1YVSA

Trimeric domain swapped barnase
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endonuclease
molecule keywords BARNASE
publication title Trimeric domain-swapped barnase.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
total genus 23
structure length 108
sequence length 108
ec nomenclature ec 3.1.27.-:
pdb deposition date 1998-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1yvsA00
3AHWA 1RGLA 1B2XA 4J5GA 3URPA 8RNTA 1RGKA 1FUTA 5RNTA 1BGSA 1BRHA 1LRAA 1RDSA 3WHOA 7GSPA 1X1WA 1TTOA 1LOYA 3HOHA 1I70A 1GOYA 1FUSA 1DE3A 1BSCA 3BIRA 1RGGA 1C54A 1BNGA 2AADA 2BU4A 1BRKA 4GHOA 1RCLA 1GOUA 1BVIA 1CH0A 1RGHA 6RNTA 1BNRA 1RMSA 3D5IA 1G02A 1BSEA 1I3FA 1BIRA 1A2PA 1YGWA 1LOVA 3A5EA 1BANA 1BSDA 2GSPA 1UCKA 2KAAA 5GSPA 1RHLA 1JBSA 1FZUA 1BRJA 2KF6A 3GSPA 1BOXA 2AAEA 1BSBA 1RN1A 3RNTA 1TRQA 1BNSA 1BNEA 3KCHA 5HOHA 2RBIA 1BAOA 1GMRA 3DGYA 1I8VA 1BU4A 1AY7A 1DETA 1PY3A 1B2ZA 3AGOA 1B2UA 1BRNL 1PYLA 3BU4A 2BIRA 1RSNA 1LNIA 1B21A 2KF3A 1B2MA 1T2HA 1FYSA 1FW7A 1JBTA 2KF5A 1I0XA 1X1UA 1B27A 1MGRA 1GMQA 4RNTA 4BU4A 1R4YA 2HOHA 1RCKA 2F5MA 3AGNA 2ZA4A 4GSPA 3WR2A 6GSPA 1BUJA 1I3IA 2C4BA 1BRSA 1X1YA 1GMPA 1B20A 1GSPA 3SYUA 1I0VA 1RN4A 4J5KA 4BIRA 1TRPA 1RGAA 1I2FA 1I2EA 9RNTA 1RNBA 1T2IA 1I2GA 1YNVX 1RGCA 1BRGA 1RLSA 2RNTA 1RNTA 1B2SA 1Q9EA 3D5GA 4HOHA 1SARA 1X1XA 3AHSA 5BIRA 2SARA 3DH2A 1UCJA 1B3SA 1BNJA 2F5WA 1LOWA 1YVSA 4HAAA 1RTUA 1JBRA 1HZ1A 2F56A 5BU4A 3Q3FA 1BRIA 1BNFA 1UCIA 1GOVA 2F4YA 3D4AA 1RGEA 1HYFA 1ZGXA 1MGWA 1BNIA 1BSAA 1RGFA 1IYYA 7RNTA 1AQZA 1UCLA 2KF4A
chains in the Genus database with same CATH superfamily
1UI8A 1ASKA 1IQ8A 5AEUB 1B2XA 2P0XA 2HMLB 2ML6A 3B8LA 3JUNA 1BGSA 1EG9B 4R1KA 1TFOA 2E2VA 1JB5A 2IMJA 5M18A 1J2BA 3LTAA 7GSPA 4BL2A 3A76A 1LOYA 3KE7A 4K1UA 3LOYA 4BTYA 1TFKA 1OHSA 3B4PA 2RCDA 1DE3A 5IW9A 5JPUA 3CCS3 3BIRA 1V58A 1S5AA 1RGGA 1MWTA 1GD4A 2YX9A 2MC8A 3SOAA 2W04A 1CQSA 2HMOB 2BU4A 3UB1A 1JB4A 2CG1A 1BUQA 2P0MA 1FGQA 5EQLA 1SPUA 2P05A 1RRHA 3FF2A 1M9GA 1RGHA 3GZXB 2INXA 4HM2B 1VQ93 2B1XB 1KD14 1W6GA 3CD63 1IT8A 3CNXA 1N8R4 4QWTA 4N6UA 3T0UA 4NHFA 3X3XA 2OQEA 1OACA 1SQWA 1VQL3 1UUVB 3LZAA 1LOVA 3F14A 1BANA 4MMZB 1VQ73 2GSPA 4GB5A 5IENA 1Q7Y4 1RHLA 4IT7A 2V1LA 3B4OA 2A15A 3NBJA 5AIIA 1FZUA 1D6UA 4WYKB 2JDIH 1BOXA 3N54B 1BSBA 1UGHI 3RNTA 4BTWA 1TRQA 4BTXA 1IT7A 2D42A 2LYXA 4MMYB 1BNEA 2RBIA 1BAOA 1GMRA 2CFGA 3DGYA 4TX4A 2GBXB 1TJDA 2YFLB 4WFOA 1QVF2 2CFKA 3IMAB 1PY3A 2OQEC 1RN7A 1KC84 2WOHA 1W6YA 3U97A 4EC6A 1ULJB 2JQ5A 3G4S3 2IYJA 1RSNA 5FGOA 1EA2A 1A2KA 5IEOA 3X41A 3KIIA 4LZIA 1TUHA 2W2CA 1SJWA 2GXFA 3MPHA 3UL6A 2Y73A 3NV0A 2UGIA 3DMCA 1TU5A 3V92A 1MGRA 3VF1A 4LEHA 1EUIC 1OHPA 1HU9A 4RNTA 5AIFA 3OWYA 4ORLA 3SOYA 1ZS7A 2CWUA 2F5MA 2IUJA 1IVWA 3WA2X 5KP1A 2Z77A 3DGOA 3AGNA 2XSHB 3K63A 4KZ1A 1DYUA 1IQXA 2ZA4A 2UUGC 1IVUA 3F8XA 3MSOA 4HVNA 3STDA 3WR2A 6GSPA 2C4BA 1IK3A 1Q814 4KVHA 1VQN3 1B20A 1NWWA 3O8YA 3SYUA 1OHOA 4H61A 1GY6A 5AYSC 1OF5A 1EKMA 1GD3A 3N9HA 3U1WA 4STDA 1W5ZA 1L5GB 3X3YA 1D6ZA 4AKZA 3CCM3 1O7MB 2QGUA 3FG1A 9RNTA 2BNGA 3G8ZA 3CCU3 4FR9A 1YI23 3JUOA 3EN8A 2CC3A 1IV7A 4NPBA 3BNEA 4HJLB 4PEJA 4HM7B 4OUQA 5STDA 1AV4A 4XBTA 1OUNA 1SARA 3F40A 2SARA 4J8TA 3LXUX 3KSED 1UCJA 4KFDA 1BNJA 1YVSA 4HAAA 3HX8A 2CWVA 4WHAA 2CKFB 3CPOA 3EE1A 1RTUA 5BU4A 1BRIA 1S723 2FNQA 4MJDA 4R80A 1Q42A 4L8OA 2OWPA 2HMJB 1FGMA 3ECFA 1ZGXA 2K3DA 1MGWA 2W56B 1W7CA 2B24B 3F7SA 3PXMA 2XSOB 1W2ZA 1Q7HA 1UCLA 5BVBA 3AHWA 2P09A 1VQQA 1KSIA 4O02B 4IPBA 3F9SA 1MNLA 5IF6A 1G0TA 2IA7A 1JKGA 2J8XB 2CX0A 2C10A 1N5PA 2K0MA 3H3HA 1TTOA 1TIJA 2CFWA 3HK4A 4MMXB 4N3VA 1I70A 2XF3A 1WTHA 5IG0A 3OWSA 1PFPA 3WOEB 1T3BA 1VQO3 3DGLA 4R9KA 2AADA 2IY2A 1BRKA 3EF8A 3ZFZA 2CG0A 4AEQA 1CH0A 1GY5A 1O7HB 4IIAA 5I97A 3G713 1YHQ3 1STDA 1JJ22 6RNTA 5G2GA 3FLJA 3X42A 3NX0A 2L4VA 1OF5B 3LMLA 3SX1A 3X40A 2K54A 5AEWB 3OW22 3NM7A 2FXTA 4R9LA 3KZTA 1VQ83 3GZRA 1BRJA 1W01A 2H0GA 3GSPA 3MG3A 1UUWB 2AAEA 1RN1A 1WMOA 2XGLA 4N6NB 5CLKA 1ZX2A 3UNLA 1N9JA 4XDVA 1E3RA 4L8PA 3I563 4XB5A 5DREA 5EEOA 1I8VA 3LTCA 1B2ZA 1MWSA 3AGOA 3RGAA 5KP4A 1B2UA 3ZG5A 4OK0A 2BIRA 4KT3B 3EC9A 1LNIA 5D81A 5IG4A 1HKXA 2OCTA 3KN4A 2RSXA 1OCVA 1FYSA 1OGZA 1V57A 1FW7A 1GS3A 2KF5A 4XBYA 4CJNA 3H51A 1M1XB 1PU4A 1DMNA 3BNDA 1Q40B 3MG1A 1B27A 2PNCA 2QA43 1GMQA 1US1A 3MHEA 1JZDA 1LQGC 3K0ZA 4KFEA 1VQM3 1JKGB 1NB3I 1K41A 3PS8A 4FMDA 4GSPA 4ZM8A 5EVHA 1NDOB 4MEIA 1LOXA 1X1YA 3EN1B 3K7CA 1A2VA 1GSPA 1YJN3 1GYBA 2Y74A 4J9AA 1WMNA 3FF0A 1I0VA 2CK3H 1RN4A 2WGOA 4BIRA 1Q864 1AVLA 1QVG2 5CF2A 1GY7A 1DMMA 1UW1A 1SIHA 6STDA 3OX9A 3D9RA 1I2GA 3L0RA 3KKGA 2XFTA 1B2SA 1Q9EA 3FZWA 1ZO2A 4HKVB 1MWRA 1X1XA 5M19A 3DH2A 3E99A 3LTDA 4K1VA 1B3SA 3T8UA 1O7PB 1UUGB 4X2OA 3ALAA 1AVKA 1JBRA 1HZ1A 4EW5A 1QAKA 3Q3FA 4FCZA 3SXXA 1BNFA 2HMKB 3X3ZA 2STDA 4CPKA 1UCIA 1YIJ3 1IQYA 3AMOA 4LSOA 3VGNA 1VQP3 5CF1A 3BNCA 1RGEA 4CCVA 2W9QA 4RNZA 1YIT3 3PZWA 3NM2A 1AQZA 3S28A 2CW9A 3CME3 1M1K4 3MKIA 3OXAA 1RGLA 2XRXB 4HM4B 4J5GA 3S67A 3OWUA 3S29A 3URPA 1T5YA 3QRDA 3ROBA 8RNTA 4JRFA 1LRAA 2XR8B 1VQ43 1FGTA 3WHOA 1CYVA 1W00A 3FCSB 3K9MC 3NBBA 3G16A 3N8BA 3WDGB 2Q07A 3I0YA 2SBLA 1GOYA 4FCMA 1OGXA 4R4KA 4EXRA 4HYZA 1NO3A 1C7HA 3NQYA 1WMPA 4GHOA 1GOUA 1BVIA 2UX0A 2W03A 3PYJA 5M1AA 3V99A 2LQVA 1BNRA 3FG3A 1RMSA 1LNHA 2ML5A 2OTL3 1K734 3D5IA 1G02A 2L1SA 1BSEA 3IJEB 1KWIA 1BIRA 4O8SA 1YGWA 1IDPA 3A5EA 3EX9A 1BSDA 5D82A 3EB8A 3ER7A 1MOLA 2KAAA 5GSPA 3G0KA 5IG5A 3DM8A 4GL6A 1DVCA 1W02A 1W4NA 3NV0B 3G6E3 3FH1A 1BNSA 1U5OA 3SEDA 3KCHA 4I5QA 5HOHA 2W0QA 5G1LA 1ROAA 4HZBB 1AR0A 1LVNA 1LXEA 1MWUA 4EYCA 1BU4A 4H3UA 2GU3A 3CCV3 2W6JH 2ZL8A 4X2HA 2XFSA 3S5CA 5ELUA 1JB2A 3AMOB 3BU4A 3CCR3 1B21A 4HZ9B 2KF3A 1T2HA 2KRTA 2WOFA 3GZBA 1IV9A 3CC73 1YVBI 1ULIB 2KCDA 1KQS2 1X1UA 1UGIA 2R4IA 2BHMA 4O2HA 2XH9A 3F7XA 3KSPA 3GZYB 1Q824 1R4YA 2HOHA 3CC23 3M8CA 4HM5B 1A67A 2BMQB 3GWRA 2CX1A 3FGYA 4RBNA 4JF8A 5D83A 4FMAA 1BRSA 4RZMA 1TP6A 2P38A 1FGRA 1SIIA 1W2B2 1QAFA 1C54A 3LT8A 2QIYA 2CFLA 1RGAA 4XBXA 3MG2A 1DMQA 2XEPA 1T2IA 1UDII 3CU3A 1RGCA 1BRGA 1Y4KA 2RNTA 3EJVA 4KFFA 1JV2B 4CDLA 2HMMB 3LT9A 1LQMB 1E3VA 3CMA3 2CHCA 1JN5A 1K28A 3JUPA 3DY5A 4HM0B 2FGTA 5JBSA 4OVMA 2M7OA 1JZOA 2F5WA 1LOWA 4U13A 4XM4A 3PCRA 3BB9A 4XDWA 3GRDA 1ISKA 1D6YA 3S27A 1FGOA 2F56A 4EV2A 2IUKA 5IG3A 3PCSA 3IPTA 1GOVA 1CYUA 2RGQA 2KXGA 3D4AA 1OPYA 5AIHA 1QMAA 3DZLA 1RGFA 4HM1B 1YGEA 4EBGA 3CCL3 1G96A 1IYYA 3EBYA 1NNVA 3MYTA 2KF4A 2ZHXB 3NXJA 3T8NA 3WODG 3CC43 1N9EA 1IU7A 1NU3A 4WP5A 1RGKA 3RGRA 4L7KA 3HIIA 1FUTA 4HBRA 4HM6B 5RNTA 1BRHA 1RDSA 5IEPA 3FG4A 2PZVA 5G1KA 3CPW2 2CWTA 2H0HA 3MWZA 3NUVA 4EV5A 2RFRA 2E2TA 5AIGA 1X1WA 7STDA 3HOHA 2GEXA 5AI1A 1M904 4DKIA 1EEJA 2W56A 1FUSA 4WWUC 1BSCA 2D1WA 5AYRB 1BNGA 2R41A 3DXOA 3I553 1RCLA 1IVXA 2OOVA 5A0OB 1W6CA 2O9UX 3Q1CA 5CK6A 3WA3A 3J7Yd 1I3FA 1EQKA 1A2PA 2ZDJA 3BLZA 3F8HA 4FMCA 1K8A4 3OV4A 3V98A 1UCKA 1RKYA 3LTBA 3WOFB 3GAXA 3CNMA 3Q2PA 3NHXA 5ELJA 1JBSA 1R4CA 2KF6A 5DRVA 1JN5B 2BMRB 2OOVC 4K90B 1JRQA 3DGNA 3DGMA 1E97A 3HI7A 3VSYA 5IERA 2BMOB 2YFIB 1AY7A 1DETA 1N8QA 4Q53A 1VZZA 1BRNL 1PYLA 3K5TA 2C11A 2CIUA 2BO9B 1B2MA 4G1MB 1YJW3 5LC6A 4BL3A 2GBWB 1STFI 1DVDA 1O7WB 3UJMA 2CH9A 2F98A 2GU1A 3LYGA 3TDGA 3EHCA 3CCQ3 1JBTA 3SVAA 1I0XA 2F86B 2XGNA 3DUKA 4FMBA 4I4KA 3Q90A 1NJI4 3UL5A 4BU4A 3D79A 1YJ93 2MF7A 2WGQA 2Z76A 4LYLB 1O7NB 1RCKA 1V74A 1N5HA 3NQZA 3CCJ3 3JVCA 1K9M4 1CEWI 1BUJA 1I3IA 3JUQA 3SLUA 3WMDA 1FUWA 1GMPA 4ILFA 3HZPA 1RRLA 1ROVA 3QK9A 3B7CA 4J5KA 1VQ53 2Z6BA 5JPPA 4FCJA 1FA3A 4NREA 1TRPA 5FW5A 5TGNA 4N6MA 2I9WA 1U8CB 1I2FA 1OH0A 3KFQC 1I2EA 4N6OB 1Q40A 2BT3A 4RNYA 3ZG0A 1RNBA 1YNVX 1QALA 2GEYA 2WO0A 4N6V0 1RLSA 2E2UA 1RNTA 4K61A 4WYKA 3D5GA 4N6LA 4HOHA 3AHSA 1QJGA 1IVVA 1WQLB 3EQQB 3NBRA 5BIRA 3FSDA 1RJOA 2OTJ3 1VQK3 3BNBA 3EBTA 5KP3A 2H0IA 1Z1SA 3PGBA 1NB5I 1F8NA 1VQ63 1O7GB 3CXC2 2YFJB 5BXQA 1WNHA 4LGQA 1JNQA 2F99A 2CFDA 2HMNB 2Z7AA 3FKAA 8CHOA 2QEX3 5LC7A 3D3LA 3RDEA 4O3VA 2F4YA 1HYFA 3JUMA 1UI7A 1BNIA 1BSAA 5HGRA 1A90A 4N6TA 2W9PA 3LH4A 4HM8B 3HIGA 5CXOA 3CCE3 4LMIA 7RNTA 4AKYA 2O3OA 4HM3B
chains in the Genus database with same CATH topology
3AHWA 1RGLA 1B2XA 4J5GA 3URPA 8RNTA 1RGKA 1FUTA 5RNTA 1BGSA 1BRHA 1LRAA 1RDSA 3WHOA 7GSPA 1X1WA 1TTOA 1LOYA 3HOHA 1I70A 1GOYA 1FUSA 1DE3A 1BSCA 3BIRA 1RGGA 1C54A 1BNGA 2AADA 2BU4A 1BRKA 4GHOA 1RCLA 1GOUA 1BVIA 1CH0A 1RGHA 6RNTA 1BNRA 1RMSA 3D5IA 1G02A 1BSEA 1I3FA 1BIRA 1A2PA 1YGWA 1LOVA 3A5EA 1BANA 1BSDA 2GSPA 1UCKA 2KAAA 5GSPA 1RHLA 1JBSA 1FZUA 1BRJA 2KF6A 3GSPA 1BOXA 2AAEA 1BSBA 1RN1A 3RNTA 1TRQA 1BNSA 1BNEA 3KCHA 5HOHA 2RBIA 1BAOA 1GMRA 3DGYA 1I8VA 1BU4A 1AY7A 1DETA 1PY3A 1B2ZA 3AGOA 1B2UA 1BRNL 1PYLA 3BU4A 2BIRA 1RSNA 1LNIA 1B21A 2KF3A 1B2MA 1T2HA 1FYSA 1FW7A 1JBTA 2KF5A 1I0XA 1X1UA 1B27A 1MGRA 1GMQA 4RNTA 4BU4A 1R4YA 2HOHA 1RCKA 2F5MA 3AGNA 2ZA4A 4GSPA 3WR2A 6GSPA 1BUJA 1I3IA 2C4BA 1BRSA 1X1YA 1GMPA 1B20A 1GSPA 3SYUA 1I0VA 1RN4A 4J5KA 4BIRA 1TRPA 1RGAA 1I2FA 1I2EA 9RNTA 1RNBA 1T2IA 1I2GA 1YNVX 1RGCA 1BRGA 1RLSA 2RNTA 1RNTA 1B2SA 1Q9EA 3D5GA 4HOHA 1SARA 1X1XA 3AHSA 5BIRA 2SARA 3DH2A 1UCJA 1B3SA 1BNJA 2F5WA 1LOWA 1YVSA 4HAAA 1RTUA 1JBRA 1HZ1A 2F56A 5BU4A 3Q3FA 1BRIA 1BNFA 1UCIA 1GOVA 2F4YA 3D4AA 1RGEA 1HYFA 1ZGXA 1MGWA 1BNIA 1BSAA 1RGFA 1IYYA 7RNTA 1AQZA 1UCLA 2KF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AHW A;  1RGL A;  1B2X A;  4J5G A;  3URP A;  8RNT A;  1RGK A;  1FUT A;  5RNT A;  1BGS A;  1BRH A;  1LRA A;  1RDS A;  3WHO A;  7GSP A;  1X1W A;  1TTO A;  1LOY A;  3HOH A;  1I70 A;  1GOY A;  1FUS A;  1DE3 A;  1BSC A;  3BIR A;  1RGG A;  1C54 A;  1BNG A;  2AAD A;  2BU4 A;  1BRK A;  4GHO A;  1RCL A;  1GOU A;  1BVI A;  1CH0 A;  1RGH A;  6RNT A;  1BNR A;  1RMS A;  3D5I A;  1G02 A;  1BSE A;  1I3F A;  1BIR A;  1A2P A;  1YGW A;  1LOV A;  3A5E A;  1BAN A;  1BSD A;  2GSP A;  1UCK A;  2KAA A;  5GSP A;  1RHL A;  1JBS A;  1FZU A;  1BRJ A;  2KF6 A;  3GSP A;  1BOX A;  2AAE A;  1BSB A;  1RN1 A;  3RNT A;  1TRQ A;  1BNS A;  1BNE A;  3KCH A;  5HOH A;  2RBI A;  1BAO A;  1GMR A;  3DGY A;  1I8V A;  1BU4 A;  1AY7 A;  1DET A;  1PY3 A;  1B2Z A;  3AGO A;  1B2U A;  1BRN L;  1PYL A;  3BU4 A;  2BIR A;  1RSN A;  1LNI A;  1B21 A;  2KF3 A;  1B2M A;  1T2H A;  1FYS A;  1FW7 A;  1JBT A;  2KF5 A;  1I0X A;  1X1U A;  1B27 A;  1MGR A;  1GMQ A;  4RNT A;  4BU4 A;  1R4Y A;  2HOH A;  1RCK A;  2F5M A;  3AGN A;  2ZA4 A;  4GSP A;  3WR2 A;  6GSP A;  1BUJ A;  1I3I A;  2C4B A;  1BRS A;  1X1Y A;  1GMP A;  1B20 A;  1GSP A;  3SYU A;  1I0V A;  1RN4 A;  4J5K A;  4BIR A;  1TRP A;  1RGA A;  1I2F A;  1I2E A;  9RNT A;  1RNB A;  1T2I A;  1I2G A;  1YNV X;  1RGC A;  1BRG A;  1RLS A;  2RNT A;  1RNT A;  1B2S A;  1Q9E A;  3D5G A;  4HOH A;  1SAR A;  1X1X A;  3AHS A;  5BIR A;  2SAR A;  3DH2 A;  1UCJ A;  1B3S A;  1BNJ A;  2F5W A;  1LOW A;  1YVS A;  4HAA A;  1RTU A;  1JBR A;  1HZ1 A;  2F56 A;  5BU4 A;  3Q3F A;  1BRI A;  1BNF A;  1UCI A;  1GOV A;  2F4Y A;  3D4A A;  1RGE A;  1HYF A;  1ZGX A;  1MGW A;  1BNI A;  1BSA A;  1RGF A;  1IYY A;  7RNT A;  1AQZ A;  1UCL A;  2KF4 A; 
#chains in the Genus database with same CATH topology
 1UI8 A;  1ASK A;  1IQ8 A;  5AEU B;  1B2X A;  2P0X A;  2HML B;  2ML6 A;  3B8L A;  3JUN A;  1BGS A;  1EG9 B;  4R1K A;  1TFO A;  2E2V A;  1JB5 A;  2IMJ A;  5M18 A;  1J2B A;  3LTA A;  7GSP A;  4BL2 A;  3A76 A;  1LOY A;  3KE7 A;  4K1U A;  3LOY A;  4BTY A;  1TFK A;  1OHS A;  3B4P A;  2RCD A;  1DE3 A;  5IW9 A;  5JPU A;  3CCS 3;  3BIR A;  1V58 A;  1S5A A;  1RGG A;  1MWT A;  1GD4 A;  2YX9 A;  2MC8 A;  3SOA A;  2W04 A;  1CQS A;  2HMO B;  2BU4 A;  3UB1 A;  1JB4 A;  2CG1 A;  1BUQ A;  2P0M A;  1FGQ A;  5EQL A;  1SPU A;  2P05 A;  1RRH A;  3FF2 A;  1M9G A;  1RGH A;  3GZX B;  2INX A;  4HM2 B;  1VQ9 3;  2B1X B;  1KD1 4;  1W6G A;  3CD6 3;  1IT8 A;  3CNX A;  1N8R 4;  4QWT A;  4N6U A;  3T0U A;  4NHF A;  3X3X A;  2OQE A;  1OAC A;  1SQW A;  1VQL 3;  1UUV B;  3LZA A;  1LOV A;  3F14 A;  1BAN A;  4MMZ B;  1VQ7 3;  2GSP A;  4GB5 A;  5IEN A;  1Q7Y 4;  1RHL A;  4IT7 A;  2V1L A;  3B4O A;  2A15 A;  3NBJ A;  5AII A;  1FZU A;  1D6U A;  4WYK B;  2JDI H;  1BOX A;  3N54 B;  1BSB A;  1UGH I;  3RNT A;  4BTW A;  1TRQ A;  4BTX A;  1IT7 A;  2D42 A;  2LYX A;  4MMY B;  1BNE A;  2RBI A;  1BAO A;  1GMR A;  2CFG A;  3DGY A;  4TX4 A;  2GBX B;  1TJD A;  2YFL B;  4WFO A;  1QVF 2;  2CFK A;  3IMA B;  1PY3 A;  2OQE C;  1RN7 A;  1KC8 4;  2WOH A;  1W6Y A;  3U97 A;  4EC6 A;  1ULJ B;  2JQ5 A;  3G4S 3;  2IYJ A;  1RSN A;  5FGO A;  1EA2 A;  1A2K A;  5IEO A;  3X41 A;  3KII A;  4LZI A;  1TUH A;  2W2C A;  1SJW A;  2GXF A;  3MPH A;  3UL6 A;  2Y73 A;  3NV0 A;  2UGI A;  3DMC A;  1TU5 A;  3V92 A;  1MGR A;  3VF1 A;  4LEH A;  1EUI C;  1OHP A;  1HU9 A;  4RNT A;  5AIF A;  3OWY A;  4ORL A;  3SOY A;  1ZS7 A;  2CWU A;  2F5M A;  2IUJ A;  1IVW A;  3WA2 X;  5KP1 A;  2Z77 A;  3DGO A;  3AGN A;  2XSH B;  3K63 A;  4KZ1 A;  1DYU A;  1IQX A;  2ZA4 A;  2UUG C;  1IVU A;  3F8X A;  3MSO A;  4HVN A;  3STD A;  3WR2 A;  6GSP A;  2C4B A;  1IK3 A;  1Q81 4;  4KVH A;  1VQN 3;  1B20 A;  1NWW A;  3O8Y A;  3SYU A;  1OHO A;  4H61 A;  1GY6 A;  5AYS C;  1OF5 A;  1EKM A;  1GD3 A;  3N9H A;  3U1W A;  4STD A;  1W5Z A;  1L5G B;  3X3Y A;  1D6Z A;  4AKZ A;  3CCM 3;  1O7M B;  2QGU A;  3FG1 A;  9RNT A;  2BNG A;  3G8Z A;  3CCU 3;  4FR9 A;  1YI2 3;  3JUO A;  3EN8 A;  2CC3 A;  1IV7 A;  4NPB A;  3BNE A;  4HJL B;  4PEJ A;  4HM7 B;  4OUQ A;  5STD A;  1AV4 A;  4XBT A;  1OUN A;  1SAR A;  3F40 A;  2SAR A;  4J8T A;  3LXU X;  3KSE D;  1UCJ A;  4KFD A;  1BNJ A;  1YVS A;  4HAA A;  3HX8 A;  2CWV A;  4WHA A;  2CKF B;  3CPO A;  3EE1 A;  1RTU A;  5BU4 A;  1BRI A;  1S72 3;  2FNQ A;  4MJD A;  4R80 A;  1Q42 A;  4L8O A;  2OWP A;  2HMJ B;  1FGM A;  3ECF A;  1ZGX A;  2K3D A;  1MGW A;  2W56 B;  1W7C A;  2B24 B;  3F7S A;  3PXM A;  2XSO B;  1W2Z A;  1Q7H A;  1UCL A;  5BVB A;  3AHW A;  2P09 A;  1VQQ A;  1KSI A;  4O02 B;  4IPB A;  3F9S A;  1MNL A;  5IF6 A;  1G0T A;  2IA7 A;  1JKG A;  2J8X B;  2CX0 A;  2C10 A;  1N5P A;  2K0M A;  3H3H A;  1TTO A;  1TIJ A;  2CFW A;  3HK4 A;  4MMX B;  4N3V A;  1I70 A;  2XF3 A;  1WTH A;  5IG0 A;  3OWS A;  1PFP A;  3WOE B;  1T3B A;  1VQO 3;  3DGL A;  4R9K A;  2AAD A;  2IY2 A;  1BRK A;  3EF8 A;  3ZFZ A;  2CG0 A;  4AEQ A;  1CH0 A;  1GY5 A;  1O7H B;  4IIA A;  5I97 A;  3G71 3;  1YHQ 3;  1STD A;  1JJ2 2;  6RNT A;  5G2G A;  3FLJ A;  3X42 A;  3NX0 A;  2L4V A;  1OF5 B;  3LML A;  3SX1 A;  3X40 A;  2K54 A;  5AEW B;  3OW2 2;  3NM7 A;  2FXT A;  4R9L A;  3KZT A;  1VQ8 3;  3GZR A;  1BRJ A;  1W01 A;  2H0G A;  3GSP A;  3MG3 A;  1UUW B;  2AAE A;  1RN1 A;  1WMO A;  2XGL A;  4N6N B;  5CLK A;  1ZX2 A;  3UNL A;  1N9J A;  4XDV A;  1E3R A;  4L8P A;  3I56 3;  4XB5 A;  5DRE A;  5EEO A;  1I8V A;  3LTC A;  1B2Z A;  1MWS A;  3AGO A;  3RGA A;  5KP4 A;  1B2U A;  3ZG5 A;  4OK0 A;  2BIR A;  4KT3 B;  3EC9 A;  1LNI A;  5D81 A;  5IG4 A;  1HKX A;  2OCT A;  3KN4 A;  2RSX A;  1OCV A;  1FYS A;  1OGZ A;  1V57 A;  1FW7 A;  1GS3 A;  2KF5 A;  4XBY A;  4CJN A;  3H51 A;  1M1X B;  1PU4 A;  1DMN A;  3BND A;  1Q40 B;  3MG1 A;  1B27 A;  2PNC A;  2QA4 3;  1GMQ A;  1US1 A;  3MHE A;  1JZD A;  1LQG C;  3K0Z A;  4KFE A;  1VQM 3;  1JKG B;  1NB3 I;  1K41 A;  3PS8 A;  4FMD A;  4GSP A;  4ZM8 A;  5EVH A;  1NDO B;  4MEI A;  1LOX A;  1X1Y A;  3EN1 B;  3K7C A;  1A2V A;  1GSP A;  1YJN 3;  1GYB A;  2Y74 A;  4J9A A;  1WMN A;  3FF0 A;  1I0V A;  2CK3 H;  1RN4 A;  2WGO A;  4BIR A;  1Q86 4;  1AVL A;  1QVG 2;  5CF2 A;  1GY7 A;  1DMM A;  1UW1 A;  1SIH A;  6STD A;  3OX9 A;  3D9R A;  1I2G A;  3L0R A;  3KKG A;  2XFT A;  1B2S A;  1Q9E A;  3FZW A;  1ZO2 A;  4HKV B;  1MWR A;  1X1X A;  5M19 A;  3DH2 A;  3E99 A;  3LTD A;  4K1V A;  1B3S A;  3T8U A;  1O7P B;  1UUG B;  4X2O A;  3ALA A;  1AVK A;  1JBR A;  1HZ1 A;  4EW5 A;  1QAK A;  3Q3F A;  4FCZ A;  3SXX A;  1BNF A;  2HMK B;  3X3Z A;  2STD A;  4CPK A;  1UCI A;  1YIJ 3;  1IQY A;  3AMO A;  4LSO A;  3VGN A;  1VQP 3;  5CF1 A;  3BNC A;  1RGE A;  4CCV A;  2W9Q A;  4RNZ A;  1YIT 3;  3PZW A;  3NM2 A;  1AQZ A;  3S28 A;  2CW9 A;  3CME 3;  1M1K 4;  3MKI A;  3OXA A;  1RGL A;  2XRX B;  4HM4 B;  4J5G A;  3S67 A;  3OWU A;  3S29 A;  3URP A;  1T5Y A;  3QRD A;  3ROB A;  8RNT A;  4JRF A;  1LRA A;  2XR8 B;  1VQ4 3;  1FGT A;  3WHO A;  1CYV A;  1W00 A;  3FCS B;  3K9M C;  3NBB A;  3G16 A;  3N8B A;  3WDG B;  2Q07 A;  3I0Y A;  2SBL A;  1GOY A;  4FCM A;  1OGX A;  4R4K A;  4EXR A;  4HYZ A;  1NO3 A;  1C7H A;  3NQY A;  1WMP A;  4GHO A;  1GOU A;  1BVI A;  2UX0 A;  2W03 A;  3PYJ A;  5M1A A;  3V99 A;  2LQV A;  1BNR A;  3FG3 A;  1RMS A;  1LNH A;  2ML5 A;  2OTL 3;  1K73 4;  3D5I A;  1G02 A;  2L1S A;  1BSE A;  3IJE B;  1KWI A;  1BIR A;  4O8S A;  1YGW A;  1IDP A;  3A5E A;  3EX9 A;  1BSD A;  5D82 A;  3EB8 A;  3ER7 A;  1MOL A;  2KAA A;  5GSP A;  3G0K A;  5IG5 A;  3DM8 A;  4GL6 A;  1DVC A;  1W02 A;  1W4N A;  3NV0 B;  3G6E 3;  3FH1 A;  1BNS A;  1U5O A;  3SED A;  3KCH A;  4I5Q A;  5HOH A;  2W0Q A;  5G1L A;  1ROA A;  4HZB B;  1AR0 A;  1LVN A;  1LXE A;  1MWU A;  4EYC A;  1BU4 A;  4H3U A;  2GU3 A;  3CCV 3;  2W6J H;  2ZL8 A;  4X2H A;  2XFS A;  3S5C A;  5ELU A;  1JB2 A;  3AMO B;  3BU4 A;  3CCR 3;  1B21 A;  4HZ9 B;  2KF3 A;  1T2H A;  2KRT A;  2WOF A;  3GZB A;  1IV9 A;  3CC7 3;  1YVB I;  1ULI B;  2KCD A;  1KQS 2;  1X1U A;  1UGI A;  2R4I A;  2BHM A;  4O2H A;  2XH9 A;  3F7X A;  3KSP A;  3GZY B;  1Q82 4;  1R4Y A;  2HOH A;  3CC2 3;  3M8C A;  4HM5 B;  1A67 A;  2BMQ B;  3GWR A;  2CX1 A;  3FGY A;  4RBN A;  4JF8 A;  5D83 A;  4FMA A;  1BRS A;  4RZM A;  1TP6 A;  2P38 A;  1FGR A;  1SII A;  1W2B 2;  1QAF A;  1C54 A;  3LT8 A;  2QIY A;  2CFL A;  1RGA A;  4XBX A;  3MG2 A;  1DMQ A;  2XEP A;  1T2I A;  1UDI I;  3CU3 A;  1RGC A;  1BRG A;  1Y4K A;  2RNT A;  3EJV A;  4KFF A;  1JV2 B;  4CDL A;  2HMM B;  3LT9 A;  1LQM B;  1E3V A;  3CMA 3;  2CHC A;  1JN5 A;  1K28 A;  3JUP A;  3DY5 A;  4HM0 B;  2FGT A;  5JBS A;  4OVM A;  2M7O A;  1JZO A;  2F5W A;  1LOW A;  4U13 A;  4XM4 A;  3PCR A;  3BB9 A;  4XDW A;  3GRD A;  1ISK A;  1D6Y A;  3S27 A;  1FGO A;  2F56 A;  4EV2 A;  2IUK A;  5IG3 A;  3PCS A;  3IPT A;  1GOV A;  1CYU A;  2RGQ A;  2KXG A;  3D4A A;  1OPY A;  5AIH A;  1QMA A;  3DZL A;  1RGF A;  4HM1 B;  1YGE A;  4EBG A;  3CCL 3;  1G96 A;  1IYY A;  3EBY A;  1NNV A;  3MYT A;  2KF4 A;  2ZHX B;  3NXJ A;  3T8N A;  3WOD G;  3CC4 3;  1N9E A;  1IU7 A;  1NU3 A;  4WP5 A;  1RGK A;  3RGR A;  4L7K A;  3HII A;  1FUT A;  4HBR A;  4HM6 B;  5RNT A;  1BRH A;  1RDS A;  5IEP A;  3FG4 A;  2PZV A;  5G1K A;  3CPW 2;  2CWT A;  2H0H A;  3MWZ A;  3NUV A;  4EV5 A;  2RFR A;  2E2T A;  5AIG A;  1X1W A;  7STD A;  3HOH A;  2GEX A;  5AI1 A;  1M90 4;  4DKI A;  1EEJ A;  2W56 A;  1FUS A;  4WWU C;  1BSC A;  2D1W A;  5AYR B;  1BNG A;  2R41 A;  3DXO A;  3I55 3;  1RCL A;  1IVX A;  2OOV A;  5A0O B;  1W6C A;  2O9U X;  3Q1C A;  5CK6 A;  3WA3 A;  3J7Y d;  1I3F A;  1EQK A;  1A2P A;  2ZDJ A;  3BLZ A;  3F8H A;  4FMC A;  1K8A 4;  3OV4 A;  3V98 A;  1UCK A;  1RKY A;  3LTB A;  3WOF B;  3GAX A;  3CNM A;  3Q2P A;  3NHX A;  5ELJ A;  1JBS A;  1R4C A;  2KF6 A;  5DRV A;  1JN5 B;  2BMR B;  2OOV C;  4K90 B;  1JRQ A;  3DGN A;  3DGM A;  1E97 A;  3HI7 A;  3VSY A;  5IER A;  2BMO B;  2YFI B;  1AY7 A;  1DET A;  1N8Q A;  4Q53 A;  1VZZ A;  1BRN L;  1PYL A;  3K5T A;  2C11 A;  2CIU A;  2BO9 B;  1B2M A;  4G1M B;  1YJW 3;  5LC6 A;  4BL3 A;  2GBW B;  1STF I;  1DVD A;  1O7W B;  3UJM A;  2CH9 A;  2F98 A;  2GU1 A;  3LYG A;  3TDG A;  3EHC A;  3CCQ 3;  1JBT A;  3SVA A;  1I0X A;  2F86 B;  2XGN A;  3DUK A;  4FMB A;  4I4K A;  3Q90 A;  1NJI 4;  3UL5 A;  4BU4 A;  3D79 A;  1YJ9 3;  2MF7 A;  2WGQ A;  2Z76 A;  4LYL B;  1O7N B;  1RCK A;  1V74 A;  1N5H A;  3NQZ A;  3CCJ 3;  3JVC A;  1K9M 4;  1CEW I;  1BUJ A;  1I3I A;  3JUQ A;  3SLU A;  3WMD A;  1FUW A;  1GMP A;  4ILF A;  3HZP A;  1RRL A;  1ROV A;  3QK9 A;  3B7C A;  4J5K A;  1VQ5 3;  2Z6B A;  5JPP A;  4FCJ A;  1FA3 A;  4NRE A;  1TRP A;  5FW5 A;  5TGN A;  4N6M A;  2I9W A;  1U8C B;  1I2F A;  1OH0 A;  3KFQ C;  1I2E A;  4N6O B;  1Q40 A;  2BT3 A;  4RNY A;  3ZG0 A;  1RNB A;  1YNV X;  1QAL A;  2GEY A;  2WO0 A;  4N6V 0;  1RLS A;  2E2U A;  1RNT A;  4K61 A;  4WYK A;  3D5G A;  4N6L A;  4HOH A;  3AHS A;  1QJG A;  1IVV A;  1WQL B;  3EQQ B;  3NBR A;  5BIR A;  3FSD A;  1RJO A;  2OTJ 3;  1VQK 3;  3BNB A;  3EBT A;  5KP3 A;  2H0I A;  1Z1S A;  3PGB A;  1NB5 I;  1F8N A;  1VQ6 3;  1O7G B;  3CXC 2;  2YFJ B;  5BXQ A;  1WNH A;  4LGQ A;  1JNQ A;  2F99 A;  2CFD A;  2HMN B;  2Z7A A;  3FKA A;  8CHO A;  2QEX 3;  5LC7 A;  3D3L A;  3RDE A;  4O3V A;  2F4Y A;  1HYF A;  3JUM A;  1UI7 A;  1BNI A;  1BSA A;  5HGR A;  1A90 A;  4N6T A;  2W9P A;  3LH4 A;  4HM8 B;  3HIG A;  5CXO A;  3CCE 3;  4LMI A;  7RNT A;  4AKY A;  2O3O A;  4HM3 B; 
#chains in the Genus database with same CATH homology
 3AHW A;  1RGL A;  1B2X A;  4J5G A;  3URP A;  8RNT A;  1RGK A;  1FUT A;  5RNT A;  1BGS A;  1BRH A;  1LRA A;  1RDS A;  3WHO A;  7GSP A;  1X1W A;  1TTO A;  1LOY A;  3HOH A;  1I70 A;  1GOY A;  1FUS A;  1DE3 A;  1BSC A;  3BIR A;  1RGG A;  1C54 A;  1BNG A;  2AAD A;  2BU4 A;  1BRK A;  4GHO A;  1RCL A;  1GOU A;  1BVI A;  1CH0 A;  1RGH A;  6RNT A;  1BNR A;  1RMS A;  3D5I A;  1G02 A;  1BSE A;  1I3F A;  1BIR A;  1A2P A;  1YGW A;  1LOV A;  3A5E A;  1BAN A;  1BSD A;  2GSP A;  1UCK A;  2KAA A;  5GSP A;  1RHL A;  1JBS A;  1FZU A;  1BRJ A;  2KF6 A;  3GSP A;  1BOX A;  2AAE A;  1BSB A;  1RN1 A;  3RNT A;  1TRQ A;  1BNS A;  1BNE A;  3KCH A;  5HOH A;  2RBI A;  1BAO A;  1GMR A;  3DGY A;  1I8V A;  1BU4 A;  1AY7 A;  1DET A;  1PY3 A;  1B2Z A;  3AGO A;  1B2U A;  1BRN L;  1PYL A;  3BU4 A;  2BIR A;  1RSN A;  1LNI A;  1B21 A;  2KF3 A;  1B2M A;  1T2H A;  1FYS A;  1FW7 A;  1JBT A;  2KF5 A;  1I0X A;  1X1U A;  1B27 A;  1MGR A;  1GMQ A;  4RNT A;  4BU4 A;  1R4Y A;  2HOH A;  1RCK A;  2F5M A;  3AGN A;  2ZA4 A;  4GSP A;  3WR2 A;  6GSP A;  1BUJ A;  1I3I A;  2C4B A;  1BRS A;  1X1Y A;  1GMP A;  1B20 A;  1GSP A;  3SYU A;  1I0V A;  1RN4 A;  4J5K A;  4BIR A;  1TRP A;  1RGA A;  1I2F A;  1I2E A;  9RNT A;  1RNB A;  1T2I A;  1I2G A;  1YNV X;  1RGC A;  1BRG A;  1RLS A;  2RNT A;  1RNT A;  1B2S A;  1Q9E A;  3D5G A;  4HOH A;  1SAR A;  1X1X A;  3AHS A;  5BIR A;  2SAR A;  3DH2 A;  1UCJ A;  1B3S A;  1BNJ A;  2F5W A;  1LOW A;  1YVS A;  4HAA A;  1RTU A;  1JBR A;  1HZ1 A;  2F56 A;  5BU4 A;  3Q3F A;  1BRI A;  1BNF A;  1UCI A;  1GOV A;  2F4Y A;  3D4A A;  1RGE A;  1HYF A;  1ZGX A;  1MGW A;  1BNI A;  1BSA A;  1RGF A;  1IYY A;  7RNT A;  1AQZ A;  1UCL A;  2KF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...