1YVSA

Trimeric domain swapped barnase
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Trimeric domain-swapped barnase.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Endonuclease
molecule keywords BARNASE
total genus 23
structure length 108
sequence length 108
ec nomenclature ec 3.1.27.-:
pdb deposition date 1998-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1yvsA00
1GOUA 3AHSA 2ZA4A 3WR2A 1X1YA 1C54A 1I3IA 3KCHA 1G02A 2F5MA 3SYUA 1LRAA 9RNTA 3RNTA 1BNJA 2KF4A 2KF5A 1BRIA 1RGAA 2BIRA 1BOXA 2F4YA 4RNTA 4GHOA 7GSPA 1RCLA 1FYSA 1BRKA 3D5IA 1UCLA 4BIRA 1HYFA 1BRNL 1RNBA 1RCKA 1RGCA 1RNTA 4J5KA 1B21A 1B3SA 1YGWA 1RHLA 1RN1A 1BUJA 1RSNA 1RGGA 1BRJA 1R4YA 1I8VA 1BVIA 1I0VA 3DGYA 1UCJA 1YNVX 3URPA 1GMPA 1Q9EA 1TTOA 2AAEA 1B2UA 1JBRA 1BAOA 1B2XA 1GOVA 1MGRA 1T2HA 5HOHA 1TRQA 1DE3A 1BSAA 1X1WA 1B2SA 1CH0A 1RGLA 2C4BA 3A5EA 1BRGA 1IYYA 4BU4A 1I2EA 2KAAA 1FZUA 2F5WA 1AQZA 1B2MA 1BIRA 1FUTA 2BU4A 3AHWA 1BSBA 3BU4A 1RGKA 1BU4A 3Q3FA 1RLSA 2KF3A 1PY3A 5BU4A 1YVSA 1HZ1A 1A2PA 1T2IA 1BANA 1BGSA 1RTUA 1MGWA 4GSPA 1RGHA 1BSEA 1LNIA 1BSCA 2RNTA 1BNGA 1I0XA 1PYLA 1AY7A 1GOYA 2AADA 1X1UA 3WHOA 3GSPA 4HAAA 1BRHA 1LOVA 1BNRA 1B2ZA 1FW7A 3HOHA 1RN4A 1B27A 1RGEA 1I70A 3D4AA 3D5GA 7RNTA 1ZGXA 1BNEA 6GSPA 1I2FA 1JBTA 2RBIA 1X1XA 1BRSA 2HOHA 1BSDA 1DETA 2SARA 3AGOA 1FUSA 1TRPA 1LOYA 1UCIA 1BNSA 1LOWA 1GSPA 4HOHA 5GSPA 2KF6A 1RDSA 2GSPA 4J5GA 1RGFA 1UCKA 5BIRA 1RMSA 1I2GA 3AGNA 1GMRA 1BNIA 2F56A 3BIRA 6RNTA 1GMQA 8RNTA 5RNTA 1BNFA 3DH2A 1B20A 1JBSA 1I3FA 1SARA
chains in the Genus database with same CATH superfamily
4CPKA 1STFI 4LEHA 2K3DA 1W00A 3NV0B 1C54A 3V98A 4WYKB 4R1KA 1A2VA 1IT7A 1I3IA 1LQMB 2F5MA 2HMKB 3SYUA 3WA2X 1VQM3 9RNTA 1TIJA 5EQLA 1WMNA 2XRXB 1AR0A 2IY2A 1IU7A 1D6UA 1JZOA 1DMMA 4L8OA 3SEDA 1BRIA 3CNMA 3FH1A 4BTWA 2F4YA 1J2BA 1RRLA 3MKIA 4GHOA 2H0GA 2ML6A 1FYSA 1BRKA 3H51A 1JN5A 2ML5A 4BIRA 1RCKA 1RNTA 2IUKA 3LXUX 1UW1A 2GU1A 4STDA 5LC6A 3CPOA 3CC23 3CD63 3HIGA 3G4S3 1Z1SA 2UGIA 4FMDA 4LSOA 1RSNA 4FR9A 4HM3B 1CQSA 2YX9A 3DGYA 2QGUA 2M7OA 3M8CA 3NQZA 3FZWA 1UUVB 1ZS7A 4WFOA 1RJOA 2ZL8A 2W56A 3BB9A 3MYTA 3KFQC 3URPA 3FG1A 5M1AA 3FG4A 1QVF2 1EUIC 1GD3A 1JNQA 1QJGA 1BAOA 3LT9A 3N8BA 1T2HA 1QVG2 5HOHA 1TRQA 1DMNA 2BMRB 2HMMB 3NXJA 3BNCA 1CH0A 3RGRA 3LYGA 4JRFA 3VSYA 2C4BA 3DGOA 4FCJA 4WP5A 5JPUA 1CYUA 4KFFA 7GSPA 2XFSA 1Q814 1I2EA 2YFLB 2A15A 2W0QA 3K0ZA 4ZM8A 2FGTA 4ORLA 1S723 2QA43 2Z7AA 5EVHA 1EKMA 1FUTA 5FW5A 3X3XA 1PFPA 4R9KA 1IVXA 4FMCA 3X41A 2H0HA 5KP4A 3VF1A 2C11A 3CPW2 3HK4A 3MG1A 3V92A 1RLSA 1ROAA 1YGEA 1K41A 2KF3A 4HZ9B 1IVUA 1HZ1A 1YVSA 4AKZA 5BU4A 1M1K4 1A2PA 5EEOA 3CME3 2QIYA 3DZLA 4MMXB 3WOFB 3LZAA 2V1LA 1WMPA 1V57A 3DXOA 1KSIA 1ISKA 1MNLA 3U1WA 1EEJA 1V58A 2Z6BA 3JUMA 1M1XB 3S67A 1W01A 3EE1A 4HJLB 1BSCA 1PYLA 2CH9A 3ALAA 2AADA 4GB5A 1X1UA 3BNBA 3IMAB 1N8QA 1UUGB 2PNCA 1B2ZA 1LQGC 2CWTA 2E2TA 3N54B 2QEX3 1FW7A 1RGEA 1SQWA 1SJWA 2OTJ3 3CCE3 1I2FA 1M9GA 3LH4A 5IG3A 3CMA3 3PZWA 4U13A 3GAXA 3DGLA 1W7CA 3OXAA 1IVVA 3L0RA 1DETA 3V99A 3ZFZA 2F98A 4AKYA 1FUSA 3K9MC 3JUOA 1W6CA 2P0XA 1UCIA 1BNSA 3WMDA 2IUJA 2P09A 3KIIA 1A90A 1U5OA 1IYYA 5LC7A 1UUWB 2XH9A 3DY5A 2GSPA 2FNQA 5AIGA 2CWVA 4LGQA 1MWUA 4FCMA 1W2ZA 3EN1B 1GMQA 1W02A 4BTXA 3F7XA 3QRDA 1EG9B 1TFOA 5RNTA 1FGMA 1BNFA 1B20A 3CCU3 1IV7A 1N9EA 1SARA 4HKVB 3WOEB 2W6JH 1NDOB 1UGHI 2CFKA 2HMOB 3CCJ3 1JJ22 3MSOA 1W5ZA 4X2OA 1YIT3 3FSDA 2CG0A 1LRAA 3K63A 3GZBA 3N9HA 3OWYA 2Y74A 5IENA 1RKYA 1YIJ3 5HGRA 3WA3A 4N3VA 3G713 4NREA 5JBSA 2L1SA 3Q1CA 1OCVA 4WHAA 2MF7A 1UCLA 4J9AA 1MOLA 5IERA 4J8TA 4J5KA 1B21A 1B3SA 3EN8A 4NPBA 1YGWA 1W2B2 1E3RA 1RHLA 5JPPA 4KFEA 1DVDA 1EQKA 1Q40B 1I8VA 4DKIA 1I0VA 4N6LA 3DM8A 4KVHA 4HM2B 3KSPA 1NO3A 3K7CA 5M19A 6STDA 3F14A 1TTOA 4TX4A 3B7CA 2KCDA 2P0MA 4IPBA 2OQEC 4BL3A 3A76A 4K61A 2BT3A 1K28A 3F9SA 1BSAA 1X1WA 1RGLA 3PGBA 3KKGA 1DVCA 1NNVA 1R4CA 2HMLB 1G96A 4I4KA 4HVNA 2XFTA 1CYVA 1FZUA 2CHCA 2KRTA 3FLJA 4HM4B 2CFWA 1IDPA 1BIRA 3I0YA 4EBGA 2HMNB 1Q824 4KZ1A 3BU4A 1HKXA 1RGKA 2HMJB 8CHOA 4JF8A 2Z76A 1VZZA 2WGQA 4EYCA 1O7PB 1ZX2A 2F99A 1OHOA 5I97A 1A2KA 4N6MA 1VQ63 3EB8A 1AVKA 3EBYA 1BANA 1BGSA 3FF0A 1O7MB 1MGWA 1RTUA 4GSPA 3NQYA 4MEIA 3CU3A 3SOAA 1QALA 1JZDA 1FGQA 1E3VA 1YI23 2RNTA 1VQL3 3D3LA 3LMLA 1I0XA 4OK0A 3LOYA 1NWWA 1GOYA 2CIUA 1LVNA 4CJNA 4HAAA 1BRHA 4G1MB 1LOVA 1BNRA 3HOHA 2YFJB 3HZPA 7RNTA 3D4AA 1IQ8A 5AYRB 2OQEA 2Y73A 3WODG 2I9WA 1IQXA 4HZBB 1JBTA 4K1VA 2J8XB 4N6OB 3OW22 2W56B 4EV2A 2HOHA 4N6UA 1U8CB 2STDA 4WWUC 2SARA 2W2CA 2XR8B 3ZG0A 1QAKA 1G0TA 1GSPA 2E2UA 2R4IA 1N5PA 3ER7A 5GSPA 1T5YA 1W6YA 3NBBA 1RDSA 3F7SA 4J5GA 2F86B 1VQQA 2H0IA 2O3OA 1I2GA 1BNIA 2GU3A 3HI7A 1VQ73 3X3YA 3UL6A 1JB4A 3D79A 3FCSB 4IT7A 2PZVA 1WTHA 1HU9A 3EHCA 5TGNA 8RNTA 1O7NB 1Q40A 3OWSA 3G8ZA 1TU5A 3WDGB 1K9M4 1JBSA 1CEWI 4BTYA 3UB1A 5D83A 1GY7A 2K0MA 3CCL3 4X2HA 1GOUA 1FA3A 3AHSA 1QMAA 3IPTA 3CC73 1S5AA 3X3ZA 3UNLA 4QWTA 3RNTA 4K90B 1BNJA 5A0OB 1FGRA 1UGIA 3KZTA 3FGYA 2GBWB 1RGAA 1SIHA 1BOXA 2XEPA 2WOFA 1W4NA 3KE7A 3MPHA 1N9JA 2IMJA 2BO9B 3JVCA 1RCLA 1KWIA 4FCZA 1D6YA 5AEUB 4EW5A 2CFGA 2D42A 1BRNL 1HYFA 2YFIB 1RNBA 3NM2A 5ELUA 3PXMA 3LTAA 2XSHB 3GZXB 1EA2A 2FXTA 2ZDJA 1AV4A 3EQQB 2LQVA 5G1LA 1BRJA 5BXQA 2E2VA 1BVIA 1R4YA 3UL5A 2KXGA 3ROBA 1GMPA 3HX8A 3O8YA 3CNXA 3MG3A 4WYKA 1Q9EA 3EC9A 1FUWA 2AAEA 3K5TA 3FKAA 1JB2A 1WQLB 4BL2A 3G16A 1JBRA 1SPUA 1MGRA 2CC3A 3FF2A 5AYSC 1DE3A 2BHMA 4XM4A 2CFDA 5IF6A 1BRGA 3EX9A 3DGNA 3RDEA 4N6TA 4O3VA 1JB5A 5ELJA 1YJW3 1GYBA 1ASKA 5CF1A 3EBTA 4HM6B 3B4PA 3DGMA 3LT8A 4HM5B 1VQ43 3AHWA 4MMYB 3CCM3 3CCV3 4HM8B 1NU3A 4H61A 1C7HA 3Q3FA 2UX0A 1OGZA 3PYJA 2GXFA 2RFRA 1Q7Y4 1VQ53 1T2IA 1VQO3 5G1KA 1TJDA 3PCSA 4O02B 4RNZA 2P05A 3EF8A 2XF3A 1OACA 1RGHA 1Q7HA 1SIIA 3OV4A 3E99A 1LNIA 4XBYA 1IT8A 3Q2PA 3B8LA 4HBRA 2RCDA 3ZG5A 2XSOB 2W9PA 1GY6A 3LTBA 3WHOA 2IYJA 3GSPA 4L7KA 1A67A 1B27A 1I70A 3D5GA 3EJVA 4MJDA 2OOVA 3S27A 1ZGXA 1BNEA 1RRHA 1W6GA 2WO0A 3UJMA 3CCQ3 4EC6A 2O9UX 4KT3B 2RBIA 1X1XA 1VQP3 1OGXA 1N8R4 5CF2A 3G6E3 4MMZB 2W03A 3PS8A 3LTCA 1BSDA 1N5HA 2WGOA 2CX0A 2XGLA 2P38A 3AGOA 3S29A 1TRPA 4HM0B 2BNGA 1L5GB 2WOHA 5DREA 4Q53A 1DMQA 3JUNA 5IG0A 1WNHA 3U97A 3KSED 4HOHA 1GS3A 3OWUA 4NHFA 2CFLA 1TFKA 4HM7B 3VGNA 2KF6A 1KC84 4XDWA 4K1UA 5AIHA 1RGFA 4FMAA 1UCKA 1E97A 1RMSA 1ROVA 2OWPA 3G0KA 1GMRA 5D82A 5BIRA 2F56A 4RNYA 3BIRA 4N6NB 4XBTA 4EV5A 1LOXA 1OF5A 4AEQA 5KP3A 3F8HA 5CLKA 4OUQA 2C10A 3MWZA 4R80A 1I3FA 5STDA 2BMQB 3SVAA 3I563 1T3BA 3SOYA 3T8UA 2ZA4A 3F40A 1X1YA 4O2HA 3WR2A 2XGNA 5CK6A 4L8PA 1DYUA 1G02A 1F8NA 1OPYA 1OUNA 2GEYA 1LXEA 3KCHA 4HM1B 3NBJA 3NX0A 2KF4A 4XB5A 1STDA 2KF5A 3GZYB 1D6ZA 1FGTA 3J7Yd 3S28A 2BIRA 1US1A 4RNTA 1QAFA 3GZRA 2CK3H 1JN5B 3D5IA 5IEPA 2BMOB 1JV2B 1OH0A 2W9QA 2K54A 1RN7A 2B1XB 1PU4A 1RGCA 1NJI4 3STDA 5KP1A 2GBXB 3NBRA 3B4OA 3S5CA 1TP6A 1RN1A 1BUJA 1O7HB 1RGGA 3AMOA 5IW9A 2OOVC 4LMIA 4LZIA 2Q07A 1UCJA 1VQ83 1YNVX 1V74A 3LTDA 4XBXA 2OCTA 3JUPA 4O8SA 2GEXA 1VQN3 1Y4KA 1B2UA 2ZHXB 1B2XA 1GOVA 2SBLA 1KD14 3ECFA 2Z77A 1B2SA 3DMCA 1ULIB 3X42A 1KQS2 3A5EA 1IK3A 3CXC2 3SXXA 2MC8A 4XDVA 3RGAA 1LNHA 1TUHA 4I5QA 1JKGA 4OVMA 5AI1A 3TDGA 4BU4A 2KAAA 3D9RA 4HYZA 5DRVA 2F5WA 2JDIH 3BNEA 1K8A4 1WMOA 1AQZA 1B2MA 1MWTA 1OF5B 2BU4A 2CG1A 1BSBA 1Q864 5CXOA 3SX1A 3PCRA 5FGOA 1BU4A 2CW9A 3CC43 3X40A 1ULJB 1PY3A 3H3HA 3DUKA 3HIIA 3MHEA 4FMBA 4ILFA 4GL6A 7STDA 3NV0A 4R4KA 1UI7A 5G2GA 3T8NA 1VQ93 3CCS3 3NHXA 4CCVA 1GY5A 3BLZA 3GWRA 1BSEA 3NUVA 3NM7A 5IEOA 2W04A 1O7WB 1BNGA 4N6V0 1VQK3 1AY7A 1JKGB 1UI8A 4KFDA 4PEJA 2L4VA 2D1WA 5M18A 1RN4A 2INXA 1M904 1NB5I 2UUGC 4H3UA 1YJ93 2B24B 6GSPA 2IA7A 3FG3A 1Q42A 2RSXA 3AMOB 1OHSA 2RGQA 3BNDA 3IJEB 1OHPA 3Q90A 4R9LA 3SLUA 1ZO2A 4CDLA 3GRDA 1IV9A 1YHQ3 4RZMA 1FGOA 3F8XA 2JQ5A 1BRSA 4IIAA 2LYXA 1GD4A 5AEWB 1IQYA 3CCR3 1IVWA 1MWSA 3T0UA 1BUQA 1LOYA 1YJN3 1LOWA 1MWRA 5AIFA 3JUQA 5BVBA 1O7GB 1YVBI 1UDII 2R41A 5IG4A 2CX1A 3I553 1K734 3OX9A 3QK9A 3MG2A 1JRQA 3AGNA 5AIIA 5IG5A 6RNTA 4EXRA 2OTL3 5D81A 3KN4A 4RBNA 2CKFB 1NB3I 3DH2A 1AVLA 4LYLB 2CWUA
chains in the Genus database with same CATH topology
1GOUA 3AHSA 2ZA4A 3WR2A 1X1YA 1C54A 1I3IA 3KCHA 1G02A 2F5MA 3SYUA 1LRAA 9RNTA 3RNTA 1BNJA 2KF4A 2KF5A 1BRIA 1RGAA 2BIRA 1BOXA 2F4YA 4RNTA 4GHOA 7GSPA 1RCLA 1FYSA 1BRKA 3D5IA 1UCLA 4BIRA 1HYFA 1BRNL 1RNBA 1RCKA 1RGCA 1RNTA 4J5KA 1B21A 1B3SA 1YGWA 1RHLA 1RN1A 1BUJA 1RSNA 1RGGA 1BRJA 1R4YA 1I8VA 1BVIA 1I0VA 3DGYA 1UCJA 1YNVX 3URPA 1GMPA 1Q9EA 1TTOA 2AAEA 1B2UA 1JBRA 1BAOA 1B2XA 1GOVA 1MGRA 1T2HA 5HOHA 1TRQA 1DE3A 1BSAA 1X1WA 1B2SA 1CH0A 1RGLA 2C4BA 3A5EA 1BRGA 1IYYA 4BU4A 1I2EA 2KAAA 1FZUA 2F5WA 1AQZA 1B2MA 1BIRA 1FUTA 2BU4A 3AHWA 1BSBA 3BU4A 1RGKA 1BU4A 3Q3FA 1RLSA 2KF3A 1PY3A 5BU4A 1YVSA 1HZ1A 1A2PA 1T2IA 1BANA 1BGSA 1RTUA 1MGWA 4GSPA 1RGHA 1BSEA 1LNIA 1BSCA 2RNTA 1BNGA 1I0XA 1PYLA 1AY7A 1GOYA 2AADA 1X1UA 3WHOA 3GSPA 4HAAA 1BRHA 1LOVA 1BNRA 1B2ZA 1FW7A 3HOHA 1RN4A 1B27A 1RGEA 1I70A 3D4AA 3D5GA 7RNTA 1ZGXA 1BNEA 6GSPA 1I2FA 1JBTA 2RBIA 1X1XA 1BRSA 2HOHA 1BSDA 1DETA 2SARA 3AGOA 1FUSA 1TRPA 1LOYA 1UCIA 1BNSA 1LOWA 1GSPA 4HOHA 5GSPA 2KF6A 1RDSA 2GSPA 4J5GA 1RGFA 1UCKA 5BIRA 1RMSA 1I2GA 3AGNA 1GMRA 1BNIA 2F56A 3BIRA 6RNTA 1GMQA 8RNTA 5RNTA 1BNFA 3DH2A 1B20A 1JBSA 1I3FA 1SARA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GOU A;  3AHS A;  2ZA4 A;  3WR2 A;  1X1Y A;  1C54 A;  1I3I A;  3KCH A;  1G02 A;  2F5M A;  3SYU A;  1LRA A;  9RNT A;  3RNT A;  1BNJ A;  2KF4 A;  2KF5 A;  1BRI A;  1RGA A;  2BIR A;  1BOX A;  2F4Y A;  4RNT A;  4GHO A;  7GSP A;  1RCL A;  1FYS A;  1BRK A;  3D5I A;  1UCL A;  4BIR A;  1HYF A;  1BRN L;  1RNB A;  1RCK A;  1RGC A;  1RNT A;  4J5K A;  1B21 A;  1B3S A;  1YGW A;  1RHL A;  1RN1 A;  1BUJ A;  1RSN A;  1RGG A;  1BRJ A;  1R4Y A;  1I8V A;  1BVI A;  1I0V A;  3DGY A;  1UCJ A;  1YNV X;  3URP A;  1GMP A;  1Q9E A;  1TTO A;  2AAE A;  1B2U A;  1JBR A;  1BAO A;  1B2X A;  1GOV A;  1MGR A;  1T2H A;  5HOH A;  1TRQ A;  1DE3 A;  1BSA A;  1X1W A;  1B2S A;  1CH0 A;  1RGL A;  2C4B A;  3A5E A;  1BRG A;  1IYY A;  4BU4 A;  1I2E A;  2KAA A;  1FZU A;  2F5W A;  1AQZ A;  1B2M A;  1BIR A;  1FUT A;  2BU4 A;  3AHW A;  1BSB A;  3BU4 A;  1RGK A;  1BU4 A;  3Q3F A;  1RLS A;  2KF3 A;  1PY3 A;  5BU4 A;  1YVS A;  1HZ1 A;  1A2P A;  1T2I A;  1BAN A;  1BGS A;  1RTU A;  1MGW A;  4GSP A;  1RGH A;  1BSE A;  1LNI A;  1BSC A;  2RNT A;  1BNG A;  1I0X A;  1PYL A;  1AY7 A;  1GOY A;  2AAD A;  1X1U A;  3WHO A;  3GSP A;  4HAA A;  1BRH A;  1LOV A;  1BNR A;  1B2Z A;  1FW7 A;  3HOH A;  1RN4 A;  1B27 A;  1RGE A;  1I70 A;  3D4A A;  3D5G A;  7RNT A;  1ZGX A;  1BNE A;  6GSP A;  1I2F A;  1JBT A;  2RBI A;  1X1X A;  1BRS A;  2HOH A;  1BSD A;  1DET A;  2SAR A;  3AGO A;  1FUS A;  1TRP A;  1LOY A;  1UCI A;  1BNS A;  1LOW A;  1GSP A;  4HOH A;  5GSP A;  2KF6 A;  1RDS A;  2GSP A;  4J5G A;  1RGF A;  1UCK A;  5BIR A;  1RMS A;  1I2G A;  3AGN A;  1GMR A;  1BNI A;  2F56 A;  3BIR A;  6RNT A;  1GMQ A;  8RNT A;  5RNT A;  1BNF A;  3DH2 A;  1B20 A;  1JBS A;  1I3F A;  1SAR A; 
#chains in the Genus database with same CATH topology
 4CPK A;  1STF I;  4LEH A;  2K3D A;  1W00 A;  3NV0 B;  1C54 A;  3V98 A;  4WYK B;  4R1K A;  1A2V A;  1IT7 A;  1I3I A;  1LQM B;  2F5M A;  2HMK B;  3SYU A;  3WA2 X;  1VQM 3;  9RNT A;  1TIJ A;  5EQL A;  1WMN A;  2XRX B;  1AR0 A;  2IY2 A;  1IU7 A;  1D6U A;  1JZO A;  1DMM A;  4L8O A;  3SED A;  1BRI A;  3CNM A;  3FH1 A;  4BTW A;  2F4Y A;  1J2B A;  1RRL A;  3MKI A;  4GHO A;  2H0G A;  2ML6 A;  1FYS A;  1BRK A;  3H51 A;  1JN5 A;  2ML5 A;  4BIR A;  1RCK A;  1RNT A;  2IUK A;  3LXU X;  1UW1 A;  2GU1 A;  4STD A;  5LC6 A;  3CPO A;  3CC2 3;  3CD6 3;  3HIG A;  3G4S 3;  1Z1S A;  2UGI A;  4FMD A;  4LSO A;  1RSN A;  4FR9 A;  4HM3 B;  1CQS A;  2YX9 A;  3DGY A;  2QGU A;  2M7O A;  3M8C A;  3NQZ A;  3FZW A;  1UUV B;  1ZS7 A;  4WFO A;  1RJO A;  2ZL8 A;  2W56 A;  3BB9 A;  3MYT A;  3KFQ C;  3URP A;  3FG1 A;  5M1A A;  3FG4 A;  1QVF 2;  1EUI C;  1GD3 A;  1JNQ A;  1QJG A;  1BAO A;  3LT9 A;  3N8B A;  1T2H A;  1QVG 2;  5HOH A;  1TRQ A;  1DMN A;  2BMR B;  2HMM B;  3NXJ A;  3BNC A;  1CH0 A;  3RGR A;  3LYG A;  4JRF A;  3VSY A;  2C4B A;  3DGO A;  4FCJ A;  4WP5 A;  5JPU A;  1CYU A;  4KFF A;  7GSP A;  2XFS A;  1Q81 4;  1I2E A;  2YFL B;  2A15 A;  2W0Q A;  3K0Z A;  4ZM8 A;  2FGT A;  4ORL A;  1S72 3;  2QA4 3;  2Z7A A;  5EVH A;  1EKM A;  1FUT A;  5FW5 A;  3X3X A;  1PFP A;  4R9K A;  1IVX A;  4FMC A;  3X41 A;  2H0H A;  5KP4 A;  3VF1 A;  2C11 A;  3CPW 2;  3HK4 A;  3MG1 A;  3V92 A;  1RLS A;  1ROA A;  1YGE A;  1K41 A;  2KF3 A;  4HZ9 B;  1IVU A;  1HZ1 A;  1YVS A;  4AKZ A;  5BU4 A;  1M1K 4;  1A2P A;  5EEO A;  3CME 3;  2QIY A;  3DZL A;  4MMX B;  3WOF B;  3LZA A;  2V1L A;  1WMP A;  1V57 A;  3DXO A;  1KSI A;  1ISK A;  1MNL A;  3U1W A;  1EEJ A;  1V58 A;  2Z6B A;  3JUM A;  1M1X B;  3S67 A;  1W01 A;  3EE1 A;  4HJL B;  1BSC A;  1PYL A;  2CH9 A;  3ALA A;  2AAD A;  4GB5 A;  1X1U A;  3BNB A;  3IMA B;  1N8Q A;  1UUG B;  2PNC A;  1B2Z A;  1LQG C;  2CWT A;  2E2T A;  3N54 B;  2QEX 3;  1FW7 A;  1RGE A;  1SQW A;  1SJW A;  2OTJ 3;  3CCE 3;  1I2F A;  1M9G A;  3LH4 A;  5IG3 A;  3CMA 3;  3PZW A;  4U13 A;  3GAX A;  3DGL A;  1W7C A;  3OXA A;  1IVV A;  3L0R A;  1DET A;  3V99 A;  3ZFZ A;  2F98 A;  4AKY A;  1FUS A;  3K9M C;  3JUO A;  1W6C A;  2P0X A;  1UCI A;  1BNS A;  3WMD A;  2IUJ A;  2P09 A;  3KII A;  1A90 A;  1U5O A;  1IYY A;  5LC7 A;  1UUW B;  2XH9 A;  3DY5 A;  2GSP A;  2FNQ A;  5AIG A;  2CWV A;  4LGQ A;  1MWU A;  4FCM A;  1W2Z A;  3EN1 B;  1GMQ A;  1W02 A;  4BTX A;  3F7X A;  3QRD A;  1EG9 B;  1TFO A;  5RNT A;  1FGM A;  1BNF A;  1B20 A;  3CCU 3;  1IV7 A;  1N9E A;  1SAR A;  4HKV B;  3WOE B;  2W6J H;  1NDO B;  1UGH I;  2CFK A;  2HMO B;  3CCJ 3;  1JJ2 2;  3MSO A;  1W5Z A;  4X2O A;  1YIT 3;  3FSD A;  2CG0 A;  1LRA A;  3K63 A;  3GZB A;  3N9H A;  3OWY A;  2Y74 A;  5IEN A;  1RKY A;  1YIJ 3;  5HGR A;  3WA3 A;  4N3V A;  3G71 3;  4NRE A;  5JBS A;  2L1S A;  3Q1C A;  1OCV A;  4WHA A;  2MF7 A;  1UCL A;  4J9A A;  1MOL A;  5IER A;  4J8T A;  4J5K A;  1B21 A;  1B3S A;  3EN8 A;  4NPB A;  1YGW A;  1W2B 2;  1E3R A;  1RHL A;  5JPP A;  4KFE A;  1DVD A;  1EQK A;  1Q40 B;  1I8V A;  4DKI A;  1I0V A;  4N6L A;  3DM8 A;  4KVH A;  4HM2 B;  3KSP A;  1NO3 A;  3K7C A;  5M19 A;  6STD A;  3F14 A;  1TTO A;  4TX4 A;  3B7C A;  2KCD A;  2P0M A;  4IPB A;  2OQE C;  4BL3 A;  3A76 A;  4K61 A;  2BT3 A;  1K28 A;  3F9S A;  1BSA A;  1X1W A;  1RGL A;  3PGB A;  3KKG A;  1DVC A;  1NNV A;  1R4C A;  2HML B;  1G96 A;  4I4K A;  4HVN A;  2XFT A;  1CYV A;  1FZU A;  2CHC A;  2KRT A;  3FLJ A;  4HM4 B;  2CFW A;  1IDP A;  1BIR A;  3I0Y A;  4EBG A;  2HMN B;  1Q82 4;  4KZ1 A;  3BU4 A;  1HKX A;  1RGK A;  2HMJ B;  8CHO A;  4JF8 A;  2Z76 A;  1VZZ A;  2WGQ A;  4EYC A;  1O7P B;  1ZX2 A;  2F99 A;  1OHO A;  5I97 A;  1A2K A;  4N6M A;  1VQ6 3;  3EB8 A;  1AVK A;  3EBY A;  1BAN A;  1BGS A;  3FF0 A;  1O7M B;  1MGW A;  1RTU A;  4GSP A;  3NQY A;  4MEI A;  3CU3 A;  3SOA A;  1QAL A;  1JZD A;  1FGQ A;  1E3V A;  1YI2 3;  2RNT A;  1VQL 3;  3D3L A;  3LML A;  1I0X A;  4OK0 A;  3LOY A;  1NWW A;  1GOY A;  2CIU A;  1LVN A;  4CJN A;  4HAA A;  1BRH A;  4G1M B;  1LOV A;  1BNR A;  3HOH A;  2YFJ B;  3HZP A;  7RNT A;  3D4A A;  1IQ8 A;  5AYR B;  2OQE A;  2Y73 A;  3WOD G;  2I9W A;  1IQX A;  4HZB B;  1JBT A;  4K1V A;  2J8X B;  4N6O B;  3OW2 2;  2W56 B;  4EV2 A;  2HOH A;  4N6U A;  1U8C B;  2STD A;  4WWU C;  2SAR A;  2W2C A;  2XR8 B;  3ZG0 A;  1QAK A;  1G0T A;  1GSP A;  2E2U A;  2R4I A;  1N5P A;  3ER7 A;  5GSP A;  1T5Y A;  1W6Y A;  3NBB A;  1RDS A;  3F7S A;  4J5G A;  2F86 B;  1VQQ A;  2H0I A;  2O3O A;  1I2G A;  1BNI A;  2GU3 A;  3HI7 A;  1VQ7 3;  3X3Y A;  3UL6 A;  1JB4 A;  3D79 A;  3FCS B;  4IT7 A;  2PZV A;  1WTH A;  1HU9 A;  3EHC A;  5TGN A;  8RNT A;  1O7N B;  1Q40 A;  3OWS A;  3G8Z A;  1TU5 A;  3WDG B;  1K9M 4;  1JBS A;  1CEW I;  4BTY A;  3UB1 A;  5D83 A;  1GY7 A;  2K0M A;  3CCL 3;  4X2H A;  1GOU A;  1FA3 A;  3AHS A;  1QMA A;  3IPT A;  3CC7 3;  1S5A A;  3X3Z A;  3UNL A;  4QWT A;  3RNT A;  4K90 B;  1BNJ A;  5A0O B;  1FGR A;  1UGI A;  3KZT A;  3FGY A;  2GBW B;  1RGA A;  1SIH A;  1BOX A;  2XEP A;  2WOF A;  1W4N A;  3KE7 A;  3MPH A;  1N9J A;  2IMJ A;  2BO9 B;  3JVC A;  1RCL A;  1KWI A;  4FCZ A;  1D6Y A;  5AEU B;  4EW5 A;  2CFG A;  2D42 A;  1BRN L;  1HYF A;  2YFI B;  1RNB A;  3NM2 A;  5ELU A;  3PXM A;  3LTA A;  2XSH B;  3GZX B;  1EA2 A;  2FXT A;  2ZDJ A;  1AV4 A;  3EQQ B;  2LQV A;  5G1L A;  1BRJ A;  5BXQ A;  2E2V A;  1BVI A;  1R4Y A;  3UL5 A;  2KXG A;  3ROB A;  1GMP A;  3HX8 A;  3O8Y A;  3CNX A;  3MG3 A;  4WYK A;  1Q9E A;  3EC9 A;  1FUW A;  2AAE A;  3K5T A;  3FKA A;  1JB2 A;  1WQL B;  4BL2 A;  3G16 A;  1JBR A;  1SPU A;  1MGR A;  2CC3 A;  3FF2 A;  5AYS C;  1DE3 A;  2BHM A;  4XM4 A;  2CFD A;  5IF6 A;  1BRG A;  3EX9 A;  3DGN A;  3RDE A;  4N6T A;  4O3V A;  1JB5 A;  5ELJ A;  1YJW 3;  1GYB A;  1ASK A;  5CF1 A;  3EBT A;  4HM6 B;  3B4P A;  3DGM A;  3LT8 A;  4HM5 B;  1VQ4 3;  3AHW A;  4MMY B;  3CCM 3;  3CCV 3;  4HM8 B;  1NU3 A;  4H61 A;  1C7H A;  3Q3F A;  2UX0 A;  1OGZ A;  3PYJ A;  2GXF A;  2RFR A;  1Q7Y 4;  1VQ5 3;  1T2I A;  1VQO 3;  5G1K A;  1TJD A;  3PCS A;  4O02 B;  4RNZ A;  2P05 A;  3EF8 A;  2XF3 A;  1OAC A;  1RGH A;  1Q7H A;  1SII A;  3OV4 A;  3E99 A;  1LNI A;  4XBY A;  1IT8 A;  3Q2P A;  3B8L A;  4HBR A;  2RCD A;  3ZG5 A;  2XSO B;  2W9P A;  1GY6 A;  3LTB A;  3WHO A;  2IYJ A;  3GSP A;  4L7K A;  1A67 A;  1B27 A;  1I70 A;  3D5G A;  3EJV A;  4MJD A;  2OOV A;  3S27 A;  1ZGX A;  1BNE A;  1RRH A;  1W6G A;  2WO0 A;  3UJM A;  3CCQ 3;  4EC6 A;  2O9U X;  4KT3 B;  2RBI A;  1X1X A;  1VQP 3;  1OGX A;  1N8R 4;  5CF2 A;  3G6E 3;  4MMZ B;  2W03 A;  3PS8 A;  3LTC A;  1BSD A;  1N5H A;  2WGO A;  2CX0 A;  2XGL A;  2P38 A;  3AGO A;  3S29 A;  1TRP A;  4HM0 B;  2BNG A;  1L5G B;  2WOH A;  5DRE A;  4Q53 A;  1DMQ A;  3JUN A;  5IG0 A;  1WNH A;  3U97 A;  3KSE D;  4HOH A;  1GS3 A;  3OWU A;  4NHF A;  2CFL A;  1TFK A;  4HM7 B;  3VGN A;  2KF6 A;  1KC8 4;  4XDW A;  4K1U A;  5AIH A;  1RGF A;  4FMA A;  1UCK A;  1E97 A;  1RMS A;  1ROV A;  2OWP A;  3G0K A;  1GMR A;  5D82 A;  5BIR A;  2F56 A;  4RNY A;  3BIR A;  4N6N B;  4XBT A;  4EV5 A;  1LOX A;  1OF5 A;  4AEQ A;  5KP3 A;  3F8H A;  5CLK A;  4OUQ A;  2C10 A;  3MWZ A;  4R80 A;  1I3F A;  5STD A;  2BMQ B;  3SVA A;  3I56 3;  1T3B A;  3SOY A;  3T8U A;  2ZA4 A;  3F40 A;  1X1Y A;  4O2H A;  3WR2 A;  2XGN A;  5CK6 A;  4L8P A;  1DYU A;  1G02 A;  1F8N A;  1OPY A;  1OUN A;  2GEY A;  1LXE A;  3KCH A;  4HM1 B;  3NBJ A;  3NX0 A;  2KF4 A;  4XB5 A;  1STD A;  2KF5 A;  3GZY B;  1D6Z A;  1FGT A;  3J7Y d;  3S28 A;  2BIR A;  1US1 A;  4RNT A;  1QAF A;  3GZR A;  2CK3 H;  1JN5 B;  3D5I A;  5IEP A;  2BMO B;  1JV2 B;  1OH0 A;  2W9Q A;  2K54 A;  1RN7 A;  2B1X B;  1PU4 A;  1RGC A;  1NJI 4;  3STD A;  5KP1 A;  2GBX B;  3NBR A;  3B4O A;  3S5C A;  1TP6 A;  1RN1 A;  1BUJ A;  1O7H B;  1RGG A;  3AMO A;  5IW9 A;  2OOV C;  4LMI A;  4LZI A;  2Q07 A;  1UCJ A;  1VQ8 3;  1YNV X;  1V74 A;  3LTD A;  4XBX A;  2OCT A;  3JUP A;  4O8S A;  2GEX A;  1VQN 3;  1Y4K A;  1B2U A;  2ZHX B;  1B2X A;  1GOV A;  2SBL A;  1KD1 4;  3ECF A;  2Z77 A;  1B2S A;  3DMC A;  1ULI B;  3X42 A;  1KQS 2;  3A5E A;  1IK3 A;  3CXC 2;  3SXX A;  2MC8 A;  4XDV A;  3RGA A;  1LNH A;  1TUH A;  4I5Q A;  1JKG A;  4OVM A;  5AI1 A;  3TDG A;  4BU4 A;  2KAA A;  3D9R A;  4HYZ A;  5DRV A;  2F5W A;  2JDI H;  3BNE A;  1K8A 4;  1WMO A;  1AQZ A;  1B2M A;  1MWT A;  1OF5 B;  2BU4 A;  2CG1 A;  1BSB A;  1Q86 4;  5CXO A;  3SX1 A;  3PCR A;  5FGO A;  1BU4 A;  2CW9 A;  3CC4 3;  3X40 A;  1ULJ B;  1PY3 A;  3H3H A;  3DUK A;  3HII A;  3MHE A;  4FMB A;  4ILF A;  4GL6 A;  7STD A;  3NV0 A;  4R4K A;  1UI7 A;  5G2G A;  3T8N A;  1VQ9 3;  3CCS 3;  3NHX A;  4CCV A;  1GY5 A;  3BLZ A;  3GWR A;  1BSE A;  3NUV A;  3NM7 A;  5IEO A;  2W04 A;  1O7W B;  1BNG A;  4N6V 0;  1VQK 3;  1AY7 A;  1JKG B;  1UI8 A;  4KFD A;  4PEJ A;  2L4V A;  2D1W A;  5M18 A;  1RN4 A;  2INX A;  1M90 4;  1NB5 I;  2UUG C;  4H3U A;  1YJ9 3;  2B24 B;  6GSP A;  2IA7 A;  3FG3 A;  1Q42 A;  2RSX A;  3AMO B;  1OHS A;  2RGQ A;  3BND A;  3IJE B;  1OHP A;  3Q90 A;  4R9L A;  3SLU A;  1ZO2 A;  4CDL A;  3GRD A;  1IV9 A;  1YHQ 3;  4RZM A;  1FGO A;  3F8X A;  2JQ5 A;  1BRS A;  4IIA A;  2LYX A;  1GD4 A;  5AEW B;  1IQY A;  3CCR 3;  1IVW A;  1MWS A;  3T0U A;  1BUQ A;  1LOY A;  1YJN 3;  1LOW A;  1MWR A;  5AIF A;  3JUQ A;  5BVB A;  1O7G B;  1YVB I;  1UDI I;  2R41 A;  5IG4 A;  2CX1 A;  3I55 3;  1K73 4;  3OX9 A;  3QK9 A;  3MG2 A;  1JRQ A;  3AGN A;  5AII A;  5IG5 A;  6RNT A;  4EXR A;  2OTL 3;  5D81 A;  3KN4 A;  4RBN A;  2CKF B;  1NB3 I;  3DH2 A;  1AVL A;  4LYL B;  2CWU A; 
#chains in the Genus database with same CATH homology
 1GOU A;  3AHS A;  2ZA4 A;  3WR2 A;  1X1Y A;  1C54 A;  1I3I A;  3KCH A;  1G02 A;  2F5M A;  3SYU A;  1LRA A;  9RNT A;  3RNT A;  1BNJ A;  2KF4 A;  2KF5 A;  1BRI A;  1RGA A;  2BIR A;  1BOX A;  2F4Y A;  4RNT A;  4GHO A;  7GSP A;  1RCL A;  1FYS A;  1BRK A;  3D5I A;  1UCL A;  4BIR A;  1HYF A;  1BRN L;  1RNB A;  1RCK A;  1RGC A;  1RNT A;  4J5K A;  1B21 A;  1B3S A;  1YGW A;  1RHL A;  1RN1 A;  1BUJ A;  1RSN A;  1RGG A;  1BRJ A;  1R4Y A;  1I8V A;  1BVI A;  1I0V A;  3DGY A;  1UCJ A;  1YNV X;  3URP A;  1GMP A;  1Q9E A;  1TTO A;  2AAE A;  1B2U A;  1JBR A;  1BAO A;  1B2X A;  1GOV A;  1MGR A;  1T2H A;  5HOH A;  1TRQ A;  1DE3 A;  1BSA A;  1X1W A;  1B2S A;  1CH0 A;  1RGL A;  2C4B A;  3A5E A;  1BRG A;  1IYY A;  4BU4 A;  1I2E A;  2KAA A;  1FZU A;  2F5W A;  1AQZ A;  1B2M A;  1BIR A;  1FUT A;  2BU4 A;  3AHW A;  1BSB A;  3BU4 A;  1RGK A;  1BU4 A;  3Q3F A;  1RLS A;  2KF3 A;  1PY3 A;  5BU4 A;  1YVS A;  1HZ1 A;  1A2P A;  1T2I A;  1BAN A;  1BGS A;  1RTU A;  1MGW A;  4GSP A;  1RGH A;  1BSE A;  1LNI A;  1BSC A;  2RNT A;  1BNG A;  1I0X A;  1PYL A;  1AY7 A;  1GOY A;  2AAD A;  1X1U A;  3WHO A;  3GSP A;  4HAA A;  1BRH A;  1LOV A;  1BNR A;  1B2Z A;  1FW7 A;  3HOH A;  1RN4 A;  1B27 A;  1RGE A;  1I70 A;  3D4A A;  3D5G A;  7RNT A;  1ZGX A;  1BNE A;  6GSP A;  1I2F A;  1JBT A;  2RBI A;  1X1X A;  1BRS A;  2HOH A;  1BSD A;  1DET A;  2SAR A;  3AGO A;  1FUS A;  1TRP A;  1LOY A;  1UCI A;  1BNS A;  1LOW A;  1GSP A;  4HOH A;  5GSP A;  2KF6 A;  1RDS A;  2GSP A;  4J5G A;  1RGF A;  1UCK A;  5BIR A;  1RMS A;  1I2G A;  3AGN A;  1GMR A;  1BNI A;  2F56 A;  3BIR A;  6RNT A;  1GMQ A;  8RNT A;  5RNT A;  1BNF A;  3DH2 A;  1B20 A;  1JBS A;  1I3F A;  1SAR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...