 1UUVB 3CNXA 1EA2A 3DGOA 5AIGA 1HU9A 3KFQC 2P05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EF8 A;  5FW5 A;  3DMC A;  5G2G A;  7STD A;  4LMI A;  3FZW A;  1C7H A;  4GB5 A;  5KP1 A;  3MYT A;  2UX0 A;  3LZA A;  1QJG A;  2GBW B;  3DM8 A;  1HKX A;  2OWP A;  2XSO B;  1W6Y A;  2QIY A;  4HM5 B;  2HML B;  1JB5 A;  3MSO A;  4XM4 A;  3F9S A;  4WYK A;  1NWW A;  1UUW B;  3LYG A;  4WWU C;  3UJM A;  1OH0 A;  4XBX A;  6STD A;  1OCV A;  3F14 A;  2F99 A;  3H51 A;  3OV4 A;  3EC9 A;  1TP6 A;  3G16 A;  1OF5 B;  5AIH A;  2XRX B;  4R9L A;  4XBT A;  4U13 A;  1U5O A;  3FGY A;  2GBX B;  3VSY A;  4J8T A;  3SOA A;  2BMR B;  5CXO A;  4HM7 B;  1OUN A;  2HMO B;  3MKI A;  1Q40 A;  3KZT A;  5AI1 A;  3OX9 A;  1WQL B;  1DMQ A;  3CU3 A;  2GEX A;  1K41 A;  3GRD A;  2HMN B;  2BMO B;  1W01 A;  1E97 A;  3GZR A;  5AEW B;  4FCJ A;  3DXO A;  1O7M B;  4HM3 B;  4RZM A;  1JKG B;  4XBY A;  3H3H A;  3ER7 A;  4HM4 B;  3F40 A;  5AIF A;  2R4I A;  2XSH B;  5JPP A;  3HX8 A;  4J9A A;  5IG5 A;  1O7N B;  3CPO A;  3DZL A;  3B7C A;  3FF2 A;  1SJW A;  1OGZ A;  5HGR A;  2BNG A;  3ECF A;  3EQQ B;  3FLJ A;  3HZP A;  1S5A A;  4HM2 B;  1OHP A;  3OWU A;  3FH1 A;  3EN8 A;  1BUQ A;  3F7S A;  1JN5 B;  4HM1 B;  2K54 A;  1O7W B;  1ULJ B;  3M8C A;  3EBY A;  3NHX A;  4ORL A;  2I9W A;  4I4K A;  1JB2 A;  3EJV A;  5DRV A;  1O7G B;  5IG0 A;  4N3V A;  4FCM A;  4R1K A;  1ZX2 A;  5CF2 A;  5IEN A;  3MG1 A;  2IMJ A;  3KKG A;  4HJL B;  2RFR A;  1AR0 A;  1OPY A;  2PZV A;  3HK4 A;  2YFI B;  3NBR A;  3I0Y A;  2Z7A A;  4HVN A;  1E3V A;  3EHC A;  3S5C A;  4XB5 A;  4OVM A;  3GWR A;  5IG3 A;  3BB9 A;  5D83 A;  3NV0 B;  2HMM B;  3DUK A;  4L7K A;  3FF0 A;  4LEH A;  2INX A;  1QMA A;  4XDW A;  5STD A;  3G8Z A;  3KE7 A;  3T8U A;  2STD A;  2XR8 B;  1NU3 A;  4L8P A;  4HKV B;  1JKG A;  3E99 A;  3B4P A;  3NM2 A;  3Q90 A;  1O7H B;  1ISK A;  3SED A;  1Z1S A;  3K0Z A;  1GY7 A;  3G0K A;  3OWS A;  5IEP A;  2QGU A;  4OUQ A;  4CDL A;  4IIA A;  2Z77 A;  3RGR A;  4PEJ A;  5BXQ A;  3BLZ A;  5DRE A;  3NUV A;  1TUH A;  2JQ5 A;  4X2O A;  1GY6 A;  3JUP A;  3JUQ A;  1NDO B;  1DMN A;  1EG9 B;  3OXA A;  3NXJ A;  3MG2 A;  1STD A;  2GEY A;  4HM6 B;  5IF6 A;  1JN5 A;  4MJD A;  1IDP A;  5IG4 A;  4X2H A;  5AII A;  4HZB B;  1ASK A;  5IER A;  1ULI B;  1O7P B;  2BMQ B;  3MG3 A;  3F8X A;  5CLK A;  5KP4 A;  2F98 A;  3JUO A;  3SOY A;  2HMJ B;  1GS3 A;  1GY5 A;  1ZO2 A;  1OHS A;  5D82 A;  4HM0 B;  1GYB A;  4WYK B;  5CF1 A;  1OF5 A;  2F86 B;  3B8L A;  3D9R A;  3B4O A;  2CHC A;  4H3U A;  2A15 A;  3STD A;  5D81 A;  5KP3 A;  1CQS A;  1E3R A;  3NV0 A;  5IEO A;  3K7C A;  3A76 A;  4K1U A;  3FSD A;  1Q42 A;  4KVH A;  3ROB A;  1OGX A;  3VGN A;  1VZZ A;  3GZX B;  1JB4 A;  3CNM A;  4HZ9 B;  3KSP A;  1OHO A;  1W00 A;  4L8O A;  3EX9 A;  1Q40 B;  3IPT A;  4R9K A;  4K1V A;  3FKA A;  1A2K A;  2W2C A;  2RGQ A;  2GXF A;  3OWY A;  2HMK B;  3F7X A;  5CK6 A;  4HM8 B;  3RGA A;  3GZB A;  2YFJ B;  3JUM A;  5JPU A;  4XDV A;  5EVH A;  2RCD A;  3JUN A;  2B1X B;  8CHO A;  4LGQ A;  2YFL B;  3UNL A;  5TGN A;  1DMM A;  3EBT A;  1W02 A;  3MHE A;  3WMD A;  3GZY B;  4WP5 A;  2B24 B;  3EN1 B;  5BVB A;  3T8N A;  5AEU B;  4Q53 A;  4STD A;  2CKF B;  2Z76 A;  3F8H A;  1UUV B;  3CNX A;  1EA2 A;  5AIG A; 
#chains in the Genus database with same CATH topology
 3EF8 A;  4J5K A;  5FW5 A;  3X3Z A;  2Q07 A;  2BU4 A;  3DMC A;  2AAE A;  3S28 A;  4N6N B;  4K61 A;  5G2G A;  1RGG A;  7STD A;  1RN4 A;  4LMI A;  1RHL A;  3FZW A;  1RCL A;  3X40 A;  3SVA A;  1BNG A;  1IVV A;  3GSP A;  3RDE A;  1C7H A;  4GB5 A;  5KP1 A;  3KSE D;  3MYT A;  1GD3 A;  2UX0 A;  1GSP A;  2CFK A;  3LZA A;  3CPW 2;  1QJG A;  5G1L A;  3V98 A;  3CCU 3;  2GBW B;  2ML5 A;  3DM8 A;  1HKX A;  3DGY A;  2OWP A;  1VQK 3;  4DKI A;  4EBG A;  2XSO B;  1IVX A;  1FGT A;  1FA3 A;  1W6Y A;  2QIY A;  5AYS C;  1KSI A;  1GOY A;  1PY3 A;  4HM5 B;  2HML B;  1FUW A;  1JB5 A;  2HOH A;  1A2P A;  2CWU A;  2V1L A;  4HAA A;  3MSO A;  3KN4 A;  1LXE A;  4XM4 A;  1C54 A;  1CH0 A;  3F9S A;  4WYK A;  1NWW A;  1PYL A;  3PGB A;  4AKY A;  1UUW B;  3S27 A;  4GHO A;  5JBS A;  2W56 A;  4AEQ A;  3LYG A;  3K63 A;  1GOV A;  1IYY A;  1BIR A;  2KXG A;  2KRT A;  4WWU C;  2C10 A;  1OH0 A;  3UJM A;  3LML A;  2UUG C;  4XBX A;  6STD A;  1W4N A;  2CFG A;  2E2V A;  3FCS B;  1OCV A;  3F14 A;  2F99 A;  2OOV A;  1TU5 A;  1NJI 4;  1T2H A;  4RNZ A;  1IVU A;  1RSN A;  1X1U A;  4IPB A;  4LSO A;  3H51 A;  3NQY A;  4EW5 A;  3CD6 3;  1TIJ A;  4K90 B;  3OV4 A;  1RNT A;  3EC9 A;  3WOD G;  1BAO A;  4NRE A;  1ZGX A;  3NBB A;  1K8A 4;  3OW2 2;  1TP6 A;  2P0X A;  2WO0 A;  3G16 A;  4FR9 A;  1LOY A;  2GU3 A;  1LOX A;  2XH9 A;  3S67 A;  1BUJ A;  1I3I A;  1OF5 B;  5AIH A;  2XRX B;  2AAD A;  4R9L A;  4XBT A;  4U13 A;  2XF3 A;  2CW9 A;  1NO3 A;  1U5O A;  3FGY A;  3A5E A;  1YI2 3;  2CWT A;  2GBX B;  3VSY A;  1STF I;  4J8T A;  3BNC A;  1RRL A;  3SOA A;  2BMR B;  3AGO A;  1RMS A;  4G1M B;  3N9H A;  1RTU A;  4CJN A;  5CXO A;  1D6Z A;  4HM7 B;  1OUN A;  1AVL A;  3FG3 A;  1DVD A;  2HMO B;  3MKI A;  1Q40 A;  1Q81 4;  9RNT A;  1EEJ A;  3KZT A;  1YIT 3;  1IT7 A;  5AI1 A;  1TRQ A;  1M9G A;  1IQX A;  2W9Q A;  3OX9 A;  1TTO A;  1SIH A;  2GU1 A;  3AMO B;  3QK9 A;  1WQL B;  4BIR A;  1BSE A;  2OTJ 3;  1M1K 4;  1DMQ A;  3I56 3;  1B2U A;  5ELU A;  1KC8 4;  1YGW A;  1DET A;  3CU3 A;  1QVG 2;  2GEX A;  3FG1 A;  2ZDJ A;  1K41 A;  1ROV A;  1UDI I;  3DY5 A;  1WMN A;  3GRD A;  2HMN B;  2BMO B;  1W01 A;  1GMP A;  1E97 A;  1VQ6 3;  3GZR A;  5AEW B;  4FCJ A;  2P38 A;  2E2T A;  2GSP A;  2M7O A;  1BOX A;  1FUS A;  1O7M B;  3DXO A;  4HM3 B;  1JV2 B;  1TJD A;  5FGO A;  4RZM A;  1IK3 A;  3CC2 3;  1JKG B;  4XBY A;  3H3H A;  3UB1 A;  2FNQ A;  3ER7 A;  4HM4 B;  2IA7 A;  3F40 A;  3PCS A;  1VQ9 3;  5AIF A;  2P09 A;  2KF4 A;  3FG4 A;  3Q1C A;  1GOU A;  2R4I A;  3S29 A;  2XSH B;  5JPP A;  5HOH A;  3HX8 A;  4J9A A;  4FCZ A;  5IG5 A;  1R4C A;  1BRK A;  1RN7 A;  2BHM A;  3SXX A;  1O7N B;  1TFO A;  1FGO A;  2SBL A;  3ZFZ A;  1MNL A;  2P0M A;  1PFP A;  3Q3F A;  1BRG A;  3CPO A;  1LQM B;  2JDI H;  3N54 B;  2F56 A;  3DZL A;  3B7C A;  3D79 A;  1K28 A;  3FF2 A;  1SJW A;  5ELJ A;  1RN1 A;  1OGZ A;  3HII A;  3CCJ 3;  4O02 B;  1YIJ 3;  2CC3 A;  1UCL A;  2BNG A;  5HGR A;  3U1W A;  3URP A;  1Q7H A;  1N5P A;  3ECF A;  1BRI A;  1AY7 A;  3EQQ B;  1B20 A;  3FLJ A;  1RRH A;  3IJE B;  3HZP A;  1QAF A;  1X1X A;  2F4Y A;  1RJO A;  1B27 A;  1S5A A;  4HM2 B;  1OHP A;  4O8S A;  3OWU A;  2XGN A;  4GL6 A;  3SYU A;  3LTD A;  3WHO A;  1B2S A;  1I2G A;  3V99 A;  3HOH A;  3FH1 A;  1DYU A;  3EN8 A;  1CYV A;  3DH2 A;  1DE3 A;  3BIR A;  1BUQ A;  3F7S A;  1JN5 B;  4HM1 B;  1T3B A;  1V58 A;  2K54 A;  4FMC A;  4O2H A;  4RNY A;  3ALA A;  3PZW A;  1O7W B;  1ULJ B;  3CMA 3;  2D1W A;  2F5M A;  3M8C A;  1MOL A;  1FZU A;  1QAK A;  1BNF A;  3EBY A;  1GMQ A;  1N5H A;  3NHX A;  2KF3 A;  1YHQ 3;  1D6U A;  1UUG B;  2I9W A;  4ORL A;  4I4K A;  3K5T A;  5LC7 A;  3GAX A;  3WOF B;  1JB2 A;  4MMZ B;  2XGL A;  3BNB A;  1AVK A;  3AHW A;  3EJV A;  4BTW A;  1B21 A;  1B3S A;  5DRV A;  4EYC A;  2K3D A;  1O7G B;  5IG0 A;  2J8X B;  4N3V A;  4FCM A;  4R1K A;  1BNI A;  2H0G A;  1YJ9 3;  3U97 A;  1A67 A;  1W2B 2;  1ZX2 A;  5CF2 A;  2KF6 A;  1JJ2 2;  2RNT A;  5IEN A;  3G4S 3;  3MG1 A;  2IMJ A;  1UI7 A;  3O8Y A;  3KKG A;  3SX1 A;  4HJL B;  1G96 A;  2RFR A;  2YX9 A;  1AR0 A;  4N6U A;  3N8B A;  5M1A A;  1OPY A;  1UCK A;  3AHS A;  1F8N A;  3UL5 A;  1DVC A;  1LOV A;  2Y74 A;  5BU4 A;  3CCS 3;  2WOH A;  2PZV A;  3HK4 A;  3MWZ A;  3X42 A;  2YFI B;  3NBR A;  3I0Y A;  1ROA A;  2Z7A A;  3EB8 A;  4HVN A;  3G71 3;  1E3V A;  3KCH A;  3K9M C;  5IW9 A;  2W56 B;  3EHC A;  3LTA A;  1JZD A;  3HIG A;  1VQL 3;  5M18 A;  1SQW A;  4RNT A;  3S5C A;  4XB5 A;  3AGN A;  1W6G A;  4N6T A;  4OVM A;  2LQV A;  2IY2 A;  3J7Y d;  3GWR A;  2PNC A;  1YJW 3;  1V74 A;  5IG3 A;  1N8R 4;  3BB9 A;  2W9P A;  2H0I A;  3NV0 B;  5D83 A;  4J5G A;  3WR2 A;  3PS8 A;  1A90 A;  4BL3 A;  4EV5 A;  3HI7 A;  4JF8 A;  2HMM B;  1RKY A;  3DUK A;  1JBT A;  3X3X A;  1IV7 A;  1I70 A;  1V57 A;  1W5Z A;  4L7K A;  3FF0 A;  1B2M A;  1LNI A;  2OCT A;  3AMO A;  4LEH A;  2INX A;  2XFT A;  1J2B A;  1QMA A;  4TX4 A;  2K0M A;  3LXU X;  4MMY B;  4XDW A;  5STD A;  1Q9E A;  3G8Z A;  1GD4 A;  3CXC 2;  1KD1 4;  1Y4K A;  2OOV C;  3KE7 A;  1I3F A;  3T8U A;  2STD A;  4ILF A;  4HOH A;  1KQS 2;  4OK0 A;  2XR8 B;  3CCV 3;  1NU3 A;  1R4Y A;  1FYS A;  4L8P A;  1PU4 A;  2QA4 3;  4HKV B;  2CFL A;  1JKG A;  1IU7 A;  1WMP A;  3B4P A;  3E99 A;  3NM2 A;  3Q2P A;  3Q90 A;  1O7H B;  3WOE B;  3SED A;  1ISK A;  2CWV A;  1BRS A;  1G02 A;  1RNB A;  2O3O A;  2OQE C;  2ML6 A;  3LTB A;  1Z1S A;  2ZHX B;  1GY7 A;  3K0Z A;  3G0K A;  3OWS A;  1IQY A;  1VQ5 3;  2CX1 A;  5IEP A;  3CME 3;  1RGE A;  2QGU A;  1BNS A;  4OUQ A;  3CC7 3;  4CDL A;  3D4A A;  4IIA A;  4AKZ A;  5RNT A;  1CYU A;  3BU4 A;  7RNT A;  2Z77 A;  3RGR A;  4PEJ A;  1VQ7 3;  2SAR A;  5BXQ A;  3RNT A;  5GSP A;  1IV9 A;  1IT8 A;  3BLZ A;  2MF7 A;  1RGA A;  3NUV A;  1I2E A;  4IT7 A;  5DRE A;  1JRQ A;  1IVW A;  2W0Q A;  1AV4 A;  4NHF A;  1TUH A;  2JQ5 A;  4H61 A;  4X2O A;  1CEW I;  3KII A;  1GY6 A;  4FMD A;  4LYL B;  2W6J H;  2R41 A;  3QRD A;  3CCL 3;  1G0T A;  5EQL A;  2LYX A;  4R80 A;  1VQM 3;  3JUP A;  1N8Q A;  1EKM A;  2Y73 A;  1NDO B;  1WNH A;  3JUQ A;  4RBN A;  5A0O B;  1IQ8 A;  1NB3 I;  1DMN A;  1EG9 B;  4MMX B;  1MWS A;  2F5W A;  3OXA A;  3WDG B;  3NXJ A;  3V92 A;  3CCR 3;  1BSA A;  1M1X B;  3MG2 A;  1STD A;  2GEY A;  1US1 A;  4HM6 B;  5IF6 A;  4BL2 A;  8RNT A;  1Q86 4;  3ZG0 A;  3D3L A;  1JN5 A;  3LTC A;  3PXM A;  1IDP A;  1ZS7 A;  4MJD A;  5IG4 A;  4X2H A;  2RBI A;  1K73 4;  4LZI A;  3I55 3;  5AII A;  2CFD A;  4HZB B;  5I97 A;  2QEX 3;  1T2I A;  1FW7 A;  1I0V A;  1ASK A;  5M19 A;  2CX0 A;  5IER A;  1A2V A;  1BRH A;  1LQG C;  1ULI B;  1LVN A;  1O7P B;  1MWU A;  2BMQ B;  2CIU A;  2IYJ A;  1YNV X;  2C11 A;  2W03 A;  1W2Z A;  3MG3 A;  2BT3 A;  1FUT A;  4BTX A;  3F8X A;  2KF5 A;  4EC6 A;  1Q7Y 4;  1I0X A;  5CLK A;  4EV2 A;  5KP4 A;  2F98 A;  3VF1 A;  3BND A;  3WA3 A;  3JUO A;  4MEI A;  3SOY A;  2XEP A;  3CCQ 3;  1RGF A;  2HMJ B;  1T5Y A;  1GS3 A;  4KFE A;  2CH9 A;  1GY5 A;  1W7C A;  2XFS A;  4FMA A;  1ZO2 A;  1OHS A;  3D5G A;  4HM0 B;  1GYB A;  5D82 A;  1SII A;  1RGH A;  1JBS A;  1D6Y A;  2WOF A;  2CK3 H;  1FGM A;  4KFF A;  1JNQ A;  5EEO A;  3NX0 A;  4WYK B;  3DGM A;  1M90 4;  4CPK A;  1HYF A;  3CC4 3;  3CCM 3;  5CF1 A;  1OF5 A;  1KWI A;  2CG0 A;  2F86 B;  1UCJ A;  3B8L A;  4NPB A;  1YVS A;  1TFK A;  1B2X A;  1YGE A;  3D9R A;  3B4O A;  2CHC A;  4N6O B;  4H3U A;  1MGR A;  1BNJ A;  2A15 A;  3LT8 A;  1HZ1 A;  2MC8 A;  3STD A;  2ZA4 A;  5D81 A;  2C4B A;  1VQP 3;  2D42 A;  4WHA A;  4WFO A;  1CQS A;  5KP3 A;  1E3R A;  2H0H A;  4KZ1 A;  1BSD A;  1L5G B;  3X3Y A;  5BIR A;  3NV0 A;  3LH4 A;  3MPH A;  2IUJ A;  4EXR A;  1RGL A;  3IMA B;  5IEO A;  3K7C A;  1MWR A;  3NQZ A;  2UGI A;  1BU4 A;  1BRJ A;  1FGR A;  3A76 A;  1RCK A;  4K1U A;  1NNV A;  3SLU A;  4BU4 A;  3FSD A;  1Q42 A;  2CFW A;  2OQE A;  4KVH A;  4KFD A;  1W6C A;  2KAA A;  3ROB A;  1SAR A;  4HBR A;  1OGX A;  1RDS A;  2L1S A;  3VGN A;  1VZZ A;  3WA2 X;  1YJN 3;  3GZX B;  1JB4 A;  3CNM A;  1BSC A;  1VQQ A;  3DGN A;  4N6V 0;  2E2U A;  1RGK A;  4HZ9 B;  1U8C B;  1X1Y A;  1EUI C;  3KSP A;  1OHO A;  1YVB I;  1AQZ A;  1WTH A;  3PYJ A;  4ZM8 A;  1Q82 4;  1W00 A;  1FGQ A;  1LOW A;  4L8O A;  1UW1 A;  3EX9 A;  5LC6 A;  1MGW A;  4BTY A;  2KCD A;  1Q40 B;  3DGL A;  3IPT A;  4CCV A;  4R9K A;  4K1V A;  1TRP A;  3FKA A;  3JVC A;  4FMB A;  1JBR A;  1I8V A;  1BSB A;  1LNH A;  1A2K A;  4I5Q A;  3UL6 A;  1VQ8 3;  2W2C A;  2RGQ A;  1N9E A;  1VQ4 3;  2GXF A;  1BNE A;  3T0U A;  3OWY A;  2Z6B A;  2BO9 B;  1MWT A;  3NBJ A;  1EQK A;  1I2F A;  2HMK B;  3F7X A;  2OTL 3;  5CK6 A;  1QVF 2;  3L0R A;  1K9M 4;  1VQO 3;  4HM8 B;  2FXT A;  1OAC A;  3D5I A;  3RGA A;  2W04 A;  3CCE 3;  1RGC A;  3GZB A;  2YFJ B;  1NB5 I;  1VQN 3;  3JUM A;  1BVI A;  1UI8 A;  5JPU A;  4XDV A;  5EVH A;  2RCD A;  3JUN A;  4QWT A;  1BGS A;  1GMR A;  2ZL8 A;  2B1X B;  1RLS A;  4JRF A;  8CHO A;  4LGQ A;  5G1K A;  1B2Z A;  2YFL B;  3LOY A;  3PCR A;  1N9J A;  3UNL A;  4R4K A;  2WGQ A;  5TGN A;  7GSP A;  1DMM A;  3EE1 A;  2WGO A;  1QAL A;  2L4V A;  4O3V A;  4HYZ A;  3EBT A;  1W02 A;  3MHE A;  3NM7 A;  3LT9 A;  2CG1 A;  2O9U X;  2FGT A;  3BNE A;  4N6M A;  1LRA A;  3WMD A;  2BIR A;  1UGH I;  3GZY B;  4GSP A;  2B24 B;  4WP5 A;  4N6L A;  4KT3 B;  3EN1 B;  5BVB A;  3TDG A;  3T8N A;  3ZG5 A;  1UGI A;  5AEU B;  1S72 3;  5AYR B;  4Q53 A;  1WMO A;  2IUK A;  4STD A;  6RNT A;  3G6E 3;  2CKF B;  2Z76 A;  1BAN A;  6GSP A;  1UCI A;  1SPU A;  2RSX A;  3F8H A;  3X41 A;  1UUV B;  3CNX A;  1JZO A;  1EA2 A;  1X1W A;  3DGO A;  5AIG A;  1HU9 A;  1BNR A;  3KFQ C;  2P05 A;  1BRN L; 
#chains in the Genus database with same CATH homology
 3EF8 A;  5FW5 A;  3X3Z A;  2Q07 A;  3DMC A;  3S28 A;  4N6N B;  4K61 A;  5G2G A;  7STD A;  4LMI A;  3FZW A;  3X40 A;  3SVA A;  1IVV A;  3RDE A;  1C7H A;  4GB5 A;  5KP1 A;  3KSE D;  3MYT A;  1GD3 A;  2UX0 A;  2CFK A;  3LZA A;  3CPW 2;  1QJG A;  3V98 A;  3CCU 3;  2GBW B;  2ML5 A;  3DM8 A;  1HKX A;  1VQK 3;  2OWP A;  4EBG A;  2XSO B;  1IVX A;  1FGT A;  1FA3 A;  1W6Y A;  2QIY A;  5AYS C;  1KSI A;  4HM5 B;  2HML B;  1FUW A;  1JB5 A;  2CWU A;  2V1L A;  3MSO A;  3KN4 A;  1LXE A;  4XM4 A;  3F9S A;  4WYK A;  1NWW A;  3PGB A;  4AKY A;  1UUW B;  3S27 A;  5JBS A;  2W56 A;  4AEQ A;  3LYG A;  3K63 A;  2KXG A;  2KRT A;  4WWU C;  2C10 A;  1OH0 A;  3UJM A;  3LML A;  4XBX A;  6STD A;  1W4N A;  2CFG A;  2E2V A;  3FCS B;  1OCV A;  3F14 A;  2F99 A;  2OOV A;  1TU5 A;  1NJI 4;  4RNZ A;  1IVU A;  4IPB A;  4LSO A;  3H51 A;  3NQY A;  3CD6 3;  1TIJ A;  4K90 B;  3OV4 A;  3EC9 A;  3WOD G;  4NRE A;  3NBB A;  1K8A 4;  3OW2 2;  1TP6 A;  2P0X A;  2WO0 A;  3G16 A;  4FR9 A;  2GU3 A;  3S67 A;  1LOX A;  2XH9 A;  1OF5 B;  5AIH A;  2XRX B;  4R9L A;  4XBT A;  4U13 A;  2XF3 A;  2CW9 A;  1NO3 A;  1U5O A;  3FGY A;  1YI2 3;  2CWT A;  2GBX B;  3VSY A;  1STF I;  4J8T A;  3BNC A;  1RRL A;  3SOA A;  2BMR B;  4G1M B;  3N9H A;  5CXO A;  1D6Z A;  4HM7 B;  1OUN A;  1AVL A;  3FG3 A;  1DVD A;  2HMO B;  3MKI A;  1Q40 A;  1Q81 4;  3KZT A;  1YIT 3;  1IT7 A;  5AI1 A;  1M9G A;  1IQX A;  2W9Q A;  3OX9 A;  3AMO B;  1SIH A;  2GU1 A;  3QK9 A;  1WQL B;  2OTJ 3;  1M1K 4;  1DMQ A;  3I56 3;  5ELU A;  1KC8 4;  1QVG 2;  3CU3 A;  2GEX A;  3FG1 A;  2ZDJ A;  1K41 A;  1ROV A;  3DY5 A;  1WMN A;  3GRD A;  2HMN B;  2BMO B;  1W01 A;  1E97 A;  1VQ6 3;  3GZR A;  5AEW B;  4FCJ A;  2P38 A;  2E2T A;  2M7O A;  3DXO A;  1O7M B;  4HM3 B;  1JV2 B;  5FGO A;  4RZM A;  1IK3 A;  3CC2 3;  1JKG B;  4XBY A;  3H3H A;  3UB1 A;  2FNQ A;  3ER7 A;  4HM4 B;  2IA7 A;  3F40 A;  3PCS A;  1VQ9 3;  5AIF A;  2P09 A;  3FG4 A;  3Q1C A;  2R4I A;  3S29 A;  2XSH B;  5JPP A;  3HX8 A;  4J9A A;  4FCZ A;  5IG5 A;  1R4C A;  2BHM A;  1RN7 A;  3SXX A;  1O7N B;  1TFO A;  1FGO A;  2SBL A;  1MNL A;  2P0M A;  1PFP A;  3CPO A;  2JDI H;  3N54 B;  3DZL A;  3B7C A;  1K28 A;  3FF2 A;  1SJW A;  5ELJ A;  1OGZ A;  3HII A;  3CCJ 3;  4O02 B;  1YIJ 3;  2CC3 A;  5HGR A;  2BNG A;  3U1W A;  1N5P A;  3ECF A;  3EQQ B;  3FLJ A;  1RRH A;  3IJE B;  3HZP A;  1QAF A;  1RJO A;  1S5A A;  4HM2 B;  1OHP A;  4O8S A;  3OWU A;  2XGN A;  4GL6 A;  3LTD A;  3V99 A;  3FH1 A;  1DYU A;  3EN8 A;  1CYV A;  1BUQ A;  3F7S A;  1JN5 B;  4HM1 B;  4RNY A;  2K54 A;  4O2H A;  4FMC A;  3ALA A;  3PZW A;  1O7W B;  1ULJ B;  3CMA 3;  2D1W A;  3M8C A;  1MOL A;  1QAK A;  3EBY A;  3NHX A;  1N5H A;  1YHQ 3;  1D6U A;  4ORL A;  2I9W A;  4I4K A;  3K5T A;  5LC7 A;  3GAX A;  3WOF B;  1JB2 A;  4MMZ B;  2XGL A;  3BNB A;  1AVK A;  4BTW A;  3EJV A;  5DRV A;  4EYC A;  1O7G B;  5IG0 A;  4N3V A;  4FCM A;  4R1K A;  1YJ9 3;  3U97 A;  1A67 A;  1W2B 2;  1ZX2 A;  5CF2 A;  1JJ2 2;  5IEN A;  3G4S 3;  3MG1 A;  2IMJ A;  1UI7 A;  3O8Y A;  3KKG A;  3SX1 A;  4HJL B;  1G96 A;  2RFR A;  2YX9 A;  1AR0 A;  4N6U A;  3N8B A;  1OPY A;  1F8N A;  3UL5 A;  1DVC A;  2Y74 A;  3CCS 3;  2WOH A;  2PZV A;  3HK4 A;  3MWZ A;  3X42 A;  2YFI B;  3NBR A;  3I0Y A;  1ROA A;  2Z7A A;  3EB8 A;  4HVN A;  3G71 3;  1E3V A;  3K9M C;  5IW9 A;  2W56 B;  3EHC A;  3LTA A;  3HIG A;  1VQL 3;  1SQW A;  3S5C A;  4XB5 A;  1W6G A;  4N6T A;  4OVM A;  2LQV A;  3J7Y d;  3GWR A;  2PNC A;  1YJW 3;  1V74 A;  5IG3 A;  1N8R 4;  3BB9 A;  2W9P A;  5D83 A;  3NV0 B;  1A90 A;  3PS8 A;  4EV5 A;  3HI7 A;  4JF8 A;  2HMM B;  1RKY A;  3DUK A;  3X3X A;  1IV7 A;  1W5Z A;  4L7K A;  3FF0 A;  2OCT A;  3AMO A;  4LEH A;  2INX A;  2XFT A;  1J2B A;  1QMA A;  4TX4 A;  2K0M A;  3LXU X;  4MMY B;  4XDW A;  5STD A;  3G8Z A;  1GD4 A;  3CXC 2;  1KD1 4;  1Y4K A;  2OOV C;  3KE7 A;  3T8U A;  2STD A;  1KQS 2;  4OK0 A;  2XR8 B;  3CCV 3;  1NU3 A;  2QA4 3;  4L8P A;  1PU4 A;  4HKV B;  2CFL A;  1JKG A;  1IU7 A;  1WMP A;  3B4P A;  3E99 A;  3NM2 A;  3Q2P A;  3Q90 A;  1O7H B;  3WOE B;  3SED A;  1ISK A;  2CWV A;  2O3O A;  2OQE C;  2ML6 A;  3LTB A;  1Z1S A;  3K0Z A;  1GY7 A;  3G0K A;  3OWS A;  1IQY A;  1VQ5 3;  5IEP A;  3CME 3;  2QGU A;  4OUQ A;  3CC7 3;  4CDL A;  4IIA A;  4AKZ A;  1CYU A;  2Z77 A;  3RGR A;  4PEJ A;  1VQ7 3;  5BXQ A;  1IV9 A;  1IT8 A;  3BLZ A;  2MF7 A;  3NUV A;  4IT7 A;  5DRE A;  1JRQ A;  1IVW A;  2W0Q A;  1AV4 A;  4NHF A;  1TUH A;  2JQ5 A;  4H61 A;  4X2O A;  1CEW I;  3KII A;  1GY6 A;  4FMD A;  2W6J H;  3QRD A;  3CCL 3;  5EQL A;  2LYX A;  4R80 A;  1VQM 3;  3JUP A;  1N8Q A;  1EKM A;  2Y73 A;  1NDO B;  1WNH A;  3JUQ A;  4RBN A;  5A0O B;  1IQ8 A;  1NB3 I;  1DMN A;  1EG9 B;  4MMX B;  3OXA A;  3WDG B;  3NXJ A;  3V92 A;  3CCR 3;  1M1X B;  3MG2 A;  1STD A;  2GEY A;  1US1 A;  4HM6 B;  5IF6 A;  1Q86 4;  3D3L A;  1JN5 A;  3LTC A;  3PXM A;  1IDP A;  4MJD A;  5IG4 A;  4X2H A;  1K73 4;  4LZI A;  3I55 3;  5AII A;  2CFD A;  4HZB B;  5I97 A;  2QEX 3;  1ASK A;  5IER A;  1A2V A;  1ULI B;  1LVN A;  1O7P B;  2BMQ B;  2CIU A;  2C11 A;  2W03 A;  1W2Z A;  3MG3 A;  2BT3 A;  4BTX A;  3F8X A;  4EC6 A;  1Q7Y 4;  5CLK A;  4EV2 A;  5KP4 A;  2F98 A;  3VF1 A;  3BND A;  3WA3 A;  3JUO A;  4MEI A;  3SOY A;  2XEP A;  3CCQ 3;  2HMJ B;  1T5Y A;  1GS3 A;  4KFE A;  2CH9 A;  1GY5 A;  1W7C A;  2XFS A;  4FMA A;  1ZO2 A;  1OHS A;  4HM0 B;  5D82 A;  1GYB A;  1SII A;  1D6Y A;  2WOF A;  2CK3 H;  1FGM A;  4KFF A;  1JNQ A;  5EEO A;  3NX0 A;  4WYK B;  3DGM A;  1M90 4;  3CC4 3;  3CCM 3;  5CF1 A;  1OF5 A;  1KWI A;  2CG0 A;  2F86 B;  3B8L A;  1TFK A;  1YGE A;  3D9R A;  3B4O A;  2CHC A;  4N6O B;  4H3U A;  2A15 A;  3LT8 A;  2MC8 A;  3STD A;  5D81 A;  1VQP 3;  2D42 A;  4WHA A;  4WFO A;  1CQS A;  5KP3 A;  1E3R A;  4KZ1 A;  1L5G B;  3X3Y A;  3NV0 A;  3LH4 A;  3MPH A;  2IUJ A;  4EXR A;  3IMA B;  5IEO A;  3K7C A;  3NQZ A;  1FGR A;  3A76 A;  3SLU A;  4K1U A;  3FSD A;  1Q42 A;  2CFW A;  2OQE A;  4KVH A;  4KFD A;  1W6C A;  3ROB A;  4HBR A;  1OGX A;  3VGN A;  3WA2 X;  1YJN 3;  1VZZ A;  3GZX B;  1JB4 A;  3CNM A;  3DGN A;  4N6V 0;  2E2U A;  4HZ9 B;  1U8C B;  3KSP A;  1OHO A;  1YVB I;  1WTH A;  3PYJ A;  4ZM8 A;  1Q82 4;  1W00 A;  1FGQ A;  4L8O A;  1UW1 A;  3EX9 A;  5LC6 A;  4BTY A;  2KCD A;  1Q40 B;  3DGL A;  3IPT A;  4CCV A;  4R9K A;  4K1V A;  3JVC A;  3FKA A;  4FMB A;  1LNH A;  1A2K A;  3UL6 A;  1VQ8 3;  2W2C A;  2RGQ A;  1N9E A;  1VQ4 3;  2GXF A;  3T0U A;  3OWY A;  2Z6B A;  2BO9 B;  3NBJ A;  1EQK A;  2HMK B;  3F7X A;  2OTL 3;  5CK6 A;  1QVF 2;  3L0R A;  1K9M 4;  1VQO 3;  4HM8 B;  2FXT A;  1OAC A;  3RGA A;  2W04 A;  3CCE 3;  3GZB A;  2YFJ B;  1NB5 I;  1VQN 3;  3JUM A;  1UI8 A;  5JPU A;  4XDV A;  5EVH A;  2RCD A;  3JUN A;  4QWT A;  2ZL8 A;  2B1X B;  4JRF A;  8CHO A;  4LGQ A;  2YFL B;  3PCR A;  3LOY A;  1N9J A;  3UNL A;  4R4K A;  2WGQ A;  5TGN A;  1DMM A;  3EE1 A;  2WGO A;  1QAL A;  2L4V A;  4O3V A;  4HYZ A;  3EBT A;  1W02 A;  3MHE A;  3NM7 A;  3LT9 A;  2CG1 A;  2O9U X;  2FGT A;  3BNE A;  4N6M A;  3WMD A;  3GZY B;  4WP5 A;  2B24 B;  4N6L A;  3EN1 B;  5BVB A;  3TDG A;  3T8N A;  1S72 3;  5AEU B;  5AYR B;  4Q53 A;  1WMO A;  2IUK A;  4STD A;  3G6E 3;  2CKF B;  2Z76 A;  1SPU A;  2RSX A;  3F8H A;  3X41 A;  1UUV B;  3CNX A;  1EA2 A;  3DGO A;  5AIG A;  1HU9 A;  3KFQ C;  2P05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...