4L7KA

Crystal structure of ketosteroid isomerase d38e from pseudomonas testosteroni (tksi)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
123
structure length
123
Chain Sequence
MNTPEHMTAVVQRYVAALNAGDLDGIVALFADDATVEEPVGSEPRSGTAAIREFYANSLKLPLAVELTQEVRAVANEAAFAFTVSFEYQGRKTVVAPIDHFRFNGAGKVVSMRALFGEKNIHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Steroid Delta-isomerase
publication title Use of anion-aromatic interactions to position the general base in the ketosteroid isomerase active site.
pubmed doi rcsb
source organism Comamonas testosteroni
total genus 32
structure length 123
sequence length 123
chains with identical sequence B, C, D, E, F, G, H, I, J, K, O
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2013-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4l7kA00
3T8UA 1W02A 1U5OA 3S5CA 1IDPA 5AEWB 2YFJB 3JUMA 5CLKA 3EBYA 1JN5A 4WWUC 3MG2A 4CDLA 1GS3A 5CF2A 4HM7B 1OF5B 3F8HA 1GY7A 1OGZA 3UNLA 5FW5A 3DXOA 4GB5A 3CU3A 1E3RA 2RGQA 4L8PA 2A15A 2BMQB 2UX0A 1E97A 1O7NB 4HM3B 4ORLA 2K54A 4STDA 5D82A 4WYKB 3B7CA 3NHXA 1A2KA 3ROBA 5HGRA 4N3VA 3EBTA 3MG3A 3CPOA 3E99A 1O7MB 2YFIB 2B1XB 2CKFB 5IENA 1UUWB 2Z7AA 3GZRA 4LMIA 1NDOB 3BLZA 3FH1A 6STDA 1O7HB 2HMJB 5TGNA 3EHCA 3MSOA 8CHOA 5IG3A 5D83A 3JUOA 1O7GB 1JKGB 3VSYA 3LYGA 4L7KA 5IG0A 3OWUA 4OUQA 3FLJA 1HKXA 1TUHA 3NXJA 1GYBA 5IG5A 5STDA 3HZPA 3H51A 2HMKB 2HMLB 1VZZA 2HMMB 1JB4A 1JN5B 3CNXA 2GXFA 4HM5B 3K7CA 3EX9A 3F14A 1ZO2A 3GWRA 2STDA 4HZ9B 2YFLB 4HM8B 5CK6A 3UJMA 3NM2A 3HX8A 3SOAA 1C7HA 4X2HA 3OWYA 5AEUB 3VGNA 1NWWA 3WMDA 3GZXB 2XRXB 4HM4B 3G16A 3F7SA 1OCVA 4R9KA 5AIHA 5IG4A 5JPPA 4RZMA 5DREA 4XDWA 3EN1B 3NUVA 3OWSA 2QIYA 3B4PA 1OGXA 2F86B 4PEJA 3JUPA 3F40A 1ZX2A 2HMOB 3OXAA 5BXQA 1W01A 3G0KA 4LGQA 3FGYA 3DZLA 3MKIA 2F99A 2B24B 4FCJA 4R1KA 5CXOA 3OV4A 4J9AA 4Q53A 2HMNB 3D9RA 1OH0A 2RFRA 2F98A 5AIIA 1QMAA 7STDA 2I9WA 5KP3A 3FF2A 4HM0B 5IEPA 3M8CA 4X2OA 5JPUA 1OHPA 3SOYA 2Z76A 1E3VA 3KZTA 1O7WB 3H3HA 3FSDA 1OHSA 5AIGA 2BMOB 1Z1SA 5IEOA 4IIAA 1Q40A 2GBXB 3STDA 1ISKA 2XSHB 1AR0A 2GBWB 3F7XA 2OWPA 1OUNA 4MJDA 3EC9A 2XR8B 3ER7A 2PZVA 3MHEA 3RGAA 2RCDA 1OHOA 4XM4A 5EVHA 3SEDA 1CQSA 3KSPA 4XBTA 4FCMA 1JB5A 3MYTA 3KE7A 3JUNA 5IERA 3GRDA 4HVNA 3EN8A 4WP5A 3B8LA 4KVHA 3FF0A 1S5AA 3DM8A 5AIFA 5D81A 3EQQB 1W6YA 4XBXA 1SJWA 3EJVA 1EG9B 2XSOB 1EA2A 1QJGA 4XB5A 3IPTA 2CHCA 4J8TA 3FZWA 4U13A 3HK4A 2BNGA 1GY6A 2W2CA 1K41A 4K1UA 3NV0B 2QGUA 1TP6A 3MG1A 2Z77A 1W00A 4HM2B 1GY5A 4XBYA 3NBRA 3DUKA 3CNMA 1Q40B 1DMMA 1STDA 2JQ5A 3G8ZA 3FKAA 5IF6A 1OF5A 3GZYB 5BVBA 3NV0A 3T8NA 4HM1B 5CF1A 5G2GA 2INXA 2R4IA 3KKGA 3F9SA 1WQLB 4LEHA 4H3UA 4HZBB 3B4OA 1DMNA 1JB2A 3DMCA 1UUVB 2IMJA 3Q90A 3BB9A 3OX9A 4WYKA 5KP1A 4OVMA 4L8OA 4K1VA 2BMRB 1ASKA 1O7PB 5DRVA 4HKVB 1ULJB 1DMQA 1OPYA 1Q42A 3EF8A 5KP4A 2GEYA 2GEXA 5AI1A 3ECFA 1NU3A 4XDVA 1ULIB 4HM6B 3RGRA 3I0YA 3K0ZA 3F8XA 4I4KA 3GZBA 3JUQA 1JKGA 3LZAA 4HJLB 3A76A 1BUQA 4R9LA
chains in the Genus database with same CATH superfamily
2XGNA 3T8UA 1OACA 4N6UA 1QVG2 1B27A 4CPKA 1W02A 3TDGA 1U5OA 3S5CA 1IDPA 2HOHA 2OOVC 3N9HA 3DY5A 2ML6A 1M904 1FUWA 5AEWB 2IUJA 1I70A 2Y73A 1MGRA 2YFJB 3JUMA 1D6YA 1US1A 3SLUA 5CLKA 3EBYA 1JN5A 4WWUC 3MG2A 3CCV3 3S67A 4CDLA 1GS3A 5CF2A 1VQ73 2ZL8A 1CYVA 1STFI 4HM7B 4AEQA 1OF5B 2Z6BA 3F8HA 1DYUA 1GY7A 3DGYA 8RNTA 2MC8A 1BNSA 1OGZA 3GSPA 4N6NB 3UNLA 1BNFA 4FMDA 5FW5A 1GOUA 3X3ZA 1PU4A 3D4AA 1AQZA 2XEPA 4TX4A 1DETA 1K8A4 1MNLA 4JF8A 3DXOA 1I2FA 1FYSA 1JRQA 1LNIA 1LXEA 1PFPA 1E3RA 2CFDA 1IQYA 2F4YA 2P05A 2RGQA 3CU3A 1QVF2 1BNRA 3UL6A 1KSIA 1I2GA 4L8PA 2A15A 2BMQB 2FGTA 3D79A 7GSPA 1IK3A 2UX0A 1FUSA 1RN7A 3CCS3 1E97A 4WFOA 1NNVA 1RN1A 1O7NB 1RNTA 1D6ZA 2K54A 4HM3B 1W4NA 4ORLA 4STDA 2ZA4A 5D82A 1NJI4 2L4VA 2E2UA 1T2IA 4HBRA 1U8CB 2V1LA 3AHSA 4WYKB 5GSPA 5RNTA 1VQ93 5FGOA 3O8YA 1VQ43 3X3XA 1Q864 3B7CA 1VQN3 6GSPA 1Q7HA 1VQO3 3NHXA 2Y74A 3LH4A 1AVKA 1A2KA 1FGMA 3BNCA 1N5HA 1B2XA 3ROBA 3MWZA 2BO9B 5HGRA 4GHOA 4KZ1A 4N3VA 1JZOA 3DGOA 3EBTA 3MG3A 1TIJA 1LOWA 3CPOA 3E99A 4LYLB 1O7MB 2RBIA 2MF7A 2YFIB 1IQXA 3G4S3 2B1XB 1LNHA 2CKFB 5IENA 3SXXA 1KQS2 5BU4A 1UUWB 2Z7AA 3GZRA 5A0OB 4LMIA 1BRJA 1NDOB 3BLZA 3WOFB 3J7Yd 1RGCA 1TRQA 2KF4A 4EW5A 1LOXA 5HOHA 3CCM3 1S723 1J2BA 1DE3A 3HI7A 1RGLA 1VQL3 4BTXA 1UCLA 1JNQA 1ZS7A 3VF1A 7RNTA 1TTOA 1RNBA 4N6LA 2OTJ3 1G96A 2CWVA 3U97A 3CCQ3 1V74A 3FH1A 6STDA 1O7HB 1RGAA 2HMJB 2LYXA 4FMAA 2WOHA 5TGNA 3EHCA 3MSOA 8CHOA 5IG3A 3FG1A 2K0MA 1W7CA 5D83A 1BVIA 1UCIA 1X1XA 3JUOA 3S29A 1BNGA 1GMQA 5ELJA 1QALA 4G1MB 1K28A 1O7GB 1LOYA 1FA3A 1JKGB 3KIIA 3VSYA 3LYGA 4L7KA 4CJNA 2KF6A 5IG0A 1SARA 3NM7A 3OWUA 4OUQA 1RGGA 3FLJA 2IUKA 1TUHA 1HKXA 4EV5A 1JBRA 3PS8A 1FW7A 3NXJA 1GYBA 1IT8A 1Q814 3EB8A 1GSPA 3LTBA 1MWUA 5STDA 5IG5A 4JRFA 3HZPA 3ZG5A 3H51A 1Q824 1LQGC 2HMKB 2HMLB 1VZZA 2HMMB 3KCHA 3WDGB 1BSBA 1JB4A 1RGKA 4BTWA 3CMA3 1JN5B 1RLSA 1PY3A 3CNXA 3D5GA 3WHOA 1JV2B 2GXFA 1MOLA 4HM5B 3K7CA 4DKIA 3EX9A 3F14A 1FGTA 1RJOA 4RNZA 1B2MA 1IV9A 1ZO2A 2F5MA 3GWRA 5M1AA 2STDA 3Q3FA 1YVBI 1FZUA 3HIGA 2OQEC 2YFLB 4HZ9B 4HM8B 5CK6A 3UJMA 3V92A 1BSEA 3NM2A 1GOYA 3K63A 3CCU3 2CWUA 3HX8A 3SOAA 2LQVA 1MWRA 2C11A 1NB3I 2WGOA 1C7HA 3DGLA 4X2HA 4BU4A 3OWYA 5AEUB 3T0UA 3K9MC 3VGNA 1KD14 1NWWA 1NB5I 3I553 2XGLA 3V98A 3BIRA 4N6OB 3A5EA 2WOFA 1YJ93 4FCZA 1IVVA 3GZXB 3WMDA 2XRXB 4HM4B 3G16A 1TJDA 3F7SA 1OCVA 4N6MA 2SBLA 1I3FA 4R9KA 2O9UX 2Q07A 4RBNA 1RCKA 1EKMA 1HYFA 5AIHA 5IG4A 1FGQA 5JPPA 4RZMA 2KF3A 4BIRA 2P0MA 3AMOA 5DREA 1LRAA 2M7OA 4IT7A 4XDWA 3NBBA 3EN1B 2CFKA 3NUVA 2CIUA 3OWSA 1L5GB 9RNTA 2QIYA 3K5TA 1N9EA 3B4PA 1BRIA 1IYYA 5BIRA 1RGFA 1LVNA 2W03A 2OTL3 4O02B 2H0IA 2XH9A 3URPA 1OGXA 2KF5A 1IT7A 1RDSA 3Q2PA 1MWSA 2F86B 4PEJA 3OW22 3JUPA 1B20A 1YIT3 3NQYA 3F40A 4MMYB 1ZX2A 3BU4A 2HMOB 3N8BA 3OXAA 3CC23 2J8XB 1X1YA 3LT8A 5BXQA 1DVCA 1W01A 2CC3A 1UI8A 3G0KA 4LGQA 2IA7A 3FGYA 1YI23 4O8SA 3CCE3 3DZLA 2P0XA 2W56A 2F56A 4J5GA 3MKIA 2F99A 4EBGA 2B24B 5M18A 1BNJA 1WMNA 3FG3A 4FCJA 3AGOA 2OOVA 4CCVA 3WR2A 4R1KA 5CXOA 3OV4A 1BRHA 1K9M4 1IV7A 2GU3A 4J9AA 4Q53A 3FCSB 4R4KA 3CC43 2HMNB 3D9RA 3X3YA 3NX0A 1OH0A 1PYLA 2RFRA 3DGNA 3EE1A 2F98A 3PGBA 5AIIA 1QMAA 1G0TA 7STDA 2I9WA 4O3VA 1W2ZA 2YX9A 3JVCA 4FMBA 4MMZB 5KP3A 3CC73 1BRNL 4NREA 3FF2A 1B21A 1N5PA 4HM0B 1N8QA 4HYZA 4KFDA 1R4YA 5IEPA 4KFEA 1A2VA 3DGMA 1VQ63 2GSPA 3M8CA 1EEJA 1MGWA 2D42A 3IMAB 4KFFA 3WODG 3PXMA 4X2OA 5JPUA 3LTCA 1AVLA 2CG1A 4FR9A 1G02A 4AKYA 1SPUA 1RTUA 2P38A 1OHPA 3KFQC 4OK0A 2Z76A 3SOYA 2GU1A 3LOYA 4EC6A 1JBTA 2CFGA 1E3VA 3KZTA 3HIIA 2FNQA 4RNTA 1I2EA 1O7WB 1WNHA 1BNIA 3H3HA 3FSDA 1RCLA 1WMOA 3X40A 1OHSA 4J5KA 1VQP3 5AIGA 2BMOB 1Z1SA 3L0RA 4IIAA 5IEOA 4ZM8A 1Q40A 3PCSA 2WGQA 4NHFA 2GBXB 1A67A 1ROAA 1YHQ3 1YJW3 5G1LA 4BTYA 3STDA 1ISKA 1IQ8A 1HZ1A 2XSHB 1AR0A 2GBWB 3F7XA 1B2SA 4K90B 1JZDA 1HU9A 4WHAA 2OWPA 1SIIA 1OUNA 2XF3A 5LC7A 3LXUX 2H0HA 4MJDA 3EC9A 1I0VA 2W04A 2XR8B 1FGRA 3ER7A 2PZVA 3MHEA 1W6CA 1AY7A 3QRDA 3RGAA 3FG4A 1RSNA 3I563 1BSAA 1BUJA 2RCDA 4GL6A 1OHOA 3LT9A 4XM4A 2W9PA 5EVHA 1BRSA 2C4BA 2RSXA 5AYRB 3SEDA 3WOEB 1X1UA 2W0QA 3AMOB 4K61A 1CQSA 1BANA 1VQ53 3Q1CA 3KSPA 4XBTA 4FCMA 1JB5A 1M9GA 2CFWA 3MYTA 4O2HA 1K734 5ELUA 1N8R4 3KE7A 3JUNA 1GD4A 5IW9A 1BU4A 3HOHA 5IERA 1RRHA 3G713 3X41A 3GRDA 1TRPA 1BNEA 1TFKA 1UUGB 4HVNA 3U1WA 3CCJ3 3EN8A 4WP5A 3B8LA 3WA2X 2IYJA 2OCTA 4KVHA 1BGSA 1YVSA 3CPW2 3FF0A 4NPBA 1YNVX 1S5AA 2CX0A 1YIJ3 3DM8A 1BSCA 2W56B 2KXGA 5AIFA 4AKZA 1BAOA 3SVAA 1QAFA 3QK9A 5D81A 5G1KA 1X1WA 1QAKA 3EQQB 1JBSA 1UCKA 2P09A 1T3BA 4MEIA 1W6YA 1BSDA 4XBXA 1SJWA 3EJVA 4HAAA 1SIHA 3MPHA 2XFTA 1BIRA 4QWTA 1V57A 1EG9B 2XSOB 4FMCA 2R41A 4IPBA 1ZGXA 1EA2A 1QJGA 6RNTA 4XB5A 2CWTA 3IPTA 1BRKA 2BU4A 2CHCA 2UUGC 4J8TA 3FZWA 2C10A 3HK4A 4U13A 1IVUA 2BNGA 1IU7A 1GY6A 4GSPA 3BNDA 2W2CA 2OQEA 1RHLA 1K41A 4K1UA 3CXC2 3NV0B 2QGUA 3GAXA 1VQQA 1TP6A 2CH9A 2W9QA 3MG1A 2Z77A 3KSED 3BNBA 3LMLA 1BRGA 1SQWA 2E2VA 1GOVA 1B2ZA 1I0XA 2ZHXB 1W00A 4HM2B 1C54A 1GY5A 4XBYA 3WA3A 1LQMB 1YGWA 3PZWA 1AV4A 3BNEA 2D1WA 3NBRA 2E2TA 3UB1A 3DUKA 4LZIA 2IY2A 3RDEA 4EYCA 1IVXA 3LTDA 4N6V0 1YGEA 3UL5A 3CNMA 1RGEA 1WTHA 1EUIC 1DMMA 1MWTA 1Q40B 2BT3A 1RRLA 1STDA 2JQ5A 2KAAA 1A90A 2W6JH 3G8ZA 5JBSA 4BL3A 3FKAA 2JDIH 1GD3A 3D3LA 5IF6A 1OF5A 1Q9EA 3GZYB 1UCJA 5EQLA 3ZG0A 1EQKA 1LOVA 5BVBA 1F8NA 1M1XB 3NV0A 3T8NA 3D5IA 2L1SA 2QEX3 3CCR3 4HM1B 1YJN3 3AHWA 5CF1A 1M1K4 2KRTA 5G2GA 1N9JA 2KCDA 2INXA 1RKYA 2R4IA 2ZDJA 2K3DA 3KKGA 4ILFA 1FGOA 3F9SA 1BOXA 1KC84 1I3IA 1A2PA 1T2HA 2ML5A 1WQLB 1UDII 2AAEA 1T5YA 2RNTA 4LEHA 3S27A 3AGNA 4H3UA 4HZBB 1CEWI 1DMNA 1JB2A 3B4OA 3DMCA 1UUVB 2H0GA 3SYUA 3NBJA 1CH0A 1D6UA 2IMJA 3Q90A 1B3SA 1NO3A 4GB5A 3BB9A 1CYUA 3DH2A 2UGIA 3OX9A 4WYKA 4EXRA 5KP1A 2WO0A 4HOHA 3X42A 4OVMA 3LTAA 1W5ZA 1GMRA 1UI7A 4L8OA 1R4CA 1VQM3 3NQZA 4K1VA 2BMRB 1B2UA 1FUTA 1ASKA 1UGHI 4R80A 3S28A 1JJ22 3G6E3 1W2B2 3RNTA 1O7PB 5DRVA 1V58A 4HKVB 1ULJB 3CME3 2SARA 1Y4KA 2CK3H 4RNYA 1KWIA 1RMSA 4N6TA 4BL2A 1DMQA 4LSOA 1OPYA 1IVWA 1Q42A 3CCL3 2F5WA 3EF8A 5LC6A 3SX1A 5KP4A 1Q7Y4 2O3OA 1VQK3 2CX1A 2GEYA 3PCRA 4EV2A 2XFSA 2BIRA 3CD63 2GEXA 5AI1A 5I97A 2AADA 3ECFA 1TU5A 3KN4A 1RN4A 1I8VA 4H61A 3N54B 1NU3A 4XDVA 1WMPA 1ULIB 2FXTA 1UGIA 4HM6B 3RGRA 3ALAA 3I0YA 2CW9A 4KT3B 2QA43 1GMPA 3K0ZA 1DVDA 3F8XA 2CFLA 2PNCA 4I4KA 1TFOA 3GZBA 1UW1A 2BHMA 3JUQA 5EEOA 3V99A 3PYJA 1W6GA 1JKGA 3LZAA 4MMXB 1ROVA 3A76A 4HJLB 5M19A 1VQ83 3IJEB 5AYSC 1BUQA 4I5QA 3ZFZA 2CG0A 1RGHA 4R9LA
chains in the Genus database with same CATH topology
2XGNA 3T8UA 1OACA 4N6UA 1QVG2 1W02A 3TDGA 1U5OA 3S5CA 1IDPA 2OOVC 3N9HA 3DY5A 2ML6A 1M904 1FUWA 5AEWB 2IUJA 2Y73A 2YFJB 3JUMA 1D6YA 1US1A 3SLUA 5CLKA 3EBYA 1JN5A 4WWUC 3MG2A 3CCV3 3S67A 4CDLA 1GS3A 5CF2A 1VQ73 2ZL8A 1CYVA 1STFI 4HM7B 4AEQA 1OF5B 2Z6BA 3F8HA 1DYUA 1GY7A 2MC8A 1OGZA 3UNLA 4N6NB 4FMDA 5FW5A 3X3ZA 1PU4A 2XEPA 4TX4A 1K8A4 1MNLA 4JF8A 3DXOA 3V98A 1JRQA 1LXEA 2CFDA 1PFPA 3CU3A 1E3RA 2P05A 1IQYA 4GB5A 2RGQA 1QVF2 3UL6A 1KSIA 4L8PA 2A15A 2BMQB 2FGTA 1IK3A 2UX0A 1RN7A 3CCS3 1E97A 4WFOA 1O7NB 4HM3B 1D6ZA 2K54A 4ORLA 1W4NA 4STDA 5D82A 1NJI4 2L4VA 2E2UA 4HBRA 1U8CB 2V1LA 4WYKB 1VQ93 5FGOA 3O8YA 1VQ43 3X3XA 1Q864 3B7CA 1VQN3 1VQO3 3NHXA 2Y74A 3LH4A 1AVKA 1A2KA 1FGMA 3BNCA 1N5HA 3ROBA 3MWZA 2BO9B 5HGRA 4KZ1A 4N3VA 3DGOA 3EBTA 3MG3A 1TIJA 3CPOA 3E99A 1O7MB 2YFIB 2MF7A 1IQXA 3G4S3 2B1XB 1LNHA 2CKFB 5IENA 3SXXA 1KQS2 1UUWB 2Z7AA 3GZRA 5A0OB 4LMIA 1NDOB 3BLZA 3WOFB 3J7Yd 1J2BA 1LOXA 3CCM3 1S723 3HI7A 1VQL3 4BTXA 1JNQA 3VF1A 4N6LA 2OTJ3 1G96A 2CWVA 3U97A 3CCQ3 1V74A 3FH1A 6STDA 1O7HB 2HMJB 2LYXA 4FMAA 2WOHA 5TGNA 3EHCA 3MSOA 8CHOA 5IG3A 3FG1A 2K0MA 1W7CA 5D83A 3JUOA 3S29A 5ELJA 1QALA 4G1MB 1K28A 1O7GB 1FA3A 1JKGB 3KIIA 3VSYA 3LYGA 4L7KA 5IG0A 3NM7A 3OWUA 4OUQA 3FLJA 2IUKA 1TUHA 1HKXA 4EV5A 3PS8A 3NXJA 1GYBA 1IT8A 1Q814 3EB8A 3LTBA 5IG5A 5STDA 4JRFA 3HZPA 1Q824 3H51A 2HMKB 2HMLB 1VZZA 2HMMB 3WDGB 1JB4A 4BTWA 3CMA3 1JN5B 3CNXA 1JV2B 2GXFA 1MOLA 4HM5B 3K7CA 3EX9A 3F14A 1FGTA 1RJOA 4RNZA 1IV9A 1ZO2A 3GWRA 2STDA 1YVBI 3HIGA 4HZ9B 2OQEC 2YFLB 4HM8B 5CK6A 3UJMA 3V92A 3NM2A 3K63A 3CCU3 2CWUA 3HX8A 3SOAA 2LQVA 2C11A 1NB3I 2WGOA 1C7HA 3DGLA 4X2HA 3OWYA 5AEUB 3T0UA 3K9MC 3VGNA 1KD14 1NWWA 1NB5I 3I553 2XGLA 4N6OB 2WOFA 1YJ93 4FCZA 1IVVA 3GZXB 3WMDA 2XRXB 4HM4B 3G16A 3F7SA 1OCVA 4N6MA 2SBLA 4R9KA 2O9UX 2Q07A 1EKMA 5AIHA 5IG4A 1FGQA 5JPPA 4RZMA 2P0MA 3AMOA 5DREA 2M7OA 4IT7A 4XDWA 3NBBA 3EN1B 2CFKA 3NUVA 2CIUA 3OWSA 1L5GB 2QIYA 3K5TA 1N9EA 3B4PA 2W03A 1LVNA 2OTL3 4O02B 2XH9A 1OGXA 1IT7A 3Q2PA 2F86B 4PEJA 3OW22 3JUPA 1YIT3 3NQYA 3F40A 4MMYB 1ZX2A 2HMOB 3N8BA 3OXAA 3CC23 3LT8A 5BXQA 1DVCA 1W01A 2CC3A 1UI8A 3G0KA 4LGQA 2IA7A 3FGYA 1YI23 4O8SA 3CCE3 3DZLA 2P0XA 2W56A 3MKIA 2F99A 4EBGA 2B24B 1WMNA 3FG3A 4FCJA 2OOVA 4CCVA 4R1KA 5CXOA 3OV4A 1K9M4 1IV7A 2GU3A 4J9AA 4Q53A 3FCSB 4R4KA 3CC43 2HMNB 3D9RA 3X3YA 3NX0A 1OH0A 2RFRA 3DGNA 3EE1A 2F98A 3PGBA 5AIIA 1QMAA 7STDA 2I9WA 4O3VA 1W2ZA 2YX9A 3JVCA 4FMBA 4MMZB 5KP3A 3CC73 4NREA 3FF2A 4HYZA 1N5PA 4HM0B 1N8QA 4KFDA 5IEPA 4KFEA 1A2VA 3DGMA 1VQ63 3M8CA 2D42A 4KFFA 3IMAB 3WODG 3PXMA 4X2OA 5JPUA 3LTCA 1AVLA 2CG1A 4FR9A 4AKYA 1SPUA 2P38A 1OHPA 3KFQC 4OK0A 2Z76A 3SOYA 2GU1A 3LOYA 4EC6A 2CFGA 1E3VA 3KZTA 3HIIA 2FNQA 1O7WB 1WNHA 3H3HA 3FSDA 1WMOA 3X40A 1OHSA 1VQP3 5AIGA 2BMOB 1Z1SA 3L0RA 4IIAA 5IEOA 4ZM8A 1Q40A 3PCSA 2WGQA 4NHFA 2GBXB 1A67A 1ROAA 1YHQ3 1YJW3 4BTYA 3STDA 1ISKA 1IQ8A 2XSHB 1AR0A 2GBWB 3F7XA 4K90B 1HU9A 4WHAA 5LC7A 2OWPA 1SIIA 1OUNA 2XF3A 3LXUX 4MJDA 3EC9A 2XR8B 2W04A 1FGRA 3ER7A 2PZVA 3MHEA 1W6CA 3RGAA 3QRDA 3FG4A 3I563 2RCDA 4GL6A 1OHOA 3LT9A 4XM4A 2W9PA 5EVHA 3SEDA 2RSXA 5AYRB 3WOEB 3AMOB 2W0QA 4K61A 1CQSA 1VQ53 3Q1CA 3KSPA 4XBTA 4FCMA 1JB5A 1M9GA 2CFWA 3MYTA 4O2HA 1K734 5ELUA 1N8R4 3KE7A 3JUNA 1GD4A 5IW9A 5IERA 1RRHA 3G713 3X41A 3GRDA 1TFKA 4HVNA 3U1WA 3CCJ3 3EN8A 4WP5A 3B8LA 3WA2X 2OCTA 4KVHA 3CPW2 3FF0A 1S5AA 1YIJ3 3DM8A 2W56B 2KXGA 5AIFA 4AKZA 3SVAA 1QAFA 3QK9A 5D81A 1QAKA 3EQQB 2P09A 4MEIA 1W6YA 4XBXA 1SJWA 3EJVA 1SIHA 3MPHA 2XFTA 4QWTA 1EG9B 2XSOB 4FMCA 4IPBA 1EA2A 1QJGA 4XB5A 2CWTA 3IPTA 2CHCA 4J8TA 3FZWA 2C10A 3HK4A 4U13A 1IVUA 2BNGA 1IU7A 1GY6A 3BNDA 2W2CA 2OQEA 1K41A 4K1UA 3CXC2 3NV0B 2QGUA 3GAXA 1TP6A 2CH9A 2W9QA 3MG1A 2Z77A 3KSED 3BNBA 3LMLA 1SQWA 2E2VA 1W00A 4HM2B 1GY5A 4XBYA 3WA3A 3PZWA 1AV4A 3BNEA 2D1WA 3NBRA 2E2TA 3UB1A 3DUKA 4LZIA 3RDEA 4EYCA 1IVXA 3LTDA 4N6V0 1YGEA 3UL5A 3CNMA 1WTHA 1Q40B 1DMMA 2BT3A 1RRLA 1STDA 2JQ5A 1A90A 2W6JH 3G8ZA 5JBSA 3FKAA 2JDIH 1GD3A 3D3LA 5IF6A 1OF5A 1EQKA 3GZYB 5EQLA 5BVBA 1F8NA 1M1XB 3NV0A 3T8NA 1YJN3 2QEX3 3CCR3 4HM1B 1M1K4 5CF1A 2KRTA 5G2GA 1N9JA 2KCDA 2INXA 1RKYA 2R4IA 2ZDJA 3KKGA 1FGOA 3F9SA 1KC84 2ML5A 1WQLB 3S27A 1T5YA 4LEHA 4H3UA 4HZBB 1CEWI 1DMNA 1JB2A 3B4OA 3DMCA 1UUVB 3NBJA 1D6UA 2IMJA 3Q90A 1NO3A 3BB9A 1CYUA 3OX9A 4WYKA 4EXRA 5KP1A 2WO0A 3X42A 4OVMA 3LTAA 1W5ZA 1UI7A 4L8OA 1R4CA 1VQM3 3NQZA 4K1VA 2BMRB 1ASKA 4R80A 3S28A 1JJ22 3G6E3 1W2B2 1O7PB 5DRVA 4HKVB 3CME3 1ULJB 4RNYA 1Y4KA 2CK3H 1KWIA 4N6TA 1DMQA 4LSOA 1OPYA 1IVWA 1Q42A 3CCL3 3EF8A 5LC6A 3SX1A 5KP4A 1Q7Y4 2O3OA 1VQK3 2GEYA 3PCRA 4EV2A 2XFSA 3CD63 2GEXA 5AI1A 5I97A 3ECFA 1TU5A 3KN4A 4H61A 3N54B 1NU3A 4XDVA 1WMPA 1ULIB 2FXTA 4HM6B 3RGRA 3ALAA 3I0YA 2CW9A 2QA43 3K0ZA 1DVDA 3F8XA 2CFLA 2PNCA 4I4KA 1TFOA 3GZBA 1UW1A 2BHMA 3JUQA 5EEOA 3V99A 3PYJA 1W6GA 1JKGA 3LZAA 4MMXB 1ROVA 3A76A 4HJLB 1VQ83 3IJEB 5AYSC 1BUQA 2CG0A 4RBNA 4R9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T8U A;  1W02 A;  1U5O A;  3S5C A;  1IDP A;  5AEW B;  2YFJ B;  3JUM A;  5CLK A;  3EBY A;  1JN5 A;  4WWU C;  3MG2 A;  4CDL A;  1GS3 A;  5CF2 A;  4HM7 B;  1OF5 B;  3F8H A;  1GY7 A;  1OGZ A;  3UNL A;  5FW5 A;  3DXO A;  4GB5 A;  3CU3 A;  1E3R A;  2RGQ A;  4L8P A;  2A15 A;  2BMQ B;  2UX0 A;  1E97 A;  1O7N B;  4HM3 B;  4ORL A;  2K54 A;  4STD A;  5D82 A;  4WYK B;  3B7C A;  3NHX A;  1A2K A;  3ROB A;  5HGR A;  4N3V A;  3EBT A;  3MG3 A;  3CPO A;  3E99 A;  1O7M B;  2YFI B;  2B1X B;  2CKF B;  5IEN A;  1UUW B;  2Z7A A;  3GZR A;  4LMI A;  1NDO B;  3BLZ A;  3FH1 A;  6STD A;  1O7H B;  2HMJ B;  5TGN A;  3EHC A;  3MSO A;  8CHO A;  5IG3 A;  5D83 A;  3JUO A;  1O7G B;  1JKG B;  3VSY A;  3LYG A;  4L7K A;  5IG0 A;  3OWU A;  4OUQ A;  3FLJ A;  1HKX A;  1TUH A;  3NXJ A;  1GYB A;  5IG5 A;  5STD A;  3HZP A;  3H51 A;  2HMK B;  2HML B;  1VZZ A;  2HMM B;  1JB4 A;  1JN5 B;  3CNX A;  2GXF A;  4HM5 B;  3K7C A;  3EX9 A;  3F14 A;  1ZO2 A;  3GWR A;  2STD A;  4HZ9 B;  2YFL B;  4HM8 B;  5CK6 A;  3UJM A;  3NM2 A;  3HX8 A;  3SOA A;  1C7H A;  4X2H A;  3OWY A;  5AEU B;  3VGN A;  1NWW A;  3WMD A;  3GZX B;  2XRX B;  4HM4 B;  3G16 A;  3F7S A;  1OCV A;  4R9K A;  5AIH A;  5IG4 A;  5JPP A;  4RZM A;  5DRE A;  4XDW A;  3EN1 B;  3NUV A;  3OWS A;  2QIY A;  3B4P A;  1OGX A;  2F86 B;  4PEJ A;  3JUP A;  3F40 A;  1ZX2 A;  2HMO B;  3OXA A;  5BXQ A;  1W01 A;  3G0K A;  4LGQ A;  3FGY A;  3DZL A;  3MKI A;  2F99 A;  2B24 B;  4FCJ A;  4R1K A;  5CXO A;  3OV4 A;  4J9A A;  4Q53 A;  2HMN B;  3D9R A;  1OH0 A;  2RFR A;  2F98 A;  5AII A;  1QMA A;  7STD A;  2I9W A;  5KP3 A;  3FF2 A;  4HM0 B;  5IEP A;  3M8C A;  4X2O A;  5JPU A;  1OHP A;  3SOY A;  2Z76 A;  1E3V A;  3KZT A;  1O7W B;  3H3H A;  3FSD A;  1OHS A;  5AIG A;  2BMO B;  1Z1S A;  5IEO A;  4IIA A;  1Q40 A;  2GBX B;  3STD A;  1ISK A;  2XSH B;  1AR0 A;  2GBW B;  3F7X A;  2OWP A;  1OUN A;  4MJD A;  3EC9 A;  2XR8 B;  3ER7 A;  2PZV A;  3MHE A;  3RGA A;  2RCD A;  1OHO A;  4XM4 A;  5EVH A;  3SED A;  1CQS A;  3KSP A;  4XBT A;  4FCM A;  1JB5 A;  3MYT A;  3KE7 A;  3JUN A;  5IER A;  3GRD A;  4HVN A;  3EN8 A;  4WP5 A;  3B8L A;  4KVH A;  3FF0 A;  1S5A A;  3DM8 A;  5AIF A;  5D81 A;  3EQQ B;  1W6Y A;  4XBX A;  1SJW A;  3EJV A;  1EG9 B;  2XSO B;  1EA2 A;  1QJG A;  4XB5 A;  3IPT A;  2CHC A;  4J8T A;  3FZW A;  4U13 A;  3HK4 A;  2BNG A;  1GY6 A;  2W2C A;  1K41 A;  4K1U A;  3NV0 B;  2QGU A;  1TP6 A;  3MG1 A;  2Z77 A;  1W00 A;  4HM2 B;  1GY5 A;  4XBY A;  3NBR A;  3DUK A;  3CNM A;  1Q40 B;  1DMM A;  1STD A;  2JQ5 A;  3G8Z A;  3FKA A;  5IF6 A;  1OF5 A;  3GZY B;  5BVB A;  3NV0 A;  3T8N A;  4HM1 B;  5CF1 A;  5G2G A;  2INX A;  2R4I A;  3KKG A;  3F9S A;  1WQL B;  4LEH A;  4H3U A;  4HZB B;  3B4O A;  1DMN A;  1JB2 A;  3DMC A;  1UUV B;  2IMJ A;  3Q90 A;  3BB9 A;  3OX9 A;  4WYK A;  5KP1 A;  4OVM A;  4L8O A;  4K1V A;  2BMR B;  1ASK A;  1O7P B;  5DRV A;  4HKV B;  1ULJ B;  1DMQ A;  1OPY A;  1Q42 A;  3EF8 A;  5KP4 A;  2GEY A;  2GEX A;  5AI1 A;  3ECF A;  1NU3 A;  4XDV A;  1ULI B;  4HM6 B;  3RGR A;  3I0Y A;  3K0Z A;  3F8X A;  4I4K A;  3GZB A;  3JUQ A;  1JKG A;  3LZA A;  4HJL B;  3A76 A;  1BUQ A;  4R9L A; 
#chains in the Genus database with same CATH topology
 2XGN A;  3T8U A;  1OAC A;  4N6U A;  1QVG 2;  1B27 A;  4CPK A;  1W02 A;  3TDG A;  1U5O A;  3S5C A;  1IDP A;  2HOH A;  2OOV C;  3N9H A;  3DY5 A;  2ML6 A;  1M90 4;  1FUW A;  5AEW B;  2IUJ A;  1I70 A;  2Y73 A;  1MGR A;  2YFJ B;  3JUM A;  1D6Y A;  1US1 A;  3SLU A;  5CLK A;  3EBY A;  1JN5 A;  4WWU C;  3MG2 A;  3CCV 3;  3S67 A;  4CDL A;  1GS3 A;  5CF2 A;  1VQ7 3;  2ZL8 A;  1CYV A;  1STF I;  4HM7 B;  4AEQ A;  1OF5 B;  2Z6B A;  3F8H A;  1DYU A;  1GY7 A;  3DGY A;  8RNT A;  2MC8 A;  1BNS A;  1OGZ A;  3GSP A;  4N6N B;  3UNL A;  1BNF A;  4FMD A;  5FW5 A;  1GOU A;  3X3Z A;  1PU4 A;  3D4A A;  1AQZ A;  2XEP A;  4TX4 A;  1DET A;  1K8A 4;  1MNL A;  4JF8 A;  3DXO A;  1I2F A;  1FYS A;  1JRQ A;  1LNI A;  1LXE A;  1PFP A;  1E3R A;  2CFD A;  1IQY A;  2F4Y A;  2P05 A;  2RGQ A;  3CU3 A;  1QVF 2;  1BNR A;  3UL6 A;  1KSI A;  1I2G A;  4L8P A;  2A15 A;  2BMQ B;  2FGT A;  3D79 A;  7GSP A;  1IK3 A;  2UX0 A;  1FUS A;  1RN7 A;  3CCS 3;  1E97 A;  4WFO A;  1NNV A;  1RN1 A;  1O7N B;  1RNT A;  1D6Z A;  2K54 A;  4HM3 B;  1W4N A;  4ORL A;  4STD A;  2ZA4 A;  5D82 A;  1NJI 4;  2L4V A;  2E2U A;  1T2I A;  4HBR A;  1U8C B;  2V1L A;  3AHS A;  4WYK B;  5GSP A;  5RNT A;  1VQ9 3;  5FGO A;  3O8Y A;  1VQ4 3;  3X3X A;  1Q86 4;  3B7C A;  1VQN 3;  6GSP A;  1Q7H A;  1VQO 3;  3NHX A;  2Y74 A;  3LH4 A;  1AVK A;  1A2K A;  1FGM A;  3BNC A;  1N5H A;  1B2X A;  3ROB A;  3MWZ A;  2BO9 B;  5HGR A;  4GHO A;  4KZ1 A;  4N3V A;  1JZO A;  3DGO A;  3EBT A;  3MG3 A;  1TIJ A;  1LOW A;  3CPO A;  3E99 A;  4LYL B;  1O7M B;  2RBI A;  2MF7 A;  2YFI B;  1IQX A;  3G4S 3;  2B1X B;  1LNH A;  2CKF B;  5IEN A;  3SXX A;  1KQS 2;  5BU4 A;  1UUW B;  2Z7A A;  3GZR A;  5A0O B;  4LMI A;  1BRJ A;  1NDO B;  3BLZ A;  3WOF B;  3J7Y d;  1RGC A;  1TRQ A;  2KF4 A;  4EW5 A;  1LOX A;  5HOH A;  3CCM 3;  1S72 3;  1J2B A;  1DE3 A;  3HI7 A;  1RGL A;  1VQL 3;  4BTX A;  1UCL A;  1JNQ A;  1ZS7 A;  3VF1 A;  7RNT A;  1TTO A;  1RNB A;  4N6L A;  2OTJ 3;  1G96 A;  2CWV A;  3U97 A;  3CCQ 3;  1V74 A;  3FH1 A;  6STD A;  1O7H B;  1RGA A;  2HMJ B;  2LYX A;  4FMA A;  2WOH A;  5TGN A;  3EHC A;  3MSO A;  8CHO A;  5IG3 A;  3FG1 A;  2K0M A;  1W7C A;  5D83 A;  1BVI A;  1UCI A;  1X1X A;  3JUO A;  3S29 A;  1BNG A;  1GMQ A;  5ELJ A;  1QAL A;  4G1M B;  1K28 A;  1O7G B;  1LOY A;  1FA3 A;  1JKG B;  3KII A;  3VSY A;  3LYG A;  4L7K A;  4CJN A;  2KF6 A;  5IG0 A;  1SAR A;  3NM7 A;  3OWU A;  4OUQ A;  1RGG A;  3FLJ A;  2IUK A;  1TUH A;  1HKX A;  4EV5 A;  1JBR A;  3PS8 A;  1FW7 A;  3NXJ A;  1GYB A;  1IT8 A;  1Q81 4;  3EB8 A;  1GSP A;  3LTB A;  1MWU A;  5STD A;  5IG5 A;  4JRF A;  3HZP A;  3ZG5 A;  3H51 A;  1Q82 4;  1LQG C;  2HMK B;  2HML B;  1VZZ A;  2HMM B;  3KCH A;  3WDG B;  1BSB A;  1JB4 A;  1RGK A;  4BTW A;  3CMA 3;  1JN5 B;  1RLS A;  1PY3 A;  3CNX A;  3D5G A;  3WHO A;  1JV2 B;  2GXF A;  1MOL A;  4HM5 B;  3K7C A;  4DKI A;  3EX9 A;  3F14 A;  1FGT A;  1RJO A;  4RNZ A;  1B2M A;  1IV9 A;  1ZO2 A;  2F5M A;  3GWR A;  5M1A A;  2STD A;  3Q3F A;  1YVB I;  1FZU A;  3HIG A;  2OQE C;  2YFL B;  4HZ9 B;  4HM8 B;  5CK6 A;  3UJM A;  3V92 A;  1BSE A;  3NM2 A;  1GOY A;  3K63 A;  3CCU 3;  2CWU A;  3HX8 A;  3SOA A;  2LQV A;  1MWR A;  2C11 A;  1NB3 I;  2WGO A;  1C7H A;  3DGL A;  4X2H A;  4BU4 A;  3OWY A;  5AEU B;  3T0U A;  3K9M C;  3VGN A;  1KD1 4;  1NWW A;  1NB5 I;  3I55 3;  2XGL A;  3V98 A;  3BIR A;  4N6O B;  3A5E A;  2WOF A;  1YJ9 3;  4FCZ A;  1IVV A;  3GZX B;  3WMD A;  2XRX B;  4HM4 B;  3G16 A;  1TJD A;  3F7S A;  1OCV A;  4N6M A;  2SBL A;  1I3F A;  4R9K A;  2O9U X;  2Q07 A;  4RBN A;  1RCK A;  1EKM A;  1HYF A;  5AIH A;  5IG4 A;  1FGQ A;  5JPP A;  4RZM A;  2KF3 A;  4BIR A;  2P0M A;  3AMO A;  5DRE A;  1LRA A;  2M7O A;  4IT7 A;  4XDW A;  3NBB A;  3EN1 B;  2CFK A;  3NUV A;  2CIU A;  3OWS A;  1L5G B;  9RNT A;  2QIY A;  3K5T A;  1N9E A;  3B4P A;  1BRI A;  1IYY A;  5BIR A;  1RGF A;  1LVN A;  2W03 A;  2OTL 3;  4O02 B;  2H0I A;  2XH9 A;  3URP A;  1OGX A;  2KF5 A;  1IT7 A;  1RDS A;  3Q2P A;  1MWS A;  2F86 B;  4PEJ A;  3OW2 2;  3JUP A;  1B20 A;  1YIT 3;  3NQY A;  3F40 A;  4MMY B;  1ZX2 A;  3BU4 A;  2HMO B;  3N8B A;  3OXA A;  3CC2 3;  2J8X B;  1X1Y A;  3LT8 A;  5BXQ A;  1DVC A;  1W01 A;  2CC3 A;  1UI8 A;  3G0K A;  4LGQ A;  2IA7 A;  3FGY A;  1YI2 3;  4O8S A;  3CCE 3;  3DZL A;  2P0X A;  2W56 A;  2F56 A;  4J5G A;  3MKI A;  2F99 A;  4EBG A;  2B24 B;  5M18 A;  1BNJ A;  1WMN A;  3FG3 A;  4FCJ A;  3AGO A;  2OOV A;  4CCV A;  3WR2 A;  4R1K A;  5CXO A;  3OV4 A;  1BRH A;  1K9M 4;  1IV7 A;  2GU3 A;  4J9A A;  4Q53 A;  3FCS B;  4R4K A;  3CC4 3;  2HMN B;  3D9R A;  3X3Y A;  3NX0 A;  1OH0 A;  1PYL A;  2RFR A;  3DGN A;  3EE1 A;  2F98 A;  3PGB A;  5AII A;  1QMA A;  1G0T A;  7STD A;  2I9W A;  4O3V A;  1W2Z A;  2YX9 A;  3JVC A;  4FMB A;  4MMZ B;  5KP3 A;  3CC7 3;  1BRN L;  4NRE A;  3FF2 A;  1B21 A;  1N5P A;  4HM0 B;  1N8Q A;  4HYZ A;  4KFD A;  1R4Y A;  5IEP A;  4KFE A;  1A2V A;  3DGM A;  1VQ6 3;  2GSP A;  3M8C A;  1EEJ A;  1MGW A;  2D42 A;  3IMA B;  4KFF A;  3WOD G;  3PXM A;  4X2O A;  5JPU A;  3LTC A;  1AVL A;  2CG1 A;  4FR9 A;  1G02 A;  4AKY A;  1SPU A;  1RTU A;  2P38 A;  1OHP A;  3KFQ C;  4OK0 A;  2Z76 A;  3SOY A;  2GU1 A;  3LOY A;  4EC6 A;  1JBT A;  2CFG A;  1E3V A;  3KZT A;  3HII A;  2FNQ A;  4RNT A;  1I2E A;  1O7W B;  1WNH A;  1BNI A;  3H3H A;  3FSD A;  1RCL A;  1WMO A;  3X40 A;  1OHS A;  4J5K A;  1VQP 3;  5AIG A;  2BMO B;  1Z1S A;  3L0R A;  4IIA A;  5IEO A;  4ZM8 A;  1Q40 A;  3PCS A;  2WGQ A;  4NHF A;  2GBX B;  1A67 A;  1ROA A;  1YHQ 3;  1YJW 3;  5G1L A;  4BTY A;  3STD A;  1ISK A;  1IQ8 A;  1HZ1 A;  2XSH B;  1AR0 A;  2GBW B;  3F7X A;  1B2S A;  4K90 B;  1JZD A;  1HU9 A;  4WHA A;  2OWP A;  1SII A;  1OUN A;  2XF3 A;  5LC7 A;  3LXU X;  2H0H A;  4MJD A;  3EC9 A;  1I0V A;  2W04 A;  2XR8 B;  1FGR A;  3ER7 A;  2PZV A;  3MHE A;  1W6C A;  1AY7 A;  3QRD A;  3RGA A;  3FG4 A;  1RSN A;  3I56 3;  1BSA A;  1BUJ A;  2RCD A;  4GL6 A;  1OHO A;  3LT9 A;  4XM4 A;  2W9P A;  5EVH A;  1BRS A;  2C4B A;  2RSX A;  5AYR B;  3SED A;  3WOE B;  1X1U A;  2W0Q A;  3AMO B;  4K61 A;  1CQS A;  1BAN A;  1VQ5 3;  3Q1C A;  3KSP A;  4XBT A;  4FCM A;  1JB5 A;  1M9G A;  2CFW A;  3MYT A;  4O2H A;  1K73 4;  5ELU A;  1N8R 4;  3KE7 A;  3JUN A;  1GD4 A;  5IW9 A;  1BU4 A;  3HOH A;  5IER A;  1RRH A;  3G71 3;  3X41 A;  3GRD A;  1TRP A;  1BNE A;  1TFK A;  1UUG B;  4HVN A;  3U1W A;  3CCJ 3;  3EN8 A;  4WP5 A;  3B8L A;  3WA2 X;  2IYJ A;  2OCT A;  4KVH A;  1BGS A;  1YVS A;  3CPW 2;  3FF0 A;  4NPB A;  1YNV X;  1S5A A;  2CX0 A;  1YIJ 3;  3DM8 A;  1BSC A;  2W56 B;  2KXG A;  5AIF A;  4AKZ A;  1BAO A;  3SVA A;  1QAF A;  3QK9 A;  5D81 A;  5G1K A;  1X1W A;  1QAK A;  3EQQ B;  1JBS A;  1UCK A;  2P09 A;  1T3B A;  4MEI A;  1W6Y A;  1BSD A;  4XBX A;  1SJW A;  3EJV A;  4HAA A;  1SIH A;  3MPH A;  2XFT A;  1BIR A;  4QWT A;  1V57 A;  1EG9 B;  2XSO B;  4FMC A;  2R41 A;  4IPB A;  1ZGX A;  1EA2 A;  1QJG A;  6RNT A;  4XB5 A;  2CWT A;  3IPT A;  1BRK A;  2BU4 A;  2CHC A;  2UUG C;  4J8T A;  3FZW A;  2C10 A;  3HK4 A;  4U13 A;  1IVU A;  2BNG A;  1IU7 A;  1GY6 A;  4GSP A;  3BND A;  2W2C A;  2OQE A;  1RHL A;  1K41 A;  4K1U A;  3CXC 2;  3NV0 B;  2QGU A;  3GAX A;  1VQQ A;  1TP6 A;  2CH9 A;  2W9Q A;  3MG1 A;  2Z77 A;  3KSE D;  3BNB A;  3LML A;  1BRG A;  1SQW A;  2E2V A;  1GOV A;  1B2Z A;  1I0X A;  2ZHX B;  1W00 A;  4HM2 B;  1C54 A;  1GY5 A;  4XBY A;  3WA3 A;  1LQM B;  1YGW A;  3PZW A;  1AV4 A;  3BNE A;  2D1W A;  3NBR A;  2E2T A;  3UB1 A;  3DUK A;  4LZI A;  2IY2 A;  3RDE A;  4EYC A;  1IVX A;  3LTD A;  4N6V 0;  1YGE A;  3UL5 A;  3CNM A;  1RGE A;  1WTH A;  1EUI C;  1DMM A;  1MWT A;  1Q40 B;  2BT3 A;  1RRL A;  1STD A;  2JQ5 A;  2KAA A;  1A90 A;  2W6J H;  3G8Z A;  5JBS A;  4BL3 A;  3FKA A;  2JDI H;  1GD3 A;  3D3L A;  5IF6 A;  1OF5 A;  1Q9E A;  3GZY B;  1UCJ A;  5EQL A;  3ZG0 A;  1EQK A;  1LOV A;  5BVB A;  1F8N A;  1M1X B;  3NV0 A;  3T8N A;  3D5I A;  2L1S A;  2QEX 3;  3CCR 3;  4HM1 B;  1YJN 3;  3AHW A;  5CF1 A;  1M1K 4;  2KRT A;  5G2G A;  1N9J A;  2KCD A;  2INX A;  1RKY A;  2R4I A;  2ZDJ A;  2K3D A;  3KKG A;  4ILF A;  1FGO A;  3F9S A;  1BOX A;  1KC8 4;  1I3I A;  1A2P A;  1T2H A;  2ML5 A;  1WQL B;  1UDI I;  2AAE A;  1T5Y A;  2RNT A;  4LEH A;  3S27 A;  3AGN A;  4H3U A;  4HZB B;  1CEW I;  1DMN A;  1JB2 A;  3B4O A;  3DMC A;  1UUV B;  2H0G A;  3SYU A;  3NBJ A;  1CH0 A;  1D6U A;  2IMJ A;  3Q90 A;  1B3S A;  1NO3 A;  4GB5 A;  3BB9 A;  1CYU A;  3DH2 A;  2UGI A;  3OX9 A;  4WYK A;  4EXR A;  5KP1 A;  2WO0 A;  4HOH A;  3X42 A;  4OVM A;  3LTA A;  1W5Z A;  1GMR A;  1UI7 A;  4L8O A;  1R4C A;  1VQM 3;  3NQZ A;  4K1V A;  2BMR B;  1B2U A;  1FUT A;  1ASK A;  1UGH I;  4R80 A;  3S28 A;  1JJ2 2;  3G6E 3;  1W2B 2;  3RNT A;  1O7P B;  5DRV A;  1V58 A;  4HKV B;  1ULJ B;  3CME 3;  2SAR A;  1Y4K A;  2CK3 H;  4RNY A;  1KWI A;  1RMS A;  4N6T A;  4BL2 A;  1DMQ A;  4LSO A;  1OPY A;  1IVW A;  1Q42 A;  3CCL 3;  2F5W A;  3EF8 A;  5LC6 A;  3SX1 A;  5KP4 A;  1Q7Y 4;  2O3O A;  1VQK 3;  2CX1 A;  2GEY A;  3PCR A;  4EV2 A;  2XFS A;  2BIR A;  3CD6 3;  2GEX A;  5AI1 A;  5I97 A;  2AAD A;  3ECF A;  1TU5 A;  3KN4 A;  1RN4 A;  1I8V A;  4H61 A;  3N54 B;  1NU3 A;  4XDV A;  1WMP A;  1ULI B;  2FXT A;  1UGI A;  4HM6 B;  3RGR A;  3ALA A;  3I0Y A;  2CW9 A;  4KT3 B;  2QA4 3;  1GMP A;  3K0Z A;  1DVD A;  3F8X A;  2CFL A;  2PNC A;  4I4K A;  1TFO A;  3GZB A;  1UW1 A;  2BHM A;  3JUQ A;  5EEO A;  3V99 A;  3PYJ A;  1W6G A;  1JKG A;  3LZA A;  4MMX B;  1ROV A;  3A76 A;  4HJL B;  5M19 A;  1VQ8 3;  3IJE B;  5AYS C;  1BUQ A;  4I5Q A;  3ZFZ A;  2CG0 A;  1RGH A;  4R9L A; 
#chains in the Genus database with same CATH homology
 2XGN A;  3T8U A;  1OAC A;  4N6U A;  1QVG 2;  1W02 A;  3TDG A;  1U5O A;  3S5C A;  1IDP A;  2OOV C;  3N9H A;  3DY5 A;  2ML6 A;  1M90 4;  1FUW A;  5AEW B;  2IUJ A;  2Y73 A;  2YFJ B;  3JUM A;  1D6Y A;  1US1 A;  3SLU A;  5CLK A;  3EBY A;  1JN5 A;  4WWU C;  3MG2 A;  3CCV 3;  3S67 A;  4CDL A;  1GS3 A;  5CF2 A;  1VQ7 3;  2ZL8 A;  1CYV A;  1STF I;  4HM7 B;  4AEQ A;  1OF5 B;  2Z6B A;  3F8H A;  1DYU A;  1GY7 A;  2MC8 A;  1OGZ A;  3UNL A;  4N6N B;  4FMD A;  5FW5 A;  3X3Z A;  1PU4 A;  2XEP A;  4TX4 A;  1K8A 4;  1MNL A;  4JF8 A;  3DXO A;  3V98 A;  1JRQ A;  1LXE A;  2CFD A;  1PFP A;  3CU3 A;  1E3R A;  2P05 A;  1IQY A;  4GB5 A;  2RGQ A;  1QVF 2;  3UL6 A;  1KSI A;  4L8P A;  2A15 A;  2BMQ B;  2FGT A;  1IK3 A;  2UX0 A;  1RN7 A;  3CCS 3;  1E97 A;  4WFO A;  1O7N B;  4HM3 B;  1D6Z A;  2K54 A;  4ORL A;  1W4N A;  4STD A;  5D82 A;  1NJI 4;  2L4V A;  2E2U A;  4HBR A;  1U8C B;  2V1L A;  4WYK B;  1VQ9 3;  5FGO A;  3O8Y A;  1VQ4 3;  3X3X A;  1Q86 4;  3B7C A;  1VQN 3;  1VQO 3;  3NHX A;  2Y74 A;  3LH4 A;  1AVK A;  1A2K A;  1FGM A;  3BNC A;  1N5H A;  3ROB A;  3MWZ A;  2BO9 B;  5HGR A;  4KZ1 A;  4N3V A;  3DGO A;  3EBT A;  3MG3 A;  1TIJ A;  3CPO A;  3E99 A;  1O7M B;  2YFI B;  2MF7 A;  1IQX A;  3G4S 3;  2B1X B;  1LNH A;  2CKF B;  5IEN A;  3SXX A;  1KQS 2;  1UUW B;  2Z7A A;  3GZR A;  5A0O B;  4LMI A;  1NDO B;  3BLZ A;  3WOF B;  3J7Y d;  1J2B A;  1LOX A;  3CCM 3;  1S72 3;  3HI7 A;  1VQL 3;  4BTX A;  1JNQ A;  3VF1 A;  4N6L A;  2OTJ 3;  1G96 A;  2CWV A;  3U97 A;  3CCQ 3;  1V74 A;  3FH1 A;  6STD A;  1O7H B;  2HMJ B;  2LYX A;  4FMA A;  2WOH A;  5TGN A;  3EHC A;  3MSO A;  8CHO A;  5IG3 A;  3FG1 A;  2K0M A;  1W7C A;  5D83 A;  3JUO A;  3S29 A;  5ELJ A;  1QAL A;  4G1M B;  1K28 A;  1O7G B;  1FA3 A;  1JKG B;  3KII A;  3VSY A;  3LYG A;  4L7K A;  5IG0 A;  3NM7 A;  3OWU A;  4OUQ A;  3FLJ A;  2IUK A;  1TUH A;  1HKX A;  4EV5 A;  3PS8 A;  3NXJ A;  1GYB A;  1IT8 A;  1Q81 4;  3EB8 A;  3LTB A;  5IG5 A;  5STD A;  4JRF A;  3HZP A;  1Q82 4;  3H51 A;  2HMK B;  2HML B;  1VZZ A;  2HMM B;  3WDG B;  1JB4 A;  4BTW A;  3CMA 3;  1JN5 B;  3CNX A;  1JV2 B;  2GXF A;  1MOL A;  4HM5 B;  3K7C A;  3EX9 A;  3F14 A;  1FGT A;  1RJO A;  4RNZ A;  1IV9 A;  1ZO2 A;  3GWR A;  2STD A;  1YVB I;  3HIG A;  4HZ9 B;  2OQE C;  2YFL B;  4HM8 B;  5CK6 A;  3UJM A;  3V92 A;  3NM2 A;  3K63 A;  3CCU 3;  2CWU A;  3HX8 A;  3SOA A;  2LQV A;  2C11 A;  1NB3 I;  2WGO A;  1C7H A;  3DGL A;  4X2H A;  3OWY A;  5AEU B;  3T0U A;  3K9M C;  3VGN A;  1KD1 4;  1NWW A;  1NB5 I;  3I55 3;  2XGL A;  4N6O B;  2WOF A;  1YJ9 3;  4FCZ A;  1IVV A;  3GZX B;  3WMD A;  2XRX B;  4HM4 B;  3G16 A;  3F7S A;  1OCV A;  4N6M A;  2SBL A;  4R9K A;  2O9U X;  2Q07 A;  1EKM A;  5AIH A;  5IG4 A;  1FGQ A;  5JPP A;  4RZM A;  2P0M A;  3AMO A;  5DRE A;  2M7O A;  4IT7 A;  4XDW A;  3NBB A;  3EN1 B;  2CFK A;  3NUV A;  2CIU A;  3OWS A;  1L5G B;  2QIY A;  3K5T A;  1N9E A;  3B4P A;  2W03 A;  1LVN A;  2OTL 3;  4O02 B;  2XH9 A;  1OGX A;  1IT7 A;  3Q2P A;  2F86 B;  4PEJ A;  3OW2 2;  3JUP A;  1YIT 3;  3NQY A;  3F40 A;  4MMY B;  1ZX2 A;  2HMO B;  3N8B A;  3OXA A;  3CC2 3;  3LT8 A;  5BXQ A;  1DVC A;  1W01 A;  2CC3 A;  1UI8 A;  3G0K A;  4LGQ A;  2IA7 A;  3FGY A;  1YI2 3;  4O8S A;  3CCE 3;  3DZL A;  2P0X A;  2W56 A;  3MKI A;  2F99 A;  4EBG A;  2B24 B;  1WMN A;  3FG3 A;  4FCJ A;  2OOV A;  4CCV A;  4R1K A;  5CXO A;  3OV4 A;  1K9M 4;  1IV7 A;  2GU3 A;  4J9A A;  4Q53 A;  3FCS B;  4R4K A;  3CC4 3;  2HMN B;  3D9R A;  3X3Y A;  3NX0 A;  1OH0 A;  2RFR A;  3DGN A;  3EE1 A;  2F98 A;  3PGB A;  5AII A;  1QMA A;  7STD A;  2I9W A;  4O3V A;  1W2Z A;  2YX9 A;  3JVC A;  4FMB A;  4MMZ B;  5KP3 A;  3CC7 3;  4NRE A;  3FF2 A;  4HYZ A;  1N5P A;  4HM0 B;  1N8Q A;  4KFD A;  5IEP A;  4KFE A;  1A2V A;  3DGM A;  1VQ6 3;  3M8C A;  2D42 A;  4KFF A;  3IMA B;  3WOD G;  3PXM A;  4X2O A;  5JPU A;  3LTC A;  1AVL A;  2CG1 A;  4FR9 A;  4AKY A;  1SPU A;  2P38 A;  1OHP A;  3KFQ C;  4OK0 A;  2Z76 A;  3SOY A;  2GU1 A;  3LOY A;  4EC6 A;  2CFG A;  1E3V A;  3KZT A;  3HII A;  2FNQ A;  1O7W B;  1WNH A;  3H3H A;  3FSD A;  1WMO A;  3X40 A;  1OHS A;  1VQP 3;  5AIG A;  2BMO B;  1Z1S A;  3L0R A;  4IIA A;  5IEO A;  4ZM8 A;  1Q40 A;  3PCS A;  2WGQ A;  4NHF A;  2GBX B;  1A67 A;  1ROA A;  1YHQ 3;  1YJW 3;  4BTY A;  3STD A;  1ISK A;  1IQ8 A;  2XSH B;  1AR0 A;  2GBW B;  3F7X A;  4K90 B;  1HU9 A;  4WHA A;  5LC7 A;  2OWP A;  1SII A;  1OUN A;  2XF3 A;  3LXU X;  4MJD A;  3EC9 A;  2XR8 B;  2W04 A;  1FGR A;  3ER7 A;  2PZV A;  3MHE A;  1W6C A;  3RGA A;  3QRD A;  3FG4 A;  3I56 3;  2RCD A;  4GL6 A;  1OHO A;  3LT9 A;  4XM4 A;  2W9P A;  5EVH A;  3SED A;  2RSX A;  5AYR B;  3WOE B;  3AMO B;  2W0Q A;  4K61 A;  1CQS A;  1VQ5 3;  3Q1C A;  3KSP A;  4XBT A;  4FCM A;  1JB5 A;  1M9G A;  2CFW A;  3MYT A;  4O2H A;  1K73 4;  5ELU A;  1N8R 4;  3KE7 A;  3JUN A;  1GD4 A;  5IW9 A;  5IER A;  1RRH A;  3G71 3;  3X41 A;  3GRD A;  1TFK A;  4HVN A;  3U1W A;  3CCJ 3;  3EN8 A;  4WP5 A;  3B8L A;  3WA2 X;  2OCT A;  4KVH A;  3CPW 2;  3FF0 A;  1S5A A;  1YIJ 3;  3DM8 A;  2W56 B;  2KXG A;  5AIF A;  4AKZ A;  3SVA A;  1QAF A;  3QK9 A;  5D81 A;  1QAK A;  3EQQ B;  2P09 A;  4MEI A;  1W6Y A;  4XBX A;  1SJW A;  3EJV A;  1SIH A;  3MPH A;  2XFT A;  4QWT A;  1EG9 B;  2XSO B;  4FMC A;  4IPB A;  1EA2 A;  1QJG A;  4XB5 A;  2CWT A;  3IPT A;  2CHC A;  4J8T A;  3FZW A;  2C10 A;  3HK4 A;  4U13 A;  1IVU A;  2BNG A;  1IU7 A;  1GY6 A;  3BND A;  2W2C A;  2OQE A;  1K41 A;  4K1U A;  3CXC 2;  3NV0 B;  2QGU A;  3GAX A;  1TP6 A;  2CH9 A;  2W9Q A;  3MG1 A;  2Z77 A;  3KSE D;  3BNB A;  3LML A;  1SQW A;  2E2V A;  1W00 A;  4HM2 B;  1GY5 A;  4XBY A;  3WA3 A;  3PZW A;  1AV4 A;  3BNE A;  2D1W A;  3NBR A;  2E2T A;  3UB1 A;  3DUK A;  4LZI A;  3RDE A;  4EYC A;  1IVX A;  3LTD A;  4N6V 0;  1YGE A;  3UL5 A;  3CNM A;  1WTH A;  1Q40 B;  1DMM A;  2BT3 A;  1RRL A;  1STD A;  2JQ5 A;  1A90 A;  2W6J H;  3G8Z A;  5JBS A;  3FKA A;  2JDI H;  1GD3 A;  3D3L A;  5IF6 A;  1OF5 A;  1EQK A;  3GZY B;  5EQL A;  5BVB A;  1F8N A;  1M1X B;  3NV0 A;  3T8N A;  1YJN 3;  2QEX 3;  3CCR 3;  4HM1 B;  1M1K 4;  5CF1 A;  2KRT A;  5G2G A;  1N9J A;  2KCD A;  2INX A;  1RKY A;  2R4I A;  2ZDJ A;  3KKG A;  1FGO A;  3F9S A;  1KC8 4;  2ML5 A;  1WQL B;  3S27 A;  1T5Y A;  4LEH A;  4H3U A;  4HZB B;  1CEW I;  1DMN A;  1JB2 A;  3B4O A;  3DMC A;  1UUV B;  3NBJ A;  1D6U A;  2IMJ A;  3Q90 A;  1NO3 A;  3BB9 A;  1CYU A;  3OX9 A;  4WYK A;  4EXR A;  5KP1 A;  2WO0 A;  3X42 A;  4OVM A;  3LTA A;  1W5Z A;  1UI7 A;  4L8O A;  1R4C A;  1VQM 3;  3NQZ A;  4K1V A;  2BMR B;  1ASK A;  4R80 A;  3S28 A;  1JJ2 2;  3G6E 3;  1W2B 2;  1O7P B;  5DRV A;  4HKV B;  3CME 3;  1ULJ B;  4RNY A;  1Y4K A;  2CK3 H;  1KWI A;  4N6T A;  1DMQ A;  4LSO A;  1OPY A;  1IVW A;  1Q42 A;  3CCL 3;  3EF8 A;  5LC6 A;  3SX1 A;  5KP4 A;  1Q7Y 4;  2O3O A;  1VQK 3;  2GEY A;  3PCR A;  4EV2 A;  2XFS A;  3CD6 3;  2GEX A;  5AI1 A;  5I97 A;  3ECF A;  1TU5 A;  3KN4 A;  4H61 A;  3N54 B;  1NU3 A;  4XDV A;  1WMP A;  1ULI B;  2FXT A;  4HM6 B;  3RGR A;  3ALA A;  3I0Y A;  2CW9 A;  2QA4 3;  3K0Z A;  1DVD A;  3F8X A;  2CFL A;  2PNC A;  4I4K A;  1TFO A;  3GZB A;  1UW1 A;  2BHM A;  3JUQ A;  5EEO A;  3V99 A;  3PYJ A;  1W6G A;  1JKG A;  3LZA A;  4MMX B;  1ROV A;  3A76 A;  4HJL B;  1VQ8 3;  3IJE B;  5AYS C;  1BUQ A;  2CG0 A;  4RBN A;  4R9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...