5DRVA

Crystal structure of the g3bp2 ntf2-like domain in complex with a peptide
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
141
structure length
131
Chain Sequence
SHMVMEKPSPLLVGREFVRQYYTLLNKAPEYLHRFYGRNSSYVHGGVYGQNDIHHKVLSLNFSECHTKIRHVDAHATLSDGVVVQVMGLLSNSGQPERKFMQTFVLAPEGSVPNKFYVHNDMFRYEDEVFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Ras GTPase-activating protein-binding protein 2
publication title Crystal structure of the G3BP2 NTF2-like domain in complex with a canonical FGDF motif peptide.
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 131
sequence length 141
ec nomenclature
pdb deposition date 2015-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5drvA00
3MYTA 4HKVB 2F98A 4R9KA 1ULJB 1Q40A 1QMAA 1OGZA 3CU3A 3NHXA 1ZX2A 4HM5B 3JUOA 1JB5A 3GZYB 3EC9A 4XB5A 3ECFA 3EF8A 2BMQB 1EG9B 5CK6A 1NWWA 1JN5B 3T8NA 4KVHA 4HM1B 2Z76A 3DUKA 2R4IA 5AIHA 3OWSA 1O7NB 2K54A 3WMDA 3FKAA 1K41A 4U13A 3NUVA 1OH0A 3E99A 4R9LA 5BVBA 2BMOB 2GEYA 1OHSA 2GEXA 3SOAA 2XSOB 2HMKB 1EA2A 2B24B 3F9SA 1OF5A 4IIAA 3EBYA 4HZ9B 1C7HA 1NDOB 2YFJB 3I0YA 2F86B 3EN8A 3G16A 3OXAA 3F14A 2XSHB 5IEPA 3CPOA 3B4PA 3RGRA 4LGQA 1OHOA 1E97A 2XR8B 3FH1A 4XDWA 1O7MB 4XBYA 3VSYA 4L8PA 3JUQA 3CNMA 3K7CA 2QIYA 3JUMA 2Z77A 1CQSA 2PZVA 4WYKB 1W02A 4X2HA 3HZPA 5IG5A 3F7XA 2BMRB 5STDA 3NV0A 5JPUA 2HMJB 3OV4A 4RZMA 3VGNA 4CDLA 5KP4A 4OUQA 3LYGA 3DMCA 3SOYA 3KSPA 1GYBA 4WP5A 5D82A 3EJVA 1WQLB 1HKXA 3ROBA 5AEWB 4H3UA 3H51A 3BLZA 4Q53A 3OWUA 2GBXB 4N3VA 2STDA 3FGYA 2A15A 3KKGA 1JKGB 3EQQB 1Q40B 1SJWA 1U5OA 3MG1A 2YFIB 1UUVB 5IF6A 1O7PB 3Q90A 2B1XB 2YFLB 2GBWB 3EBTA 3GZRA 3MHEA 3D9RA 2GXFA 3KZTA 2CKFB 3MG3A 2HMNB 1O7HB 3FSDA 1GY6A 4XDVA 1GS3A 1OHPA 3EN1B 3CNXA 4J9AA 4HM2B 1AR0A 7STDA 5AIFA 2HMMB 4FCJA 5CF1A 3FZWA 3F7SA 1O7WB 3GZXB 4HJLB 3NXJA 1OPYA 4L7KA 1ASKA 4STDA 3F40A 3A76A 3FF2A 2JQ5A 5JPPA 3H3HA 2RCDA 3STDA 3JUPA 3FLJA 5DRVA 2CHCA 5IG0A 3GWRA 1OF5B 4HVNA 3F8HA 4HM8B 5AEUB 2W2CA 5IERA 3NM2A 2Z7AA 2UX0A 1DMNA 5KP3A 3OX9A 4MJDA 1OCVA 1DMMA 4WWUC 1DMQA 1IDPA 2I9WA 4HM6B 3BB9A 6STDA 1GY5A 1S5AA 3EHCA 1TP6A 2XRXB 5FW5A 1Q42A 4LEHA 5AIGA 5TGNA 3ER7A 1OGXA 3NV0B 3DM8A 3K0ZA 1ULIB 1ISKA 2IMJA 3UJMA 5G2GA 3S5CA 2OWPA 3MKIA 1JKGA 3DZLA 5BXQA 3B8LA 1JN5A 3B7CA 4R1KA 1OUNA 3KE7A 5CLKA 5CXOA 5IG3A 3M8CA 1E3RA 3UNLA 3SEDA 4HM0B 8CHOA 3F8XA 5KP1A 1O7GB 4GB5A 1QJGA 5IG4A 5DREA 4L8OA 3GRDA 4HZBB 1BUQA 2QGUA 4HM7B 2BNGA 5AI1A 1JB2A 3MG2A 1STDA 2HMOB 5HGRA 2INXA 1NU3A 4ORLA 4LMIA 3GZBA 4K1UA 1ZO2A 4HM3B 3LZAA 1W00A 3EX9A 3T8UA 3FF0A 1GY7A 4K1VA 3IPTA 2RGQA 1TUHA 4J8TA 1VZZA 4XM4A 4PEJA 4XBXA 2RFRA 5EVHA 4FCMA 4WYKA 4HM4B 5IENA 2HMLB 4OVMA 1Z1SA 1W6YA 4I4KA 3OWYA 1JB4A 3B4OA 3JUNA 5D81A 3HK4A 3MSOA 2F99A 3G8ZA 3DXOA 1W01A 3G0KA 4XBTA 5AIIA 5IEOA 1E3VA 3RGAA 5D83A 5CF2A 4X2OA 3NBRA 1A2KA 1UUWB 3HX8A
chains in the Genus database with same CATH superfamily
1VQL3 3DGYA 3MYTA 1VQ93 4HKVB 1UCKA 2F98A 3CC23 2P09A 1U8CB 2W6JH 1ULJB 1Q40A 4R9KA 1NO3A 1QMAA 1OGZA 2KAAA 1K9M4 3T0UA 2IA7A 3CC73 3CU3A 2H0GA 1Q824 3NHXA 6RNTA 1IT8A 1GMRA 3N54B 1RKYA 2XEPA 1ZX2A 2OOVC 3NBBA 3JUOA 4HM5B 1JB5A 1W5ZA 3CCR3 2AAEA 3GZYB 4EBGA 3PCRA 2QEX3 1B20A 3EC9A 1STFI 3PXMA 3ECFA 3EE1A 4XB5A 2IY2A 1GMPA 3EF8A 1RGKA 3V99A 2BMQB 2J8XB 3S29A 1EG9B 2BO9B 1RRHA 3LT9A 1YJN3 1BNGA 1BRHA 1NWWA 5CK6A 2ML6A 1JN5B 3FG4A 4I5QA 1JV2B 3T8NA 2CFDA 1IQ8A 2O3OA 4KVHA 3PCSA 1BNEA 2V1LA 2BIRA 4HM1B 4BU4A 4FR9A 1US1A 2Z76A 1YVSA 3LTBA 3SYUA 1X1WA 3KCHA 2W04A 3DUKA 4EC6A 2R4IA 5AIHA 3G4S3 3PS8A 1BUJA 1JRQA 3OWSA 1O7NB 2K54A 3WMDA 4FMCA 3CPW2 2M7OA 1N5PA 1YHQ3 3FKAA 2WOHA 2OOVA 1R4YA 1HU9A 1YGWA 5BIRA 3I553 1K41A 2CFKA 1TRQA 1IVWA 2W9QA 4U13A 4AKZA 3I563 1JZDA 3NUVA 1OH0A 3E99A 1UW1A 4R9LA 5BVBA 2BMOB 4HYZA 4NPBA 2GEYA 1N9EA 1OHSA 2K3DA 1LOVA 2GEXA 2XSOB 3IJEB 2CWUA 3SOAA 1KD14 3KN4A 2HMKB 1EA2A 2L1SA 2B24B 3LMLA 2CG1A 1LNHA 3F9SA 1YNVX 2WOFA 1OF5A 2W56B 1IU7A 1PU4A 1S723 4IIAA 2C10A 2KF3A 2MF7A 3EBYA 4HZ9B 5FGOA 1VQ53 3LT8A 1C7HA 1NDOB 2YFJB 2RBIA 3I0YA 4N6OB 1VQ73 2F86B 3LTCA 3V98A 1GOVA 4MEIA 1CH0A 2CW9A 3EN8A 3G16A 3WOFB 3OXAA 1KC84 1NB5I 3RNTA 1I0VA 1LOXA 1BRGA 3CCV3 3F14A 3DGMA 3JVCA 2XSHB 5IEPA 3CPOA 3B4PA 3LXUX 3HIGA 3RGRA 4DKIA 4LGQA 1OHOA 1E97A 2XGNA 2XR8B 3FH1A 4XDWA 3UL5A 1JBTA 1BNSA 1O7MB 1RNTA 3D3LA 5ELJA 5HOHA 4XBYA 3WOEB 3VSYA 4L8PA 3JUQA 2Z6BA 2CIUA 1UGHI 2GU1A 3CNMA 1FUTA 1UDII 2BU4A 3K7CA 3LH4A 2QIYA 3AGOA 1YIJ3 3JUMA 2Z77A 1CQSA 2PZVA 4WYKB 1W02A 2F5WA 3Q2PA 4X2HA 3URPA 2OTL3 1IVUA 3BNEA 1GMQA 3HZPA 5IG5A 3F7XA 1BU4A 1LNIA 2BMRB 1PY3A 1AV4A 2KF6A 3KFQC 1BNRA 3CC43 2HOHA 3MPHA 1BSDA 2W0QA 4H61A 8RNTA 1WNHA 1Y4KA 2CWTA 1FUSA 3NV0A 2XF3A 1TJDA 2HMJB 1BNJA 3OV4A 4R80A 5STDA 4RZMA 3VGNA 1BSBA 1RN7A 3X3YA 1A2VA 1SIHA 4O02B 4OUQA 4FMDA 3SVAA 3ZFZA 5KP4A 3LYGA 4CCVA 4N6NB 1YIT3 5IG4A 3DMCA 1FGQA 3SOYA 1UCLA 1GYBA 1W6CA 3KSPA 4WP5A 5D82A 4CJNA 3EJVA 4EXRA 1IV7A 3HIIA 1FW7A 1WQLB 3WA3A 1RMSA 1HKXA 1RJOA 2Q07A 3BNDA 1NNVA 3ROBA 2XH9A 1GD3A 1T3BA 5AEWB 4H3UA 3VF1A 1UCJA 1I2FA 3HOHA 1SARA 1N5HA 3H51A 3BLZA 3PYJA 4EV2A 4Q53A 1DE3A 1JBRA 5AYSC 1DVCA 3OWUA 3EB8A 1L5GB 5A0OB 1SQWA 2GBXB 3S28A 3CXC2 2E2UA 3D5GA 1SPUA 4N3VA 2STDA 2CG0A 1MGRA 2ZHXB 1TRPA 2SBLA 3FGYA 4CDLA 2RNTA 3CCU3 2A15A 3KKGA 1BANA 2AADA 1JKGB 3WODG 3Q3FA 2IYJA 1G96A 3EQQB 1Q864 1MOLA 1Q40B 1SJWA 1U5OA 5BU4A 3MG1A 4AKYA 3UB1A 2YFIB 1TFOA 1UUVB 3SXXA 5IF6A 1O7PB 3X3ZA 3Q90A 1BSAA 1YJ93 4GSPA 1VQ63 2B1XB 3BNCA 1UCIA 2C4BA 3GSPA 1UUWB 4HOHA 2YFLB 3D5IA 1BIRA 2GBWB 3CCM3 3EBTA 1BRJA 3GZRA 1RGEA 3MHEA 1OACA 3D9RA 3G713 4BTXA 2GXFA 3KZTA 4J5GA 3CCE3 1DVDA 1AY7A 2CKFB 1PFPA 2HMNB 3MG3A 2CX0A 1O7HB 3NQZA 3FSDA 1GY6A 4XDVA 5AYRB 4CPKA 4GL6A 1GS3A 1OHPA 3EN1B 2H0HA 3K9MC 1GOUA 4IPBA 1BAOA 3CNXA 4HM2B 1AR0A 4J9AA 1TIJA 7STDA 5AIFA 2HMMB 1W6GA 4FCJA 5CF1A 3ALAA 1G0TA 3FG1A 3FZWA 1W7CA 3F7SA 4K90B 1O7WB 2CFLA 1VQP3 1ROVA 3GZXB 4HJLB 3CCS3 3N8BA 1KSIA 3NXJA 1UI8A 1OPYA 1B2UA 3WHOA 2XFSA 5RNTA 4OK0A 1D6YA 4L7KA 5LC6A 1K8A4 1CYVA 1ASKA 4STDA 2LQVA 5JBSA 4K61A 4HBRA 2FXTA 5ELUA 5M19A 1M1XB 2P05A 4G1MB 2H0IA 1IQXA 1B3SA 1B2MA 1J2BA 3F40A 1I70A 3A76A 1MGWA 5EQLA 1BRIA 1LOWA 1BNFA 1Q7Y4 3FF2A 1QAFA 2JQ5A 2P0MA 5JPPA 1LRAA 1X1XA 1FA3A 2XFTA 3H3HA 3HX8A 4NREA 1RDSA 1YI23 3MWZA 2RCDA 3CD63 3IMAB 4MMZB 1TFKA 3STDA 2JDIH 3U1WA 3JUPA 1M1K4 1KQS2 1RN1A 3FLJA 5DRVA 1CEWI 2GU3A 1G02A 3PZWA 2CHCA 4QWTA 5IG0A 3GWRA 1OF5B 4KZ1A 4HVNA 1N8R4 5G1KA 3F8HA 1ZS7A 3BIRA 1FYSA 2KRTA 1RGCA 2GSPA 1Q7HA 1F8NA 1RN4A 3AGNA 4HM8B 2XGLA 4KT3B 4BTWA 3DGNA 5AEUB 5G1LA 1VQ43 1GOYA 2CC3A 1TTOA 2WO0A 3QK9A 3UL6A 4BL3A 7GSPA 1EQKA 3CCL3 4EW5A 4N6TA 2W2CA 5IERA 3CME3 1MNLA 4KFFA 2R41A 1ROAA 2BHMA 3NM2A 1YJW3 3FCSB 2Z7AA 2UX0A 1LOYA 1D6UA 1DMNA 1BSEA 5KP3A 1B2SA 1B2XA 3OX9A 4MJDA 1OCVA 1AQZA 1DMMA 4WWUC 1X1YA 3O8YA 1DMQA 3CCJ3 1IDPA 2I9WA 4HM6B 3BB9A 6STDA 1DETA 1GY5A 1I2EA 1I2GA 1S5AA 2KF4A 1EUIC 1JNQA 3EHCA 1MWUA 1TP6A 2E2VA 1TU5A 2KF5A 1EKMA 2ML5A 3D4AA 2XRXB 4WFOA 3AMOA 5FW5A 1Q42A 4BTYA 4LEHA 1V74A 5AIGA 1YGEA 4R4KA 5TGNA 3NX0A 4EV5A 3ER7A 5M1AA 1GD4A 1K28A 1PYLA 1OGXA 1QAKA 1FGTA 3NV0B 1KWIA 3DM8A 3K0ZA 3X40A 1Q814 1ULIB 1RNBA 2F56A 1I3FA 4O3VA 3KSED 1FGOA 3J7Yd 1I3IA 2Y74A 4KFEA 1IQYA 3DGLA 1UGIA 2KCDA 3SLUA 4MMYB 1IT7A 1ISKA 2IMJA 3UJMA 1N8QA 1I0XA 4KFDA 5G2GA 3RDEA 1VQM3 1MWTA 2F4YA 1IK3A 2ZDJA 3S5CA 2SARA 4J5KA 2OWPA 1WMOA 3MKIA 1IVVA 1JKGA 3DZLA 5BXQA 1VQO3 5JPUA 1RGHA 3S27A 1RGLA 4IT7A 2D1WA 3B8LA 3KIIA 5GSPA 1JN5A 3ZG5A 3B7CA 4R1KA 1RGAA 2UGIA 1OUNA 3CCQ3 1D6ZA 3KE7A 5I97A 3GAXA 1AVLA 2PNCA 2IUJA 1NJI4 5CLKA 1JZOA 5CXOA 4EYCA 2F5MA 5IG3A 3M8CA 4N6V0 2L4VA 4RNTA 1K734 1E3RA 3UNLA 3SEDA 4HM0B 8CHOA 1W2B2 1RHLA 1JBSA 3F8XA 5KP1A 1VQK3 4ZM8A 1O7GB 3NQYA 1IVXA 1QJGA 4FMAA 4GB5A 5DREA 7RNTA 4BL2A 1RCLA 4HZBB 3GRDA 2CFGA 4L8OA 1BUQA 5IW9A 4JF8A 1BVIA 2QGUA 1UI7A 1VQN3 4HM7B 1B2ZA 2K0MA 2BNGA 4O8SA 5AI1A 1JB2A 4TX4A 1RSNA 3MG2A 2Y73A 1AVKA 3DGOA 3NM7A 1GSPA 1W4NA 4ILFA 1STDA 3A5EA 1QALA 2HMOB 3D79A 5HGRA 4LYLB 1JJ22 1LQMB 1V58A 2INXA 1FUWA 4AEQA 1NU3A 1N9JA 4N6LA 3QRDA 4ORLA 1WTHA 2OTJ3 2UUGC 3AHSA 2MC8A 2W56A 4LMIA 3S67A 2LYXA 1B27A 1B21A 2WGOA 3GZBA 2P38A 1W2ZA 4K1UA 2CFWA 1IYYA 4HM3B 3LOYA 3L0RA 1R4CA 2FGTA 1BRSA 2KXGA 3LTAA 3LZAA 1W00A 2CK3H 2W9PA 3EX9A 1VQ83 3T8UA 1BOXA 3FF0A 3AHWA 1GY7A 4MMXB 4K1VA 3IPTA 2RGQA 1X1UA 3N9HA 1BNIA 1TUHA 2WGQA 4J8TA 1RGFA 1BRKA 1VZZA 3LTDA 5LC7A 4NHFA 2FNQA 4O2HA 4XM4A 5M18A 1MWSA 1FZUA 1M9GA 1T2HA 1UUGB 3K63A 3X41A 4PEJA 4JRFA 1LXEA 2RFRA 4XBXA 5EVHA 3WR2A 1NB3I 3BU4A 4GHOA 5EEOA 1V57A 3X42A 2ZA4A 2W03A 3NBJA 1HZ1A 4FCMA 2ZL8A 4WYKA 4HM4B 3SX1A 1DYUA 1IV9A 5IENA 3Q1CA 4FCZA 2C11A 1I8VA 2HMLB 4OVMA 3TDGA 2OQEC 3WDGB 1A67A 1QVG2 1Z1SA 1W6YA 4I4KA 3OWYA 3X3XA 1BGSA 1JB4A 4N6UA 3B4OA 1BSCA 1CYUA 4LZIA 3JUNA 2D42A 2CH9A 4RNYA 5D81A 1M904 6GSPA 9RNTA 3HI7A 4BIRA 1QVF2 3HK4A 3K5TA 3G6E3 1YVBI 3FG3A 2BT3A 2CX1A 4HAAA 2QA43 4RBNA 3OW22 3MSOA 3WA2X 1RTUA 1MWRA 2YX9A 1ZGXA 2CWVA 2F99A 2OCTA 3PGBA 3G8ZA 2RSXA 3DY5A 1VQQA 3DXOA 3ZG0A 4FMBA 1RLSA 1T2IA 1RRLA 2E2TA 3CMA3 1W01A 3G0KA 4XBTA 5AIIA 3DH2A 1FGRA 1EEJA 5IEOA 3V92A 1WMPA 2P0XA 1SIIA 1FGMA 1T5YA 1Q9EA 1E3VA 3AMOB 1RCKA 4LSOA 2OQEA 3RGAA 1LVNA 1LQGC 1HYFA 1A2PA 5D83A 3U97A 1RGGA 5CF2A 4X2OA 3NBRA 1A90A 4RNZA 1A2KA 4WHAA 1BRNL 3BNBA 2IUKA 4N6MA 1C54A 2O9UX 1ZO2A 1WMNA
chains in the Genus database with same CATH topology
1VQL3 3MYTA 1VQ93 4HKVB 3CC23 2F98A 2P09A 1U8CB 2W6JH 1ULJB 1Q40A 4R9KA 1NO3A 1QMAA 1OGZA 1K9M4 3T0UA 2IA7A 3CC73 3CU3A 1Q824 3NHXA 1IT8A 1RKYA 3N54B 2XEPA 1ZX2A 2OOVC 3NBBA 3JUOA 4HM5B 1JB5A 1W5ZA 3CCR3 3GZYB 4EBGA 3PCRA 2QEX3 3EC9A 1STFI 3PXMA 3ECFA 3EE1A 4XB5A 3EF8A 3V99A 2BMQB 3S29A 1EG9B 2BO9B 1RRHA 3LT9A 1YJN3 5CK6A 1NWWA 2ML6A 1JN5B 3FG4A 1JV2B 3T8NA 2CFDA 1IQ8A 2O3OA 4KVHA 3PCSA 2V1LA 4HM1B 4FR9A 1US1A 2Z76A 3LTBA 2W04A 3DUKA 4EC6A 2R4IA 5AIHA 3G4S3 3PS8A 1JRQA 3OWSA 1O7NB 2K54A 3WMDA 4FMCA 3CPW2 2M7OA 1N5PA 1YHQ3 3FKAA 2WOHA 2OOVA 1HU9A 3I553 1K41A 2CFKA 2W9QA 1IVWA 4U13A 4AKZA 3I563 3NUVA 1OH0A 3E99A 1UW1A 4R9LA 5BVBA 2BMOB 4HYZA 2GEYA 1N9EA 1OHSA 2GEXA 3IJEB 2XSOB 3SOAA 2CWUA 1KD14 3KN4A 2HMKB 1EA2A 2B24B 3LMLA 2CG1A 1LNHA 3F9SA 2WOFA 1OF5A 2W56B 1IU7A 1PU4A 1S723 4IIAA 2C10A 2MF7A 3EBYA 4HZ9B 5FGOA 1VQ53 3LT8A 1C7HA 1NDOB 2YFJB 3I0YA 4N6OB 1VQ73 2F86B 3LTCA 3V98A 4MEIA 1KC84 2CW9A 3EN8A 3G16A 3WOFB 3OXAA 1NB5I 1LOXA 3CCV3 3F14A 3DGMA 3JVCA 2XSHB 5IEPA 3CPOA 3B4PA 3LXUX 3HIGA 3RGRA 4LGQA 1OHOA 2XR8B 1E97A 2XGNA 3FH1A 4XDWA 3UL5A 1O7MB 5ELJA 3D3LA 4XBYA 3WOEB 3VSYA 4L8PA 3JUQA 2Z6BA 2CIUA 2GU1A 3CNMA 3K7CA 3LH4A 2QIYA 1YIJ3 3JUMA 2Z77A 1CQSA 2PZVA 4WYKB 1W02A 3Q2PA 4X2HA 2OTL3 1IVUA 3BNEA 3HZPA 5IG5A 3F7XA 2BMRB 1AV4A 3KFQC 3CC43 3MPHA 2W0QA 4H61A 1WNHA 1Y4KA 2CWTA 3NV0A 5STDA 2XF3A 2HMJB 3OV4A 5JPUA 4R80A 4RZMA 3VGNA 1RN7A 4CDLA 3X3YA 1A2VA 1SIHA 4O02B 4OUQA 4FMDA 3SVAA 5KP4A 3LYGA 4CCVA 4N6NB 1YIT3 3DMCA 1FGQA 3SOYA 1W6CA 1GYBA 3KSPA 4WP5A 5D82A 3EJVA 4EXRA 1IV7A 3HIIA 1WQLB 3WA3A 1HKXA 1RJOA 2Q07A 3BNDA 3ROBA 2XH9A 1GD3A 5AEWB 4H3UA 3VF1A 3H51A 1N5HA 3PYJA 3BLZA 4EV2A 4Q53A 5AYSC 1DVCA 3OWUA 3EB8A 1L5GB 5A0OB 1SQWA 2GBXB 3S28A 3CXC2 2E2UA 4N3VA 1SPUA 2STDA 2CG0A 3FGYA 2SBLA 3CCU3 2A15A 3KKGA 1JKGB 3WODG 1G96A 3EQQB 1Q864 1MOLA 1Q40B 1SJWA 1U5OA 3MG1A 4AKYA 3UB1A 2YFIB 1TFOA 1UUVB 3SXXA 5IF6A 1O7PB 3X3ZA 3Q90A 1YJ93 1VQ63 2B1XB 3BNCA 1UUWB 2YFLB 2GBWB 3CCM3 3EBTA 3GZRA 3CCE3 3MHEA 1OACA 3D9RA 3G713 4BTXA 2GXFA 3KZTA 1DVDA 2CKFB 1PFPA 2HMNB 3MG3A 1O7HB 3NQZA 3FSDA 1GY6A 4XDVA 5AYRB 4GL6A 1GS3A 1OHPA 3EN1B 1VQ83 3K9MC 4IPBA 3CNXA 4J9AA 4HM2B 1AR0A 7STDA 1TIJA 5AIFA 2HMMB 1W6GA 4FCJA 5CF1A 3ALAA 3FZWA 3FG1A 1W7CA 3F7SA 4K90B 1O7WB 2CFLA 1VQP3 1ROVA 3GZXB 4HJLB 3CCS3 3N8BA 1KSIA 3NXJA 1UI8A 1OPYA 2XFSA 4OK0A 1D6YA 4L7KA 5LC6A 1K8A4 1CYVA 1ASKA 4STDA 2LQVA 5JBSA 4K61A 4HBRA 2FXTA 5ELUA 1M1XB 2P05A 4G1MB 1IQXA 1J2BA 3F40A 5EQLA 3A76A 1Q7Y4 3FF2A 1QAFA 2JQ5A 2P0MA 5JPPA 1FA3A 2XFTA 3H3HA 3HX8A 4NREA 1YI23 3MWZA 2RCDA 3CD63 3IMAB 4MMZB 1TFKA 3STDA 2JDIH 3U1WA 3JUPA 1M1K4 1KQS2 3FLJA 5DRVA 1CEWI 2GU3A 3PZWA 2CHCA 4QWTA 5IG0A 3GWRA 1OF5B 4KZ1A 4HVNA 1N8R4 3F8HA 2KRTA 1F8NA 4HM8B 2XGLA 4BTWA 3DGNA 5AEUB 1VQ43 3UL6A 2CC3A 2WO0A 3QK9A 1EQKA 3CCL3 4N6TA 2W2CA 5IERA 3CME3 1MNLA 4KFFA 1ROAA 2BHMA 3NM2A 1YJW3 3FCSB 2Z7AA 2UX0A 1D6UA 1DMNA 5KP3A 3OX9A 4MJDA 1OCVA 1DMMA 4WWUC 3O8YA 1DMQA 3CCJ3 1IDPA 2I9WA 4HM6B 3BB9A 6STDA 1GY5A 1S5AA 1JNQA 3EHCA 1TP6A 2E2VA 1TU5A 1EKMA 2ML5A 2XRXB 4WFOA 3AMOA 5FW5A 1Q42A 4BTYA 4LEHA 1V74A 5AIGA 1YGEA 4R4KA 5TGNA 3NX0A 4EV5A 3ER7A 1GD4A 1K28A 1OGXA 1QAKA 1FGTA 3NV0B 1KWIA 3DM8A 3K0ZA 3X40A 1Q814 1ULIB 4O3VA 3KSED 1FGOA 3J7Yd 4KFEA 2Y74A 1IQYA 3DGLA 2KCDA 3SLUA 4MMYB 1IT7A 1ISKA 2IMJA 3UJMA 1N8QA 4KFDA 5G2GA 3RDEA 1VQM3 1IK3A 2ZDJA 3S5CA 2OWPA 1WMOA 3MKIA 1IVVA 1JKGA 3DZLA 5BXQA 1VQO3 3S27A 4IT7A 2D1WA 3B8LA 3KIIA 1JN5A 3B7CA 4R1KA 3CCQ3 1OUNA 1D6ZA 3KE7A 5I97A 3GAXA 1AVLA 2PNCA 2IUJA 1NJI4 5CLKA 5CXOA 4EYCA 5IG3A 3M8CA 4N6V0 2L4VA 1K734 1E3RA 3UNLA 3SEDA 4HM0B 8CHOA 1W2B2 3F8XA 5KP1A 1VQK3 4ZM8A 1O7GB 3NQYA 1IVXA 1QJGA 4FMAA 4GB5A 5DREA 5IG4A 4HZBB 3GRDA 2CFGA 4L8OA 1BUQA 5IW9A 4JF8A 2QGUA 1UI7A 1VQN3 4HM7B 2K0MA 2BNGA 4O8SA 5AI1A 1JB2A 4TX4A 3MG2A 2Y73A 1AVKA 3DGOA 3NM7A 1W4NA 1STDA 1QALA 2HMOB 5HGRA 1JJ22 1FUWA 2INXA 4AEQA 1NU3A 1N9JA 4N6LA 3QRDA 4ORLA 1WTHA 2OTJ3 2MC8A 2W56A 4LMIA 3S67A 2LYXA 2WGOA 3GZBA 2P38A 1W2ZA 4K1UA 2CFWA 4HM3B 3LOYA 3L0RA 1R4CA 2FGTA 2KXGA 3LTAA 3LZAA 1W00A 2CK3H 2W9PA 3EX9A 3T8UA 3FF0A 1GY7A 4MMXB 4K1VA 3IPTA 2RGQA 3N9HA 1TUHA 2WGQA 4J8TA 1VZZA 3LTDA 5LC7A 4NHFA 2FNQA 4O2HA 4XM4A 1M9GA 3K63A 3X41A 4PEJA 4JRFA 1LXEA 2RFRA 4XBXA 5EVHA 1NB3I 5EEOA 3X42A 2W03A 3NBJA 4FCMA 2ZL8A 4WYKA 4HM4B 3SX1A 1DYUA 1IV9A 5IENA 3Q1CA 4FCZA 2C11A 2HMLB 4OVMA 3TDGA 2OQEC 3WDGB 1A67A 1QVG2 1Z1SA 1W6YA 4I4KA 3OWYA 3X3XA 1JB4A 4N6UA 3B4OA 1CYUA 4LZIA 3JUNA 2D42A 2CH9A 4RNYA 5D81A 1M904 3HI7A 1QVF2 3HK4A 3K5TA 3G6E3 1YVBI 3FG3A 2BT3A 2QA43 4RBNA 3OW22 3MSOA 3WA2X 2YX9A 2CWVA 2F99A 2OCTA 3PGBA 3G8ZA 2RSXA 3DY5A 3DXOA 4FMBA 2E2TA 1RRLA 3CMA3 1W01A 3G0KA 4XBTA 5AIIA 3V92A 1FGRA 5IEOA 1WMPA 2P0XA 1SIIA 1FGMA 1T5YA 1E3VA 3AMOB 4LSOA 2OQEA 3RGAA 1LVNA 5D83A 3U97A 5CF2A 4X2OA 3NBRA 1A90A 4RNZA 1A2KA 4WHAA 3BNBA 2IUKA 4N6MA 2O9UX 1ZO2A 1WMNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MYT A;  4HKV B;  2F98 A;  4R9K A;  1ULJ B;  1Q40 A;  1QMA A;  1OGZ A;  3CU3 A;  3NHX A;  1ZX2 A;  4HM5 B;  3JUO A;  1JB5 A;  3GZY B;  3EC9 A;  4XB5 A;  3ECF A;  3EF8 A;  2BMQ B;  1EG9 B;  5CK6 A;  1NWW A;  1JN5 B;  3T8N A;  4KVH A;  4HM1 B;  2Z76 A;  3DUK A;  2R4I A;  5AIH A;  3OWS A;  1O7N B;  2K54 A;  3WMD A;  3FKA A;  1K41 A;  4U13 A;  3NUV A;  1OH0 A;  3E99 A;  4R9L A;  5BVB A;  2BMO B;  2GEY A;  1OHS A;  2GEX A;  3SOA A;  2XSO B;  2HMK B;  1EA2 A;  2B24 B;  3F9S A;  1OF5 A;  4IIA A;  3EBY A;  4HZ9 B;  1C7H A;  1NDO B;  2YFJ B;  3I0Y A;  2F86 B;  3EN8 A;  3G16 A;  3OXA A;  3F14 A;  2XSH B;  5IEP A;  3CPO A;  3B4P A;  3RGR A;  4LGQ A;  1OHO A;  1E97 A;  2XR8 B;  3FH1 A;  4XDW A;  1O7M B;  4XBY A;  3VSY A;  4L8P A;  3JUQ A;  3CNM A;  3K7C A;  2QIY A;  3JUM A;  2Z77 A;  1CQS A;  2PZV A;  4WYK B;  1W02 A;  4X2H A;  3HZP A;  5IG5 A;  3F7X A;  2BMR B;  5STD A;  3NV0 A;  5JPU A;  2HMJ B;  3OV4 A;  4RZM A;  3VGN A;  4CDL A;  5KP4 A;  4OUQ A;  3LYG A;  3DMC A;  3SOY A;  3KSP A;  1GYB A;  4WP5 A;  5D82 A;  3EJV A;  1WQL B;  1HKX A;  3ROB A;  5AEW B;  4H3U A;  3H51 A;  3BLZ A;  4Q53 A;  3OWU A;  2GBX B;  4N3V A;  2STD A;  3FGY A;  2A15 A;  3KKG A;  1JKG B;  3EQQ B;  1Q40 B;  1SJW A;  1U5O A;  3MG1 A;  2YFI B;  1UUV B;  5IF6 A;  1O7P B;  3Q90 A;  2B1X B;  2YFL B;  2GBW B;  3EBT A;  3GZR A;  3MHE A;  3D9R A;  2GXF A;  3KZT A;  2CKF B;  3MG3 A;  2HMN B;  1O7H B;  3FSD A;  1GY6 A;  4XDV A;  1GS3 A;  1OHP A;  3EN1 B;  3CNX A;  4J9A A;  4HM2 B;  1AR0 A;  7STD A;  5AIF A;  2HMM B;  4FCJ A;  5CF1 A;  3FZW A;  3F7S A;  1O7W B;  3GZX B;  4HJL B;  3NXJ A;  1OPY A;  4L7K A;  1ASK A;  4STD A;  3F40 A;  3A76 A;  3FF2 A;  2JQ5 A;  5JPP A;  3H3H A;  2RCD A;  3STD A;  3JUP A;  3FLJ A;  5DRV A;  2CHC A;  5IG0 A;  3GWR A;  1OF5 B;  4HVN A;  3F8H A;  4HM8 B;  5AEU B;  2W2C A;  5IER A;  3NM2 A;  2Z7A A;  2UX0 A;  1DMN A;  5KP3 A;  3OX9 A;  4MJD A;  1OCV A;  1DMM A;  4WWU C;  1DMQ A;  1IDP A;  2I9W A;  4HM6 B;  3BB9 A;  6STD A;  1GY5 A;  1S5A A;  3EHC A;  1TP6 A;  2XRX B;  5FW5 A;  1Q42 A;  4LEH A;  5AIG A;  5TGN A;  3ER7 A;  1OGX A;  3NV0 B;  3DM8 A;  3K0Z A;  1ULI B;  1ISK A;  2IMJ A;  3UJM A;  5G2G A;  3S5C A;  2OWP A;  3MKI A;  1JKG A;  3DZL A;  5BXQ A;  3B8L A;  1JN5 A;  3B7C A;  4R1K A;  1OUN A;  3KE7 A;  5CLK A;  5CXO A;  5IG3 A;  3M8C A;  1E3R A;  3UNL A;  3SED A;  4HM0 B;  8CHO A;  3F8X A;  5KP1 A;  1O7G B;  4GB5 A;  1QJG A;  5IG4 A;  5DRE A;  4L8O A;  3GRD A;  4HZB B;  1BUQ A;  2QGU A;  4HM7 B;  2BNG A;  5AI1 A;  1JB2 A;  3MG2 A;  1STD A;  2HMO B;  5HGR A;  2INX A;  1NU3 A;  4ORL A;  4LMI A;  3GZB A;  4K1U A;  1ZO2 A;  4HM3 B;  3LZA A;  1W00 A;  3EX9 A;  3T8U A;  3FF0 A;  1GY7 A;  4K1V A;  3IPT A;  2RGQ A;  1TUH A;  4J8T A;  1VZZ A;  4XM4 A;  4PEJ A;  4XBX A;  2RFR A;  5EVH A;  4FCM A;  4WYK A;  4HM4 B;  5IEN A;  2HML B;  4OVM A;  1Z1S A;  1W6Y A;  4I4K A;  3OWY A;  1JB4 A;  3B4O A;  3JUN A;  5D81 A;  3HK4 A;  3MSO A;  2F99 A;  3G8Z A;  3DXO A;  1W01 A;  3G0K A;  4XBT A;  5AII A;  5IEO A;  1E3V A;  3RGA A;  5D83 A;  5CF2 A;  4X2O A;  3NBR A;  1A2K A;  1UUW B;  3HX8 A; 
#chains in the Genus database with same CATH topology
 1VQL 3;  3DGY A;  3MYT A;  1VQ9 3;  4HKV B;  1UCK A;  2F98 A;  3CC2 3;  2P09 A;  1U8C B;  2W6J H;  1ULJ B;  1Q40 A;  4R9K A;  1NO3 A;  1QMA A;  1OGZ A;  2KAA A;  1K9M 4;  3T0U A;  2IA7 A;  3CC7 3;  3CU3 A;  2H0G A;  1Q82 4;  3NHX A;  6RNT A;  1IT8 A;  1GMR A;  3N54 B;  1RKY A;  2XEP A;  1ZX2 A;  2OOV C;  3NBB A;  3JUO A;  4HM5 B;  1JB5 A;  1W5Z A;  3CCR 3;  2AAE A;  3GZY B;  4EBG A;  3PCR A;  2QEX 3;  1B20 A;  3EC9 A;  1STF I;  3PXM A;  3ECF A;  3EE1 A;  4XB5 A;  2IY2 A;  1GMP A;  3EF8 A;  1RGK A;  3V99 A;  2BMQ B;  2J8X B;  3S29 A;  1EG9 B;  2BO9 B;  1RRH A;  3LT9 A;  1YJN 3;  1BNG A;  1BRH A;  1NWW A;  5CK6 A;  2ML6 A;  1JN5 B;  3FG4 A;  4I5Q A;  1JV2 B;  3T8N A;  2CFD A;  1IQ8 A;  2O3O A;  4KVH A;  3PCS A;  1BNE A;  2V1L A;  2BIR A;  4HM1 B;  4BU4 A;  4FR9 A;  1US1 A;  2Z76 A;  1YVS A;  3LTB A;  3SYU A;  1X1W A;  3KCH A;  2W04 A;  3DUK A;  4EC6 A;  2R4I A;  5AIH A;  3G4S 3;  3PS8 A;  1BUJ A;  1JRQ A;  3OWS A;  1O7N B;  2K54 A;  3WMD A;  4FMC A;  3CPW 2;  2M7O A;  1N5P A;  1YHQ 3;  3FKA A;  2WOH A;  2OOV A;  1R4Y A;  1HU9 A;  1YGW A;  5BIR A;  3I55 3;  1K41 A;  2CFK A;  1TRQ A;  1IVW A;  2W9Q A;  4U13 A;  4AKZ A;  3I56 3;  1JZD A;  3NUV A;  1OH0 A;  3E99 A;  1UW1 A;  4R9L A;  5BVB A;  2BMO B;  4HYZ A;  4NPB A;  2GEY A;  1N9E A;  1OHS A;  2K3D A;  1LOV A;  2GEX A;  2XSO B;  3IJE B;  2CWU A;  3SOA A;  1KD1 4;  3KN4 A;  2HMK B;  1EA2 A;  2L1S A;  2B24 B;  3LML A;  2CG1 A;  1LNH A;  3F9S A;  1YNV X;  2WOF A;  1OF5 A;  2W56 B;  1IU7 A;  1PU4 A;  1S72 3;  4IIA A;  2C10 A;  2KF3 A;  2MF7 A;  3EBY A;  4HZ9 B;  5FGO A;  1VQ5 3;  3LT8 A;  1C7H A;  1NDO B;  2YFJ B;  2RBI A;  3I0Y A;  4N6O B;  1VQ7 3;  2F86 B;  3LTC A;  3V98 A;  1GOV A;  4MEI A;  1CH0 A;  2CW9 A;  3EN8 A;  3G16 A;  3WOF B;  3OXA A;  1KC8 4;  1NB5 I;  3RNT A;  1I0V A;  1LOX A;  1BRG A;  3CCV 3;  3F14 A;  3DGM A;  3JVC A;  2XSH B;  5IEP A;  3CPO A;  3B4P A;  3LXU X;  3HIG A;  3RGR A;  4DKI A;  4LGQ A;  1OHO A;  1E97 A;  2XGN A;  2XR8 B;  3FH1 A;  4XDW A;  3UL5 A;  1JBT A;  1BNS A;  1O7M B;  1RNT A;  3D3L A;  5ELJ A;  5HOH A;  4XBY A;  3WOE B;  3VSY A;  4L8P A;  3JUQ A;  2Z6B A;  2CIU A;  1UGH I;  2GU1 A;  3CNM A;  1FUT A;  1UDI I;  2BU4 A;  3K7C A;  3LH4 A;  2QIY A;  3AGO A;  1YIJ 3;  3JUM A;  2Z77 A;  1CQS A;  2PZV A;  4WYK B;  1W02 A;  2F5W A;  3Q2P A;  4X2H A;  3URP A;  2OTL 3;  1IVU A;  3BNE A;  1GMQ A;  3HZP A;  5IG5 A;  3F7X A;  1BU4 A;  1LNI A;  2BMR B;  1PY3 A;  1AV4 A;  2KF6 A;  3KFQ C;  1BNR A;  3CC4 3;  2HOH A;  3MPH A;  1BSD A;  2W0Q A;  4H61 A;  8RNT A;  1WNH A;  1Y4K A;  2CWT A;  1FUS A;  3NV0 A;  2XF3 A;  1TJD A;  2HMJ B;  1BNJ A;  3OV4 A;  4R80 A;  5STD A;  4RZM A;  3VGN A;  1BSB A;  1RN7 A;  3X3Y A;  1A2V A;  1SIH A;  4O02 B;  4OUQ A;  4FMD A;  3SVA A;  3ZFZ A;  5KP4 A;  3LYG A;  4CCV A;  4N6N B;  1YIT 3;  5IG4 A;  3DMC A;  1FGQ A;  3SOY A;  1UCL A;  1GYB A;  1W6C A;  3KSP A;  4WP5 A;  5D82 A;  4CJN A;  3EJV A;  4EXR A;  1IV7 A;  3HII A;  1FW7 A;  1WQL B;  3WA3 A;  1RMS A;  1HKX A;  1RJO A;  2Q07 A;  3BND A;  1NNV A;  3ROB A;  2XH9 A;  1GD3 A;  1T3B A;  5AEW B;  4H3U A;  3VF1 A;  1UCJ A;  1I2F A;  3HOH A;  1SAR A;  1N5H A;  3H51 A;  3BLZ A;  3PYJ A;  4EV2 A;  4Q53 A;  1DE3 A;  1JBR A;  5AYS C;  1DVC A;  3OWU A;  3EB8 A;  1L5G B;  5A0O B;  1SQW A;  2GBX B;  3S28 A;  3CXC 2;  2E2U A;  3D5G A;  1SPU A;  4N3V A;  2STD A;  2CG0 A;  1MGR A;  2ZHX B;  1TRP A;  2SBL A;  3FGY A;  4CDL A;  2RNT A;  3CCU 3;  2A15 A;  3KKG A;  1BAN A;  2AAD A;  1JKG B;  3WOD G;  3Q3F A;  2IYJ A;  1G96 A;  3EQQ B;  1Q86 4;  1MOL A;  1Q40 B;  1SJW A;  1U5O A;  5BU4 A;  3MG1 A;  4AKY A;  3UB1 A;  2YFI B;  1TFO A;  1UUV B;  3SXX A;  5IF6 A;  1O7P B;  3X3Z A;  3Q90 A;  1BSA A;  1YJ9 3;  4GSP A;  1VQ6 3;  2B1X B;  3BNC A;  1UCI A;  2C4B A;  3GSP A;  1UUW B;  4HOH A;  2YFL B;  3D5I A;  1BIR A;  2GBW B;  3CCM 3;  3EBT A;  1BRJ A;  3GZR A;  1RGE A;  3MHE A;  1OAC A;  3D9R A;  3G71 3;  4BTX A;  2GXF A;  3KZT A;  4J5G A;  3CCE 3;  1DVD A;  1AY7 A;  2CKF B;  1PFP A;  2HMN B;  3MG3 A;  2CX0 A;  1O7H B;  3NQZ A;  3FSD A;  1GY6 A;  4XDV A;  5AYR B;  4CPK A;  4GL6 A;  1GS3 A;  1OHP A;  3EN1 B;  2H0H A;  3K9M C;  1GOU A;  4IPB A;  1BAO A;  3CNX A;  4HM2 B;  1AR0 A;  4J9A A;  1TIJ A;  7STD A;  5AIF A;  2HMM B;  1W6G A;  4FCJ A;  5CF1 A;  3ALA A;  1G0T A;  3FG1 A;  3FZW A;  1W7C A;  3F7S A;  4K90 B;  1O7W B;  2CFL A;  1VQP 3;  1ROV A;  3GZX B;  4HJL B;  3CCS 3;  3N8B A;  1KSI A;  3NXJ A;  1UI8 A;  1OPY A;  1B2U A;  3WHO A;  2XFS A;  5RNT A;  4OK0 A;  1D6Y A;  4L7K A;  5LC6 A;  1K8A 4;  1CYV A;  1ASK A;  4STD A;  2LQV A;  5JBS A;  4K61 A;  4HBR A;  2FXT A;  5ELU A;  5M19 A;  1M1X B;  2P05 A;  4G1M B;  2H0I A;  1IQX A;  1B3S A;  1B2M A;  1J2B A;  3F40 A;  1I70 A;  3A76 A;  1MGW A;  5EQL A;  1BRI A;  1LOW A;  1BNF A;  1Q7Y 4;  3FF2 A;  1QAF A;  2JQ5 A;  2P0M A;  5JPP A;  1LRA A;  1X1X A;  1FA3 A;  2XFT A;  3H3H A;  3HX8 A;  4NRE A;  1RDS A;  1YI2 3;  3MWZ A;  2RCD A;  3CD6 3;  3IMA B;  4MMZ B;  1TFK A;  3STD A;  2JDI H;  3U1W A;  3JUP A;  1M1K 4;  1KQS 2;  1RN1 A;  3FLJ A;  5DRV A;  1CEW I;  2GU3 A;  1G02 A;  3PZW A;  2CHC A;  4QWT A;  5IG0 A;  3GWR A;  1OF5 B;  4KZ1 A;  4HVN A;  1N8R 4;  5G1K A;  3F8H A;  1ZS7 A;  3BIR A;  1FYS A;  2KRT A;  1RGC A;  2GSP A;  1Q7H A;  1F8N A;  1RN4 A;  3AGN A;  4HM8 B;  2XGL A;  4KT3 B;  4BTW A;  3DGN A;  5AEU B;  5G1L A;  1VQ4 3;  1GOY A;  2CC3 A;  1TTO A;  2WO0 A;  3QK9 A;  3UL6 A;  4BL3 A;  7GSP A;  1EQK A;  3CCL 3;  4EW5 A;  4N6T A;  2W2C A;  5IER A;  3CME 3;  1MNL A;  4KFF A;  2R41 A;  1ROA A;  2BHM A;  3NM2 A;  1YJW 3;  3FCS B;  2Z7A A;  2UX0 A;  1LOY A;  1D6U A;  1DMN A;  1BSE A;  5KP3 A;  1B2S A;  1B2X A;  3OX9 A;  4MJD A;  1OCV A;  1AQZ A;  1DMM A;  4WWU C;  1X1Y A;  3O8Y A;  1DMQ A;  3CCJ 3;  1IDP A;  2I9W A;  4HM6 B;  3BB9 A;  6STD A;  1DET A;  1GY5 A;  1I2E A;  1I2G A;  1S5A A;  2KF4 A;  1EUI C;  1JNQ A;  3EHC A;  1MWU A;  1TP6 A;  2E2V A;  1TU5 A;  2KF5 A;  1EKM A;  2ML5 A;  3D4A A;  2XRX B;  4WFO A;  3AMO A;  5FW5 A;  1Q42 A;  4BTY A;  4LEH A;  1V74 A;  5AIG A;  1YGE A;  4R4K A;  5TGN A;  3NX0 A;  4EV5 A;  3ER7 A;  5M1A A;  1GD4 A;  1K28 A;  1PYL A;  1OGX A;  1QAK A;  1FGT A;  3NV0 B;  1KWI A;  3DM8 A;  3K0Z A;  3X40 A;  1Q81 4;  1ULI B;  1RNB A;  2F56 A;  1I3F A;  4O3V A;  3KSE D;  1FGO A;  3J7Y d;  1I3I A;  2Y74 A;  4KFE A;  1IQY A;  3DGL A;  1UGI A;  2KCD A;  3SLU A;  4MMY B;  1IT7 A;  1ISK A;  2IMJ A;  3UJM A;  1N8Q A;  1I0X A;  4KFD A;  5G2G A;  3RDE A;  1VQM 3;  1MWT A;  2F4Y A;  1IK3 A;  2ZDJ A;  3S5C A;  2SAR A;  4J5K A;  2OWP A;  1WMO A;  3MKI A;  1IVV A;  1JKG A;  3DZL A;  5BXQ A;  1VQO 3;  5JPU A;  1RGH A;  3S27 A;  1RGL A;  4IT7 A;  2D1W A;  3B8L A;  3KII A;  5GSP A;  1JN5 A;  3ZG5 A;  3B7C A;  4R1K A;  1RGA A;  2UGI A;  1OUN A;  3CCQ 3;  1D6Z A;  3KE7 A;  5I97 A;  3GAX A;  1AVL A;  2PNC A;  2IUJ A;  1NJI 4;  5CLK A;  1JZO A;  5CXO A;  4EYC A;  2F5M A;  5IG3 A;  3M8C A;  4N6V 0;  2L4V A;  4RNT A;  1K73 4;  1E3R A;  3UNL A;  3SED A;  4HM0 B;  8CHO A;  1W2B 2;  1RHL A;  1JBS A;  3F8X A;  5KP1 A;  1VQK 3;  4ZM8 A;  1O7G B;  3NQY A;  1IVX A;  1QJG A;  4FMA A;  4GB5 A;  5DRE A;  7RNT A;  4BL2 A;  1RCL A;  4HZB B;  3GRD A;  2CFG A;  4L8O A;  1BUQ A;  5IW9 A;  4JF8 A;  1BVI A;  2QGU A;  1UI7 A;  1VQN 3;  4HM7 B;  1B2Z A;  2K0M A;  2BNG A;  4O8S A;  5AI1 A;  1JB2 A;  4TX4 A;  1RSN A;  3MG2 A;  2Y73 A;  1AVK A;  3DGO A;  3NM7 A;  1GSP A;  1W4N A;  4ILF A;  1STD A;  3A5E A;  1QAL A;  2HMO B;  3D79 A;  5HGR A;  4LYL B;  1JJ2 2;  1LQM B;  1V58 A;  2INX A;  1FUW A;  4AEQ A;  1NU3 A;  1N9J A;  4N6L A;  3QRD A;  4ORL A;  1WTH A;  2OTJ 3;  2UUG C;  3AHS A;  2MC8 A;  2W56 A;  4LMI A;  3S67 A;  2LYX A;  1B27 A;  1B21 A;  2WGO A;  3GZB A;  2P38 A;  1W2Z A;  4K1U A;  2CFW A;  1IYY A;  4HM3 B;  3LOY A;  3L0R A;  1R4C A;  2FGT A;  1BRS A;  2KXG A;  3LTA A;  3LZA A;  1W00 A;  2CK3 H;  2W9P A;  3EX9 A;  1VQ8 3;  3T8U A;  1BOX A;  3FF0 A;  3AHW A;  1GY7 A;  4MMX B;  4K1V A;  3IPT A;  2RGQ A;  1X1U A;  3N9H A;  1BNI A;  1TUH A;  2WGQ A;  4J8T A;  1RGF A;  1BRK A;  1VZZ A;  3LTD A;  5LC7 A;  4NHF A;  2FNQ A;  4O2H A;  4XM4 A;  5M18 A;  1MWS A;  1FZU A;  1M9G A;  1T2H A;  1UUG B;  3K63 A;  3X41 A;  4PEJ A;  4JRF A;  1LXE A;  2RFR A;  4XBX A;  5EVH A;  3WR2 A;  1NB3 I;  3BU4 A;  4GHO A;  5EEO A;  1V57 A;  3X42 A;  2ZA4 A;  2W03 A;  3NBJ A;  1HZ1 A;  4FCM A;  2ZL8 A;  4WYK A;  4HM4 B;  3SX1 A;  1DYU A;  1IV9 A;  5IEN A;  3Q1C A;  4FCZ A;  2C11 A;  1I8V A;  2HML B;  4OVM A;  3TDG A;  2OQE C;  3WDG B;  1A67 A;  1QVG 2;  1Z1S A;  1W6Y A;  4I4K A;  3OWY A;  3X3X A;  1BGS A;  1JB4 A;  4N6U A;  3B4O A;  1BSC A;  1CYU A;  4LZI A;  3JUN A;  2D42 A;  2CH9 A;  4RNY A;  5D81 A;  1M90 4;  6GSP A;  9RNT A;  3HI7 A;  4BIR A;  1QVF 2;  3HK4 A;  3K5T A;  3G6E 3;  1YVB I;  3FG3 A;  2BT3 A;  2CX1 A;  4HAA A;  2QA4 3;  4RBN A;  3OW2 2;  3MSO A;  3WA2 X;  1RTU A;  1MWR A;  2YX9 A;  1ZGX A;  2CWV A;  2F99 A;  2OCT A;  3PGB A;  3G8Z A;  2RSX A;  3DY5 A;  1VQQ A;  3DXO A;  3ZG0 A;  4FMB A;  1RLS A;  1T2I A;  1RRL A;  2E2T A;  3CMA 3;  1W01 A;  3G0K A;  4XBT A;  5AII A;  3DH2 A;  1FGR A;  1EEJ A;  5IEO A;  3V92 A;  1WMP A;  2P0X A;  1SII A;  1FGM A;  1T5Y A;  1Q9E A;  1E3V A;  3AMO B;  1RCK A;  4LSO A;  2OQE A;  3RGA A;  1LVN A;  1LQG C;  1HYF A;  1A2P A;  5D83 A;  3U97 A;  1RGG A;  5CF2 A;  4X2O A;  3NBR A;  1A90 A;  4RNZ A;  1A2K A;  4WHA A;  1BRN L;  3BNB A;  2IUK A;  4N6M A;  1C54 A;  2O9U X;  1ZO2 A;  1WMN A; 
#chains in the Genus database with same CATH homology
 1VQL 3;  3MYT A;  1VQ9 3;  4HKV B;  3CC2 3;  2F98 A;  2P09 A;  1U8C B;  2W6J H;  1ULJ B;  1Q40 A;  4R9K A;  1NO3 A;  1QMA A;  1OGZ A;  1K9M 4;  3T0U A;  2IA7 A;  3CC7 3;  3CU3 A;  1Q82 4;  3NHX A;  1IT8 A;  1RKY A;  3N54 B;  2XEP A;  1ZX2 A;  2OOV C;  3NBB A;  3JUO A;  4HM5 B;  1JB5 A;  1W5Z A;  3CCR 3;  3GZY B;  4EBG A;  3PCR A;  2QEX 3;  3EC9 A;  1STF I;  3PXM A;  3ECF A;  3EE1 A;  4XB5 A;  3EF8 A;  3V99 A;  2BMQ B;  3S29 A;  1EG9 B;  2BO9 B;  1RRH A;  3LT9 A;  1YJN 3;  5CK6 A;  1NWW A;  2ML6 A;  1JN5 B;  3FG4 A;  1JV2 B;  3T8N A;  2CFD A;  1IQ8 A;  2O3O A;  4KVH A;  3PCS A;  2V1L A;  4HM1 B;  4FR9 A;  1US1 A;  2Z76 A;  3LTB A;  2W04 A;  3DUK A;  4EC6 A;  2R4I A;  5AIH A;  3G4S 3;  3PS8 A;  1JRQ A;  3OWS A;  1O7N B;  2K54 A;  3WMD A;  4FMC A;  3CPW 2;  2M7O A;  1N5P A;  1YHQ 3;  3FKA A;  2WOH A;  2OOV A;  1HU9 A;  3I55 3;  1K41 A;  2CFK A;  2W9Q A;  1IVW A;  4U13 A;  4AKZ A;  3I56 3;  3NUV A;  1OH0 A;  3E99 A;  1UW1 A;  4R9L A;  5BVB A;  2BMO B;  4HYZ A;  2GEY A;  1N9E A;  1OHS A;  2GEX A;  3IJE B;  2XSO B;  3SOA A;  2CWU A;  1KD1 4;  3KN4 A;  2HMK B;  1EA2 A;  2B24 B;  3LML A;  2CG1 A;  1LNH A;  3F9S A;  2WOF A;  1OF5 A;  2W56 B;  1IU7 A;  1PU4 A;  1S72 3;  4IIA A;  2C10 A;  2MF7 A;  3EBY A;  4HZ9 B;  5FGO A;  1VQ5 3;  3LT8 A;  1C7H A;  1NDO B;  2YFJ B;  3I0Y A;  4N6O B;  1VQ7 3;  2F86 B;  3LTC A;  3V98 A;  4MEI A;  1KC8 4;  2CW9 A;  3EN8 A;  3G16 A;  3WOF B;  3OXA A;  1NB5 I;  1LOX A;  3CCV 3;  3F14 A;  3DGM A;  3JVC A;  2XSH B;  5IEP A;  3CPO A;  3B4P A;  3LXU X;  3HIG A;  3RGR A;  4LGQ A;  1OHO A;  2XR8 B;  1E97 A;  2XGN A;  3FH1 A;  4XDW A;  3UL5 A;  1O7M B;  5ELJ A;  3D3L A;  4XBY A;  3WOE B;  3VSY A;  4L8P A;  3JUQ A;  2Z6B A;  2CIU A;  2GU1 A;  3CNM A;  3K7C A;  3LH4 A;  2QIY A;  1YIJ 3;  3JUM A;  2Z77 A;  1CQS A;  2PZV A;  4WYK B;  1W02 A;  3Q2P A;  4X2H A;  2OTL 3;  1IVU A;  3BNE A;  3HZP A;  5IG5 A;  3F7X A;  2BMR B;  1AV4 A;  3KFQ C;  3CC4 3;  3MPH A;  2W0Q A;  4H61 A;  1WNH A;  1Y4K A;  2CWT A;  3NV0 A;  5STD A;  2XF3 A;  2HMJ B;  3OV4 A;  5JPU A;  4R80 A;  4RZM A;  3VGN A;  1RN7 A;  4CDL A;  3X3Y A;  1A2V A;  1SIH A;  4O02 B;  4OUQ A;  4FMD A;  3SVA A;  5KP4 A;  3LYG A;  4CCV A;  4N6N B;  1YIT 3;  3DMC A;  1FGQ A;  3SOY A;  1W6C A;  1GYB A;  3KSP A;  4WP5 A;  5D82 A;  3EJV A;  4EXR A;  1IV7 A;  3HII A;  1WQL B;  3WA3 A;  1HKX A;  1RJO A;  2Q07 A;  3BND A;  3ROB A;  2XH9 A;  1GD3 A;  5AEW B;  4H3U A;  3VF1 A;  3H51 A;  1N5H A;  3PYJ A;  3BLZ A;  4EV2 A;  4Q53 A;  5AYS C;  1DVC A;  3OWU A;  3EB8 A;  1L5G B;  5A0O B;  1SQW A;  2GBX B;  3S28 A;  3CXC 2;  2E2U A;  4N3V A;  1SPU A;  2STD A;  2CG0 A;  3FGY A;  2SBL A;  3CCU 3;  2A15 A;  3KKG A;  1JKG B;  3WOD G;  1G96 A;  3EQQ B;  1Q86 4;  1MOL A;  1Q40 B;  1SJW A;  1U5O A;  3MG1 A;  4AKY A;  3UB1 A;  2YFI B;  1TFO A;  1UUV B;  3SXX A;  5IF6 A;  1O7P B;  3X3Z A;  3Q90 A;  1YJ9 3;  1VQ6 3;  2B1X B;  3BNC A;  1UUW B;  2YFL B;  2GBW B;  3CCM 3;  3EBT A;  3GZR A;  3CCE 3;  3MHE A;  1OAC A;  3D9R A;  3G71 3;  4BTX A;  2GXF A;  3KZT A;  1DVD A;  2CKF B;  1PFP A;  2HMN B;  3MG3 A;  1O7H B;  3NQZ A;  3FSD A;  1GY6 A;  4XDV A;  5AYR B;  4GL6 A;  1GS3 A;  1OHP A;  3EN1 B;  1VQ8 3;  3K9M C;  4IPB A;  3CNX A;  4J9A A;  4HM2 B;  1AR0 A;  7STD A;  1TIJ A;  5AIF A;  2HMM B;  1W6G A;  4FCJ A;  5CF1 A;  3ALA A;  3FZW A;  3FG1 A;  1W7C A;  3F7S A;  4K90 B;  1O7W B;  2CFL A;  1VQP 3;  1ROV A;  3GZX B;  4HJL B;  3CCS 3;  3N8B A;  1KSI A;  3NXJ A;  1UI8 A;  1OPY A;  2XFS A;  4OK0 A;  1D6Y A;  4L7K A;  5LC6 A;  1K8A 4;  1CYV A;  1ASK A;  4STD A;  2LQV A;  5JBS A;  4K61 A;  4HBR A;  2FXT A;  5ELU A;  1M1X B;  2P05 A;  4G1M B;  1IQX A;  1J2B A;  3F40 A;  5EQL A;  3A76 A;  1Q7Y 4;  3FF2 A;  1QAF A;  2JQ5 A;  2P0M A;  5JPP A;  1FA3 A;  2XFT A;  3H3H A;  3HX8 A;  4NRE A;  1YI2 3;  3MWZ A;  2RCD A;  3CD6 3;  3IMA B;  4MMZ B;  1TFK A;  3STD A;  2JDI H;  3U1W A;  3JUP A;  1M1K 4;  1KQS 2;  3FLJ A;  5DRV A;  1CEW I;  2GU3 A;  3PZW A;  2CHC A;  4QWT A;  5IG0 A;  3GWR A;  1OF5 B;  4KZ1 A;  4HVN A;  1N8R 4;  3F8H A;  2KRT A;  1F8N A;  4HM8 B;  2XGL A;  4BTW A;  3DGN A;  5AEU B;  1VQ4 3;  3UL6 A;  2CC3 A;  2WO0 A;  3QK9 A;  1EQK A;  3CCL 3;  4N6T A;  2W2C A;  5IER A;  3CME 3;  1MNL A;  4KFF A;  1ROA A;  2BHM A;  3NM2 A;  1YJW 3;  3FCS B;  2Z7A A;  2UX0 A;  1D6U A;  1DMN A;  5KP3 A;  3OX9 A;  4MJD A;  1OCV A;  1DMM A;  4WWU C;  3O8Y A;  1DMQ A;  3CCJ 3;  1IDP A;  2I9W A;  4HM6 B;  3BB9 A;  6STD A;  1GY5 A;  1S5A A;  1JNQ A;  3EHC A;  1TP6 A;  2E2V A;  1TU5 A;  1EKM A;  2ML5 A;  2XRX B;  4WFO A;  3AMO A;  5FW5 A;  1Q42 A;  4BTY A;  4LEH A;  1V74 A;  5AIG A;  1YGE A;  4R4K A;  5TGN A;  3NX0 A;  4EV5 A;  3ER7 A;  1GD4 A;  1K28 A;  1OGX A;  1QAK A;  1FGT A;  3NV0 B;  1KWI A;  3DM8 A;  3K0Z A;  3X40 A;  1Q81 4;  1ULI B;  4O3V A;  3KSE D;  1FGO A;  3J7Y d;  4KFE A;  2Y74 A;  1IQY A;  3DGL A;  2KCD A;  3SLU A;  4MMY B;  1IT7 A;  1ISK A;  2IMJ A;  3UJM A;  1N8Q A;  4KFD A;  5G2G A;  3RDE A;  1VQM 3;  1IK3 A;  2ZDJ A;  3S5C A;  2OWP A;  1WMO A;  3MKI A;  1IVV A;  1JKG A;  3DZL A;  5BXQ A;  1VQO 3;  3S27 A;  4IT7 A;  2D1W A;  3B8L A;  3KII A;  1JN5 A;  3B7C A;  4R1K A;  3CCQ 3;  1OUN A;  1D6Z A;  3KE7 A;  5I97 A;  3GAX A;  1AVL A;  2PNC A;  2IUJ A;  1NJI 4;  5CLK A;  5CXO A;  4EYC A;  5IG3 A;  3M8C A;  4N6V 0;  2L4V A;  1K73 4;  1E3R A;  3UNL A;  3SED A;  4HM0 B;  8CHO A;  1W2B 2;  3F8X A;  5KP1 A;  1VQK 3;  4ZM8 A;  1O7G B;  3NQY A;  1IVX A;  1QJG A;  4FMA A;  4GB5 A;  5DRE A;  5IG4 A;  4HZB B;  3GRD A;  2CFG A;  4L8O A;  1BUQ A;  5IW9 A;  4JF8 A;  2QGU A;  1UI7 A;  1VQN 3;  4HM7 B;  2K0M A;  2BNG A;  4O8S A;  5AI1 A;  1JB2 A;  4TX4 A;  3MG2 A;  2Y73 A;  1AVK A;  3DGO A;  3NM7 A;  1W4N A;  1STD A;  1QAL A;  2HMO B;  5HGR A;  1JJ2 2;  1FUW A;  2INX A;  4AEQ A;  1NU3 A;  1N9J A;  4N6L A;  3QRD A;  4ORL A;  1WTH A;  2OTJ 3;  2MC8 A;  2W56 A;  4LMI A;  3S67 A;  2LYX A;  2WGO A;  3GZB A;  2P38 A;  1W2Z A;  4K1U A;  2CFW A;  4HM3 B;  3LOY A;  3L0R A;  1R4C A;  2FGT A;  2KXG A;  3LTA A;  3LZA A;  1W00 A;  2CK3 H;  2W9P A;  3EX9 A;  3T8U A;  3FF0 A;  1GY7 A;  4MMX B;  4K1V A;  3IPT A;  2RGQ A;  3N9H A;  1TUH A;  2WGQ A;  4J8T A;  1VZZ A;  3LTD A;  5LC7 A;  4NHF A;  2FNQ A;  4O2H A;  4XM4 A;  1M9G A;  3K63 A;  3X41 A;  4PEJ A;  4JRF A;  1LXE A;  2RFR A;  4XBX A;  5EVH A;  1NB3 I;  5EEO A;  3X42 A;  2W03 A;  3NBJ A;  4FCM A;  2ZL8 A;  4WYK A;  4HM4 B;  3SX1 A;  1DYU A;  1IV9 A;  5IEN A;  3Q1C A;  4FCZ A;  2C11 A;  2HML B;  4OVM A;  3TDG A;  2OQE C;  3WDG B;  1A67 A;  1QVG 2;  1Z1S A;  1W6Y A;  4I4K A;  3OWY A;  3X3X A;  1JB4 A;  4N6U A;  3B4O A;  1CYU A;  4LZI A;  3JUN A;  2D42 A;  2CH9 A;  4RNY A;  5D81 A;  1M90 4;  3HI7 A;  1QVF 2;  3HK4 A;  3K5T A;  3G6E 3;  1YVB I;  3FG3 A;  2BT3 A;  2QA4 3;  4RBN A;  3OW2 2;  3MSO A;  3WA2 X;  2YX9 A;  2CWV A;  2F99 A;  2OCT A;  3PGB A;  3G8Z A;  2RSX A;  3DY5 A;  3DXO A;  4FMB A;  2E2T A;  1RRL A;  3CMA 3;  1W01 A;  3G0K A;  4XBT A;  5AII A;  3V92 A;  1FGR A;  5IEO A;  1WMP A;  2P0X A;  1SII A;  1FGM A;  1T5Y A;  1E3V A;  3AMO B;  4LSO A;  2OQE A;  3RGA A;  1LVN A;  5D83 A;  3U97 A;  5CF2 A;  4X2O A;  3NBR A;  1A90 A;  4RNZ A;  1A2K A;  4WHA A;  3BNB A;  2IUK A;  4N6M A;  2O9U X;  1ZO2 A;  1WMN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...