1YVSA

Trimeric domain swapped barnase
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Trimeric domain-swapped barnase.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Endonuclease
molecule keywords BARNASE
total genus 23
structure length 108
sequence length 108
ec nomenclature ec 3.1.27.-:
pdb deposition date 1998-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1yvsA00
1B21A 1RN1A 1BRGA 1R4YA 4HAAA 1GOVA 1JBRA 3HOHA 1B27A 4GSPA 2SARA 1LRAA 6GSPA 1RGGA 1RHLA 1BNRA 1I3IA 1PYLA 3A5EA 6RNTA 1DE3A 1LOWA 1BSDA 1LOYA 1RGEA 1B20A 1RGFA 1GMRA 3BU4A 1RGLA 1BAOA 4J5KA 1B2UA 1G02A 1HYFA 2GSPA 1UCLA 3AGOA 1B3SA 1PY3A 1B2SA 2F5MA 2KF6A 3WHOA 7RNTA 3WR2A 1FUTA 1FUSA 1T2HA 1YVSA 1RGKA 1BSEA 2F5WA 5BIRA 1BNFA 1BIRA 1BVIA 1RN4A 1AQZA 2F4YA 2F56A 2KF5A 1JBSA 1BNSA 1BRSA 1RGHA 1RLSA 3GSPA 1RDSA 1T2IA 4GHOA 1RCLA 4BU4A 5BU4A 1RNBA 1BUJA 1JBTA 1Q9EA 1BNGA 1RCKA 1B2MA 1ZGXA 2KF3A 1YNVX 2BIRA 1I2FA 1C54A 1BNEA 1MGWA 1RSNA 4RNTA 3SYUA 1X1XA 2C4BA 2KF4A 3AGNA 1X1WA 5GSPA 1BSBA 1I0XA 1GMQA 3D4AA 3AHSA 1BRJA 1DETA 1UCJA 1I70A 8RNTA 1B2XA 1FYSA 1IYYA 3URPA 5RNTA 1BRKA 1BRHA 1YGWA 1GSPA 1GMPA 2AAEA 2BU4A 1RGCA 1I2GA 1BRNL 1RTUA 9RNTA 1BSAA 2AADA 1TRQA 1RMSA 2RBIA 1X1YA 3Q3FA 1B2ZA 2KAAA 3DH2A 2RNTA 1BNIA 1TRPA 1GOYA 3BIRA 1LNIA 5HOHA 1SARA 3AHWA 1BANA 1RGAA 1RNTA 1UCIA 1X1UA 4J5GA 1BGSA 1BU4A 1I0VA 3RNTA 1BRIA 1UCKA 1FW7A 3DGYA 7GSPA 1AY7A 1HZ1A 1I3FA 1MGRA 3KCHA 3D5GA 1CH0A 4BIRA 2HOHA 1BOXA 1GOUA 3D5IA 2ZA4A 1BSCA 1I2EA 1BNJA 1I8VA 1LOVA 4HOHA 1TTOA 1FZUA 1A2PA
chains in the Genus database with same CATH superfamily
1JNQA 1B21A 3CME3 3EBTA 5ELUA 3HIIA 2MF7A 2H0GA 4HAAA 1NNVA 1QAFA 1U5OA 1M9GA 2BHMA 2Z77A 3HOHA 1SIHA 4CPKA 3I553 3FGYA 1D6YA 4H3UA 3FCSB 1TP6A 1RHLA 4WWUC 3U97A 1EEJA 4N6NB 3CNMA 3LTDA 3A5EA 1KWIA 1W4NA 1DE3A 1LOWA 3OX9A 3F7SA 4GB5A 1O7GB 1KQS2 1G0TA 2K54A 4LMIA 1FGTA 4O8SA 4WYKB 3M8CA 3S67A 3SLUA 1VQ53 3ROBA 5ELJA 4EYCA 1WMOA 2PZVA 3F14A 3NM2A 1YIT3 2P0XA 2GSPA 1T3BA 3MSOA 1UCLA 1MWUA 3AGOA 4HJLB 1O7NB 2F5MA 1FUSA 1T2HA 1UUGB 3F40A 1EG9B 3HZPA 2RCDA 4O02B 2LQVA 4Q53A 2F4YA 1BIRA 2P05A 4AKYA 4K1VA 5BIRA 1BRSA 1RGHA 1W5ZA 4HVNA 1OCVA 1QJGA 1RLSA 1RDSA 1T2IA 2RSXA 3LTCA 4STDA 3CCS3 3CCV3 1RNBA 4GL6A 3KFQC 5AYSC 1BNGA 1KSIA 2K3DA 2HMLB 3OXAA 1JB2A 1YNVX 2IMJA 4R4KA 1I2FA 1Q42A 3G16A 1BNEA 3KSED 1W6CA 1EUIC 1RJOA 2STDA 2FGTA 5GSPA 3PZWA 1LNHA 3UL5A 3V92A 3MG1A 4OUQA 2ZHXB 1IVUA 3BB9A 3TDGA 1CEWI 1NU3A 1OGXA 1DETA 3X3YA 3EX9A 4HM3B 1IK3A 1GYBA 2JDIH 1IYYA 4XBTA 3RGAA 3URPA 1MOLA 1WQLB 3IPTA 3LOYA 5G2GA 3MG2A 2Z76A 5TGNA 2BU4A 2ML5A 3CCR3 4OK0A 5IEPA 1DMNA 4N6V0 2J8XB 1IVWA 1UUWB 3LMLA 1AV4A 2RBIA 2W56A 1B2ZA 2WGQA 2F98A 4LYLB 4KT3B 1JBSA 5IF6A 3CXC2 4RZMA 1Q824 2CG1A 2XFSA 3FG3A 4KFEA 1TJDA 4HM1B 4N6UA 3CPW2 2P09A 2CFDA 1RRHA 2D1WA 3L0RA 1IQYA 2YFJB 1SARA 3SVAA 1X1UA 1BANA 5AIGA 3JUQA 4JRFA 4FCZA 1FUWA 1JZDA 3DGYA 5IEOA 5D81A 3FF0A 5M1AA 4N6MA 3PXMA 5M19A 2IYJA 3DXOA 1RN7A 3VGNA 2YFLB 1TIJA 1BOXA 3BLZA 4ILFA 5CK6A 1JJ22 1VQO3 3G6E3 3UNLA 1BSCA 1GD4A 1US1A 2XSOB 1I2EA 1VQ73 4LSOA 4N3VA 1L5GB 2OTL3 1G96A 1YJN3 1VQL3 4ZM8A 1CQSA 1LOVA 4HOHA 1LQGC 1IV9A 3SOAA 1YJW3 1NO3A 1LOXA 1B27A 1SPUA 1V74A 4GSPA 2SARA 3F7XA 4N6TA 4EV2A 3CCL3 5JBSA 2IA7A 1LQMB 1LRAA 2KXGA 6GSPA 1RGGA 4FCMA 4BTWA 2BO9B 1LXEA 4LZIA 1PYLA 2RGQA 2FXTA 3NBBA 4FMBA 4WP5A 4XBXA 2OQEA 3T0UA 3PYJA 6RNTA 1MWRA 2QGUA 2ZDJA 4XBYA 3S27A 3FZWA 1K28A 3EB8A 3A76A 3DY5A 1LOYA 2KRTA 3NBRA 1MWSA 3KSPA 1VQM3 1NB5I 2JQ5A 4AEQA 1N9JA 2W0QA 3EN1B 1U8CB 3BU4A 1CYVA 5FGOA 1RGLA 3JUMA 2I9WA 3BNBA 4FCJA 1B2UA 1EKMA 4X2HA 2HMOB 3GZRA 4FMCA 2B24B 4XDWA 5AYRB 2XGLA 5BVBA 2OTJ3 1UGIA 1GY6A 4G1MB 2IY2A 2OQEC 3K7CA 4TX4A 1Q7Y4 7RNTA 3FG4A 1FUTA 3BNCA 4CDLA 1BSEA 1W6GA 2F5WA 1E97A 1BNFA 4FMAA 2F56A 4XM4A 1FGOA 2D42A 1O7PB 4HM5B 4HKVB 3F8HA 1W2B2 3CC43 2B1XB 1W02A 1W6YA 1RCLA 2XR8B 1OHOA 3LT9A 3G713 1JBTA 1JB4A 2WOHA 4BTXA 2W9QA 1W7CA 1AVKA 1O7MB 2BMQB 1RCKA 1WNHA 3NXJA 5AEWB 1TU5A 5G1LA 4KVHA 2BIRA 2O9UX 4HZ9B 2R4IA 3CMA3 4O2HA 1YHQ3 4RNTA 1SIIA 3CCJ3 2GEYA 3IJEB 3LZAA 4KZ1A 5EEOA 3MYTA 2C4BA 3SOYA 1X1WA 2XFTA 1Q40B 3GZYB 1TFKA 1I0XA 4OVMA 1M1K4 2OOVC 2CW9A 3D4AA 3D9RA 2XF3A 3AHSA 4J8TA 1UI8A 3WDGB 1FGRA 2ML6A 3B7CA 2PNCA 4RNZA 2KCDA 2XRXB 1B2XA 3ZFZA 2CWTA 3MHEA 3X40A 1STDA 1UGHI 5DREA 1DVDA 1BRKA 5I97A 2W04A 1GSPA 1I2GA 3N8BA 1A90A 1E3RA 1RTUA 5G1KA 4R80A 1EA2A 3EF8A 3LTAA 3S5CA 3NUVA 3O8YA 3WOEB 1X1YA 3Q3FA 1A2KA 1NDOB 3OWSA 3V99A 1Q814 3PS8A 3CC23 3DZLA 4HZBB 3DH2A 3JUOA 5FW5A 2F86B 3OWYA 1JKGA 3N9HA 3B4OA 1Q40A 3AHWA 2UUGC 1UCIA 4BL3A 1S723 3BNDA 2CHCA 4J5GA 1BU4A 1QVF2 1VQ63 2LYXA 2C11A 5CF2A 4HM0B 4K61A 2ZL8A 4XDVA 4L7KA 1JZOA 2CX0A 2OWPA 2SBLA 7GSPA 5M18A 1NB3I 1Y4KA 2MC8A 3CCM3 4WHAA 3NQZA 4LGQA 2Z7AA 3DMCA 3MG3A 3S28A 2M7OA 1GOUA 5KP4A 1N9EA 8CHOA 1FA3A 1VQN3 5LC7A 1N8QA 4K1UA 2XGNA 1I8VA 2OOVA 1YJ93 5CF1A 4XB5A 5IENA 2WGOA 1ZX2A 1W01A 2XH9A 2O3OA 5LC6A 1BRGA 1R4YA 4HM4B 5AIHA 1WMNA 1IDPA 2P0MA 3LT8A 3AMOA 1VQ83 4MMZB 4EXRA 4ORLA 2HMJB 1RKYA 3FF2A 1I3IA 3FG1A 1Q7HA 4CJNA 2W2CA 1K734 1WTHA 1BSDA 4O3VA 5CLKA 3G0KA 1RGFA 3LH4A 3H3HA 3D79A 3ZG5A 3BNEA 4H61A 1GMRA 1DMQA 3Q1CA 5DRVA 4CCVA 1YIJ3 3VF1A 2BNGA 1UDII 3X3XA 3K0ZA 4I5QA 3MWZA 1IQ8A 1R4CA 1PFPA 1TUHA 3T8NA 1OH0A 1YI23 3CU3A 7STDA 3E99A 1B3SA 1PY3A 1ULJB 2KF6A 1Z1SA 4HM7B 3WHOA 3WOFB 3WR2A 1YVSA 2GBWB 2BMRB 5IERA 3J7Yd 4IIAA 1F8NA 2Y74A 2KF5A 1DVCA 3DGMA 1UI7A 4MJDA 1BNSA 1QAKA 5STDA 2CFGA 3SEDA 3GSPA 2CFWA 3NV0B 3KIIA 4GHOA 4KFFA 4BU4A 1O7HB 4QWTA 5BU4A 1BUJA 3HI7A 3FKAA 2F99A 1ZGXA 2QIYA 4WYKA 2KF3A 2W56B 3K63A 1N5HA 5AIIA 1IU7A 1Q864 3CD63 1MGWA 3ER7A 1K9M4 1OHPA 3F8XA 3PCRA 1JKGB 3AGNA 4L8PA 5D82A 3UB1A 1BSBA 1N8R4 3I563 1EQKA 2HMNB 3B8LA 1DYUA 1GMQA 2CWVA 1IVXA 4KFDA 2E2UA 1HU9A 3EE1A 3KE7A 4RNYA 6STDA 1SJWA 2A15A 3JUPA 5EVHA 1BUQA 4N6OB 3QK9A 1UCJA 4L8OA 4PEJA 4MMYB 5AEUB 1VQQA 3X42A 1VQK3 3LYGA 1BRHA 1YGWA 1GMPA 1OHSA 3X41A 5IG0A 2CWUA 3NBJA 4FMDA 1BRNL 4I4KA 1BSAA 3X3ZA 1TRQA 2K0MA 1LVNA 4U13A 2YFIB 1GY7A 2KAAA 1IQXA 2RNTA 3EBYA 4RBNA 3KKGA 1BNIA 3BIRA 3QRDA 4HM8B 1SQWA 5HOHA 1NJI4 2E2VA 1RGAA 2V1LA 3DGNA 4EV5A 3AMOB 1BGSA 1IT7A 5IW9A 1BRIA 3ALAA 1UCKA 3UL6A 1UW1A 3HX8A 4X2OA 3DUKA 3EHCA 4IT7A 1A67A 2L1SA 2WO0A 3GRDA 5IG5A 3SX1A 3V98A 4AKZA 1WMPA 3FSDA 1OPYA 3RGRA 2E2TA 1JV2B 2HOHA 3VSYA 4NPBA 3WMDA 1QALA 3FLJA 3D5IA 1V57A 1VZZA 2L4VA 2YX9A 1AR0A 3EN8A 1CYUA 1BNJA 4LEHA 1JRQA 1M1XB 2GEXA 5JPPA 1TTOA 1FZUA 1RRLA 3D3LA 3KZTA 3WA2X 2FNQA 2WOFA 1RN1A 1GS3A 1ISKA 3Q2PA 4NHFA 2CIUA 2Q07A 1GOVA 1OACA 3JVCA 1JBRA 4IPBA 1S5AA 3H51A 3F9SA 3OV4A 2W03A 1JN5A 4K90B 1ZO2A 1VQ93 1BNRA 2IUKA 3DGLA 1YGEA 1FGQA 3CNXA 3G8ZA 2Y73A 4NREA 2W9PA 3CCE3 5KP3A 2QA43 3I0YA 3MKIA 1UUVB 1FGMA 3Q90A 2HMKB 2OCTA 1ROVA 1IVVA 1RGEA 2GU1A 1B20A 1JB5A 2Z6BA 2GXFA 3LXUX 1MWTA 4R9KA 3HK4A 4BL2A 1QVG2 1BAOA 4J5KA 2XEPA 1G02A 1KC84 4HYZA 1HYFA 2HMMB 1HKXA 4MEIA 2GU3A 3IMAB 3GAXA 2INXA 3PGBA 4J9AA 3PCSA 4JF8A 1B2SA 1A2VA 3CCU3 2CKFB 2QEX3 1TFOA 3T8UA 4N6LA 1V58A 4DKIA 4EW5A 1RGKA 3ZG0A 4FR9A 1OF5B 1BVIA 1RN4A 1AQZA 2RFRA 4BTYA 5A0OB 2GBXB 3FH1A 1VQ43 3GWRA 3S29A 1IV7A 5JPUA 1Q9EA 1W00A 3DM8A 3NX0A 5AIFA 5IG3A 4HM2B 5HGRA 1B2MA 1J2BA 3UJMA 3K9MC 5AI1A 2H0IA 4WFOA 1C54A 2C10A 1RSNA 3B4PA 2XSHB 3SYUA 3EQQB 3CCQ3 1QMAA 4R1KA 1MNLA 1X1XA 2KF4A 5IG4A 1OGZA 3G4S3 3U1WA 2UX0A 3ECFA 1D6UA 3EJVA 5D83A 5KP1A 5BXQA 1BRJA 1K41A 1YVBI 3KN4A 3NQYA 3LTBA 4HM6B 1I70A 8RNTA 1FYSA 1GY5A 5RNTA 1VQP3 2AAEA 3RDEA 1RGCA 2BT3A 3MPHA 3CPOA 1ZS7A 1K8A4 5EQLA 9RNTA 1IT8A 2CH9A 3CC73 2AADA 1RMSA 2UGIA 3NHXA 3NV0A 3WA3A 3NM7A 2CFLA 2P38A 4HBRA 1TRPA 1ULIB 2IUJA 1GOYA 3SXXA 4EBGA 3OW22 2CFKA 1GD3A 1ASKA 1LNIA 4MMXB 2CC3A 1RNTA 1C7HA 1N5PA 3RNTA 1I0VA 1JN5B 1E3VA 1FW7A 2CK3H 2BMOB 1PU4A 3GZXB 1STFI 1AY7A 3DGOA 1HZ1A 2R41A 3N54B 3HIGA 1I3FA 1MGRA 3KCHA 3EC9A 3K5TA 2CG0A 4EC6A 1DMMA 1D6ZA 3D5GA 1CH0A 4BIRA 1NWWA 3STDA 1KD14 2H0HA 1AVLA 2ZA4A 3WODG 5CXOA 3OWUA 1ROAA 2CX1A 1W2ZA 3GZBA 4R9LA 1M904 1OUNA 2W6JH 1T5YA 1OF5A 1O7WB 3JUNA 1A2PA
chains in the Genus database with same CATH topology
1B21A 1RN1A 1BRGA 1R4YA 4HAAA 1GOVA 1JBRA 3HOHA 1B27A 4GSPA 2SARA 1LRAA 6GSPA 1RGGA 1RHLA 1BNRA 1I3IA 1PYLA 3A5EA 6RNTA 1DE3A 1LOWA 1BSDA 1LOYA 1RGEA 1B20A 1RGFA 1GMRA 3BU4A 1RGLA 1BAOA 4J5KA 1B2UA 1G02A 1HYFA 2GSPA 1UCLA 3AGOA 1B3SA 1PY3A 1B2SA 2F5MA 2KF6A 3WHOA 7RNTA 3WR2A 1FUTA 1FUSA 1T2HA 1YVSA 1RGKA 1BSEA 2F5WA 5BIRA 1BNFA 1BIRA 1BVIA 1RN4A 1AQZA 2F4YA 2F56A 2KF5A 1JBSA 1BNSA 1BRSA 1RGHA 1RLSA 3GSPA 1RDSA 1T2IA 4GHOA 1RCLA 4BU4A 5BU4A 1RNBA 1BUJA 1JBTA 1Q9EA 1BNGA 1RCKA 1B2MA 1ZGXA 2KF3A 1YNVX 2BIRA 1I2FA 1C54A 1BNEA 1MGWA 1RSNA 4RNTA 3SYUA 1X1XA 2C4BA 2KF4A 3AGNA 1X1WA 5GSPA 1BSBA 1I0XA 1GMQA 3D4AA 3AHSA 1BRJA 1DETA 1UCJA 1I70A 8RNTA 1B2XA 1FYSA 1IYYA 3URPA 5RNTA 1BRKA 1BRHA 1YGWA 1GSPA 1GMPA 2AAEA 2BU4A 1RGCA 1I2GA 1BRNL 1RTUA 9RNTA 1BSAA 2AADA 1TRQA 1RMSA 2RBIA 1X1YA 3Q3FA 1B2ZA 2KAAA 3DH2A 2RNTA 1BNIA 1TRPA 1GOYA 3BIRA 1LNIA 5HOHA 1SARA 3AHWA 1BANA 1RGAA 1RNTA 1UCIA 1X1UA 4J5GA 1BGSA 1BU4A 1I0VA 3RNTA 1BRIA 1UCKA 1FW7A 3DGYA 7GSPA 1AY7A 1HZ1A 1I3FA 1MGRA 3KCHA 3D5GA 1CH0A 4BIRA 2HOHA 1BOXA 1GOUA 3D5IA 2ZA4A 1BSCA 1I2EA 1BNJA 1I8VA 1LOVA 4HOHA 1TTOA 1FZUA 1A2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B21 A;  1RN1 A;  1BRG A;  1R4Y A;  4HAA A;  1GOV A;  1JBR A;  3HOH A;  1B27 A;  4GSP A;  2SAR A;  1LRA A;  6GSP A;  1RGG A;  1RHL A;  1BNR A;  1I3I A;  1PYL A;  3A5E A;  6RNT A;  1DE3 A;  1LOW A;  1BSD A;  1LOY A;  1RGE A;  1B20 A;  1RGF A;  1GMR A;  3BU4 A;  1RGL A;  1BAO A;  4J5K A;  1B2U A;  1G02 A;  1HYF A;  2GSP A;  1UCL A;  3AGO A;  1B3S A;  1PY3 A;  1B2S A;  2F5M A;  2KF6 A;  3WHO A;  7RNT A;  3WR2 A;  1FUT A;  1FUS A;  1T2H A;  1YVS A;  1RGK A;  1BSE A;  2F5W A;  5BIR A;  1BNF A;  1BIR A;  1BVI A;  1RN4 A;  1AQZ A;  2F4Y A;  2F56 A;  2KF5 A;  1JBS A;  1BNS A;  1BRS A;  1RGH A;  1RLS A;  3GSP A;  1RDS A;  1T2I A;  4GHO A;  1RCL A;  4BU4 A;  5BU4 A;  1RNB A;  1BUJ A;  1JBT A;  1Q9E A;  1BNG A;  1RCK A;  1B2M A;  1ZGX A;  2KF3 A;  1YNV X;  2BIR A;  1I2F A;  1C54 A;  1BNE A;  1MGW A;  1RSN A;  4RNT A;  3SYU A;  1X1X A;  2C4B A;  2KF4 A;  3AGN A;  1X1W A;  5GSP A;  1BSB A;  1I0X A;  1GMQ A;  3D4A A;  3AHS A;  1BRJ A;  1DET A;  1UCJ A;  1I70 A;  8RNT A;  1B2X A;  1FYS A;  1IYY A;  3URP A;  5RNT A;  1BRK A;  1BRH A;  1YGW A;  1GSP A;  1GMP A;  2AAE A;  2BU4 A;  1RGC A;  1I2G A;  1BRN L;  1RTU A;  9RNT A;  1BSA A;  2AAD A;  1TRQ A;  1RMS A;  2RBI A;  1X1Y A;  3Q3F A;  1B2Z A;  2KAA A;  3DH2 A;  2RNT A;  1BNI A;  1TRP A;  1GOY A;  3BIR A;  1LNI A;  5HOH A;  1SAR A;  3AHW A;  1BAN A;  1RGA A;  1RNT A;  1UCI A;  1X1U A;  4J5G A;  1BGS A;  1BU4 A;  1I0V A;  3RNT A;  1BRI A;  1UCK A;  1FW7 A;  3DGY A;  7GSP A;  1AY7 A;  1HZ1 A;  1I3F A;  1MGR A;  3KCH A;  3D5G A;  1CH0 A;  4BIR A;  2HOH A;  1BOX A;  1GOU A;  3D5I A;  2ZA4 A;  1BSC A;  1I2E A;  1BNJ A;  1I8V A;  1LOV A;  4HOH A;  1TTO A;  1FZU A;  1A2P A; 
#chains in the Genus database with same CATH topology
 1JNQ A;  1B21 A;  3CME 3;  3EBT A;  5ELU A;  3HII A;  2MF7 A;  2H0G A;  4HAA A;  1NNV A;  1QAF A;  1U5O A;  1M9G A;  2BHM A;  2Z77 A;  3HOH A;  1SIH A;  4CPK A;  3I55 3;  3FGY A;  1D6Y A;  4H3U A;  3FCS B;  1TP6 A;  1RHL A;  4WWU C;  3U97 A;  1EEJ A;  4N6N B;  3CNM A;  3LTD A;  3A5E A;  1KWI A;  1W4N A;  1DE3 A;  1LOW A;  3OX9 A;  3F7S A;  4GB5 A;  1O7G B;  1KQS 2;  1G0T A;  2K54 A;  4LMI A;  1FGT A;  4O8S A;  4WYK B;  3M8C A;  3S67 A;  3SLU A;  1VQ5 3;  3ROB A;  5ELJ A;  4EYC A;  1WMO A;  2PZV A;  3F14 A;  3NM2 A;  1YIT 3;  2P0X A;  2GSP A;  1T3B A;  3MSO A;  1UCL A;  1MWU A;  3AGO A;  4HJL B;  1O7N B;  2F5M A;  1FUS A;  1T2H A;  1UUG B;  3F40 A;  1EG9 B;  3HZP A;  2RCD A;  4O02 B;  2LQV A;  4Q53 A;  2F4Y A;  1BIR A;  2P05 A;  4AKY A;  4K1V A;  5BIR A;  1BRS A;  1RGH A;  1W5Z A;  4HVN A;  1OCV A;  1QJG A;  1RLS A;  1RDS A;  1T2I A;  2RSX A;  3LTC A;  4STD A;  3CCS 3;  3CCV 3;  1RNB A;  4GL6 A;  3KFQ C;  5AYS C;  1BNG A;  1KSI A;  2K3D A;  2HML B;  3OXA A;  1JB2 A;  1YNV X;  2IMJ A;  4R4K A;  1I2F A;  1Q42 A;  3G16 A;  1BNE A;  3KSE D;  1W6C A;  1EUI C;  1RJO A;  2STD A;  2FGT A;  5GSP A;  3PZW A;  1LNH A;  3UL5 A;  3V92 A;  3MG1 A;  4OUQ A;  2ZHX B;  1IVU A;  3BB9 A;  3TDG A;  1CEW I;  1NU3 A;  1OGX A;  1DET A;  3X3Y A;  3EX9 A;  4HM3 B;  1IK3 A;  1GYB A;  2JDI H;  1IYY A;  4XBT A;  3RGA A;  3URP A;  1MOL A;  1WQL B;  3IPT A;  3LOY A;  5G2G A;  3MG2 A;  2Z76 A;  5TGN A;  2BU4 A;  2ML5 A;  3CCR 3;  4OK0 A;  5IEP A;  1DMN A;  4N6V 0;  2J8X B;  1IVW A;  1UUW B;  3LML A;  1AV4 A;  2RBI A;  2W56 A;  1B2Z A;  2WGQ A;  2F98 A;  4LYL B;  4KT3 B;  1JBS A;  5IF6 A;  3CXC 2;  4RZM A;  1Q82 4;  2CG1 A;  2XFS A;  3FG3 A;  4KFE A;  1TJD A;  4HM1 B;  4N6U A;  3CPW 2;  2P09 A;  2CFD A;  1RRH A;  2D1W A;  3L0R A;  1IQY A;  2YFJ B;  1SAR A;  3SVA A;  1X1U A;  1BAN A;  5AIG A;  3JUQ A;  4JRF A;  4FCZ A;  1FUW A;  1JZD A;  3DGY A;  5IEO A;  5D81 A;  3FF0 A;  5M1A A;  4N6M A;  3PXM A;  5M19 A;  2IYJ A;  3DXO A;  1RN7 A;  3VGN A;  2YFL B;  1TIJ A;  1BOX A;  3BLZ A;  4ILF A;  5CK6 A;  1JJ2 2;  1VQO 3;  3G6E 3;  3UNL A;  1BSC A;  1GD4 A;  1US1 A;  2XSO B;  1I2E A;  1VQ7 3;  4LSO A;  4N3V A;  1L5G B;  2OTL 3;  1G96 A;  1YJN 3;  1VQL 3;  4ZM8 A;  1CQS A;  1LOV A;  4HOH A;  1LQG C;  1IV9 A;  3SOA A;  1YJW 3;  1NO3 A;  1LOX A;  1B27 A;  1SPU A;  1V74 A;  4GSP A;  2SAR A;  3F7X A;  4N6T A;  4EV2 A;  3CCL 3;  5JBS A;  2IA7 A;  1LQM B;  1LRA A;  2KXG A;  6GSP A;  1RGG A;  4FCM A;  4BTW A;  2BO9 B;  1LXE A;  4LZI A;  1PYL A;  2RGQ A;  2FXT A;  3NBB A;  4FMB A;  4WP5 A;  4XBX A;  2OQE A;  3T0U A;  3PYJ A;  6RNT A;  1MWR A;  2QGU A;  2ZDJ A;  4XBY A;  3S27 A;  3FZW A;  1K28 A;  3EB8 A;  3A76 A;  3DY5 A;  1LOY A;  2KRT A;  3NBR A;  1MWS A;  3KSP A;  1VQM 3;  1NB5 I;  2JQ5 A;  4AEQ A;  1N9J A;  2W0Q A;  3EN1 B;  1U8C B;  3BU4 A;  1CYV A;  5FGO A;  1RGL A;  3JUM A;  2I9W A;  3BNB A;  4FCJ A;  1B2U A;  1EKM A;  4X2H A;  2HMO B;  3GZR A;  4FMC A;  2B24 B;  4XDW A;  5AYR B;  2XGL A;  5BVB A;  2OTJ 3;  1UGI A;  1GY6 A;  4G1M B;  2IY2 A;  2OQE C;  3K7C A;  4TX4 A;  1Q7Y 4;  7RNT A;  3FG4 A;  1FUT A;  3BNC A;  4CDL A;  1BSE A;  1W6G A;  2F5W A;  1E97 A;  1BNF A;  4FMA A;  2F56 A;  4XM4 A;  1FGO A;  2D42 A;  1O7P B;  4HM5 B;  4HKV B;  3F8H A;  1W2B 2;  3CC4 3;  2B1X B;  1W02 A;  1W6Y A;  1RCL A;  2XR8 B;  1OHO A;  3LT9 A;  3G71 3;  1JBT A;  1JB4 A;  2WOH A;  4BTX A;  2W9Q A;  1W7C A;  1AVK A;  1O7M B;  2BMQ B;  1RCK A;  1WNH A;  3NXJ A;  5AEW B;  1TU5 A;  5G1L A;  4KVH A;  2BIR A;  2O9U X;  4HZ9 B;  2R4I A;  3CMA 3;  4O2H A;  1YHQ 3;  4RNT A;  1SII A;  3CCJ 3;  2GEY A;  3IJE B;  3LZA A;  4KZ1 A;  5EEO A;  3MYT A;  2C4B A;  3SOY A;  1X1W A;  2XFT A;  1Q40 B;  3GZY B;  1TFK A;  1I0X A;  4OVM A;  1M1K 4;  2OOV C;  2CW9 A;  3D4A A;  3D9R A;  2XF3 A;  3AHS A;  4J8T A;  1UI8 A;  3WDG B;  1FGR A;  2ML6 A;  3B7C A;  2PNC A;  4RNZ A;  2KCD A;  2XRX B;  1B2X A;  3ZFZ A;  2CWT A;  3MHE A;  3X40 A;  1STD A;  1UGH I;  5DRE A;  1DVD A;  1BRK A;  5I97 A;  2W04 A;  1GSP A;  1I2G A;  3N8B A;  1A90 A;  1E3R A;  1RTU A;  5G1K A;  4R80 A;  1EA2 A;  3EF8 A;  3LTA A;  3S5C A;  3NUV A;  3O8Y A;  3WOE B;  1X1Y A;  3Q3F A;  1A2K A;  1NDO B;  3OWS A;  3V99 A;  1Q81 4;  3PS8 A;  3CC2 3;  3DZL A;  4HZB B;  3DH2 A;  3JUO A;  5FW5 A;  2F86 B;  3OWY A;  1JKG A;  3N9H A;  3B4O A;  1Q40 A;  3AHW A;  2UUG C;  1UCI A;  4BL3 A;  1S72 3;  3BND A;  2CHC A;  4J5G A;  1BU4 A;  1QVF 2;  1VQ6 3;  2LYX A;  2C11 A;  5CF2 A;  4HM0 B;  4K61 A;  2ZL8 A;  4XDV A;  4L7K A;  1JZO A;  2CX0 A;  2OWP A;  2SBL A;  7GSP A;  5M18 A;  1NB3 I;  1Y4K A;  2MC8 A;  3CCM 3;  4WHA A;  3NQZ A;  4LGQ A;  2Z7A A;  3DMC A;  3MG3 A;  3S28 A;  2M7O A;  1GOU A;  5KP4 A;  1N9E A;  8CHO A;  1FA3 A;  1VQN 3;  5LC7 A;  1N8Q A;  4K1U A;  2XGN A;  1I8V A;  2OOV A;  1YJ9 3;  5CF1 A;  4XB5 A;  5IEN A;  2WGO A;  1ZX2 A;  1W01 A;  2XH9 A;  2O3O A;  5LC6 A;  1BRG A;  1R4Y A;  4HM4 B;  5AIH A;  1WMN A;  1IDP A;  2P0M A;  3LT8 A;  3AMO A;  1VQ8 3;  4MMZ B;  4EXR A;  4ORL A;  2HMJ B;  1RKY A;  3FF2 A;  1I3I A;  3FG1 A;  1Q7H A;  4CJN A;  2W2C A;  1K73 4;  1WTH A;  1BSD A;  4O3V A;  5CLK A;  3G0K A;  1RGF A;  3LH4 A;  3H3H A;  3D79 A;  3ZG5 A;  3BNE A;  4H61 A;  1GMR A;  1DMQ A;  3Q1C A;  5DRV A;  4CCV A;  1YIJ 3;  3VF1 A;  2BNG A;  1UDI I;  3X3X A;  3K0Z A;  4I5Q A;  3MWZ A;  1IQ8 A;  1R4C A;  1PFP A;  1TUH A;  3T8N A;  1OH0 A;  1YI2 3;  3CU3 A;  7STD A;  3E99 A;  1B3S A;  1PY3 A;  1ULJ B;  2KF6 A;  1Z1S A;  4HM7 B;  3WHO A;  3WOF B;  3WR2 A;  1YVS A;  2GBW B;  2BMR B;  5IER A;  3J7Y d;  4IIA A;  1F8N A;  2Y74 A;  2KF5 A;  1DVC A;  3DGM A;  1UI7 A;  4MJD A;  1BNS A;  1QAK A;  5STD A;  2CFG A;  3SED A;  3GSP A;  2CFW A;  3NV0 B;  3KII A;  4GHO A;  4KFF A;  4BU4 A;  1O7H B;  4QWT A;  5BU4 A;  1BUJ A;  3HI7 A;  3FKA A;  2F99 A;  1ZGX A;  2QIY A;  4WYK A;  2KF3 A;  2W56 B;  3K63 A;  1N5H A;  5AII A;  1IU7 A;  1Q86 4;  3CD6 3;  1MGW A;  3ER7 A;  1K9M 4;  1OHP A;  3F8X A;  3PCR A;  1JKG B;  3AGN A;  4L8P A;  5D82 A;  3UB1 A;  1BSB A;  1N8R 4;  3I56 3;  1EQK A;  2HMN B;  3B8L A;  1DYU A;  1GMQ A;  2CWV A;  1IVX A;  4KFD A;  2E2U A;  1HU9 A;  3EE1 A;  3KE7 A;  4RNY A;  6STD A;  1SJW A;  2A15 A;  3JUP A;  5EVH A;  1BUQ A;  4N6O B;  3QK9 A;  1UCJ A;  4L8O A;  4PEJ A;  4MMY B;  5AEU B;  1VQQ A;  3X42 A;  1VQK 3;  3LYG A;  1BRH A;  1YGW A;  1GMP A;  1OHS A;  3X41 A;  5IG0 A;  2CWU A;  3NBJ A;  4FMD A;  1BRN L;  4I4K A;  1BSA A;  3X3Z A;  1TRQ A;  2K0M A;  1LVN A;  4U13 A;  2YFI B;  1GY7 A;  2KAA A;  1IQX A;  2RNT A;  3EBY A;  4RBN A;  3KKG A;  1BNI A;  3BIR A;  3QRD A;  4HM8 B;  1SQW A;  5HOH A;  1NJI 4;  2E2V A;  1RGA A;  2V1L A;  3DGN A;  4EV5 A;  3AMO B;  1BGS A;  1IT7 A;  5IW9 A;  1BRI A;  3ALA A;  1UCK A;  3UL6 A;  1UW1 A;  3HX8 A;  4X2O A;  3DUK A;  3EHC A;  4IT7 A;  1A67 A;  2L1S A;  2WO0 A;  3GRD A;  5IG5 A;  3SX1 A;  3V98 A;  4AKZ A;  1WMP A;  3FSD A;  1OPY A;  3RGR A;  2E2T A;  1JV2 B;  2HOH A;  3VSY A;  4NPB A;  3WMD A;  1QAL A;  3FLJ A;  3D5I A;  1V57 A;  1VZZ A;  2L4V A;  2YX9 A;  1AR0 A;  3EN8 A;  1CYU A;  1BNJ A;  4LEH A;  1JRQ A;  1M1X B;  2GEX A;  5JPP A;  1TTO A;  1FZU A;  1RRL A;  3D3L A;  3KZT A;  3WA2 X;  2FNQ A;  2WOF A;  1RN1 A;  1GS3 A;  1ISK A;  3Q2P A;  4NHF A;  2CIU A;  2Q07 A;  1GOV A;  1OAC A;  3JVC A;  1JBR A;  4IPB A;  1S5A A;  3H51 A;  3F9S A;  3OV4 A;  2W03 A;  1JN5 A;  4K90 B;  1ZO2 A;  1VQ9 3;  1BNR A;  2IUK A;  3DGL A;  1YGE A;  1FGQ A;  3CNX A;  3G8Z A;  2Y73 A;  4NRE A;  2W9P A;  3CCE 3;  5KP3 A;  2QA4 3;  3I0Y A;  3MKI A;  1UUV B;  1FGM A;  3Q90 A;  2HMK B;  2OCT A;  1ROV A;  1IVV A;  1RGE A;  2GU1 A;  1B20 A;  1JB5 A;  2Z6B A;  2GXF A;  3LXU X;  1MWT A;  4R9K A;  3HK4 A;  4BL2 A;  1QVG 2;  1BAO A;  4J5K A;  2XEP A;  1G02 A;  1KC8 4;  4HYZ A;  1HYF A;  2HMM B;  1HKX A;  4MEI A;  2GU3 A;  3IMA B;  3GAX A;  2INX A;  3PGB A;  4J9A A;  3PCS A;  4JF8 A;  1B2S A;  1A2V A;  3CCU 3;  2CKF B;  2QEX 3;  1TFO A;  3T8U A;  4N6L A;  1V58 A;  4DKI A;  4EW5 A;  1RGK A;  3ZG0 A;  4FR9 A;  1OF5 B;  1BVI A;  1RN4 A;  1AQZ A;  2RFR A;  4BTY A;  5A0O B;  2GBX B;  3FH1 A;  1VQ4 3;  3GWR A;  3S29 A;  1IV7 A;  5JPU A;  1Q9E A;  1W00 A;  3DM8 A;  3NX0 A;  5AIF A;  5IG3 A;  4HM2 B;  5HGR A;  1B2M A;  1J2B A;  3UJM A;  3K9M C;  5AI1 A;  2H0I A;  4WFO A;  1C54 A;  2C10 A;  1RSN A;  3B4P A;  2XSH B;  3SYU A;  3EQQ B;  3CCQ 3;  1QMA A;  4R1K A;  1MNL A;  1X1X A;  2KF4 A;  5IG4 A;  1OGZ A;  3G4S 3;  3U1W A;  2UX0 A;  3ECF A;  1D6U A;  3EJV A;  5D83 A;  5KP1 A;  5BXQ A;  1BRJ A;  1K41 A;  1YVB I;  3KN4 A;  3NQY A;  3LTB A;  4HM6 B;  1I70 A;  8RNT A;  1FYS A;  1GY5 A;  5RNT A;  1VQP 3;  2AAE A;  3RDE A;  1RGC A;  2BT3 A;  3MPH A;  3CPO A;  1ZS7 A;  1K8A 4;  5EQL A;  9RNT A;  1IT8 A;  2CH9 A;  3CC7 3;  2AAD A;  1RMS A;  2UGI A;  3NHX A;  3NV0 A;  3WA3 A;  3NM7 A;  2CFL A;  2P38 A;  4HBR A;  1TRP A;  1ULI B;  2IUJ A;  1GOY A;  3SXX A;  4EBG A;  3OW2 2;  2CFK A;  1GD3 A;  1ASK A;  1LNI A;  4MMX B;  2CC3 A;  1RNT A;  1C7H A;  1N5P A;  3RNT A;  1I0V A;  1JN5 B;  1E3V A;  1FW7 A;  2CK3 H;  2BMO B;  1PU4 A;  3GZX B;  1STF I;  1AY7 A;  3DGO A;  1HZ1 A;  2R41 A;  3N54 B;  3HIG A;  1I3F A;  1MGR A;  3KCH A;  3EC9 A;  3K5T A;  2CG0 A;  4EC6 A;  1DMM A;  1D6Z A;  3D5G A;  1CH0 A;  4BIR A;  1NWW A;  3STD A;  1KD1 4;  2H0H A;  1AVL A;  2ZA4 A;  3WOD G;  5CXO A;  3OWU A;  1ROA A;  2CX1 A;  1W2Z A;  3GZB A;  4R9L A;  1M90 4;  1OUN A;  2W6J H;  1T5Y A;  1OF5 A;  1O7W B;  3JUN A;  1A2P A; 
#chains in the Genus database with same CATH homology
 1B21 A;  1RN1 A;  1BRG A;  1R4Y A;  4HAA A;  1GOV A;  1JBR A;  3HOH A;  1B27 A;  4GSP A;  2SAR A;  1LRA A;  6GSP A;  1RGG A;  1RHL A;  1BNR A;  1I3I A;  1PYL A;  3A5E A;  6RNT A;  1DE3 A;  1LOW A;  1BSD A;  1LOY A;  1RGE A;  1B20 A;  1RGF A;  1GMR A;  3BU4 A;  1RGL A;  1BAO A;  4J5K A;  1B2U A;  1G02 A;  1HYF A;  2GSP A;  1UCL A;  3AGO A;  1B3S A;  1PY3 A;  1B2S A;  2F5M A;  2KF6 A;  3WHO A;  7RNT A;  3WR2 A;  1FUT A;  1FUS A;  1T2H A;  1YVS A;  1RGK A;  1BSE A;  2F5W A;  5BIR A;  1BNF A;  1BIR A;  1BVI A;  1RN4 A;  1AQZ A;  2F4Y A;  2F56 A;  2KF5 A;  1JBS A;  1BNS A;  1BRS A;  1RGH A;  1RLS A;  3GSP A;  1RDS A;  1T2I A;  4GHO A;  1RCL A;  4BU4 A;  5BU4 A;  1RNB A;  1BUJ A;  1JBT A;  1Q9E A;  1BNG A;  1RCK A;  1B2M A;  1ZGX A;  2KF3 A;  1YNV X;  2BIR A;  1I2F A;  1C54 A;  1BNE A;  1MGW A;  1RSN A;  4RNT A;  3SYU A;  1X1X A;  2C4B A;  2KF4 A;  3AGN A;  1X1W A;  5GSP A;  1BSB A;  1I0X A;  1GMQ A;  3D4A A;  3AHS A;  1BRJ A;  1DET A;  1UCJ A;  1I70 A;  8RNT A;  1B2X A;  1FYS A;  1IYY A;  3URP A;  5RNT A;  1BRK A;  1BRH A;  1YGW A;  1GSP A;  1GMP A;  2AAE A;  2BU4 A;  1RGC A;  1I2G A;  1BRN L;  1RTU A;  9RNT A;  1BSA A;  2AAD A;  1TRQ A;  1RMS A;  2RBI A;  1X1Y A;  3Q3F A;  1B2Z A;  2KAA A;  3DH2 A;  2RNT A;  1BNI A;  1TRP A;  1GOY A;  3BIR A;  1LNI A;  5HOH A;  1SAR A;  3AHW A;  1BAN A;  1RGA A;  1RNT A;  1UCI A;  1X1U A;  4J5G A;  1BGS A;  1BU4 A;  1I0V A;  3RNT A;  1BRI A;  1UCK A;  1FW7 A;  3DGY A;  7GSP A;  1AY7 A;  1HZ1 A;  1I3F A;  1MGR A;  3KCH A;  3D5G A;  1CH0 A;  4BIR A;  2HOH A;  1BOX A;  1GOU A;  3D5I A;  2ZA4 A;  1BSC A;  1I2E A;  1BNJ A;  1I8V A;  1LOV A;  4HOH A;  1TTO A;  1FZU A;  1A2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...