1YVSA

Trimeric domain swapped barnase
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BARNASE
publication title Trimeric domain-swapped barnase.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Endonuclease
total genus 23
structure length 108
sequence length 108
ec nomenclature ec 3.1.27.-:
pdb deposition date 1998-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1yvsA00
1UCKA 1BNJA 1CH0A 1I0XA 1I3IA 1BNGA 3AGOA 7RNTA 1MGWA 3WHOA 5HOHA 1RTUA 1FUTA 1B2SA 2KF4A 1BNIA 1T2IA 1I2EA 2F4YA 3BU4A 1IYYA 3RNTA 1DE3A 1HZ1A 1BSDA 1BVIA 1B3SA 1RNTA 4J5KA 2BIRA 1DETA 1RGLA 1I2GA 7GSPA 2RBIA 3URPA 1GMQA 1PY3A 1A2PA 2KF6A 1LRAA 5BIRA 1RGKA 1BRIA 4HOHA 1BNEA 5RNTA 1RCKA 1I0VA 1GMRA 1B21A 1BSEA 2C4BA 1BRKA 1JBSA 1RGHA 1SARA 1TRPA 1BNFA 1RSNA 5BU4A 3D5IA 1I70A 1BSAA 1AY7A 2GSPA 1RGEA 1B2XA 1RN4A 4RNTA 1LOVA 3AGNA 1FW7A 3AHSA 1FZUA 1JBRA 1B27A 1B2UA 4GSPA 1RCLA 2BU4A 3DGYA 3HOHA 4GHOA 1BNRA 6GSPA 1RN1A 2RNTA 1R4YA 2AADA 1BUJA 2KF3A 1YGWA 9RNTA 4J5GA 4BIRA 1BNSA 3KCHA 1BAOA 1FUSA 1GSPA 1BRGA 1BSCA 1RGFA 1UCJA 1BRNL 1BRHA 2KAAA 1ZGXA 1MGRA 1X1WA 1BRSA 3D4AA 3SYUA 1B2MA 2F56A 1I3FA 1X1UA 1X1XA 2F5MA 1GOUA 1YVSA 2SARA 1X1YA 1I8VA 1RGGA 1YNVX 3DH2A 1UCIA 1G02A 6RNTA 1RGCA 1RGAA 1RMSA 3GSPA 3WR2A 1BIRA 1BSBA 1BANA 2HOHA 1HYFA 3A5EA 1BRJA 1Q9EA 1T2HA 1LOYA 1RNBA 1AQZA 1RDSA 1C54A 1B20A 3AHWA 1LNIA 2ZA4A 4BU4A 1BGSA 1BU4A 1GMPA 1BOXA 1LOWA 1JBTA 1B2ZA 2KF5A 3D5GA 2F5WA 4HAAA 3Q3FA 1PYLA 1I2FA 1FYSA 1GOVA 2AAEA 1UCLA 1RLSA 1TRQA 8RNTA 1GOYA 5GSPA 1RHLA 1TTOA 3BIRA
chains in the Genus database with same CATH superfamily
2OWPA 1UCKA 3FCSB 3K9MC 1D6YA 1I0XA 3PZWA 1I3IA 1GD4A 2MC8A 1QVF2 5M18A 3EBTA 4QWTA 1RTUA 1VZZA 4HYZA 1E3RA 4H3UA 4K61A 3PXMA 4N6UA 1RJOA 1I2EA 1T2IA 1U5OA 2A15A 2F4YA 3GZBA 3NQYA 3NX0A 3O8YA 4AKYA 1VQM3 3CCV3 1DETA 3D9RA 3N8BA 1CEWI 3N9HA 5IEPA 1I2GA 3H3HA 2F99A 3S28A 2KCDA 5ELJA 3OW22 1FUWA 2WGQA 3EQQB 3RGRA 7GSPA 2C10A 1UW1A 3URPA 1PY3A 2CFGA 2Z76A 5BIRA 1Q864 2GU1A 1K41A 1BRIA 2QGUA 1TFOA 1JJ22 4BTYA 1V57A 1E97A 5RNTA 2OQEC 3SXXA 4XM4A 1LXEA 3FF0A 5G1KA 1B21A 1BSEA 2C4BA 1BRKA 3F7SA 1RGHA 2Y73A 1O7MB 1AR0A 4O2HA 1UI8A 3CC43 2BO9B 1K734 2E2TA 3D5IA 4KFDA 2H0IA 5BU4A 2IMJA 1BSAA 3LMLA 3GZRA 4HM2B 3F8HA 2HMNB 4L8OA 3LOYA 3ROBA 3ZG0A 5BVBA 1KC84 1Q824 1B2XA 2CWUA 2K0MA 4WP5A 3DXOA 5KP3A 2CH9A 1RRLA 4FMCA 3WOFB 1OGZA 3WMDA 1UUWB 1GY7A 1B27A 3LT8A 2BU4A 1EG9B 1GYBA 3HOHA 1GS3A 2W9QA 1O7WB 3MSOA 2HMMB 2RNTA 5EEOA 5IERA 3BNEA 1UI7A 1VQ83 1FA3A 1W6GA 1SIIA 1IVUA 4G1MB 1WNHA 3CMA3 1UUGB 3GWRA 3PCRA 1VQP3 4MMZB 1FGOA 1FUSA 1BSCA 5AIHA 2WOFA 2XGLA 1JB4A 5EQLA 4HZ9B 1FGTA 2BNGA 2F98A 1OF5B 4FCZA 2IYJA 2ML6A 4R4KA 3D4AA 2XFSA 5AIGA 4FCJA 3MG1A 3SYUA 3X42A 1B2MA 1VQ73 1PU4A 1M904 2OTL3 3SX1A 4BTWA 5CLKA 1QVG2 1X1UA 1X1XA 4WWUC 2CIUA 5DRVA 3MKIA 1IDPA 3EC9A 3KN4A 3EN1B 3SEDA 3VSYA 1MWUA 1RGGA 2E2UA 3DH2A 4CCVA 1SQWA 4R1KA 1RGCA 3NV0B 1ROAA 2XRXB 3WR2A 3FSDA 7STDA 5G1LA 5JBSA 2R4IA 4O3VA 3UL5A 4LGQA 4AEQA 5AYRB 1T2HA 4J8TA 1IQYA 4X2HA 2QEX3 3MWZA 4HM8B 5JPUA 3EF8A 1AQZA 1N9EA 2D1WA 1C54A 5M1AA 2CFDA 4BL3A 1JRQA 1OUNA 2ZA4A 4XDWA 4BU4A 2IUKA 1YHQ3 1GMPA 4PEJA 3EJVA 3SLUA 4CPKA 1LOXA 2Q07A 4KT3B 3LXUX 3ALAA 1W4NA 3X3YA 1KD14 5TGNA 1DYUA 3KE7A 4HM6B 2AAEA 1GOVA 2BMQB 2JDIH 3A76A 1YI23 1UDII 3KFQC 1Q40A 1TRQA 1DMMA 2W9PA 2Z6BA 3LTCA 8RNTA 4R9KA 1DVCA 2HOHA 5IW9A 2PNCA 2CC3A 4LEHA 1VQ43 1ISKA 5LC7A 1BNJA 1DMQA 5HOHA 1BNGA 1JZDA 2MF7A 1MGWA 1A67A 1W6YA 3UNLA 1ZX2A 1F8NA 4LYLB 3DUKA 1NU3A 3Q90A 4KZ1A 3G6E3 3UL6A 1V74A 2L1SA 2RFRA 4MEIA 3CCS3 4LZIA 1DE3A 1RNTA 1OPYA 1SJWA 4J5KA 2BIRA 2OQEA 3KSPA 3CCR3 3MG3A 2RBIA 3FF2A 4EXRA 1EKMA 1JV2B 1TP6A 3HIGA 2CG0A 1GMQA 2CFLA 1A2PA 1LRAA 1NNVA 3FG3A 1QMAA 3JUPA 1WMOA 3FGYA 4HOHA 5ELUA 3DGLA 3STDA 1BNEA 1Q814 1BUQA 1RCKA 3CCL3 5KP1A 1W6CA 1GMRA 5IF6A 2CKFB 1JBSA 1SARA 1ZS7A 1JKGA 1N8QA 3IMAB 1I70A 1CQSA 2CX1A 4NPBA 4U13A 1IK3A 5M19A 3T0UA 5FGOA 2GSPA 1RGEA 1WMNA 3B4PA 3JVCA 4DKIA 2CWTA 3X41A 3WOEB 3X3ZA 1L5GB 4IPBA 1VQ63 1NB3I 4RNTA 4N6OB 1FW7A 3AHSA 4K1VA 1S5AA 1FGMA 3CC73 2CW9A 1B2UA 2LYXA 1W01A 4HM7B 3NBRA 3DGYA 4KVHA 2W2CA 3NM7A 1IVWA 3AMOA 3JUMA 6GSPA 2UGIA 4N6NB 2HMLB 1YIJ3 2AADA 2XFTA 4J5GA 2W56B 1N9JA 4OUQA 1O7GB 4ILFA 1BNSA 2GU3A 1JB5A 4BIRA 3KCHA 3T8UA 4EV2A 2P0XA 2OTJ3 1K9M4 1YGEA 1UCJA 1KWIA 1BRNL 1BRHA 2H0HA 3L0RA 5I97A 2XF3A 1VQQA 1JN5A 1MGRA 2SBLA 2XGNA 4FCMA 3I0YA 3S27A 1EUIC 1UGIA 3H51A 3CC23 1VQL3 1STDA 4K1UA 1IVVA 5AEUB 1NO3A 2HMOB 2CG1A 1E3VA 3LH4A 3DMCA 1I8VA 1ZO2A 4GB5A 3U97A 1NWWA 1W00A 1G0TA 1TIJA 2RSXA 1OGXA 3DZLA 1RMSA 3BNCA 3WDGB 1VQK3 1K8A4 1IT7A 3E99A 1HYFA 3DGOA 2J8XB 3A5EA 3UB1A 3CPOA 4ZM8A 3S67A 2ZL8A 1RDSA 3J7Yd 3NBBA 5D83A 3AHWA 3BNDA 4WYKB 4WHAA 1M9GA 2UUGC 1QAFA 1EA2A 4HVNA 3KIIA 3GZXB 3OXAA 1B2ZA 1DMNA 2KF5A 3EN8A 4XB5A 5JPPA 3CCU3 3ECFA 4HAAA 1IT8A 4X2OA 4EYCA 1JZOA 3CME3 3CCJ3 1PYLA 1W5ZA 1YVBI 4Q53A 1SIHA 3D3LA 3G713 4HBRA 1N5PA 3B4OA 1UCLA 3UJMA 1JB2A 1VQ93 2LQVA 2XEPA 1A2VA 3EHCA 2KRTA 4XBYA 5GSPA 3G4S3 4CDLA 5IG0A 1EQKA 4OK0A 1CH0A 2CWVA 2P0MA 4J9AA 3AGOA 3I563 4N6LA 4ORLA 4TX4A 1HU9A 2XR8B 3DY5A 1VQO3 2KF4A 1IYYA 4MMXB 4R9LA 1HZ1A 1BSDA 1BVIA 2V1LA 3DGNA 3N54B 5G2GA 5AEWB 4HM0B 1A2KA 6STDA 3WA3A 4XBTA 1NJI4 1MOLA 2I9WA 2WGOA 4N6TA 1MWSA 3HI7A 3FH1A 3FLJA 3X3XA 3EE1A 1J2BA 3PGBA 3GAXA 2IUJA 3CPW2 1CYUA 2GEXA 3X40A 2RCDA 1IQXA 5CXOA 2INXA 1Z1SA 3CCQ3 2BMRB 1I0VA 1TU5A 2BMOB 1T3BA 3KKGA 4IIAA 1S723 3DGMA 3HZPA 3OX9A 2ZDJA 2XSHB 1TRPA 3KSED 1BNFA 1RSNA 1V58A 4L8PA 1AY7A 1T5YA 3EBYA 1RKYA 4LSOA 2GBWB 2CFKA 1KSIA 3K5TA 2R41A 2FNQA 3G8ZA 2RGQA 2F86B 1FZUA 2YFIB 2YX9A 1DVDA 1AVKA 4GSPA 4GHOA 3GRDA 4FR9A 2BT3A 3LTBA 3HK4A 1BNRA 1RN1A 1IV9A 3FKAA 2KF3A 5CF2A 2IA7A 2E2VA 5STDA 1JNQA 3MHEA 3NHXA 1BAOA 4HKVB 1NB5I 2YFLB 1OF5A 2Z7AA 3OWYA 5D81A 5IG3A 3NBJA 2CK3H 1X1WA 1N8R4 1FGQA 2D42A 4EW5A 2QA43 4OVMA 2F56A 1GD3A 1R4CA 1MNLA 1HKXA 3ZFZA 2SARA 3RDEA 4MJDA 3NV0A 1CYVA 3ZG5A 1UGHI 1UCIA 3ER7A 1G02A 2WO0A 3VGNA 3VF1A 2L4VA 1RGAA 3GSPA 1QAKA 1W2ZA 2B24B 1BANA 4KFFA 4EV5A 4LMIA 2WOHA 3HIIA 5LC6A 2ZHXB 1O7HB 2CHCA 1LOYA 1B20A 3JUNA 3PCSA 3NXJA 2KXGA 2K54A 1BGSA 2W6JH 2CX0A 4MMYB 1LOWA 2Y74A 3TDGA 2OOVC 4R80A 1MWRA 2C11A 3NUVA 5CF1A 1W2B2 2BHMA 1M1K4 1WTHA 2W0QA 3Q3FA 3NM2A 4FMDA 3BNBA 1K28A 2O9UX 1YIT3 1AVLA 3OWUA 4KFEA 1FYSA 2FXTA 2ML5A 3OWSA 1VQN3 1RLSA 3LTDA 1PFPA 3HX8A 1TJDA 1TTOA 3BIRA 2P38A 1Q40B 1M1XB 5HGRA 5CK6A 1YJ93 3WA2X 7RNTA 1QALA 2OCTA 3WHOA 1OHSA 1RN7A 4EC6A 4BTXA 1NDOB 5FW5A 1ULJB 5A0OB 5KP4A 3F9SA 1IQ8A 3IJEB 3CU3A 4O8SA 3S5CA 1FUTA 4H61A 1B2SA 4JF8A 5BXQA 1BNIA 1LQGC 4IT7A 3BU4A 1C7HA 3IPTA 2STDA 3RNTA 1Q7Y4 3CD63 5AYSC 3DM8A 1B3SA 5IG5A 4AKZA 1OHPA 1RGLA 1W7CA 3FG1A 1Q7HA 3Q1CA 3Q2PA 3MYTA 3CCE3 3EX9A 4RBNA 2KF6A 3PYJA 1YJW3 1RGKA 3GZYB 3WODG 1VQ53 5IG4A 2HMJB 4XDVA 1LNHA 1N5HA 4N3VA 3KZTA 4FMAA 1W02A 4N6MA 2XSOB 3JUOA 4RNZA 4NHFA 5AIFA 5DREA 4STDA 1GY5A 1TUHA 2W04A 1D6UA 3CNMA 1QJGA 3SOAA 2Z77A 1OH0A 1JKGB 2GXFA 4WFOA 2P05A 4BL2A 5EVHA 1A90A 5IENA 1IVXA 3I553 1GY6A 3F40A 3MPHA 1RRHA 4HM3B 1RN4A 3EB8A 1LOVA 3AGNA 5AI1A 5D82A 3U1WA 1JBRA 3K7CA 1ULIB 4HZBB 4EBGA 1D6ZA 1RCLA 3V99A 3CCM3 3M8CA 1WQLB 4K90B 1ASKA 3B8LA 2QIYA 4O02B 2W56A 3F8XA 3G16A 3LT9A 1R4YA 1BUJA 1YGWA 3AMOB 9RNTA 1SPUA 3SOYA 1TFKA 3V92A 2XH9A 1GSPA 1RGFA 1BRGA 4RNYA 1YJN3 4CJNA 3K63A 3QRDA 1EEJA 1STFI 1ZGXA 2IY2A 2KAAA 3S29A 3BLZA 1OCVA 2JQ5A 3JUQA 3CNXA 3OV4A 4HM5B 1BRSA 4I5QA 3D79A 1LVNA 1IV7A 3CXC2 2B1XB 2H0GA 3QK9A 1G96A 1JN5B 2GBXB 4JRFA 1I3FA 3SVAA 2F5MA 1AV4A 1GOUA 2GEYA 1YVSA 3LTAA 4HM1B 1X1YA 4RZMA 1YNVX 3RGAA 4HJLB 3V98A 6RNTA 1OHOA 3FG4A 1Y4KA 2FGTA 1UUVB 1BIRA 4NREA 3B7CA 3K0ZA 1BSBA 1ROVA 1US1A 2CFWA 2K3DA 2W03A 3MG2A 5AIIA 2OOVA 4GL6A 3F14A 1BRJA 1Q9EA 2O3OA 2M7OA 1WMPA 4L7KA 3LZAA 5IEOA 1O7PB 1RNBA 4WYKA 8CHOA 1LNIA 4FMBA 4XBXA 3NQZA 3LYGA 4I4KA 1O7NB 3PS8A 1KQS2 1BU4A 2PZVA 1BOXA 1JBTA 3G0KA 3BB9A 3D5GA 2F5WA 3F7XA 2UX0A 4HM4B 1LQMB 1IU7A 2P09A 1I2FA 3FZWA 1OACA 1Q42A 1MWTA 2HMKB 4N6V0 3T8NA 1GOYA 1RHLA 2YFJB 1FGRA 1U8CB
chains in the Genus database with same CATH topology
1UCKA 1BNJA 1CH0A 1I0XA 1I3IA 1BNGA 3AGOA 7RNTA 1MGWA 3WHOA 5HOHA 1RTUA 1FUTA 1B2SA 2KF4A 1BNIA 1T2IA 1I2EA 2F4YA 3BU4A 1IYYA 3RNTA 1DE3A 1HZ1A 1BSDA 1BVIA 1B3SA 1RNTA 4J5KA 2BIRA 1DETA 1RGLA 1I2GA 7GSPA 2RBIA 3URPA 1GMQA 1PY3A 1A2PA 2KF6A 1LRAA 5BIRA 1RGKA 1BRIA 4HOHA 1BNEA 5RNTA 1RCKA 1I0VA 1GMRA 1B21A 1BSEA 2C4BA 1BRKA 1JBSA 1RGHA 1SARA 1TRPA 1BNFA 1RSNA 5BU4A 3D5IA 1I70A 1BSAA 1AY7A 2GSPA 1RGEA 1B2XA 1RN4A 4RNTA 1LOVA 3AGNA 1FW7A 3AHSA 1FZUA 1JBRA 1B27A 1B2UA 4GSPA 1RCLA 2BU4A 3DGYA 3HOHA 4GHOA 1BNRA 6GSPA 1RN1A 2RNTA 1R4YA 2AADA 1BUJA 2KF3A 1YGWA 9RNTA 4J5GA 4BIRA 1BNSA 3KCHA 1BAOA 1FUSA 1GSPA 1BRGA 1BSCA 1RGFA 1UCJA 1BRNL 1BRHA 2KAAA 1ZGXA 1MGRA 1X1WA 1BRSA 3D4AA 3SYUA 1B2MA 2F56A 1I3FA 1X1UA 1X1XA 2F5MA 1GOUA 1YVSA 2SARA 1X1YA 1I8VA 1RGGA 1YNVX 3DH2A 1UCIA 1G02A 6RNTA 1RGCA 1RGAA 1RMSA 3GSPA 3WR2A 1BIRA 1BSBA 1BANA 2HOHA 1HYFA 3A5EA 1BRJA 1Q9EA 1T2HA 1LOYA 1RNBA 1AQZA 1RDSA 1C54A 1B20A 3AHWA 1LNIA 2ZA4A 4BU4A 1BGSA 1BU4A 1GMPA 1BOXA 1LOWA 1JBTA 1B2ZA 2KF5A 3D5GA 2F5WA 4HAAA 3Q3FA 1PYLA 1I2FA 1FYSA 1GOVA 2AAEA 1UCLA 1RLSA 1TRQA 8RNTA 1GOYA 5GSPA 1RHLA 1TTOA 3BIRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UCK A;  1BNJ A;  1CH0 A;  1I0X A;  1I3I A;  1BNG A;  3AGO A;  7RNT A;  1MGW A;  3WHO A;  5HOH A;  1RTU A;  1FUT A;  1B2S A;  2KF4 A;  1BNI A;  1T2I A;  1I2E A;  2F4Y A;  3BU4 A;  1IYY A;  3RNT A;  1DE3 A;  1HZ1 A;  1BSD A;  1BVI A;  1B3S A;  1RNT A;  4J5K A;  2BIR A;  1DET A;  1RGL A;  1I2G A;  7GSP A;  2RBI A;  3URP A;  1GMQ A;  1PY3 A;  1A2P A;  2KF6 A;  1LRA A;  5BIR A;  1RGK A;  1BRI A;  4HOH A;  1BNE A;  5RNT A;  1RCK A;  1I0V A;  1GMR A;  1B21 A;  1BSE A;  2C4B A;  1BRK A;  1JBS A;  1RGH A;  1SAR A;  1TRP A;  1BNF A;  1RSN A;  5BU4 A;  3D5I A;  1I70 A;  1BSA A;  1AY7 A;  2GSP A;  1RGE A;  1B2X A;  1RN4 A;  4RNT A;  1LOV A;  3AGN A;  1FW7 A;  3AHS A;  1FZU A;  1JBR A;  1B27 A;  1B2U A;  4GSP A;  1RCL A;  2BU4 A;  3DGY A;  3HOH A;  4GHO A;  1BNR A;  6GSP A;  1RN1 A;  2RNT A;  1R4Y A;  2AAD A;  1BUJ A;  2KF3 A;  1YGW A;  9RNT A;  4J5G A;  4BIR A;  1BNS A;  3KCH A;  1BAO A;  1FUS A;  1GSP A;  1BRG A;  1BSC A;  1RGF A;  1UCJ A;  1BRN L;  1BRH A;  2KAA A;  1ZGX A;  1MGR A;  1X1W A;  1BRS A;  3D4A A;  3SYU A;  1B2M A;  2F56 A;  1I3F A;  1X1U A;  1X1X A;  2F5M A;  1GOU A;  1YVS A;  2SAR A;  1X1Y A;  1I8V A;  1RGG A;  1YNV X;  3DH2 A;  1UCI A;  1G02 A;  6RNT A;  1RGC A;  1RGA A;  1RMS A;  3GSP A;  3WR2 A;  1BIR A;  1BSB A;  1BAN A;  2HOH A;  1HYF A;  3A5E A;  1BRJ A;  1Q9E A;  1T2H A;  1LOY A;  1RNB A;  1AQZ A;  1RDS A;  1C54 A;  1B20 A;  3AHW A;  1LNI A;  2ZA4 A;  4BU4 A;  1BGS A;  1BU4 A;  1GMP A;  1BOX A;  1LOW A;  1JBT A;  1B2Z A;  2KF5 A;  3D5G A;  2F5W A;  4HAA A;  3Q3F A;  1PYL A;  1I2F A;  1FYS A;  1GOV A;  2AAE A;  1UCL A;  1RLS A;  1TRQ A;  8RNT A;  1GOY A;  5GSP A;  1RHL A;  1TTO A;  3BIR A; 
#chains in the Genus database with same CATH topology
 2OWP A;  1UCK A;  3FCS B;  3K9M C;  1D6Y A;  1I0X A;  3PZW A;  1I3I A;  1GD4 A;  2MC8 A;  1QVF 2;  5M18 A;  3EBT A;  4QWT A;  1RTU A;  1VZZ A;  4HYZ A;  1E3R A;  4H3U A;  4K61 A;  3PXM A;  4N6U A;  1RJO A;  1I2E A;  1T2I A;  1U5O A;  2A15 A;  2F4Y A;  3GZB A;  3NQY A;  3NX0 A;  3O8Y A;  4AKY A;  1VQM 3;  3CCV 3;  1DET A;  3D9R A;  3N8B A;  1CEW I;  3N9H A;  5IEP A;  1I2G A;  3H3H A;  2F99 A;  3S28 A;  2KCD A;  5ELJ A;  3OW2 2;  1FUW A;  2WGQ A;  3EQQ B;  3RGR A;  7GSP A;  2C10 A;  1UW1 A;  3URP A;  1PY3 A;  2CFG A;  2Z76 A;  5BIR A;  1Q86 4;  2GU1 A;  1K41 A;  1BRI A;  2QGU A;  1TFO A;  1JJ2 2;  4BTY A;  1V57 A;  1E97 A;  5RNT A;  2OQE C;  3SXX A;  4XM4 A;  1LXE A;  3FF0 A;  5G1K A;  1B21 A;  1BSE A;  2C4B A;  1BRK A;  3F7S A;  1RGH A;  2Y73 A;  1O7M B;  1AR0 A;  4O2H A;  1UI8 A;  3CC4 3;  2BO9 B;  1K73 4;  2E2T A;  3D5I A;  4KFD A;  2H0I A;  5BU4 A;  2IMJ A;  1BSA A;  3LML A;  3GZR A;  4HM2 B;  3F8H A;  2HMN B;  4L8O A;  3LOY A;  3ROB A;  3ZG0 A;  5BVB A;  1KC8 4;  1Q82 4;  1B2X A;  2CWU A;  2K0M A;  4WP5 A;  3DXO A;  5KP3 A;  2CH9 A;  1RRL A;  4FMC A;  3WOF B;  1OGZ A;  3WMD A;  1UUW B;  1GY7 A;  1B27 A;  3LT8 A;  2BU4 A;  1EG9 B;  1GYB A;  3HOH A;  1GS3 A;  2W9Q A;  1O7W B;  3MSO A;  2HMM B;  2RNT A;  5EEO A;  5IER A;  3BNE A;  1UI7 A;  1VQ8 3;  1FA3 A;  1W6G A;  1SII A;  1IVU A;  4G1M B;  1WNH A;  3CMA 3;  1UUG B;  3GWR A;  3PCR A;  1VQP 3;  4MMZ B;  1FGO A;  1FUS A;  1BSC A;  5AIH A;  2WOF A;  2XGL A;  1JB4 A;  5EQL A;  4HZ9 B;  1FGT A;  2BNG A;  2F98 A;  1OF5 B;  4FCZ A;  2IYJ A;  2ML6 A;  4R4K A;  3D4A A;  2XFS A;  5AIG A;  4FCJ A;  3MG1 A;  3SYU A;  3X42 A;  1B2M A;  1VQ7 3;  1PU4 A;  1M90 4;  2OTL 3;  3SX1 A;  4BTW A;  5CLK A;  1QVG 2;  1X1U A;  1X1X A;  4WWU C;  2CIU A;  5DRV A;  3MKI A;  1IDP A;  3EC9 A;  3KN4 A;  3EN1 B;  3SED A;  3VSY A;  1MWU A;  1RGG A;  2E2U A;  3DH2 A;  4CCV A;  1SQW A;  4R1K A;  1RGC A;  3NV0 B;  1ROA A;  2XRX B;  3WR2 A;  3FSD A;  7STD A;  5G1L A;  5JBS A;  2R4I A;  4O3V A;  3UL5 A;  4LGQ A;  4AEQ A;  5AYR B;  1T2H A;  4J8T A;  1IQY A;  4X2H A;  2QEX 3;  3MWZ A;  4HM8 B;  5JPU A;  3EF8 A;  1AQZ A;  1N9E A;  2D1W A;  1C54 A;  5M1A A;  2CFD A;  4BL3 A;  1JRQ A;  1OUN A;  2ZA4 A;  4XDW A;  4BU4 A;  2IUK A;  1YHQ 3;  1GMP A;  4PEJ A;  3EJV A;  3SLU A;  4CPK A;  1LOX A;  2Q07 A;  4KT3 B;  3LXU X;  3ALA A;  1W4N A;  3X3Y A;  1KD1 4;  5TGN A;  1DYU A;  3KE7 A;  4HM6 B;  2AAE A;  1GOV A;  2BMQ B;  2JDI H;  3A76 A;  1YI2 3;  1UDI I;  3KFQ C;  1Q40 A;  1TRQ A;  1DMM A;  2W9P A;  2Z6B A;  3LTC A;  8RNT A;  4R9K A;  1DVC A;  2HOH A;  5IW9 A;  2PNC A;  2CC3 A;  4LEH A;  1VQ4 3;  1ISK A;  5LC7 A;  1BNJ A;  1DMQ A;  5HOH A;  1BNG A;  1JZD A;  2MF7 A;  1MGW A;  1A67 A;  1W6Y A;  3UNL A;  1ZX2 A;  1F8N A;  4LYL B;  3DUK A;  1NU3 A;  3Q90 A;  4KZ1 A;  3G6E 3;  3UL6 A;  1V74 A;  2L1S A;  2RFR A;  4MEI A;  3CCS 3;  4LZI A;  1DE3 A;  1RNT A;  1OPY A;  1SJW A;  4J5K A;  2BIR A;  2OQE A;  3KSP A;  3CCR 3;  3MG3 A;  2RBI A;  3FF2 A;  4EXR A;  1EKM A;  1JV2 B;  1TP6 A;  3HIG A;  2CG0 A;  1GMQ A;  2CFL A;  1A2P A;  1LRA A;  1NNV A;  3FG3 A;  1QMA A;  3JUP A;  1WMO A;  3FGY A;  4HOH A;  5ELU A;  3DGL A;  3STD A;  1BNE A;  1Q81 4;  1BUQ A;  1RCK A;  3CCL 3;  5KP1 A;  1W6C A;  1GMR A;  5IF6 A;  2CKF B;  1JBS A;  1SAR A;  1ZS7 A;  1JKG A;  1N8Q A;  3IMA B;  1I70 A;  1CQS A;  2CX1 A;  4NPB A;  4U13 A;  1IK3 A;  5M19 A;  3T0U A;  5FGO A;  2GSP A;  1RGE A;  1WMN A;  3B4P A;  3JVC A;  4DKI A;  2CWT A;  3X41 A;  3WOE B;  3X3Z A;  1L5G B;  4IPB A;  1VQ6 3;  1NB3 I;  4RNT A;  4N6O B;  1FW7 A;  3AHS A;  4K1V A;  1S5A A;  1FGM A;  3CC7 3;  2CW9 A;  1B2U A;  2LYX A;  1W01 A;  4HM7 B;  3NBR A;  3DGY A;  4KVH A;  2W2C A;  3NM7 A;  1IVW A;  3AMO A;  3JUM A;  6GSP A;  2UGI A;  4N6N B;  2HML B;  1YIJ 3;  2AAD A;  2XFT A;  4J5G A;  2W56 B;  1N9J A;  4OUQ A;  1O7G B;  4ILF A;  1BNS A;  2GU3 A;  1JB5 A;  4BIR A;  3KCH A;  3T8U A;  4EV2 A;  2P0X A;  2OTJ 3;  1K9M 4;  1YGE A;  1UCJ A;  1KWI A;  1BRN L;  1BRH A;  2H0H A;  3L0R A;  5I97 A;  2XF3 A;  1VQQ A;  1JN5 A;  1MGR A;  2SBL A;  2XGN A;  4FCM A;  3I0Y A;  3S27 A;  1EUI C;  1UGI A;  3H51 A;  3CC2 3;  1VQL 3;  1STD A;  4K1U A;  1IVV A;  5AEU B;  1NO3 A;  2HMO B;  2CG1 A;  1E3V A;  3LH4 A;  3DMC A;  1I8V A;  1ZO2 A;  4GB5 A;  3U97 A;  1NWW A;  1W00 A;  1G0T A;  1TIJ A;  2RSX A;  1OGX A;  3DZL A;  1RMS A;  3BNC A;  3WDG B;  1VQK 3;  1K8A 4;  1IT7 A;  3E99 A;  1HYF A;  3DGO A;  2J8X B;  3A5E A;  3UB1 A;  3CPO A;  4ZM8 A;  3S67 A;  2ZL8 A;  1RDS A;  3J7Y d;  3NBB A;  5D83 A;  3AHW A;  3BND A;  4WYK B;  4WHA A;  1M9G A;  2UUG C;  1QAF A;  1EA2 A;  4HVN A;  3KII A;  3GZX B;  3OXA A;  1B2Z A;  1DMN A;  2KF5 A;  3EN8 A;  4XB5 A;  5JPP A;  3CCU 3;  3ECF A;  4HAA A;  1IT8 A;  4X2O A;  4EYC A;  1JZO A;  3CME 3;  3CCJ 3;  1PYL A;  1W5Z A;  1YVB I;  4Q53 A;  1SIH A;  3D3L A;  3G71 3;  4HBR A;  1N5P A;  3B4O A;  1UCL A;  3UJM A;  1JB2 A;  1VQ9 3;  2LQV A;  2XEP A;  1A2V A;  3EHC A;  2KRT A;  4XBY A;  5GSP A;  3G4S 3;  4CDL A;  5IG0 A;  1EQK A;  4OK0 A;  1CH0 A;  2CWV A;  2P0M A;  4J9A A;  3AGO A;  3I56 3;  4N6L A;  4ORL A;  4TX4 A;  1HU9 A;  2XR8 B;  3DY5 A;  1VQO 3;  2KF4 A;  1IYY A;  4MMX B;  4R9L A;  1HZ1 A;  1BSD A;  1BVI A;  2V1L A;  3DGN A;  3N54 B;  5G2G A;  5AEW B;  4HM0 B;  1A2K A;  6STD A;  3WA3 A;  4XBT A;  1NJI 4;  1MOL A;  2I9W A;  2WGO A;  4N6T A;  1MWS A;  3HI7 A;  3FH1 A;  3FLJ A;  3X3X A;  3EE1 A;  1J2B A;  3PGB A;  3GAX A;  2IUJ A;  3CPW 2;  1CYU A;  2GEX A;  3X40 A;  2RCD A;  1IQX A;  5CXO A;  2INX A;  1Z1S A;  3CCQ 3;  2BMR B;  1I0V A;  1TU5 A;  2BMO B;  1T3B A;  3KKG A;  4IIA A;  1S72 3;  3DGM A;  3HZP A;  3OX9 A;  2ZDJ A;  2XSH B;  1TRP A;  3KSE D;  1BNF A;  1RSN A;  1V58 A;  4L8P A;  1AY7 A;  1T5Y A;  3EBY A;  1RKY A;  4LSO A;  2GBW B;  2CFK A;  1KSI A;  3K5T A;  2R41 A;  2FNQ A;  3G8Z A;  2RGQ A;  2F86 B;  1FZU A;  2YFI B;  2YX9 A;  1DVD A;  1AVK A;  4GSP A;  4GHO A;  3GRD A;  4FR9 A;  2BT3 A;  3LTB A;  3HK4 A;  1BNR A;  1RN1 A;  1IV9 A;  3FKA A;  2KF3 A;  5CF2 A;  2IA7 A;  2E2V A;  5STD A;  1JNQ A;  3MHE A;  3NHX A;  1BAO A;  4HKV B;  1NB5 I;  2YFL B;  1OF5 A;  2Z7A A;  3OWY A;  5D81 A;  5IG3 A;  3NBJ A;  2CK3 H;  1X1W A;  1N8R 4;  1FGQ A;  2D42 A;  4EW5 A;  2QA4 3;  4OVM A;  2F56 A;  1GD3 A;  1R4C A;  1MNL A;  1HKX A;  3ZFZ A;  2SAR A;  3RDE A;  4MJD A;  3NV0 A;  1CYV A;  3ZG5 A;  1UGH I;  1UCI A;  3ER7 A;  1G02 A;  2WO0 A;  3VGN A;  3VF1 A;  2L4V A;  1RGA A;  3GSP A;  1QAK A;  1W2Z A;  2B24 B;  1BAN A;  4KFF A;  4EV5 A;  4LMI A;  2WOH A;  3HII A;  5LC6 A;  2ZHX B;  1O7H B;  2CHC A;  1LOY A;  1B20 A;  3JUN A;  3PCS A;  3NXJ A;  2KXG A;  2K54 A;  1BGS A;  2W6J H;  2CX0 A;  4MMY B;  1LOW A;  2Y74 A;  3TDG A;  2OOV C;  4R80 A;  1MWR A;  2C11 A;  3NUV A;  5CF1 A;  1W2B 2;  2BHM A;  1M1K 4;  1WTH A;  2W0Q A;  3Q3F A;  3NM2 A;  4FMD A;  3BNB A;  1K28 A;  2O9U X;  1YIT 3;  1AVL A;  3OWU A;  4KFE A;  1FYS A;  2FXT A;  2ML5 A;  3OWS A;  1VQN 3;  1RLS A;  3LTD A;  1PFP A;  3HX8 A;  1TJD A;  1TTO A;  3BIR A;  2P38 A;  1Q40 B;  1M1X B;  5HGR A;  5CK6 A;  1YJ9 3;  3WA2 X;  7RNT A;  1QAL A;  2OCT A;  3WHO A;  1OHS A;  1RN7 A;  4EC6 A;  4BTX A;  1NDO B;  5FW5 A;  1ULJ B;  5A0O B;  5KP4 A;  3F9S A;  1IQ8 A;  3IJE B;  3CU3 A;  4O8S A;  3S5C A;  1FUT A;  4H61 A;  1B2S A;  4JF8 A;  5BXQ A;  1BNI A;  1LQG C;  4IT7 A;  3BU4 A;  1C7H A;  3IPT A;  2STD A;  3RNT A;  1Q7Y 4;  3CD6 3;  5AYS C;  3DM8 A;  1B3S A;  5IG5 A;  4AKZ A;  1OHP A;  1RGL A;  1W7C A;  3FG1 A;  1Q7H A;  3Q1C A;  3Q2P A;  3MYT A;  3CCE 3;  3EX9 A;  4RBN A;  2KF6 A;  3PYJ A;  1YJW 3;  1RGK A;  3GZY B;  3WOD G;  1VQ5 3;  5IG4 A;  2HMJ B;  4XDV A;  1LNH A;  1N5H A;  4N3V A;  3KZT A;  4FMA A;  1W02 A;  4N6M A;  2XSO B;  3JUO A;  4RNZ A;  4NHF A;  5AIF A;  5DRE A;  4STD A;  1GY5 A;  1TUH A;  2W04 A;  1D6U A;  3CNM A;  1QJG A;  3SOA A;  2Z77 A;  1OH0 A;  1JKG B;  2GXF A;  4WFO A;  2P05 A;  4BL2 A;  5EVH A;  1A90 A;  5IEN A;  1IVX A;  3I55 3;  1GY6 A;  3F40 A;  3MPH A;  1RRH A;  4HM3 B;  1RN4 A;  3EB8 A;  1LOV A;  3AGN A;  5AI1 A;  5D82 A;  3U1W A;  1JBR A;  3K7C A;  1ULI B;  4HZB B;  4EBG A;  1D6Z A;  1RCL A;  3V99 A;  3CCM 3;  3M8C A;  1WQL B;  4K90 B;  1ASK A;  3B8L A;  2QIY A;  4O02 B;  2W56 A;  3F8X A;  3G16 A;  3LT9 A;  1R4Y A;  1BUJ A;  1YGW A;  3AMO B;  9RNT A;  1SPU A;  3SOY A;  1TFK A;  3V92 A;  2XH9 A;  1GSP A;  1RGF A;  1BRG A;  4RNY A;  1YJN 3;  4CJN A;  3K63 A;  3QRD A;  1EEJ A;  1STF I;  1ZGX A;  2IY2 A;  2KAA A;  3S29 A;  3BLZ A;  1OCV A;  2JQ5 A;  3JUQ A;  3CNX A;  3OV4 A;  4HM5 B;  1BRS A;  4I5Q A;  3D79 A;  1LVN A;  1IV7 A;  3CXC 2;  2B1X B;  2H0G A;  3QK9 A;  1G96 A;  1JN5 B;  2GBX B;  4JRF A;  1I3F A;  3SVA A;  2F5M A;  1AV4 A;  1GOU A;  2GEY A;  1YVS A;  3LTA A;  4HM1 B;  1X1Y A;  4RZM A;  1YNV X;  3RGA A;  4HJL B;  3V98 A;  6RNT A;  1OHO A;  3FG4 A;  1Y4K A;  2FGT A;  1UUV B;  1BIR A;  4NRE A;  3B7C A;  3K0Z A;  1BSB A;  1ROV A;  1US1 A;  2CFW A;  2K3D A;  2W03 A;  3MG2 A;  5AII A;  2OOV A;  4GL6 A;  3F14 A;  1BRJ A;  1Q9E A;  2O3O A;  2M7O A;  1WMP A;  4L7K A;  3LZA A;  5IEO A;  1O7P B;  1RNB A;  4WYK A;  8CHO A;  1LNI A;  4FMB A;  4XBX A;  3NQZ A;  3LYG A;  4I4K A;  1O7N B;  3PS8 A;  1KQS 2;  1BU4 A;  2PZV A;  1BOX A;  1JBT A;  3G0K A;  3BB9 A;  3D5G A;  2F5W A;  3F7X A;  2UX0 A;  4HM4 B;  1LQM B;  1IU7 A;  2P09 A;  1I2F A;  3FZW A;  1OAC A;  1Q42 A;  1MWT A;  2HMK B;  4N6V 0;  3T8N A;  1GOY A;  1RHL A;  2YFJ B;  1FGR A;  1U8C B; 
#chains in the Genus database with same CATH homology
 1UCK A;  1BNJ A;  1CH0 A;  1I0X A;  1I3I A;  1BNG A;  3AGO A;  7RNT A;  1MGW A;  3WHO A;  5HOH A;  1RTU A;  1FUT A;  1B2S A;  2KF4 A;  1BNI A;  1T2I A;  1I2E A;  2F4Y A;  3BU4 A;  1IYY A;  3RNT A;  1DE3 A;  1HZ1 A;  1BSD A;  1BVI A;  1B3S A;  1RNT A;  4J5K A;  2BIR A;  1DET A;  1RGL A;  1I2G A;  7GSP A;  2RBI A;  3URP A;  1GMQ A;  1PY3 A;  1A2P A;  2KF6 A;  1LRA A;  5BIR A;  1RGK A;  1BRI A;  4HOH A;  1BNE A;  5RNT A;  1RCK A;  1I0V A;  1GMR A;  1B21 A;  1BSE A;  2C4B A;  1BRK A;  1JBS A;  1RGH A;  1SAR A;  1TRP A;  1BNF A;  1RSN A;  5BU4 A;  3D5I A;  1I70 A;  1BSA A;  1AY7 A;  2GSP A;  1RGE A;  1B2X A;  1RN4 A;  4RNT A;  1LOV A;  3AGN A;  1FW7 A;  3AHS A;  1FZU A;  1JBR A;  1B27 A;  1B2U A;  4GSP A;  1RCL A;  2BU4 A;  3DGY A;  3HOH A;  4GHO A;  1BNR A;  6GSP A;  1RN1 A;  2RNT A;  1R4Y A;  2AAD A;  1BUJ A;  2KF3 A;  1YGW A;  9RNT A;  4J5G A;  4BIR A;  1BNS A;  3KCH A;  1BAO A;  1FUS A;  1GSP A;  1BRG A;  1BSC A;  1RGF A;  1UCJ A;  1BRN L;  1BRH A;  2KAA A;  1ZGX A;  1MGR A;  1X1W A;  1BRS A;  3D4A A;  3SYU A;  1B2M A;  2F56 A;  1I3F A;  1X1U A;  1X1X A;  2F5M A;  1GOU A;  1YVS A;  2SAR A;  1X1Y A;  1I8V A;  1RGG A;  1YNV X;  3DH2 A;  1UCI A;  1G02 A;  6RNT A;  1RGC A;  1RGA A;  1RMS A;  3GSP A;  3WR2 A;  1BIR A;  1BSB A;  1BAN A;  2HOH A;  1HYF A;  3A5E A;  1BRJ A;  1Q9E A;  1T2H A;  1LOY A;  1RNB A;  1AQZ A;  1RDS A;  1C54 A;  1B20 A;  3AHW A;  1LNI A;  2ZA4 A;  4BU4 A;  1BGS A;  1BU4 A;  1GMP A;  1BOX A;  1LOW A;  1JBT A;  1B2Z A;  2KF5 A;  3D5G A;  2F5W A;  4HAA A;  3Q3F A;  1PYL A;  1I2F A;  1FYS A;  1GOV A;  2AAE A;  1UCL A;  1RLS A;  1TRQ A;  8RNT A;  1GOY A;  5GSP A;  1RHL A;  1TTO A;  3BIR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...