1YVSA

Trimeric domain swapped barnase
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BARNASE
publication title Trimeric domain-swapped barnase.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Endonuclease
total genus 23
structure length 108
sequence length 108
ec nomenclature ec 3.1.27.-:
pdb deposition date 1998-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1yvsA00
1IYYA 1UCLA 1X1YA 2RBIA 1BSBA 3AGOA 1GOVA 1LOVA 6RNTA 4BU4A 1LNIA 1B2SA 1I3IA 1YVSA 2F5WA 2KF4A 1BU4A 1GSPA 1I70A 3SYUA 1ZGXA 1X1XA 4J5KA 1AQZA 1RGEA 1PYLA 3AHWA 4RNTA 1RHLA 1UCJA 1I8VA 1RGKA 1BRGA 1BRIA 5HOHA 1LOYA 2RNTA 2SARA 1BGSA 2AAEA 1B2MA 1MGWA 1BRHA 4GSPA 1RCLA 1G02A 1JBTA 1RGAA 1BNGA 1BNSA 1BRSA 1YNVX 1DETA 2F56A 1FZUA 1RGCA 1BOXA 2F4YA 1TRQA 3D5GA 3AHSA 1B21A 1FUTA 1RGGA 1T2HA 1Q9EA 1TTOA 2KF3A 1BNFA 1RN1A 1BSDA 2BIRA 1I2FA 1FYSA 1BANA 1SARA 2GSPA 1I3FA 1RNBA 2HOHA 2AADA 1MGRA 1X1WA 2C4BA 1RN4A 3GSPA 3BIRA 3HOHA 1R4YA 2F5MA 7GSPA 3DGYA 1LOWA 5BIRA 7RNTA 1A2PA 1DE3A 2BU4A 1BNEA 1BRKA 1I0XA 2KF5A 1GMQA 8RNTA 1BSCA 1LRAA 9RNTA 1FUSA 1JBRA 1B27A 1CH0A 3BU4A 3URPA 1I2EA 1RNTA 1JBSA 1BNIA 1X1UA 2ZA4A 1RGLA 4HAAA 3WHOA 1BAOA 5BU4A 1GOUA 1YGWA 1BSEA 3AGNA 1RMSA 1RCKA 1GMRA 4HOHA 1BUJA 1I0VA 1PY3A 2KF6A 1BNJA 1UCIA 1BNRA 1B20A 1T2IA 5GSPA 1B2UA 1B3SA 1RSNA 1HYFA 3KCHA 4GHOA 1RGHA 1BRNL 6GSPA 3D5IA 1RDSA 1UCKA 1BSAA 3WR2A 1BVIA 1C54A 1GMPA 3A5EA 3DH2A 2KAAA 3Q3FA 1BIRA 3RNTA 1I2GA 1B2ZA 1HZ1A 4BIRA 1GOYA 1B2XA 1AY7A 1BRJA 1RTUA 5RNTA 3D4AA 1TRPA 1FW7A 1RLSA 4J5GA 1RGFA
chains in the Genus database with same CATH superfamily
3FG3A 1L5GB 4R80A 1S5AA 1LNIA 5IG4A 1O7HB 8CHOA 1EG9B 2F5WA 1QAKA 2GBWB 1ZO2A 1O7NB 4MJDA 5AI1A 1GSPA 4H3UA 3F7SA 5M1AA 3GAXA 5M18A 1RGEA 1W6CA 1EKMA 1RHLA 3LTCA 3I553 1JB4A 1NJI4 3MG3A 1RGKA 2D42A 1LOYA 2CG1A 5IERA 2RNTA 3EQQB 1BGSA 1PU4A 1B2MA 1YGEA 1MGWA 3MKIA 3F8XA 2C11A 4CJNA 1BRHA 1IVUA 3LYGA 3LZAA 1BNGA 4R1KA 4GL6A 2ML5A 2Z6BA 1DETA 5ELUA 1W02A 2RSXA 2XSHB 3CCQ3 4WFOA 1RGCA 2B1XB 1TRQA 3D5GA 1IK3A 1YJ93 4MMYB 1DYUA 1B21A 1RGGA 1T2HA 2PNCA 1Q9EA 4BL3A 2FXTA 3KSPA 2JQ5A 1N9JA 3RGRA 5STDA 1JNQA 4EV2A 3PS8A 4J9AA 1Q814 3OXAA 4BTWA 1SARA 2XFTA 5BVBA 2CFKA 1G0TA 2GBXB 2L1SA 1DMQA 3LMLA 1ROVA 4CCVA 3MPHA 3PZWA 3FSDA 3CD63 1RN4A 3EX9A 1MOLA 1KC84 2HMNB 7GSPA 2RFRA 3LOYA 5BIRA 1RKYA 2CKFB 2XEPA 3FLJA 3GZBA 1E3VA 2WO0A 2KCDA 3JUMA 3S67A 1W7CA 4HZ9B 5G1LA 2IUKA 2KF5A 2JDIH 1WMOA 3LXUX 1V74A 3VGNA 4NPBA 1B27A 1R4CA 1OACA 1OF5B 3MG2A 4MMZB 4KT3B 3HX8A 1RNTA 1OHOA 1RGLA 5IG5A 3EN1B 3FGYA 4KZ1A 1U5OA 3S5CA 1PFPA 1BAOA 4FMCA 1GOUA 2XGLA 4N6OB 3J7Yd 2OTL3 2Z7AA 4J5GA 1BSEA 2HMLB 2YFIB 1TU5A 2E2VA 1A67A 2CHCA 4GB5A 3OV4A 3ZFZA 3GWRA 1RCKA 1W01A 2BMRB 3QRDA 1CQSA 4N3VA 3FF2A 3V99A 5IG3A 5KP1A 1GY6A 3KSED 1VQ53 1O7PB 2KF6A 2WOFA 1GYBA 1BNJA 3N9HA 4KFDA 3S28A 1QVG2 1Q864 1Q42A 2XSOB 5JPPA 3CCR3 1JB2A 5GSPA 1B2UA 2H0HA 5IEPA 1HYFA 2HMJB 4GHOA 1EA2A 1BRNL 2P0MA 3UB1A 1TP6A 1K9M4 3D5IA 4LYLB 3S29A 2GXFA 1GMPA 2C10A 4LZIA 5D82A 1UUGB 1O7WB 2BNGA 4BIRA 2F86B 3IPTA 1GOYA 5IG0A 3UL5A 5KP4A 2CWTA 1B2XA 4N6MA 4XBTA 3B7CA 3GRDA 3SXXA 3T8NA 4AKYA 4EC6A 5RNTA 1IT7A 3D4AA 3HZPA 3NV0A 1J2BA 2RCDA 1RLSA 4EW5A 1YHQ3 5IEOA 1TIJA 1RGFA 4IPBA 1UI7A 5JPUA 1X1YA 2CG0A 2RBIA 1DMNA 3GZYB 3KIIA 2XGNA 3VSYA 1YJN3 3ZG5A 1M1XB 3JUNA 3SVAA 1DMMA 2P0XA 5IENA 4OVMA 3STDA 1OHPA 3K5TA 1BU4A 1TFKA 3DM8A 3SLUA 3E99A 4XDVA 4FR9A 1E3RA 2ZHXB 1T5YA 3EN8A 4RNTA 1O7MB 2CFDA 4R9LA 1BRGA 2LYXA 5HOHA 5G2GA 3JUPA 5G1KA 3WOEB 4HM3B 2ML6A 4FMAA 1RCLA 2BHMA 2FNQA 1S723 1RRHA 1MWSA 3I0YA 5DRVA 2XR8B 1SJWA 3NBJA 4N6UA 1ULIB 1A90A 3Q1CA 1AVLA 3CXC2 5IF6A 2P38A 1FUTA 1VQO3 2HMMB 2W56A 2CFLA 1ZX2A 2CW9A 2CWVA 2KF3A 4MMXB 3SX1A 1BNFA 4HJLB 5JBSA 2IY2A 1RN1A 2Z77A 2QGUA 1BSDA 1FGOA 2L4VA 2W03A 3L0RA 4FMBA 1I2FA 3DZLA 4HYZA 3EE1A 5FGOA 1BANA 3LTAA 1WNHA 3B4OA 1SPUA 4FMDA 4XBXA 1UUVB 2QEX3 1IV9A 2QA43 1UGIA 2GU1A 2AADA 1X1WA 2C4BA 4EV5A 4XBYA 1CEWI 2CK3H 1R4YA 3HOHA 3JVCA 2F5MA 3WDGB 5LC6A 2V1LA 4N6LA 1NNVA 3DGMA 7RNTA 3CC73 1OHSA 4STDA 2BU4A 5CF1A 1YIJ3 5EQLA 1Q40B 3MHEA 2W0QA 1IVVA 3RDEA 1NB5I 1BRKA 1AV4A 1U8CB 1JB5A 1MWRA 4WHAA 8RNTA 1KQS2 1G96A 1Q824 4L8OA 3CPW2 5AYRB 3X40A 3DXOA 1I2EA 3OWSA 3VF1A 3T0UA 2CC3A 1X1UA 3ROBA 2ZA4A 1BUQA 4HAAA 3WHOA 1SIIA 4XDWA 3Q2PA 2XRXB 4X2OA 2K54A 3V98A 2IA7A 1RJOA 3UNLA 3CCU3 5EEOA 2H0IA 3B8LA 4BTYA 3AGNA 1UUWB 2M7OA 5CXOA 2BMOB 2O3OA 1MWUA 1IT8A 2KRTA 4L7KA 1NWWA 1N9EA 4HOHA 3PCSA 1I0VA 1PY3A 1VQN3 2F98A 4U13A 1T2IA 1RSNA 2FGTA 2OQEA 4K61A 2YFJB 3MSOA 5TGNA 2WOHA 1NDOB 1RDSA 1UCKA 3S27A 1JN5A 2UUGC 3WR2A 1BVIA 1FGQA 2GEYA 4XB5A 1W5ZA 1UI8A 2KAAA 2Z76A 1M1K4 4WYKA 4K90B 1HZ1A 3ALAA 3NHXA 1Q7HA 5AEWB 1OGXA 4LGQA 1W4NA 1AY7A 1AVKA 1M9GA 1QJGA 2OWPA 5A0OB 2R41A 3BNEA 1IQYA 2GEXA 5I97A 2IUJA 1VQ63 1QAFA 1MNLA 3FH1A 4HZBB 3BNCA 3K9MC 1VQ93 1FUWA 2HMOB 2CX0A 3AGOA 1GOVA 1LOVA 1DVCA 4HKVB 3U97A 3I563 3NV0B 4BU4A 3BNBA 3K0ZA 1RN7A 2GU3A 4EBGA 1TUHA 1YVSA 2Y73A 5LC7A 2KF4A 5AIIA 1I70A 1LVNA 1ZGXA 4QWTA 1X1XA 1A2VA 1AQZA 3DGOA 1UGHI 4MEIA 3CCS3 4AKZA 1FGTA 3UJMA 1IQXA 1I8VA 2O9UX 3M8CA 2INXA 2AAEA 3F7XA 1VQL3 1OCVA 1EQKA 2ZL8A 4EXRA 4GSPA 2I9WA 1G02A 3B4PA 3MYTA 1JBTA 1RGAA 3F40A 4OUQA 1BRSA 1YIT3 1YNVX 1CYVA 2YX9A 1OUNA 2IMJA 2E2TA 2F4YA 3NXJA 1D6ZA 2WGOA 4N6NB 5CF2A 4CDLA 4ZM8A 3ZG0A 1TTOA 3FKAA 1YVBI 3PYJA 1GY5A 3EJVA 1IV7A 1FYSA 4G1MB 3SOAA 4IIAA 1STFI 2K3DA 3TDGA 2HOHA 4HVNA 4RNYA 2OQEC 2W56B 5FW5A 1MGRA 3Q90A 4K1VA 3WMDA 4RBNA 3F8HA 2HMKB 3OW22 2K0MA 3AMOA 3GSPA 3X42A 4O2HA 4I4KA 4L8PA 3DGYA 3EC9A 1LOWA 2PZVA 3HIGA 1VQP3 2XFSA 1LOXA 4HM6B 3DGLA 3EBTA 3JUQA 4HM2B 3ER7A 3LTDA 4WWUC 1JV2B 1KD14 3NQZA 4X2HA 2UGIA 1I0XA 5KP3A 2LQVA 3CNXA 1FGMA 1MWTA 4FCZA 3NM2A 1JJ22 1CYUA 3BLZA 3U1WA 9RNTA 4R4KA 1F8NA 2A15A 4HM4B 3LH4A 3LT9A 2P05A 1CH0A 3BU4A 3URPA 3NQYA 3NUVA 3PCRA 3WA2X 3X3YA 1DVDA 4HM1B 5BU4A 3O8YA 1W00A 3GZRA 1D6YA 2W6JH 3X3XA 3QK9A 4N6V0 1RMSA 1K28A 1WMPA 1N5PA 3FZWA 3CNMA 3CCJ3 1N8QA 1GMRA 1JKGA 2SBLA 3IJEB 1VQ73 4JRFA 1IDPA 5AIFA 4KFEA 1UCIA 3CCV3 2BO9B 4EYCA 1M904 5BXQA 1BNRA 1FA3A 1E97A 3NM7A 2IYJA 1ULJB 2KXGA 1B3SA 1WTHA 3CC43 2CFGA 1OGZA 2W9PA 3CCL3 4O02B 6GSPA 3G6E3 1W6YA 1BSAA 1K734 5CLKA 1YI23 1US1A 2D1WA 1IQ8A 1BIRA 3RNTA 3KZTA 1I2GA 1B2ZA 2CH9A 1O7GB 2STDA 4HM7B 1BRJA 4I5QA 1DE3A 1JN5B 3LT8A 3WOFB 1ZS7A 1TRPA 3EB8A 7STDA 1JZOA 2CFWA 4WYKB 5AEUB 2W9QA 1ASKA 3HK4A 5AIGA 3GZXB 1IYYA 3OWUA 3FF0A 1UCLA 4LMIA 1BSBA 6RNTA 3CMA3 1SIHA 2H0GA 3NBRA 3WODG 2CX1A 1ROAA 1B2SA 1VQ43 2CIUA 1I3IA 3DUKA 3V92A 2B24B 5ELJA 2BMQB 3MG1A 3EHCA 3MWZA 3SYUA 3G4S3 3CCM3 1W2B2 1VQ83 4J5KA 1PYLA 4LEHA 3KE7A 1LQMB 3X41A 3AHWA 1Q7Y4 5EVHA 5M19A 1UCJA 3EBYA 1NU3A 3F14A 2R4IA 3CCE3 1EUIC 1BRIA 1Q40A 6STDA 2SARA 1UW1A 3DMCA 4WP5A 5AIHA 4ORLA 3OX9A 4XM4A 1HKXA 1VQQA 1FGRA 2F99A 3PGBA 2UX0A 2XH9A 2W2CA 1BNSA 3G16A 3N8BA 3CC23 1A2KA 2F56A 1TJDA 2Q07A 3HIIA 5D81A 1RRLA 2OOVA 1FZUA 1KSIA 1BOXA 1JZDA 5IW9A 1IVWA 1KWIA 3AHSA 3FG1A 1YJW3 1UDII 1LXEA 3KKGA 1GD4A 3IMAB 4HBRA 2BIRA 3FG4A 1NB3I 2MF7A 1OPYA 1V57A 3RGAA 2J8XB 3G8ZA 4CPKA 2GSPA 1I3FA 1QALA 2QIYA 3G0KA 4FCJA 4N6TA 1QMAA 2YFLB 4NHFA 1RNBA 4HM0B 2MC8A 3PXMA 3EF8A 4J8TA 3K63A 3BIRA 3H51A 4Q53A 2WGQA 3FCSB 3NX0A 1IVXA 2OTJ3 4HM5B 3H3HA 1A2PA 3F9SA 3HI7A 4JF8A 2OCTA 5D83A 1GY7A 4BL2A 1OF5A 4O8SA 3AMOB 5AYSC 1C7HA 3SEDA 1VZZA 1BNEA 4TX4A 1GMQA 1N5HA 1Z1SA 3G713 2W04A 1WQLB 1BSCA 1LRAA 1N8R4 2RGQA 4IT7A 1FUSA 4R9KA 1JBRA 2Y74A 4KVHA 3BB9A 1D6UA 1JBSA 1BNIA 3DY5A 4NREA 5CK6A 4RNZA 1K41A 1LQGC 3UL6A 3BNDA 3K7CA 1YGWA 1QVF2 1W6GA 4LSOA 1SQWA 1GS3A 1WMNA 3NBBA 4PEJA 1AR0A 5HGRA 1LNHA 1T3BA 3D79A 3N54B 1HU9A 1IU7A 4DKIA 2ZDJA 2XF3A 4KFFA 3LTBA 1BUJA 4H61A 1B20A 1W2ZA 4BTXA 4FCMA 3KCHA 1NO3A 1JKGB 5DREA 1RGHA 3CME3 1ISKA 1JRQA 2E2UA 1OH0A 2BT3A 3CPOA 2OOVC 3SOYA 3WA3A 4AEQA 1Y4KA 3ECFA 3CU3A 1VQK3 1C54A 3A5EA 4OK0A 3DH2A 2CWUA 3Q3FA 4ILFA 4K1UA 1STDA 1K8A4 4HM8B 2P09A 3A76A 3JUOA 1VQM3 4RZMA 3KFQC 3X3ZA 1EEJA 1RTUA 1FW7A 3OWYA 3DGNA 3T8UA 1GD3A 3KN4A 4O3VA 1TFOA 1V58A 3D3LA 3D9RA
chains in the Genus database with same CATH topology
1IYYA 1UCLA 1X1YA 2RBIA 1BSBA 3AGOA 1GOVA 1LOVA 6RNTA 4BU4A 1LNIA 1B2SA 1I3IA 1YVSA 2F5WA 2KF4A 1BU4A 1GSPA 1I70A 3SYUA 1ZGXA 1X1XA 4J5KA 1AQZA 1RGEA 1PYLA 3AHWA 4RNTA 1RHLA 1UCJA 1I8VA 1RGKA 1BRGA 1BRIA 5HOHA 1LOYA 2RNTA 2SARA 1BGSA 2AAEA 1B2MA 1MGWA 1BRHA 4GSPA 1RCLA 1G02A 1JBTA 1RGAA 1BNGA 1BNSA 1BRSA 1YNVX 1DETA 2F56A 1FZUA 1RGCA 1BOXA 2F4YA 1TRQA 3D5GA 3AHSA 1B21A 1FUTA 1RGGA 1T2HA 1Q9EA 1TTOA 2KF3A 1BNFA 1RN1A 1BSDA 2BIRA 1I2FA 1FYSA 1BANA 1SARA 2GSPA 1I3FA 1RNBA 2HOHA 2AADA 1MGRA 1X1WA 2C4BA 1RN4A 3GSPA 3BIRA 3HOHA 1R4YA 2F5MA 7GSPA 3DGYA 1LOWA 5BIRA 7RNTA 1A2PA 1DE3A 2BU4A 1BNEA 1BRKA 1I0XA 2KF5A 1GMQA 8RNTA 1BSCA 1LRAA 9RNTA 1FUSA 1JBRA 1B27A 1CH0A 3BU4A 3URPA 1I2EA 1RNTA 1JBSA 1BNIA 1X1UA 2ZA4A 1RGLA 4HAAA 3WHOA 1BAOA 5BU4A 1GOUA 1YGWA 1BSEA 3AGNA 1RMSA 1RCKA 1GMRA 4HOHA 1BUJA 1I0VA 1PY3A 2KF6A 1BNJA 1UCIA 1BNRA 1B20A 1T2IA 5GSPA 1B2UA 1B3SA 1RSNA 1HYFA 3KCHA 4GHOA 1RGHA 1BRNL 6GSPA 3D5IA 1RDSA 1UCKA 1BSAA 3WR2A 1BVIA 1C54A 1GMPA 3A5EA 3DH2A 2KAAA 3Q3FA 1BIRA 3RNTA 1I2GA 1B2ZA 1HZ1A 4BIRA 1GOYA 1B2XA 1AY7A 1BRJA 1RTUA 5RNTA 3D4AA 1TRPA 1FW7A 1RLSA 4J5GA 1RGFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IYY A;  1UCL A;  1X1Y A;  2RBI A;  1BSB A;  3AGO A;  1GOV A;  1LOV A;  6RNT A;  4BU4 A;  1LNI A;  1B2S A;  1I3I A;  1YVS A;  2F5W A;  2KF4 A;  1BU4 A;  1GSP A;  1I70 A;  3SYU A;  1ZGX A;  1X1X A;  4J5K A;  1AQZ A;  1RGE A;  1PYL A;  3AHW A;  4RNT A;  1RHL A;  1UCJ A;  1I8V A;  1RGK A;  1BRG A;  1BRI A;  5HOH A;  1LOY A;  2RNT A;  2SAR A;  1BGS A;  2AAE A;  1B2M A;  1MGW A;  1BRH A;  4GSP A;  1RCL A;  1G02 A;  1JBT A;  1RGA A;  1BNG A;  1BNS A;  1BRS A;  1YNV X;  1DET A;  2F56 A;  1FZU A;  1RGC A;  1BOX A;  2F4Y A;  1TRQ A;  3D5G A;  3AHS A;  1B21 A;  1FUT A;  1RGG A;  1T2H A;  1Q9E A;  1TTO A;  2KF3 A;  1BNF A;  1RN1 A;  1BSD A;  2BIR A;  1I2F A;  1FYS A;  1BAN A;  1SAR A;  2GSP A;  1I3F A;  1RNB A;  2HOH A;  2AAD A;  1MGR A;  1X1W A;  2C4B A;  1RN4 A;  3GSP A;  3BIR A;  3HOH A;  1R4Y A;  2F5M A;  7GSP A;  3DGY A;  1LOW A;  5BIR A;  7RNT A;  1A2P A;  1DE3 A;  2BU4 A;  1BNE A;  1BRK A;  1I0X A;  2KF5 A;  1GMQ A;  8RNT A;  1BSC A;  1LRA A;  9RNT A;  1FUS A;  1JBR A;  1B27 A;  1CH0 A;  3BU4 A;  3URP A;  1I2E A;  1RNT A;  1JBS A;  1BNI A;  1X1U A;  2ZA4 A;  1RGL A;  4HAA A;  3WHO A;  1BAO A;  5BU4 A;  1GOU A;  1YGW A;  1BSE A;  3AGN A;  1RMS A;  1RCK A;  1GMR A;  4HOH A;  1BUJ A;  1I0V A;  1PY3 A;  2KF6 A;  1BNJ A;  1UCI A;  1BNR A;  1B20 A;  1T2I A;  5GSP A;  1B2U A;  1B3S A;  1RSN A;  1HYF A;  3KCH A;  4GHO A;  1RGH A;  1BRN L;  6GSP A;  3D5I A;  1RDS A;  1UCK A;  1BSA A;  3WR2 A;  1BVI A;  1C54 A;  1GMP A;  3A5E A;  3DH2 A;  2KAA A;  3Q3F A;  1BIR A;  3RNT A;  1I2G A;  1B2Z A;  1HZ1 A;  4BIR A;  1GOY A;  1B2X A;  1AY7 A;  1BRJ A;  1RTU A;  5RNT A;  3D4A A;  1TRP A;  1FW7 A;  1RLS A;  4J5G A;  1RGF A; 
#chains in the Genus database with same CATH topology
 3FG3 A;  1L5G B;  4R80 A;  1S5A A;  1LNI A;  5IG4 A;  1O7H B;  8CHO A;  1EG9 B;  2F5W A;  1QAK A;  2GBW B;  1ZO2 A;  1O7N B;  4MJD A;  5AI1 A;  1GSP A;  4H3U A;  3F7S A;  5M1A A;  3GAX A;  5M18 A;  1RGE A;  1W6C A;  1EKM A;  1RHL A;  3LTC A;  3I55 3;  1JB4 A;  1NJI 4;  3MG3 A;  1RGK A;  2D42 A;  1LOY A;  2CG1 A;  5IER A;  2RNT A;  3EQQ B;  1BGS A;  1PU4 A;  1B2M A;  1YGE A;  1MGW A;  3MKI A;  3F8X A;  2C11 A;  4CJN A;  1BRH A;  1IVU A;  3LYG A;  3LZA A;  1BNG A;  4R1K A;  4GL6 A;  2ML5 A;  2Z6B A;  1DET A;  5ELU A;  1W02 A;  2RSX A;  2XSH B;  3CCQ 3;  4WFO A;  1RGC A;  2B1X B;  1TRQ A;  3D5G A;  1IK3 A;  1YJ9 3;  4MMY B;  1DYU A;  1B21 A;  1RGG A;  1T2H A;  2PNC A;  1Q9E A;  4BL3 A;  2FXT A;  3KSP A;  2JQ5 A;  1N9J A;  3RGR A;  5STD A;  1JNQ A;  4EV2 A;  3PS8 A;  4J9A A;  1Q81 4;  3OXA A;  4BTW A;  1SAR A;  2XFT A;  5BVB A;  2CFK A;  1G0T A;  2GBX B;  2L1S A;  1DMQ A;  3LML A;  1ROV A;  4CCV A;  3MPH A;  3PZW A;  3FSD A;  3CD6 3;  1RN4 A;  3EX9 A;  1MOL A;  1KC8 4;  2HMN B;  7GSP A;  2RFR A;  3LOY A;  5BIR A;  1RKY A;  2CKF B;  2XEP A;  3FLJ A;  3GZB A;  1E3V A;  2WO0 A;  2KCD A;  3JUM A;  3S67 A;  1W7C A;  4HZ9 B;  5G1L A;  2IUK A;  2KF5 A;  2JDI H;  1WMO A;  3LXU X;  1V74 A;  3VGN A;  4NPB A;  1B27 A;  1R4C A;  1OAC A;  1OF5 B;  3MG2 A;  4MMZ B;  4KT3 B;  3HX8 A;  1RNT A;  1OHO A;  1RGL A;  5IG5 A;  3EN1 B;  3FGY A;  4KZ1 A;  1U5O A;  3S5C A;  1PFP A;  1BAO A;  4FMC A;  1GOU A;  2XGL A;  4N6O B;  3J7Y d;  2OTL 3;  2Z7A A;  4J5G A;  1BSE A;  2HML B;  2YFI B;  1TU5 A;  2E2V A;  1A67 A;  2CHC A;  4GB5 A;  3OV4 A;  3ZFZ A;  3GWR A;  1RCK A;  1W01 A;  2BMR B;  3QRD A;  1CQS A;  4N3V A;  3FF2 A;  3V99 A;  5IG3 A;  5KP1 A;  1GY6 A;  3KSE D;  1VQ5 3;  1O7P B;  2KF6 A;  2WOF A;  1GYB A;  1BNJ A;  3N9H A;  4KFD A;  3S28 A;  1QVG 2;  1Q86 4;  1Q42 A;  2XSO B;  5JPP A;  3CCR 3;  1JB2 A;  5GSP A;  1B2U A;  2H0H A;  5IEP A;  1HYF A;  2HMJ B;  4GHO A;  1EA2 A;  1BRN L;  2P0M A;  3UB1 A;  1TP6 A;  1K9M 4;  3D5I A;  4LYL B;  3S29 A;  2GXF A;  1GMP A;  2C10 A;  4LZI A;  5D82 A;  1UUG B;  1O7W B;  2BNG A;  4BIR A;  2F86 B;  3IPT A;  1GOY A;  5IG0 A;  3UL5 A;  5KP4 A;  2CWT A;  1B2X A;  4N6M A;  4XBT A;  3B7C A;  3GRD A;  3SXX A;  3T8N A;  4AKY A;  4EC6 A;  5RNT A;  1IT7 A;  3D4A A;  3HZP A;  3NV0 A;  1J2B A;  2RCD A;  1RLS A;  4EW5 A;  1YHQ 3;  5IEO A;  1TIJ A;  1RGF A;  4IPB A;  1UI7 A;  5JPU A;  1X1Y A;  2CG0 A;  2RBI A;  1DMN A;  3GZY B;  3KII A;  2XGN A;  3VSY A;  1YJN 3;  3ZG5 A;  1M1X B;  3JUN A;  3SVA A;  1DMM A;  2P0X A;  5IEN A;  4OVM A;  3STD A;  1OHP A;  3K5T A;  1BU4 A;  1TFK A;  3DM8 A;  3SLU A;  3E99 A;  4XDV A;  4FR9 A;  1E3R A;  2ZHX B;  1T5Y A;  3EN8 A;  4RNT A;  1O7M B;  2CFD A;  4R9L A;  1BRG A;  2LYX A;  5HOH A;  5G2G A;  3JUP A;  5G1K A;  3WOE B;  4HM3 B;  2ML6 A;  4FMA A;  1RCL A;  2BHM A;  2FNQ A;  1S72 3;  1RRH A;  1MWS A;  3I0Y A;  5DRV A;  2XR8 B;  1SJW A;  3NBJ A;  4N6U A;  1ULI B;  1A90 A;  3Q1C A;  1AVL A;  3CXC 2;  5IF6 A;  2P38 A;  1FUT A;  1VQO 3;  2HMM B;  2W56 A;  2CFL A;  1ZX2 A;  2CW9 A;  2CWV A;  2KF3 A;  4MMX B;  3SX1 A;  1BNF A;  4HJL B;  5JBS A;  2IY2 A;  1RN1 A;  2Z77 A;  2QGU A;  1BSD A;  1FGO A;  2L4V A;  2W03 A;  3L0R A;  4FMB A;  1I2F A;  3DZL A;  4HYZ A;  3EE1 A;  5FGO A;  1BAN A;  3LTA A;  1WNH A;  3B4O A;  1SPU A;  4FMD A;  4XBX A;  1UUV B;  2QEX 3;  1IV9 A;  2QA4 3;  1UGI A;  2GU1 A;  2AAD A;  1X1W A;  2C4B A;  4EV5 A;  4XBY A;  1CEW I;  2CK3 H;  1R4Y A;  3HOH A;  3JVC A;  2F5M A;  3WDG B;  5LC6 A;  2V1L A;  4N6L A;  1NNV A;  3DGM A;  7RNT A;  3CC7 3;  1OHS A;  4STD A;  2BU4 A;  5CF1 A;  1YIJ 3;  5EQL A;  1Q40 B;  3MHE A;  2W0Q A;  1IVV A;  3RDE A;  1NB5 I;  1BRK A;  1AV4 A;  1U8C B;  1JB5 A;  1MWR A;  4WHA A;  8RNT A;  1KQS 2;  1G96 A;  1Q82 4;  4L8O A;  3CPW 2;  5AYR B;  3X40 A;  3DXO A;  1I2E A;  3OWS A;  3VF1 A;  3T0U A;  2CC3 A;  1X1U A;  3ROB A;  2ZA4 A;  1BUQ A;  4HAA A;  3WHO A;  1SII A;  4XDW A;  3Q2P A;  2XRX B;  4X2O A;  2K54 A;  3V98 A;  2IA7 A;  1RJO A;  3UNL A;  3CCU 3;  5EEO A;  2H0I A;  3B8L A;  4BTY A;  3AGN A;  1UUW B;  2M7O A;  5CXO A;  2BMO B;  2O3O A;  1MWU A;  1IT8 A;  2KRT A;  4L7K A;  1NWW A;  1N9E A;  4HOH A;  3PCS A;  1I0V A;  1PY3 A;  1VQN 3;  2F98 A;  4U13 A;  1T2I A;  1RSN A;  2FGT A;  2OQE A;  4K61 A;  2YFJ B;  3MSO A;  5TGN A;  2WOH A;  1NDO B;  1RDS A;  1UCK A;  3S27 A;  1JN5 A;  2UUG C;  3WR2 A;  1BVI A;  1FGQ A;  2GEY A;  4XB5 A;  1W5Z A;  1UI8 A;  2KAA A;  2Z76 A;  1M1K 4;  4WYK A;  4K90 B;  1HZ1 A;  3ALA A;  3NHX A;  1Q7H A;  5AEW B;  1OGX A;  4LGQ A;  1W4N A;  1AY7 A;  1AVK A;  1M9G A;  1QJG A;  2OWP A;  5A0O B;  2R41 A;  3BNE A;  1IQY A;  2GEX A;  5I97 A;  2IUJ A;  1VQ6 3;  1QAF A;  1MNL A;  3FH1 A;  4HZB B;  3BNC A;  3K9M C;  1VQ9 3;  1FUW A;  2HMO B;  2CX0 A;  3AGO A;  1GOV A;  1LOV A;  1DVC A;  4HKV B;  3U97 A;  3I56 3;  3NV0 B;  4BU4 A;  3BNB A;  3K0Z A;  1RN7 A;  2GU3 A;  4EBG A;  1TUH A;  1YVS A;  2Y73 A;  5LC7 A;  2KF4 A;  5AII A;  1I70 A;  1LVN A;  1ZGX A;  4QWT A;  1X1X A;  1A2V A;  1AQZ A;  3DGO A;  1UGH I;  4MEI A;  3CCS 3;  4AKZ A;  1FGT A;  3UJM A;  1IQX A;  1I8V A;  2O9U X;  3M8C A;  2INX A;  2AAE A;  3F7X A;  1VQL 3;  1OCV A;  1EQK A;  2ZL8 A;  4EXR A;  4GSP A;  2I9W A;  1G02 A;  3B4P A;  3MYT A;  1JBT A;  1RGA A;  3F40 A;  4OUQ A;  1BRS A;  1YIT 3;  1YNV X;  1CYV A;  2YX9 A;  1OUN A;  2IMJ A;  2E2T A;  2F4Y A;  3NXJ A;  1D6Z A;  2WGO A;  4N6N B;  5CF2 A;  4CDL A;  4ZM8 A;  3ZG0 A;  1TTO A;  3FKA A;  1YVB I;  3PYJ A;  1GY5 A;  3EJV A;  1IV7 A;  1FYS A;  4G1M B;  3SOA A;  4IIA A;  1STF I;  2K3D A;  3TDG A;  2HOH A;  4HVN A;  4RNY A;  2OQE C;  2W56 B;  5FW5 A;  1MGR A;  3Q90 A;  4K1V A;  3WMD A;  4RBN A;  3F8H A;  2HMK B;  3OW2 2;  2K0M A;  3AMO A;  3GSP A;  3X42 A;  4O2H A;  4I4K A;  4L8P A;  3DGY A;  3EC9 A;  1LOW A;  2PZV A;  3HIG A;  1VQP 3;  2XFS A;  1LOX A;  4HM6 B;  3DGL A;  3EBT A;  3JUQ A;  4HM2 B;  3ER7 A;  3LTD A;  4WWU C;  1JV2 B;  1KD1 4;  3NQZ A;  4X2H A;  2UGI A;  1I0X A;  5KP3 A;  2LQV A;  3CNX A;  1FGM A;  1MWT A;  4FCZ A;  3NM2 A;  1JJ2 2;  1CYU A;  3BLZ A;  3U1W A;  9RNT A;  4R4K A;  1F8N A;  2A15 A;  4HM4 B;  3LH4 A;  3LT9 A;  2P05 A;  1CH0 A;  3BU4 A;  3URP A;  3NQY A;  3NUV A;  3PCR A;  3WA2 X;  3X3Y A;  1DVD A;  4HM1 B;  5BU4 A;  3O8Y A;  1W00 A;  3GZR A;  1D6Y A;  2W6J H;  3X3X A;  3QK9 A;  4N6V 0;  1RMS A;  1K28 A;  1WMP A;  1N5P A;  3FZW A;  3CNM A;  3CCJ 3;  1N8Q A;  1GMR A;  1JKG A;  2SBL A;  3IJE B;  1VQ7 3;  4JRF A;  1IDP A;  5AIF A;  4KFE A;  1UCI A;  3CCV 3;  2BO9 B;  4EYC A;  1M90 4;  5BXQ A;  1BNR A;  1FA3 A;  1E97 A;  3NM7 A;  2IYJ A;  1ULJ B;  2KXG A;  1B3S A;  1WTH A;  3CC4 3;  2CFG A;  1OGZ A;  2W9P A;  3CCL 3;  4O02 B;  6GSP A;  3G6E 3;  1W6Y A;  1BSA A;  1K73 4;  5CLK A;  1YI2 3;  1US1 A;  2D1W A;  1IQ8 A;  1BIR A;  3RNT A;  3KZT A;  1I2G A;  1B2Z A;  2CH9 A;  1O7G B;  2STD A;  4HM7 B;  1BRJ A;  4I5Q A;  1DE3 A;  1JN5 B;  3LT8 A;  3WOF B;  1ZS7 A;  1TRP A;  3EB8 A;  7STD A;  1JZO A;  2CFW A;  4WYK B;  5AEU B;  2W9Q A;  1ASK A;  3HK4 A;  5AIG A;  3GZX B;  1IYY A;  3OWU A;  3FF0 A;  1UCL A;  4LMI A;  1BSB A;  6RNT A;  3CMA 3;  1SIH A;  2H0G A;  3NBR A;  3WOD G;  2CX1 A;  1ROA A;  1B2S A;  1VQ4 3;  2CIU A;  1I3I A;  3DUK A;  3V92 A;  2B24 B;  5ELJ A;  2BMQ B;  3MG1 A;  3EHC A;  3MWZ A;  3SYU A;  3G4S 3;  3CCM 3;  1W2B 2;  1VQ8 3;  4J5K A;  1PYL A;  4LEH A;  3KE7 A;  1LQM B;  3X41 A;  3AHW A;  1Q7Y 4;  5EVH A;  5M19 A;  1UCJ A;  3EBY A;  1NU3 A;  3F14 A;  2R4I A;  3CCE 3;  1EUI C;  1BRI A;  1Q40 A;  6STD A;  2SAR A;  1UW1 A;  3DMC A;  4WP5 A;  5AIH A;  4ORL A;  3OX9 A;  4XM4 A;  1HKX A;  1VQQ A;  1FGR A;  2F99 A;  3PGB A;  2UX0 A;  2XH9 A;  2W2C A;  1BNS A;  3G16 A;  3N8B A;  3CC2 3;  1A2K A;  2F56 A;  1TJD A;  2Q07 A;  3HII A;  5D81 A;  1RRL A;  2OOV A;  1FZU A;  1KSI A;  1BOX A;  1JZD A;  5IW9 A;  1IVW A;  1KWI A;  3AHS A;  3FG1 A;  1YJW 3;  1UDI I;  1LXE A;  3KKG A;  1GD4 A;  3IMA B;  4HBR A;  2BIR A;  3FG4 A;  1NB3 I;  2MF7 A;  1OPY A;  1V57 A;  3RGA A;  2J8X B;  3G8Z A;  4CPK A;  2GSP A;  1I3F A;  1QAL A;  2QIY A;  3G0K A;  4FCJ A;  4N6T A;  1QMA A;  2YFL B;  4NHF A;  1RNB A;  4HM0 B;  2MC8 A;  3PXM A;  3EF8 A;  4J8T A;  3K63 A;  3BIR A;  3H51 A;  4Q53 A;  2WGQ A;  3FCS B;  3NX0 A;  1IVX A;  2OTJ 3;  4HM5 B;  3H3H A;  1A2P A;  3F9S A;  3HI7 A;  4JF8 A;  2OCT A;  5D83 A;  1GY7 A;  4BL2 A;  1OF5 A;  4O8S A;  3AMO B;  5AYS C;  1C7H A;  3SED A;  1VZZ A;  1BNE A;  4TX4 A;  1GMQ A;  1N5H A;  1Z1S A;  3G71 3;  2W04 A;  1WQL B;  1BSC A;  1LRA A;  1N8R 4;  2RGQ A;  4IT7 A;  1FUS A;  4R9K A;  1JBR A;  2Y74 A;  4KVH A;  3BB9 A;  1D6U A;  1JBS A;  1BNI A;  3DY5 A;  4NRE A;  5CK6 A;  4RNZ A;  1K41 A;  1LQG C;  3UL6 A;  3BND A;  3K7C A;  1YGW A;  1QVF 2;  1W6G A;  4LSO A;  1SQW A;  1GS3 A;  1WMN A;  3NBB A;  4PEJ A;  1AR0 A;  5HGR A;  1LNH A;  1T3B A;  3D79 A;  3N54 B;  1HU9 A;  1IU7 A;  4DKI A;  2ZDJ A;  2XF3 A;  4KFF A;  3LTB A;  1BUJ A;  4H61 A;  1B20 A;  1W2Z A;  4BTX A;  4FCM A;  3KCH A;  1NO3 A;  1JKG B;  5DRE A;  1RGH A;  3CME 3;  1ISK A;  1JRQ A;  2E2U A;  1OH0 A;  2BT3 A;  3CPO A;  2OOV C;  3SOY A;  3WA3 A;  4AEQ A;  1Y4K A;  3ECF A;  3CU3 A;  1VQK 3;  1C54 A;  3A5E A;  4OK0 A;  3DH2 A;  2CWU A;  3Q3F A;  4ILF A;  4K1U A;  1STD A;  1K8A 4;  4HM8 B;  2P09 A;  3A76 A;  3JUO A;  1VQM 3;  4RZM A;  3KFQ C;  3X3Z A;  1EEJ A;  1RTU A;  1FW7 A;  3OWY A;  3DGN A;  3T8U A;  1GD3 A;  3KN4 A;  4O3V A;  1TFO A;  1V58 A;  3D3L A;  3D9R A; 
#chains in the Genus database with same CATH homology
 1IYY A;  1UCL A;  1X1Y A;  2RBI A;  1BSB A;  3AGO A;  1GOV A;  1LOV A;  6RNT A;  4BU4 A;  1LNI A;  1B2S A;  1I3I A;  1YVS A;  2F5W A;  2KF4 A;  1BU4 A;  1GSP A;  1I70 A;  3SYU A;  1ZGX A;  1X1X A;  4J5K A;  1AQZ A;  1RGE A;  1PYL A;  3AHW A;  4RNT A;  1RHL A;  1UCJ A;  1I8V A;  1RGK A;  1BRG A;  1BRI A;  5HOH A;  1LOY A;  2RNT A;  2SAR A;  1BGS A;  2AAE A;  1B2M A;  1MGW A;  1BRH A;  4GSP A;  1RCL A;  1G02 A;  1JBT A;  1RGA A;  1BNG A;  1BNS A;  1BRS A;  1YNV X;  1DET A;  2F56 A;  1FZU A;  1RGC A;  1BOX A;  2F4Y A;  1TRQ A;  3D5G A;  3AHS A;  1B21 A;  1FUT A;  1RGG A;  1T2H A;  1Q9E A;  1TTO A;  2KF3 A;  1BNF A;  1RN1 A;  1BSD A;  2BIR A;  1I2F A;  1FYS A;  1BAN A;  1SAR A;  2GSP A;  1I3F A;  1RNB A;  2HOH A;  2AAD A;  1MGR A;  1X1W A;  2C4B A;  1RN4 A;  3GSP A;  3BIR A;  3HOH A;  1R4Y A;  2F5M A;  7GSP A;  3DGY A;  1LOW A;  5BIR A;  7RNT A;  1A2P A;  1DE3 A;  2BU4 A;  1BNE A;  1BRK A;  1I0X A;  2KF5 A;  1GMQ A;  8RNT A;  1BSC A;  1LRA A;  9RNT A;  1FUS A;  1JBR A;  1B27 A;  1CH0 A;  3BU4 A;  3URP A;  1I2E A;  1RNT A;  1JBS A;  1BNI A;  1X1U A;  2ZA4 A;  1RGL A;  4HAA A;  3WHO A;  1BAO A;  5BU4 A;  1GOU A;  1YGW A;  1BSE A;  3AGN A;  1RMS A;  1RCK A;  1GMR A;  4HOH A;  1BUJ A;  1I0V A;  1PY3 A;  2KF6 A;  1BNJ A;  1UCI A;  1BNR A;  1B20 A;  1T2I A;  5GSP A;  1B2U A;  1B3S A;  1RSN A;  1HYF A;  3KCH A;  4GHO A;  1RGH A;  1BRN L;  6GSP A;  3D5I A;  1RDS A;  1UCK A;  1BSA A;  3WR2 A;  1BVI A;  1C54 A;  1GMP A;  3A5E A;  3DH2 A;  2KAA A;  3Q3F A;  1BIR A;  3RNT A;  1I2G A;  1B2Z A;  1HZ1 A;  4BIR A;  1GOY A;  1B2X A;  1AY7 A;  1BRJ A;  1RTU A;  5RNT A;  3D4A A;  1TRP A;  1FW7 A;  1RLS A;  4J5G A;  1RGF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...