1YVSA

Trimeric domain swapped barnase
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
108
structure length
108
Chain Sequence
b'VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BARNASE
publication title Trimeric domain-swapped barnase.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Endonuclease
total genus 23
structure length 108
sequence length 108
ec nomenclature ec 3.1.27.-:
pdb deposition date 1998-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1yvsA00
2RNTA 1BUJA 1UCJA 3WR2A 1G02A 3URPA 1I3FA 1BNIA 1TRQA 1I70A 2ZA4A 1JBSA 4GHOA 5RNTA 1BGSA 1B21A 1FYSA 1LNIA 1MGRA 6RNTA 1R4YA 1UCLA 3D4AA 2C4BA 1BNRA 3A5EA 1YNVX 4J5GA 3RNTA 1GMRA 1TRPA 7RNTA 2KF3A 1Q9EA 1I0VA 1UCIA 1X1WA 1MGWA 1GSPA 1BNJA 1LOVA 1RGEA 1BU4A 1BRGA 1I2FA 1RNTA 1RSNA 2F5MA 1RN1A 1RGHA 3KCHA 3WHOA 1B3SA 1PYLA 1YVSA 1RGCA 1FUSA 3BU4A 1BNFA 6GSPA 1GOUA 1BANA 1BNSA 1RN4A 1LOYA 2AADA 1BRHA 1I0XA 5GSPA 3DGYA 1RTUA 2AAEA 2KAAA 1B2ZA 1BRJA 2HOHA 4GSPA 8RNTA 3AHWA 1I2GA 3AGNA 1RMSA 2F5WA 3AGOA 1JBRA 1GOYA 1JBTA 3GSPA 5HOHA 1DETA 1SARA 2BU4A 4BU4A 1BRKA 3AHSA 1BRIA 1RGAA 1T2IA 2F56A 1I2EA 4J5KA 4HOHA 1FW7A 1I8VA 2BIRA 1B2XA 1LOWA 5BIRA 1RDSA 1BRNL 1GOVA 1T2HA 1RGFA 5BU4A 4RNTA 1BRSA 3SYUA 2KF5A 1HZ1A 1RGLA 1BSAA 7GSPA 3HOHA 1GMPA 2SARA 1A2PA 1AY7A 1B27A 1PY3A 1RCLA 1BSCA 1GMQA 1RCKA 1BIRA 9RNTA 4BIRA 1BSEA 3D5IA 2RBIA 1ZGXA 1DE3A 1RLSA 4HAAA 3BIRA 2KF4A 1B2UA 1B2SA 1AQZA 1FZUA 1UCKA 1X1UA 1B2MA 1X1YA 1BVIA 3Q3FA 1X1XA 1BNGA 1LRAA 1RHLA 1FUTA 2F4YA 1B20A 1RNBA 1CH0A 1YGWA 1C54A 1IYYA 1BOXA 1RGGA 1I3IA 1RGKA 1HYFA 1BNEA 3D5GA 1BAOA 1BSBA 3DH2A 2KF6A 1TTOA 1BSDA 2GSPA
chains in the Genus database with same CATH superfamily
1UCJA 3WR2A 1G02A 1VQ83 1DMMA 1BNIA 1TRQA 1I70A 4FR9A 4KFEA 4L8PA 3K0ZA 2CFGA 3EBTA 1MWSA 3LOYA 3G713 1MNLA 5BXQA 4L7KA 4N6MA 1W5ZA 1FYSA 2H0HA 4H3UA 1KSIA 1MWRA 3HX8A 5G1LA 1NB3I 2P0MA 1ZO2A 5IG4A 2FNQA 4HM8B 3BNDA 3WOFB 2ML6A 1Q7HA 3SLUA 4HM1B 2BNGA 2WGOA 5G1KA 1Q9EA 3IJEB 4K1UA 1Q864 4N3VA 3S67A 2OTJ3 1BNJA 3VSYA 1LOVA 3K7CA 1QMAA 2W56A 1BU4A 1IV9A 3MG1A 3NQYA 2F5MA 4HBRA 4HM6B 3NV0A 2HMOB 2K3DA 4WWUC 1YVSA 2XEPA 1UGIA 3EJVA 2QA43 4J8TA 4JF8A 4KT3B 3B4OA 3JUQA 4MJDA 1GOUA 2CW9A 1LOXA 3OW22 1W6GA 4O8SA 1WQLB 2R41A 4IIAA 1W00A 1JKGB 1BRHA 1FGTA 1I0XA 5LC7A 3I553 1Q7Y4 1VQQA 3UL5A 1GY6A 4MMYB 3CD63 3MKIA 3KZTA 1IVXA 2KAAA 1KQS2 1B2ZA 1EG9B 2GEXA 3CCS3 2HOHA 4GSPA 3EBYA 3AHWA 1JV2B 3CNMA 4CPKA 1N5HA 2F5WA 4WFOA 1O7GB 1BSDA 2FXTA 3EN8A 4TX4A 3D3LA 3LT9A 4R4KA 4FCJA 3LTBA 5I97A 2KXGA 1GD3A 1K28A 3H51A 2Z6BA 4BU4A 4IT7A 3EX9A 3MG2A 1WMNA 2STDA 3BLZA 1IVVA 1GYBA 2XSHB 1RGAA 3BNEA 2BO9B 1WNHA 3F7SA 1JRQA 5A0OB 2F56A 1QVG2 3FG4A 1IVUA 4HOHA 1D6YA 4HM2B 4L8OA 3NXJA 3LZAA 1LOWA 2CFWA 4HYZA 3BB9A 2UGIA 1T2HA 1K9M4 3B7CA 1DMNA 2RCDA 2KF5A 1K734 4KVHA 3FZWA 4R1KA 4WYKA 2W56B 5EVHA 4KFFA 4N6V0 3PZWA 2OOVC 5M19A 1W01A 1QAFA 3D79A 3A76A 3LMLA 1A2PA 1KC84 2QGUA 1VQM3 5HGRA 3FG3A 1W6YA 1IT7A 3JUMA 1RCKA 4EXRA 1BIRA 4O3VA 1VQP3 3D5IA 3UNLA 1O7WB 1ZGXA 1JB2A 1OUNA 3H3HA 1Y4KA 1J2BA 1DE3A 1K41A 1JN5B 2XFSA 4FCMA 1FZUA 1S723 1IV7A 1X1UA 2CC3A 4HM5B 1BVIA 1OCVA 1X1XA 4N6TA 3M8CA 1UDII 1FUTA 1AVKA 2RGQA 1B20A 1EQKA 1O7NB 1YGWA 1Q42A 4WHAA 3CCV3 5IEOA 1TFKA 1TJDA 1HYFA 2BMRB 1SIHA 2HMKB 2RSXA 1YGEA 1BAOA 3FF2A 1QVF2 2CWTA 4BL2A 2KF6A 1VQO3 1TTOA 3MPHA 1ROAA 3N8BA 2GU3A 1VQK3 2I9WA 1NNVA 4XDWA 4LEHA 3URPA 3LTDA 1Q824 3OX9A 1W2B2 2XGLA 1VQ73 4NHFA 3CCE3 4GHOA 4N6LA 4CCVA 1MGRA 2KRTA 3CCR3 5AIHA 3K5TA 2IYJA 1IDPA 2C4BA 2MC8A 1IQYA 4KFDA 7STDA 1YNVX 2QIYA 1DMQA 1LXEA 3RNTA 2CG0A 1GMRA 1STFI 4OK0A 1K8A4 4NREA 4WYKB 2KF3A 1I0VA 2GBXB 1IQXA 2QEX3 4FCZA 3WODG 3HIGA 8CHOA 1IT8A 1RGEA 1BRGA 1RNTA 1RSNA 1A2VA 1W2ZA 3CCL3 2BMQB 2YFJB 3DZLA 2CHCA 2W9PA 3WHOA 3B4PA 3MSOA 4R9LA 1N5PA 2W04A 3F9SA 1FUSA 4MEIA 4O02B 3BU4A 3ROBA 5JBSA 3EC9A 4AKZA 3DUKA 1BANA 1RN4A 2AADA 1LOYA 3TDGA 5CF1A 1RRHA 3Q90A 4X2OA 1NJI4 4HM3B 3N54B 2XFTA 4RBNA 1ISKA 1LVNA 1A67A 1OF5B 5IG3A 2SBLA 4FMDA 3NHXA 3FCSB 3NBJA 1VQ63 3AGNA 1RMSA 2F98A 3O8YA 1FGMA 2C10A 3SVAA 3D9RA 4N6NB 3CC73 2GXFA 4N6OB 3UJMA 3FSDA 3GSPA 2W2CA 2GU1A 5G2GA 4XDVA 1US1A 3KSPA 1BUQA 1SARA 3DGOA 3JUNA 2XH9A 3T0UA 2CFLA 1ASKA 1SJWA 5FW5A 3KIIA 3AHSA 1BRIA 3Q1CA 1YJ93 2CWUA 1RJOA 3T8NA 2Y74A 2MF7A 3MHEA 3OWUA 5BVBA 2ZDJA 5IG0A 3NBRA 3CC43 1GY5A 2ML5A 5AYSC 3Q2PA 1RDSA 5EQLA 4HM0B 1RGFA 5AEUB 4EV2A 2J8XB 2C11A 2UX0A 1BRSA 5BU4A 1HU9A 3SYUA 3KKGA 3I563 3NBBA 1HZ1A 2H0IA 4EV5A 1RGLA 4CDLA 3DGMA 7GSPA 1VQN3 3FG1A 2YFIB 1GS3A 2RFRA 5IERA 3HIIA 5DRVA 5TGNA 1ULJB 5IW9A 2W0QA 2WOFA 2B24B 4LMIA 3ECFA 3U1WA 3IMAB 1UI8A 1QAKA 1NU3A 1W4NA 3DY5A 1NDOB 4H61A 1M904 1YI23 3NQZA 2KF4A 1B2UA 3AMOA 1N8R4 1UCKA 1AQZA 1N8QA 3G8ZA 1NO3A 4GB5A 3V92A 3ZG0A 1RN7A 4RNYA 3Q3FA 1Q40A 1O7HB 4ZM8A 1VQ43 4BTWA 1W7CA 2F4YA 2O9UX 3RDEA 1RNBA 5CK6A 2CFDA 1BOXA 1DVCA 1PU4A 4FMCA 4CJNA 3BNBA 3D5GA 3FH1A 3DH2A 1UGHI 3VGNA 1STDA 2IUJA 1CYUA 1N9JA 3GZRA 3NV0B 2GSPA 2RNTA 1OGZA 1VZZA 2K54A 3B8LA 3LXUX 3PCSA 5IEPA 1YIJ3 3WMDA 4I5QA 1U8CB 3ER7A 1UW1A 4RZMA 3X42A 2ZA4A 1JBSA 5RNTA 1W6CA 3DGLA 3QK9A 3X40A 1B21A 3UL6A 6RNTA 3EE1A 4LYLB 3D4AA 1Q814 4FMAA 3A5EA 1AVLA 4AEQA 3FLJA 1Z1SA 5AI1A 1SIIA 1TRPA 4OVMA 3LT8A 2OWPA 3K63A 7RNTA 1CYVA 4WP5A 2R4IA 1VQL3 1X1WA 1TP6A 5KP3A 2LYXA 3ZFZA 1MGWA 2YX9A 4BL3A 4EYCA 1N9EA 1I2FA 1OH0A 2OQEC 1WMOA 4AKYA 2L1SA 3L0RA 5KP1A 3STDA 2M7OA 2HMJB 2PNCA 1UUWB 4U13A 1MWTA 4JRFA 3LH4A 1BNFA 5D81A 3WDGB 5KP4A 3LYGA 6GSPA 3V98A 4ORLA 1BNSA 5M1AA 2E2TA 3CCQ3 6STDA 1Q40B 3CCJ3 1U5OA 4K61A 3PGBA 1O7MB 1EA2A 5GSPA 3DGYA 3ZG5A 3IPTA 1V58A 3OWSA 3GAXA 4N6UA 5AEWB 1SPUA 2Z77A 1FA3A 1BRJA 3WA2X 3PXMA 5IG5A 1CEWI 3HK4A 1V74A 1YVBI 3S29A 4LGQA 3AGOA 3GZBA 2KCDA 1LQGC 3KN4A 2JDIH 5D82A 5EEOA 2BHMA 4DKIA 2GEYA 3NX0A 1DETA 1JB4A 1FGQA 1UI7A 1QJGA 2JQ5A 3EN1B 2BU4A 3KSED 3NUVA 2CX0A 3E99A 1T2IA 2XSOB 1I2EA 1JB5A 1T5YA 3F8XA 4J5KA 3T8UA 1I8VA 3HZPA 2BIRA 1W02A 1MOLA 1B2XA 5BIRA 1G0TA 3S27A 1AV4A 1BRNL 1D6ZA 2CH9A 3JUOA 1NB5I 1YJN3 3NM7A 1BSAA 1RRLA 4BTYA 1G96A 1O7PB 3SX1A 1GMPA 2SARA 1IU7A 1AY7A 1IK3A 3OV4A 1AR0A 1M1K4 5STDA 2IUKA 2OQEA 1PY3A 1RCLA 1CQSA 1GMQA 1YIT3 9RNTA 2E2VA 3S5CA 3DXOA 1JZDA 2WGQA 4XB5A 5CLKA 3CNXA 2P38A 1JNQA 2K0MA 2HMNB 3MG3A 3PCRA 2P09A 3BIRA 3CPW2 3GRDA 3G16A 3QRDA 4MMXB 3I0YA 1X1YA 2W03A 2LQVA 1BNGA 1LRAA 2FGTA 3LTCA 5AYRB 2P05A 3PYJA 1C54A 1IYYA 3G6E3 2B1XB 4I4KA 1I3IA 3CME3 2IMJA 3G0KA 4J9AA 1ZX2A 2CG1A 3WA3A 3KFQC 3DMCA 4NPBA 4HZ9B 1BUJA 4LZIA 3KE7A 5LC6A 5M18A 1I3FA 3F40A 3SEDA 3WOEB 4QWTA 5DREA 1D6UA 2L4VA 1DVDA 2ZL8A 1BGSA 3F8HA 1EEJA 1A90A 1LNIA 4K90B 1NWWA 4R9KA 1GD4A 1R4YA 3GZXB 1EKMA 1FGRA 1UCLA 3JUPA 4HVNA 4RNZA 1JN5A 1ULIB 4R80A 3F14A 3SOYA 1KWIA 1UUVB 1BNRA 3MWZA 1E3VA 4J5GA 1QALA 3EQQB 1M1XB 1OPYA 3EB8A 3GZYB 1HKXA 5AIIA 3X3XA 2W6JH 1FUWA 2HMMB 1UCIA 3DGNA 4GL6A 4ILFA 2CX1A 1GSPA 1ZS7A 2Y73A 3LTAA 4HM7B 4XBXA 4IPBA 3CMA3 1OHOA 1E97A 1GY7A 2IA7A 2XR8B 2CKFB 1RN1A 4G1MB 1EUIC 1M9GA 1SQWA 3MYTA 1RGHA 4X2HA 1T3BA 3KCHA 4Q53A 2XGNA 2Q07A 1B3SA 1KD14 1PYLA 1RGCA 3HI7A 2XRXB 2E2UA 3CU3A 3RGRA 2OCTA 5JPPA 1VQ53 1WMPA 2H0GA 1IVWA 4BTXA 3CCM3 2BT3A 2F86B 2D1WA 4STDA 5AIFA 3UB1A 4PEJA 1TFOA 5CXOA 3PS8A 1PFPA 3U97A 1L5GB 1OHPA 4FMBA 1RTUA 4HKVB 1E3RA 2AAEA 1TU5A 3N9HA 1F8NA 8RNTA 1S5AA 1RKYA 1I2GA 1ROVA 2PZVA 3NM2A 3V99A 2O3OA 3CXC2 1IQ8A 2GBWB 1GOYA 2Z76A 2UUGC 2Z7AA 3JVCA 1JJ22 1JBRA 1JBTA 3ALAA 5HOHA 5D83A 1MWUA 1VQ93 2WOHA 3K9MC 3SOAA 3EHCA 3OWYA 4O2HA 4HZBB 2YFLB 5IF6A 1BRKA 1V57A 2W9QA 1R4CA 1WTHA 2XF3A 3EF8A 1A2KA 1JZOA 3SXXA 1LNHA 1UUGB 3AMOB 1DYUA 2CIUA 2ZHXB 3J7Yd 4EC6A 1FW7A 3CPOA 1C7HA 3FGYA 1TIJA 1GOVA 2D42A 3OXAA 4XBYA 1OF5A 4RNTA 2WO0A 3FKAA 4K1VA 3F7XA 4HM4B 3S28A 2CK3H 3HOHA 3G4S3 1OHSA 5FGOA 3GWRA 3CCU3 1FGOA 5IENA 3BNCA 4XBTA 1B27A 4XM4A 2CFKA 3VF1A 1BSCA 2INXA 3X3YA 1YHQ3 4BIRA 2BMOB 1BSEA 2RBIA 2P0XA 4LSOA 1RLSA 4HAAA 3X3ZA 1OGXA 2HMLB 2OTL3 1YJW3 1B2SA 2CWVA 3CC23 2IY2A 3DM8A 5ELUA 1B2MA 1RHLA 4OUQA 1JKGA 5ELJA 4MMZB 1CH0A 1TUHA 2A15A 3FF0A 3X41A 5CF2A 3RGAA 1RGGA 1LQMB 4EW5A 1RGKA 2V1LA 2F99A 1BNEA 4KZ1A 4EBGA 4HJLB 5AIGA 1BSBA 5JPUA 1OACA 2OOVA
chains in the Genus database with same CATH topology
2RNTA 1BUJA 1UCJA 3WR2A 1G02A 3URPA 1I3FA 1BNIA 1TRQA 1I70A 2ZA4A 1JBSA 4GHOA 5RNTA 1BGSA 1B21A 1FYSA 1LNIA 1MGRA 6RNTA 1R4YA 1UCLA 3D4AA 2C4BA 1BNRA 3A5EA 1YNVX 4J5GA 3RNTA 1GMRA 1TRPA 7RNTA 2KF3A 1Q9EA 1I0VA 1UCIA 1X1WA 1MGWA 1GSPA 1BNJA 1LOVA 1RGEA 1BU4A 1BRGA 1I2FA 1RNTA 1RSNA 2F5MA 1RN1A 1RGHA 3KCHA 3WHOA 1B3SA 1PYLA 1YVSA 1RGCA 1FUSA 3BU4A 1BNFA 6GSPA 1GOUA 1BANA 1BNSA 1RN4A 1LOYA 2AADA 1BRHA 1I0XA 5GSPA 3DGYA 1RTUA 2AAEA 2KAAA 1B2ZA 1BRJA 2HOHA 4GSPA 8RNTA 3AHWA 1I2GA 3AGNA 1RMSA 2F5WA 3AGOA 1JBRA 1GOYA 1JBTA 3GSPA 5HOHA 1DETA 1SARA 2BU4A 4BU4A 1BRKA 3AHSA 1BRIA 1RGAA 1T2IA 2F56A 1I2EA 4J5KA 4HOHA 1FW7A 1I8VA 2BIRA 1B2XA 1LOWA 5BIRA 1RDSA 1BRNL 1GOVA 1T2HA 1RGFA 5BU4A 4RNTA 1BRSA 3SYUA 2KF5A 1HZ1A 1RGLA 1BSAA 7GSPA 3HOHA 1GMPA 2SARA 1A2PA 1AY7A 1B27A 1PY3A 1RCLA 1BSCA 1GMQA 1RCKA 1BIRA 9RNTA 4BIRA 1BSEA 3D5IA 2RBIA 1ZGXA 1DE3A 1RLSA 4HAAA 3BIRA 2KF4A 1B2UA 1B2SA 1AQZA 1FZUA 1UCKA 1X1UA 1B2MA 1X1YA 1BVIA 3Q3FA 1X1XA 1BNGA 1LRAA 1RHLA 1FUTA 2F4YA 1B20A 1RNBA 1CH0A 1YGWA 1C54A 1IYYA 1BOXA 1RGGA 1I3IA 1RGKA 1HYFA 1BNEA 3D5GA 1BAOA 1BSBA 3DH2A 2KF6A 1TTOA 1BSDA 2GSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RNT A;  1BUJ A;  1UCJ A;  3WR2 A;  1G02 A;  3URP A;  1I3F A;  1BNI A;  1TRQ A;  1I70 A;  2ZA4 A;  1JBS A;  4GHO A;  5RNT A;  1BGS A;  1B21 A;  1FYS A;  1LNI A;  1MGR A;  6RNT A;  1R4Y A;  1UCL A;  3D4A A;  2C4B A;  1BNR A;  3A5E A;  1YNV X;  4J5G A;  3RNT A;  1GMR A;  1TRP A;  7RNT A;  2KF3 A;  1Q9E A;  1I0V A;  1UCI A;  1X1W A;  1MGW A;  1GSP A;  1BNJ A;  1LOV A;  1RGE A;  1BU4 A;  1BRG A;  1I2F A;  1RNT A;  1RSN A;  2F5M A;  1RN1 A;  1RGH A;  3KCH A;  3WHO A;  1B3S A;  1PYL A;  1YVS A;  1RGC A;  1FUS A;  3BU4 A;  1BNF A;  6GSP A;  1GOU A;  1BAN A;  1BNS A;  1RN4 A;  1LOY A;  2AAD A;  1BRH A;  1I0X A;  5GSP A;  3DGY A;  1RTU A;  2AAE A;  2KAA A;  1B2Z A;  1BRJ A;  2HOH A;  4GSP A;  8RNT A;  3AHW A;  1I2G A;  3AGN A;  1RMS A;  2F5W A;  3AGO A;  1JBR A;  1GOY A;  1JBT A;  3GSP A;  5HOH A;  1DET A;  1SAR A;  2BU4 A;  4BU4 A;  1BRK A;  3AHS A;  1BRI A;  1RGA A;  1T2I A;  2F56 A;  1I2E A;  4J5K A;  4HOH A;  1FW7 A;  1I8V A;  2BIR A;  1B2X A;  1LOW A;  5BIR A;  1RDS A;  1BRN L;  1GOV A;  1T2H A;  1RGF A;  5BU4 A;  4RNT A;  1BRS A;  3SYU A;  2KF5 A;  1HZ1 A;  1RGL A;  1BSA A;  7GSP A;  3HOH A;  1GMP A;  2SAR A;  1A2P A;  1AY7 A;  1B27 A;  1PY3 A;  1RCL A;  1BSC A;  1GMQ A;  1RCK A;  1BIR A;  9RNT A;  4BIR A;  1BSE A;  3D5I A;  2RBI A;  1ZGX A;  1DE3 A;  1RLS A;  4HAA A;  3BIR A;  2KF4 A;  1B2U A;  1B2S A;  1AQZ A;  1FZU A;  1UCK A;  1X1U A;  1B2M A;  1X1Y A;  1BVI A;  3Q3F A;  1X1X A;  1BNG A;  1LRA A;  1RHL A;  1FUT A;  2F4Y A;  1B20 A;  1RNB A;  1CH0 A;  1YGW A;  1C54 A;  1IYY A;  1BOX A;  1RGG A;  1I3I A;  1RGK A;  1HYF A;  1BNE A;  3D5G A;  1BAO A;  1BSB A;  3DH2 A;  2KF6 A;  1TTO A;  1BSD A;  2GSP A; 
#chains in the Genus database with same CATH topology
 1UCJ A;  3WR2 A;  1G02 A;  1VQ8 3;  1DMM A;  1BNI A;  1TRQ A;  1I70 A;  4FR9 A;  4KFE A;  4L8P A;  3K0Z A;  2CFG A;  3EBT A;  1MWS A;  3LOY A;  3G71 3;  1MNL A;  5BXQ A;  4L7K A;  4N6M A;  1W5Z A;  1FYS A;  2H0H A;  4H3U A;  1KSI A;  1MWR A;  3HX8 A;  5G1L A;  1NB3 I;  2P0M A;  1ZO2 A;  5IG4 A;  2FNQ A;  4HM8 B;  3BND A;  3WOF B;  2ML6 A;  1Q7H A;  3SLU A;  4HM1 B;  2BNG A;  2WGO A;  5G1K A;  1Q9E A;  3IJE B;  4K1U A;  1Q86 4;  4N3V A;  3S67 A;  2OTJ 3;  1BNJ A;  3VSY A;  1LOV A;  3K7C A;  1QMA A;  2W56 A;  1BU4 A;  1IV9 A;  3MG1 A;  3NQY A;  2F5M A;  4HBR A;  4HM6 B;  3NV0 A;  2HMO B;  2K3D A;  4WWU C;  1YVS A;  2XEP A;  1UGI A;  3EJV A;  2QA4 3;  4J8T A;  4JF8 A;  4KT3 B;  3B4O A;  3JUQ A;  4MJD A;  1GOU A;  2CW9 A;  1LOX A;  3OW2 2;  1W6G A;  4O8S A;  1WQL B;  2R41 A;  4IIA A;  1W00 A;  1JKG B;  1BRH A;  1FGT A;  1I0X A;  5LC7 A;  3I55 3;  1Q7Y 4;  1VQQ A;  3UL5 A;  1GY6 A;  4MMY B;  3CD6 3;  3MKI A;  3KZT A;  1IVX A;  2KAA A;  1KQS 2;  1B2Z A;  1EG9 B;  2GEX A;  3CCS 3;  2HOH A;  4GSP A;  3EBY A;  3AHW A;  1JV2 B;  3CNM A;  4CPK A;  1N5H A;  2F5W A;  4WFO A;  1O7G B;  1BSD A;  2FXT A;  3EN8 A;  4TX4 A;  3D3L A;  3LT9 A;  4R4K A;  4FCJ A;  3LTB A;  5I97 A;  2KXG A;  1GD3 A;  1K28 A;  3H51 A;  2Z6B A;  4BU4 A;  4IT7 A;  3EX9 A;  3MG2 A;  1WMN A;  2STD A;  3BLZ A;  1IVV A;  1GYB A;  2XSH B;  1RGA A;  3BNE A;  2BO9 B;  1WNH A;  3F7S A;  1JRQ A;  5A0O B;  2F56 A;  1QVG 2;  3FG4 A;  1IVU A;  4HOH A;  1D6Y A;  4HM2 B;  4L8O A;  3NXJ A;  3LZA A;  1LOW A;  2CFW A;  4HYZ A;  3BB9 A;  2UGI A;  1T2H A;  1K9M 4;  3B7C A;  1DMN A;  2RCD A;  2KF5 A;  1K73 4;  4KVH A;  3FZW A;  4R1K A;  4WYK A;  2W56 B;  5EVH A;  4KFF A;  4N6V 0;  3PZW A;  2OOV C;  5M19 A;  1W01 A;  1QAF A;  3D79 A;  3A76 A;  3LML A;  1A2P A;  1KC8 4;  2QGU A;  1VQM 3;  5HGR A;  3FG3 A;  1W6Y A;  1IT7 A;  3JUM A;  1RCK A;  4EXR A;  1BIR A;  4O3V A;  1VQP 3;  3D5I A;  3UNL A;  1O7W B;  1ZGX A;  1JB2 A;  1OUN A;  3H3H A;  1Y4K A;  1J2B A;  1DE3 A;  1K41 A;  1JN5 B;  2XFS A;  4FCM A;  1FZU A;  1S72 3;  1IV7 A;  1X1U A;  2CC3 A;  4HM5 B;  1BVI A;  1OCV A;  1X1X A;  4N6T A;  3M8C A;  1UDI I;  1FUT A;  1AVK A;  2RGQ A;  1B20 A;  1EQK A;  1O7N B;  1YGW A;  1Q42 A;  4WHA A;  3CCV 3;  5IEO A;  1TFK A;  1TJD A;  1HYF A;  2BMR B;  1SIH A;  2HMK B;  2RSX A;  1YGE A;  1BAO A;  3FF2 A;  1QVF 2;  2CWT A;  4BL2 A;  2KF6 A;  1VQO 3;  1TTO A;  3MPH A;  1ROA A;  3N8B A;  2GU3 A;  1VQK 3;  2I9W A;  1NNV A;  4XDW A;  4LEH A;  3URP A;  3LTD A;  1Q82 4;  3OX9 A;  1W2B 2;  2XGL A;  1VQ7 3;  4NHF A;  3CCE 3;  4GHO A;  4N6L A;  4CCV A;  1MGR A;  2KRT A;  3CCR 3;  5AIH A;  3K5T A;  2IYJ A;  1IDP A;  2C4B A;  2MC8 A;  1IQY A;  4KFD A;  7STD A;  1YNV X;  2QIY A;  1DMQ A;  1LXE A;  3RNT A;  2CG0 A;  1GMR A;  1STF I;  4OK0 A;  1K8A 4;  4NRE A;  4WYK B;  2KF3 A;  1I0V A;  2GBX B;  1IQX A;  2QEX 3;  4FCZ A;  3WOD G;  3HIG A;  8CHO A;  1IT8 A;  1RGE A;  1BRG A;  1RNT A;  1RSN A;  1A2V A;  1W2Z A;  3CCL 3;  2BMQ B;  2YFJ B;  3DZL A;  2CHC A;  2W9P A;  3WHO A;  3B4P A;  3MSO A;  4R9L A;  1N5P A;  2W04 A;  3F9S A;  1FUS A;  4MEI A;  4O02 B;  3BU4 A;  3ROB A;  5JBS A;  3EC9 A;  4AKZ A;  3DUK A;  1BAN A;  1RN4 A;  2AAD A;  1LOY A;  3TDG A;  5CF1 A;  1RRH A;  3Q90 A;  4X2O A;  1NJI 4;  4HM3 B;  3N54 B;  2XFT A;  4RBN A;  1ISK A;  1LVN A;  1A67 A;  1OF5 B;  5IG3 A;  2SBL A;  4FMD A;  3NHX A;  3FCS B;  3NBJ A;  1VQ6 3;  3AGN A;  1RMS A;  2F98 A;  3O8Y A;  1FGM A;  2C10 A;  3SVA A;  3D9R A;  4N6N B;  3CC7 3;  2GXF A;  4N6O B;  3UJM A;  3FSD A;  3GSP A;  2W2C A;  2GU1 A;  5G2G A;  4XDV A;  1US1 A;  3KSP A;  1BUQ A;  1SAR A;  3DGO A;  3JUN A;  2XH9 A;  3T0U A;  2CFL A;  1ASK A;  1SJW A;  5FW5 A;  3KII A;  3AHS A;  1BRI A;  3Q1C A;  1YJ9 3;  2CWU A;  1RJO A;  3T8N A;  2Y74 A;  2MF7 A;  3MHE A;  3OWU A;  5BVB A;  2ZDJ A;  5IG0 A;  3NBR A;  3CC4 3;  1GY5 A;  2ML5 A;  5AYS C;  3Q2P A;  1RDS A;  5EQL A;  4HM0 B;  1RGF A;  5AEU B;  4EV2 A;  2J8X B;  2C11 A;  2UX0 A;  1BRS A;  5BU4 A;  1HU9 A;  3SYU A;  3KKG A;  3I56 3;  3NBB A;  1HZ1 A;  2H0I A;  4EV5 A;  1RGL A;  4CDL A;  3DGM A;  7GSP A;  1VQN 3;  3FG1 A;  2YFI B;  1GS3 A;  2RFR A;  5IER A;  3HII A;  5DRV A;  5TGN A;  1ULJ B;  5IW9 A;  2W0Q A;  2WOF A;  2B24 B;  4LMI A;  3ECF A;  3U1W A;  3IMA B;  1UI8 A;  1QAK A;  1NU3 A;  1W4N A;  3DY5 A;  1NDO B;  4H61 A;  1M90 4;  1YI2 3;  3NQZ A;  2KF4 A;  1B2U A;  3AMO A;  1N8R 4;  1UCK A;  1AQZ A;  1N8Q A;  3G8Z A;  1NO3 A;  4GB5 A;  3V92 A;  3ZG0 A;  1RN7 A;  4RNY A;  3Q3F A;  1Q40 A;  1O7H B;  4ZM8 A;  1VQ4 3;  4BTW A;  1W7C A;  2F4Y A;  2O9U X;  3RDE A;  1RNB A;  5CK6 A;  2CFD A;  1BOX A;  1DVC A;  1PU4 A;  4FMC A;  4CJN A;  3BNB A;  3D5G A;  3FH1 A;  3DH2 A;  1UGH I;  3VGN A;  1STD A;  2IUJ A;  1CYU A;  1N9J A;  3GZR A;  3NV0 B;  2GSP A;  2RNT A;  1OGZ A;  1VZZ A;  2K54 A;  3B8L A;  3LXU X;  3PCS A;  5IEP A;  1YIJ 3;  3WMD A;  4I5Q A;  1U8C B;  3ER7 A;  1UW1 A;  4RZM A;  3X42 A;  2ZA4 A;  1JBS A;  5RNT A;  1W6C A;  3DGL A;  3QK9 A;  3X40 A;  1B21 A;  3UL6 A;  6RNT A;  3EE1 A;  4LYL B;  3D4A A;  1Q81 4;  4FMA A;  3A5E A;  1AVL A;  4AEQ A;  3FLJ A;  1Z1S A;  5AI1 A;  1SII A;  1TRP A;  4OVM A;  3LT8 A;  2OWP A;  3K63 A;  7RNT A;  1CYV A;  4WP5 A;  2R4I A;  1VQL 3;  1X1W A;  1TP6 A;  5KP3 A;  2LYX A;  3ZFZ A;  1MGW A;  2YX9 A;  4BL3 A;  4EYC A;  1N9E A;  1I2F A;  1OH0 A;  2OQE C;  1WMO A;  4AKY A;  2L1S A;  3L0R A;  5KP1 A;  3STD A;  2M7O A;  2HMJ B;  2PNC A;  1UUW B;  4U13 A;  1MWT A;  4JRF A;  3LH4 A;  1BNF A;  5D81 A;  3WDG B;  5KP4 A;  3LYG A;  6GSP A;  3V98 A;  4ORL A;  1BNS A;  5M1A A;  2E2T A;  3CCQ 3;  6STD A;  1Q40 B;  3CCJ 3;  1U5O A;  4K61 A;  3PGB A;  1O7M B;  1EA2 A;  5GSP A;  3DGY A;  3ZG5 A;  3IPT A;  1V58 A;  3OWS A;  3GAX A;  4N6U A;  5AEW B;  1SPU A;  2Z77 A;  1FA3 A;  1BRJ A;  3WA2 X;  3PXM A;  5IG5 A;  1CEW I;  3HK4 A;  1V74 A;  1YVB I;  3S29 A;  4LGQ A;  3AGO A;  3GZB A;  2KCD A;  1LQG C;  3KN4 A;  2JDI H;  5D82 A;  5EEO A;  2BHM A;  4DKI A;  2GEY A;  3NX0 A;  1DET A;  1JB4 A;  1FGQ A;  1UI7 A;  1QJG A;  2JQ5 A;  3EN1 B;  2BU4 A;  3KSE D;  3NUV A;  2CX0 A;  3E99 A;  1T2I A;  2XSO B;  1I2E A;  1JB5 A;  1T5Y A;  3F8X A;  4J5K A;  3T8U A;  1I8V A;  3HZP A;  2BIR A;  1W02 A;  1MOL A;  1B2X A;  5BIR A;  1G0T A;  3S27 A;  1AV4 A;  1BRN L;  1D6Z A;  2CH9 A;  3JUO A;  1NB5 I;  1YJN 3;  3NM7 A;  1BSA A;  1RRL A;  4BTY A;  1G96 A;  1O7P B;  3SX1 A;  1GMP A;  2SAR A;  1IU7 A;  1AY7 A;  1IK3 A;  3OV4 A;  1AR0 A;  1M1K 4;  5STD A;  2IUK A;  2OQE A;  1PY3 A;  1RCL A;  1CQS A;  1GMQ A;  1YIT 3;  9RNT A;  2E2V A;  3S5C A;  3DXO A;  1JZD A;  2WGQ A;  4XB5 A;  5CLK A;  3CNX A;  2P38 A;  1JNQ A;  2K0M A;  2HMN B;  3MG3 A;  3PCR A;  2P09 A;  3BIR A;  3CPW 2;  3GRD A;  3G16 A;  3QRD A;  4MMX B;  3I0Y A;  1X1Y A;  2W03 A;  2LQV A;  1BNG A;  1LRA A;  2FGT A;  3LTC A;  5AYR B;  2P05 A;  3PYJ A;  1C54 A;  1IYY A;  3G6E 3;  2B1X B;  4I4K A;  1I3I A;  3CME 3;  2IMJ A;  3G0K A;  4J9A A;  1ZX2 A;  2CG1 A;  3WA3 A;  3KFQ C;  3DMC A;  4NPB A;  4HZ9 B;  1BUJ A;  4LZI A;  3KE7 A;  5LC6 A;  5M18 A;  1I3F A;  3F40 A;  3SED A;  3WOE B;  4QWT A;  5DRE A;  1D6U A;  2L4V A;  1DVD A;  2ZL8 A;  1BGS A;  3F8H A;  1EEJ A;  1A90 A;  1LNI A;  4K90 B;  1NWW A;  4R9K A;  1GD4 A;  1R4Y A;  3GZX B;  1EKM A;  1FGR A;  1UCL A;  3JUP A;  4HVN A;  4RNZ A;  1JN5 A;  1ULI B;  4R80 A;  3F14 A;  3SOY A;  1KWI A;  1UUV B;  1BNR A;  3MWZ A;  1E3V A;  4J5G A;  1QAL A;  3EQQ B;  1M1X B;  1OPY A;  3EB8 A;  3GZY B;  1HKX A;  5AII A;  3X3X A;  2W6J H;  1FUW A;  2HMM B;  1UCI A;  3DGN A;  4GL6 A;  4ILF A;  2CX1 A;  1GSP A;  1ZS7 A;  2Y73 A;  3LTA A;  4HM7 B;  4XBX A;  4IPB A;  3CMA 3;  1OHO A;  1E97 A;  1GY7 A;  2IA7 A;  2XR8 B;  2CKF B;  1RN1 A;  4G1M B;  1EUI C;  1M9G A;  1SQW A;  3MYT A;  1RGH A;  4X2H A;  1T3B A;  3KCH A;  4Q53 A;  2XGN A;  2Q07 A;  1B3S A;  1KD1 4;  1PYL A;  1RGC A;  3HI7 A;  2XRX B;  2E2U A;  3CU3 A;  3RGR A;  2OCT A;  5JPP A;  1VQ5 3;  1WMP A;  2H0G A;  1IVW A;  4BTX A;  3CCM 3;  2BT3 A;  2F86 B;  2D1W A;  4STD A;  5AIF A;  3UB1 A;  4PEJ A;  1TFO A;  5CXO A;  3PS8 A;  1PFP A;  3U97 A;  1L5G B;  1OHP A;  4FMB A;  1RTU A;  4HKV B;  1E3R A;  2AAE A;  1TU5 A;  3N9H A;  1F8N A;  8RNT A;  1S5A A;  1RKY A;  1I2G A;  1ROV A;  2PZV A;  3NM2 A;  3V99 A;  2O3O A;  3CXC 2;  1IQ8 A;  2GBW B;  1GOY A;  2Z76 A;  2UUG C;  2Z7A A;  3JVC A;  1JJ2 2;  1JBR A;  1JBT A;  3ALA A;  5HOH A;  5D83 A;  1MWU A;  1VQ9 3;  2WOH A;  3K9M C;  3SOA A;  3EHC A;  3OWY A;  4O2H A;  4HZB B;  2YFL B;  5IF6 A;  1BRK A;  1V57 A;  2W9Q A;  1R4C A;  1WTH A;  2XF3 A;  3EF8 A;  1A2K A;  1JZO A;  3SXX A;  1LNH A;  1UUG B;  3AMO B;  1DYU A;  2CIU A;  2ZHX B;  3J7Y d;  4EC6 A;  1FW7 A;  3CPO A;  1C7H A;  3FGY A;  1TIJ A;  1GOV A;  2D42 A;  3OXA A;  4XBY A;  1OF5 A;  4RNT A;  2WO0 A;  3FKA A;  4K1V A;  3F7X A;  4HM4 B;  3S28 A;  2CK3 H;  3HOH A;  3G4S 3;  1OHS A;  5FGO A;  3GWR A;  3CCU 3;  1FGO A;  5IEN A;  3BNC A;  4XBT A;  1B27 A;  4XM4 A;  2CFK A;  3VF1 A;  1BSC A;  2INX A;  3X3Y A;  1YHQ 3;  4BIR A;  2BMO B;  1BSE A;  2RBI A;  2P0X A;  4LSO A;  1RLS A;  4HAA A;  3X3Z A;  1OGX A;  2HML B;  2OTL 3;  1YJW 3;  1B2S A;  2CWV A;  3CC2 3;  2IY2 A;  3DM8 A;  5ELU A;  1B2M A;  1RHL A;  4OUQ A;  1JKG A;  5ELJ A;  4MMZ B;  1CH0 A;  1TUH A;  2A15 A;  3FF0 A;  3X41 A;  5CF2 A;  3RGA A;  1RGG A;  1LQM B;  4EW5 A;  1RGK A;  2V1L A;  2F99 A;  1BNE A;  4KZ1 A;  4EBG A;  4HJL B;  5AIG A;  1BSB A;  5JPU A;  1OAC A;  2OOV A; 
#chains in the Genus database with same CATH homology
 2RNT A;  1BUJ A;  1UCJ A;  3WR2 A;  1G02 A;  3URP A;  1I3F A;  1BNI A;  1TRQ A;  1I70 A;  2ZA4 A;  1JBS A;  4GHO A;  5RNT A;  1BGS A;  1B21 A;  1FYS A;  1LNI A;  1MGR A;  6RNT A;  1R4Y A;  1UCL A;  3D4A A;  2C4B A;  1BNR A;  3A5E A;  1YNV X;  4J5G A;  3RNT A;  1GMR A;  1TRP A;  7RNT A;  2KF3 A;  1Q9E A;  1I0V A;  1UCI A;  1X1W A;  1MGW A;  1GSP A;  1BNJ A;  1LOV A;  1RGE A;  1BU4 A;  1BRG A;  1I2F A;  1RNT A;  1RSN A;  2F5M A;  1RN1 A;  1RGH A;  3KCH A;  3WHO A;  1B3S A;  1PYL A;  1YVS A;  1RGC A;  1FUS A;  3BU4 A;  1BNF A;  6GSP A;  1GOU A;  1BAN A;  1BNS A;  1RN4 A;  1LOY A;  2AAD A;  1BRH A;  1I0X A;  5GSP A;  3DGY A;  1RTU A;  2AAE A;  2KAA A;  1B2Z A;  1BRJ A;  2HOH A;  4GSP A;  8RNT A;  3AHW A;  1I2G A;  3AGN A;  1RMS A;  2F5W A;  3AGO A;  1JBR A;  1GOY A;  1JBT A;  3GSP A;  5HOH A;  1DET A;  1SAR A;  2BU4 A;  4BU4 A;  1BRK A;  3AHS A;  1BRI A;  1RGA A;  1T2I A;  2F56 A;  1I2E A;  4J5K A;  4HOH A;  1FW7 A;  1I8V A;  2BIR A;  1B2X A;  1LOW A;  5BIR A;  1RDS A;  1BRN L;  1GOV A;  1T2H A;  1RGF A;  5BU4 A;  4RNT A;  1BRS A;  3SYU A;  2KF5 A;  1HZ1 A;  1RGL A;  1BSA A;  7GSP A;  3HOH A;  1GMP A;  2SAR A;  1A2P A;  1AY7 A;  1B27 A;  1PY3 A;  1RCL A;  1BSC A;  1GMQ A;  1RCK A;  1BIR A;  9RNT A;  4BIR A;  1BSE A;  3D5I A;  2RBI A;  1ZGX A;  1DE3 A;  1RLS A;  4HAA A;  3BIR A;  2KF4 A;  1B2U A;  1B2S A;  1AQZ A;  1FZU A;  1UCK A;  1X1U A;  1B2M A;  1X1Y A;  1BVI A;  3Q3F A;  1X1X A;  1BNG A;  1LRA A;  1RHL A;  1FUT A;  2F4Y A;  1B20 A;  1RNB A;  1CH0 A;  1YGW A;  1C54 A;  1IYY A;  1BOX A;  1RGG A;  1I3I A;  1RGK A;  1HYF A;  1BNE A;  3D5G A;  1BAO A;  1BSB A;  3DH2 A;  2KF6 A;  1TTO A;  1BSD A;  2GSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...