1QVG2

Structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit
pubmed doi rcsb
total genus 14
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2003-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1qvg200
1YJ93 3CCS3 1QVF2 1K9M4 1VQK3 3I553 1VQ83 3CC23 1VQ73 2QEX3 1YIT3 3CD63 3CCJ3 3CCL3 3CC43 1K8A4 1S723 1N8R4 1JJ22 3CCM3 2QA43 1VQO3 1VQ43 1YJN3 2OTL3 3CMA3 1VQL3 3CCQ3 1YHQ3 1VQ63 1KC84 1VQ93 1M904 3CCV3 1YI23 1QVG2 1KD14 1NJI4 1VQ53 1YIJ3 1KQS2 3I563 3CC73 1VQN3 1W2B2 2OTJ3 1VQM3 1K734 3CCU3 3G713 1Q864 3CME3 1M1K4 1Q7Y4 3CCR3 3G6E3 3G4S3 3OW22 3CPW2 3CCE3 1Q824 3CXC2 1YJW3 1VQP3 1Q814
chains in the Genus database with same CATH superfamily
1CH0A 1TTOA 1CYUA 3URPA 2W04A 4L7KA 1VQ83 4LZIA 1ISKA 3EJVA 1IYYA 1I0XA 3CCJ3 1MOLA 1CQSA 2BNGA 3STDA 1STDA 2B24B 2W03A 3NQZA 2CFKA 1IV9A 1BRSA 1OGZA 1NDOB 2K54A 1BSDA 3K0ZA 4HM1B 3DZLA 3RGAA 1SARA 5HOHA 3OV4A 3O8YA 3DM8A 7STDA 2L1SA 5EEOA 2F5MA 1DYUA 3SEDA 2GEXA 2STDA 2CWUA 1YGWA 2P05A 1Q40A 2F98A 1PU4A 1N9EA 2GXFA 1WMOA 4WYKA 1AY7A 1NO3A 1O7PB 5KP1A 3FG4A 3UJMA 4HOHA 2JDIH 2RNTA 2F86B 2SBLA 1QAKA 1TRPA 3HOHA 3WOFB 4BU4A 1Q814 2BO9B 1N5PA 2KF5A 3PZWA 3X41A 3MSOA 1RGEA 3G16A 1RN7A 2YFJB 2P0MA 1W2ZA 3B8LA 4DKIA 3K5TA 3F40A 1RDSA 2Q07A 1W6GA 1VQL3 2CFWA 1ZX2A 5M1AA 4FCMA 2H0HA 1RN1A 3OWSA 3Q3FA 5IERA 1R4CA 2BMQB 1DMNA 2F5WA 1EKMA 1I3FA 3GZYB 3I563 5AEWB 5JPPA 5D82A 1JB4A 1LRAA 2OOVC 1BVIA 1X1WA 1W01A 1X1YA 1BRIA 1UUVB 1JZDA 1RCLA 3D4AA 3OW22 3NBRA 4WWUC 1RRHA 4XDVA 7GSPA 1BSAA 1SIHA 3B7CA 4WYKB 4N6TA 3SOYA 5IENA 3LTCA 1RGHA 1KWIA 3X3ZA 3ZG5A 4U13A 1A90A 1ZGXA 3CCL3 1MGRA 3WA3A 4R4KA 1W6CA 3DXOA 1Q9EA 1A67A 3CPOA 3BNCA 3U1WA 2J8XB 1BNIA 3FZWA 3NHXA 1MNLA 3EN8A 1RLSA 1GMRA 3H51A 3RGRA 4CDLA 4WHAA 1I2FA 1BGSA 2HMNB 1B2ZA 1PFPA 3KN4A 1WMPA 4BIRA 4R9LA 1OPYA 3ALAA 1IVXA 1TRQA 2XH9A 4CCVA 2W9PA 3FCSB 1GMPA 4RBNA 1EEJA 3MG2A 1UCKA 3ZG0A 3Q2PA 1US1A 1VQK3 2HOHA 2WGQA 1YIT3 1B21A 2IA7A 1SQWA 5CXOA 2CFLA 5EVHA 1IV7A 1JZOA 3Q1CA 1O7MB 2R41A 1GYBA 1BNSA 2I9WA 2Z7AA 2E2TA 3IMAB 3MWZA 3T0UA 1VZZA 1RGFA 1HYFA 5I97A 3QRDA 1IVVA 5FGOA 1MGWA 5STDA 4N6OB 2WOFA 1EQKA 3FKAA 3WR2A 1RGGA 1RMSA 1TU5A 5KP3A 2Y73A 4FR9A 3SYUA 3N9HA 1UGIA 1QAFA 4LMIA 1EA2A 1GOYA 1OHOA 2GSPA 2Y74A 1VQ73 1SPUA 1GD4A 4OVMA 3NUVA 1YVBI 4X2HA 1AV4A 1NNVA 3X40A 1ZS7A 4BTXA 2QA43 1JJ22 2UUGC 2W2CA 1JN5B 4J5KA 1YHQ3 1K8A4 1V57A 1C7HA 1GD3A 1IQ8A 1M904 2D1WA 4HJLB 1GOUA 1GS3A 2XR8B 3BNDA 3WA2X 4EC6A 1NJI4 1G96A 4MMXB 1B2SA 1DMQA 1NU3A 1PYLA 1ROAA 1W02A 1TFKA 1UCJA 2YX9A 3VSYA 1YJW3 3SLUA 1PY3A 3DH2A 2E2VA 5IG3A 3DGYA 1MWRA 3GAXA 3LTBA 4FCJA 1WNHA 2SARA 3KE7A 5CF1A 2CW9A 2H0IA 1I8VA 3F7SA 2Z76A 2Z77A 3D3LA 3UL6A 3JVCA 3DMCA 2KRTA 3PGBA 3WDGB 3WOEB 5AEUB 3CMA3 3DGNA 1I0VA 3JUQA 4BL2A 1BUJA 1X1UA 3LYGA 4N6NB 1BAOA 1IVWA 1M9GA 3AHWA 3EE1A 3FSDA 5IEPA 5JPUA 3KKGA 2W0QA 2BIRA 3AGNA 1RRLA 3AMOB 2QIYA 4HBRA 1UW1A 3LT9A 4JF8A 1M1K4 1T5YA 3BB9A 5G1KA 3V98A 1TFOA 2H0GA 4IPBA 1BRJA 4QWTA 1MWSA 5ELUA 2CWVA 6GSPA 3IJEB 2W6JH 1BOXA 2CG1A 2XSHB 1AVLA 5BXQA 2A15A 3PYJA 1UGHI 1AVKA 4MMYB 1K9M4 3BLZA 1KSIA 1AR0A 1W4NA 1IQYA 2M7OA 3G0KA 3KFQC 2Z6BA 3EF8A 4AKYA 3KSPA 3SX1A 1I2GA 2LQVA 1W7CA 4EV2A 3CU3A 1VQ63 1GY5A 1RSNA 3EBYA 4NPBA 2CH9A 2UX0A 3MHEA 4ORLA 3DGLA 3LMLA 4KFEA 2XFSA 3F14A 4O3VA 2AADA 4FMCA 2BHMA 4LSOA 2O9UX 3S67A 2OQEA 1JB2A 1Q864 1I3IA 2KAAA 2W56B 1GSPA 1OH0A 9RNTA 4N3VA 3MYTA 1FA3A 3G6E3 4R80A 3CPW2 1BSBA 1Q824 1BRGA 3H3HA 3CXC2 4HZ9B 5D81A 1F8NA 1K41A 1GY7A 1V58A 4GHOA 2XRXB 4K1VA 3TDGA 4EV5A 4O8SA 2QEX3 2BT3A 1UCLA 3Q90A 2CFGA 1D6UA 1HKXA 2WO0A 3L0RA 3ER7A 4N6MA 5TGNA 2XF3A 1Y4KA 2KF6A 3V99A 1B2MA 3B4PA 4GL6A 4JRFA 1N5HA 2ML6A 4K90B 1JV2B 2CHCA 3LTAA 1RGCA 1X1XA 4ZM8A 3OXAA 2O3OA 2F4YA 3J7Yd 1RJOA 4IIAA 5BIRA 1UDII 1K28A 3D5IA 1T2IA 1IT7A 3QK9A 4HKVB 4BTWA 3GZBA 1RHLA 2UGIA 3D5GA 3HZPA 4J5GA 3DGOA 1BRHA 4N6UA 1RTUA 2IUJA 2RGQA 1OHPA 1W5ZA 2PZVA 1JBSA 1QALA 1FUSA 3NV0B 3NBBA 1OHSA 1I2EA 1ULIB 1DETA 1JN5A 1MWTA 1SIIA 1CYVA 1LOXA 2WGOA 3AHSA 3PCRA 4HM0B 5AIHA 4EBGA 3UB1A 3FG3A 6RNTA 2BMOB 1BSCA 2HMKB 3CCV3 4HVNA 3HK4A 4KT3B 1N9JA 1B3SA 3FG1A 4STDA 4X2OA 1OGXA 1IT8A 2GU1A 4RNTA 1BRKA 3CME3 2GU3A 4XBXA 2HMMB 1JKGB 4PEJA 7RNTA 1Q7Y4 1JBTA 3B4OA 3D9RA 2KF3A 2KXGA 1UUWB 4HM7B 1BANA 1VQ53 1RNTA 4RNZA 5M18A 1DE3A 2HMLB 4N6V0 3RDEA 1G02A 3GZXB 3VGNA 5A0OB 2C10A 2MC8A 2C4BA 1JB5A 1LQGC 5CF2A 3N8BA 1M1XB 2MF7A 3HIGA 3HX8A 1B27A 2CG0A 5AIGA 1DVDA 1QMAA 1HU9A 1ZO2A 5KP4A 4KFDA 3FF2A 1O7WB 3AMOA 2KCDA 1LOVA 1FW7A 1FGMA 3KZTA 3CCU3 1E3RA 3K63A 3F9SA 4L8OA 3LZAA 4WFOA 5DREA 3S27A 2CC3A 3LOYA 2IMJA 3EC9A 2LYXA 2CK3H 1LOYA 1NB3I 2RCDA 1YGEA 2ML5A 3UL5A 3EN1B 3V92A 1VQP3 5HGRA 3S29A 1W00A 4HYZA 1LQMB 1UI7A 3HI7A 3NXJA 4FMAA 1UUGB 3T8UA 3X3YA 4TX4A 1VQO3 2YFIB 3LTDA 4LGQA 4OUQA 1STFI 5IW9A 1IK3A 1NB5I 1RGAA 1U8CB 3D79A 1SJWA 1LOWA 2PNCA 3WMDA 3CC73 2GBXB 3FLJA 1W2B2 3JUPA 2W56A 1N8QA 1K734 4J8TA 1LNHA 3MKIA 4O02B 4XM4A 1O7HB 1DVCA 4K61A 1S5AA 3M8CA 1IVUA 3GWRA 4RZMA 5LC6A 3K7CA 3X3XA 3BU4A 1DMMA 1YJ93 4HAAA 5IEOA 1I70A 1WTHA 3ECFA 3IPTA 3PXMA 4CJNA 1FUWA 2FNQA 3OWYA 4R9KA 1RGLA 2XSOB 3BIRA 4IT7A 4MJDA 1RCKA 3GSPA 1WQLB 1L5GB 1UI8A 4MMZB 1YVSA 4FCZA 1QVG2 2XGNA 1QJGA 3JUMA 4WP5A 1B20A 3DY5A 4O2HA 1BNGA 2ZA4A 2FXTA 3F7XA 1BNFA 4L8PA 2OOVA 1O7NB 3G713 1VQM3 3NQYA 3PCSA 5IG4A 1BU4A 1ASKA 2CX1A 1V74A 6STDA 2P0XA 4AEQA 1E3VA 1TIJA 4EW5A 1B2UA 3EX9A 5JBSA 1O7GB 5IF6A 1OF5B 3FH1A 2ZHXB 1WMNA 1LXEA 3NV0A 1TJDA 4GB5A 1VQQA 1GMQA 3I0YA 3HIIA 3SXXA 2OTL3 2XFTA 3MG1A 4HM4B 5RNTA 5CLKA 1BUQA 4EYCA 3S28A 2F56A 2FGTA 2ZL8A 2AAEA 1JRQA 3NBJA 5ELJA 2ZDJA 3OWUA 3ZFZA 5D83A 3EBTA 1FYSA 4H3UA 1HZ1A 4ILFA 2IUKA 1D6YA 3DUKA 3A76A 4CPKA 1VQN3 1JKGA 1YNVX 4HM6B 2GBWB 4Q53A 1FZUA 8CHOA 1EUIC 1JBRA 2B1XB 2OQEC 4AKZA 3GRDA 3LT8A 2GEYA 1Q40B 3DGMA 2F99A 2R4IA 3CCE3 5G1LA 5IG0A 2XEPA 2K3DA 3NM2A 3BNEA 4HM8B 4LYLB 1GOVA 2D42A 3AGOA 3GZRA 2CIUA 3NM7A 5GSPA 3WODG 3I553 1TUHA 1BNEA 2INXA 3CD63 5BVBA 3CNXA 2C11A 4FMBA 1U5OA 3KIIA 1VQ43 1A2PA 5IG5A 3SOAA 5AIIA 1IQXA 3MPHA 4HM2B 1A2VA 2CWTA 1KD14 1ULJB 2IYJA 3EQQB 4BTYA 2OWPA 2L4VA 1KQS2 1E97A 4J9AA 1RGKA 1T2HA 2OTJ3 1B2XA 5AI1A 2K0MA 1OACA 4KVHA 2RBIA 3UNLA 1FGQA 4HM3B 5AYRB 2CKFB 5EQLA 5BU4A 3ROBA 4KFFA 1T3BA 2W9QA 2BU4A 4R1KA 4XBTA 2E2UA 1QVF2 1EG9B 1FUTA 1NWWA 1UCIA 4MEIA 2P09A 4K1UA 4N6LA 3E99A 3SVAA 2HMJB 2CX0A 2CFDA 1AQZA 1LVNA 2BMRB 1S723 1N8R4 1FGOA 1BIRA 3K9MC 4FMDA 1J2BA 5G2GA 1W6YA 3JUOA 3FF0A 1KC84 1R4YA 4XB5A 4HM5B 1YI23 3U97A 1VQ93 3EHCA 3F8XA 4I5QA 3OX9A 1MWUA 2RSXA 3NX0A 4NHFA 5AYSC 4LEHA 3RNTA 1FGRA 1LNIA 1Q42A 2P38A 3MG3A 1RNBA 2V1LA 1GY6A 4KZ1A 1BNJA 4G1MB 3BNBA 1Q7HA 3JUNA 4NREA 3G4S3 1G0TA 1D6ZA 2IY2A 4H61A 3CCS3 1CEWI 4I4KA 3CC23 3KCHA 4EXRA 2KF4A 4BL3A 1OCVA 2JQ5A 5DRVA 1RKYA 3CC43 3PS8A 1FGTA 3CCM3 3CNMA 4XDWA 3S5CA 8RNTA 3LH4A 5LC7A 5M19A 1YJN3 2YFLB 3CCQ3 1IU7A 4OK0A 1BNRA 1OUNA 2QGUA 3FGYA 1C54A 4GSPA 1BSEA 1IDPA 1ROVA 3N54B 4XBYA 3LXUX 1Z1SA 3T8NA 1YIJ3 1BRNL 3A5EA 3F8HA 2XGLA 1RN4A 3G8ZA 2HMOB 3X42A 5AIFA 2RFRA 4HZBB 1A2KA 3EB8A 5FW5A 3CCR3 1TP6A 5CK6A 4RNYA 1OF5A 2OCTA 2WOHA 3VF1A 3KSED 1JNQA 3WHOA
chains in the Genus database with same CATH topology
1CYUA 2W04A 4L7KA 1VQ83 4LZIA 1ISKA 3EJVA 3CCJ3 1MOLA 1CQSA 2BNGA 3STDA 1STDA 2B24B 2W03A 3NQZA 2CFKA 1IV9A 1OGZA 1NDOB 2K54A 4HM1B 3K0ZA 3RGAA 3DZLA 3OV4A 3O8YA 3DM8A 7STDA 5EEOA 3SEDA 1DYUA 2GEXA 2STDA 2CWUA 2P05A 1Q40A 2F98A 1PU4A 1N9EA 2GXFA 1WMOA 4WYKA 1NO3A 5KP1A 1O7PB 3FG4A 3UJMA 2JDIH 3WOFB 2F86B 2SBLA 1QAKA 1Q814 2BO9B 1N5PA 3PZWA 3X41A 3MSOA 3G16A 1RN7A 2YFJB 2P0MA 1W2ZA 3B8LA 3K5TA 3F40A 2Q07A 1W6GA 1VQL3 2CFWA 1ZX2A 4FCMA 3OWSA 5IERA 1R4CA 2BMQB 1DMNA 1EKMA 3GZYB 3I563 5AEWB 5JPPA 5D82A 1JB4A 2OOVC 1W01A 1UUVB 3OW22 3NBRA 4WWUC 1RRHA 4XDVA 1SIHA 3B7CA 4WYKB 4N6TA 3SOYA 5IENA 3LTCA 1KWIA 3X3ZA 4U13A 1A90A 3CCL3 3WA3A 4R4KA 1W6CA 3DXOA 1A67A 3CPOA 3BNCA 3U1WA 3FZWA 3NHXA 1MNLA 3EN8A 3H51A 3RGRA 4CDLA 4WHAA 2HMNB 3KN4A 1PFPA 1WMPA 4R9LA 1OPYA 3ALAA 1IVXA 2XH9A 4CCVA 2W9PA 3FCSB 4RBNA 3MG2A 3Q2PA 1US1A 1VQK3 2WGQA 1YIT3 2IA7A 1SQWA 5CXOA 2CFLA 5EVHA 1IV7A 3Q1CA 1O7MB 1GYBA 2Z7AA 2I9WA 2E2TA 3IMAB 3MWZA 3T0UA 1VZZA 5I97A 3QRDA 1IVVA 5FGOA 5STDA 4N6OB 2WOFA 1EQKA 3FKAA 1TU5A 5KP3A 2Y73A 4FR9A 3N9HA 1QAFA 4LMIA 1EA2A 1OHOA 2Y74A 1VQ73 1SPUA 1GD4A 4OVMA 3NUVA 1YVBI 4X2HA 1AV4A 1JJ22 3X40A 4BTXA 2QA43 2W2CA 1JN5B 1YHQ3 1C7HA 1GD3A 1IQ8A 1M904 2D1WA 4HJLB 1GS3A 2XR8B 3BNDA 3WA2X 4EC6A 1NJI4 1G96A 4MMXB 1DMQA 1NU3A 1ROAA 1W02A 1TFKA 2YX9A 3VSYA 1YJW3 3SLUA 2E2VA 5IG3A 3GAXA 3LTBA 4FCJA 1WNHA 3KE7A 5CF1A 2CW9A 3F7SA 2Z76A 2Z77A 3D3LA 3UL6A 3JVCA 3DMCA 2KRTA 3PGBA 3WDGB 3WOEB 5AEUB 3CMA3 3DGNA 3JUQA 3LYGA 4N6NB 3EE1A 1IVWA 1M9GA 5IEPA 3FSDA 5JPUA 3KKGA 2W0QA 1RRLA 3AMOB 2QIYA 4HBRA 1UW1A 3LT9A 4JF8A 1M1K4 1T5YA 3BB9A 3V98A 1TFOA 4IPBA 5ELUA 4QWTA 2CWVA 3IJEB 2W6JH 2CG1A 2XSHB 1AVLA 5BXQA 2A15A 3PYJA 1AVKA 4MMYB 1K9M4 3BLZA 1KSIA 1AR0A 1W4NA 1IQYA 2M7OA 3G0KA 3KFQC 2Z6BA 3EF8A 4AKYA 3KSPA 3SX1A 2LQVA 1W7CA 4EV2A 3CU3A 1VQ63 1GY5A 3EBYA 2CH9A 2UX0A 3MHEA 4ORLA 3DGLA 3LMLA 4KFEA 2XFSA 3F14A 4O3VA 4FMCA 2BHMA 4LSOA 2O9UX 3S67A 2OQEA 1JB2A 1Q864 2W56B 1OH0A 4N3VA 3MYTA 1FA3A 3G6E3 4R80A 3CPW2 1Q824 3H3HA 3CXC2 4HZ9B 5D81A 1F8NA 1K41A 1GY7A 4K1VA 2XRXB 3TDGA 4EV5A 4O8SA 2QEX3 2BT3A 3Q90A 2CFGA 1D6UA 1HKXA 2WO0A 3L0RA 3ER7A 4N6MA 5TGNA 2XF3A 1Y4KA 3V99A 3B4PA 4GL6A 4JRFA 1N5HA 2ML6A 4K90B 1JV2B 2CHCA 3LTAA 4ZM8A 3OXAA 2O3OA 3J7Yd 1RJOA 4IIAA 1K28A 1IT7A 3QK9A 4HKVB 4BTWA 3GZBA 3HZPA 3DGOA 4N6UA 2IUJA 2RGQA 1OHPA 1W5ZA 2PZVA 1QALA 3NV0B 3NBBA 1OHSA 1ULIB 1SIIA 1JN5A 1K8A4 2WGOA 1CYVA 1LOXA 3PCRA 4HM0B 5AIHA 4EBGA 3UB1A 3FG3A 2BMOB 2HMKB 3CCV3 4HVNA 3HK4A 1N9JA 3FG1A 4STDA 4X2OA 1OGXA 1IT8A 2GU1A 3CME3 2GU3A 4XBXA 2HMMB 1JKGB 4PEJA 1Q7Y4 3B4OA 3D9RA 2KXGA 1UUWB 4HM7B 1VQ53 4RNZA 2HMLB 4N6V0 3RDEA 3GZXB 3VGNA 5A0OB 2C10A 2MC8A 1JB5A 5CF2A 3N8BA 1M1XB 2MF7A 3HIGA 3HX8A 2CG0A 1DVDA 5AIGA 1QMAA 1HU9A 1ZO2A 5KP4A 4KFDA 3FF2A 1O7WB 3AMOA 2KCDA 1FGMA 3KZTA 3CCU3 1E3RA 3K63A 3F9SA 4L8OA 3LZAA 4WFOA 5DREA 3S27A 2CC3A 3LOYA 2IMJA 3EC9A 2LYXA 2CK3H 1NB3I 2RCDA 1YGEA 2ML5A 3UL5A 3EN1B 3V92A 1VQP3 5HGRA 3S29A 1W00A 4HYZA 3HI7A 1UI7A 3NXJA 4FMAA 3T8UA 3X3YA 4TX4A 1VQO3 2YFIB 3LTDA 4LGQA 4OUQA 1STFI 5IW9A 1IK3A 1NB5I 1U8CB 3WMDA 1SJWA 2PNCA 3CC73 2GBXB 3FLJA 1W2B2 3JUPA 2W56A 1N8QA 1K734 4J8TA 1LNHA 3MKIA 4O02B 4XM4A 1O7HB 1DVCA 4K61A 1S5AA 3M8CA 1IVUA 3GWRA 4RZMA 5LC6A 3K7CA 3X3XA 1DMMA 1YJ93 5IEOA 1WTHA 3ECFA 3IPTA 3PXMA 1FUWA 2FNQA 3OWYA 4R9KA 2XSOB 4IT7A 4MJDA 1L5GB 1WQLB 1UI8A 4MMZB 1QVG2 4FCZA 2XGNA 1QJGA 3JUMA 4WP5A 3DY5A 4O2HA 2FXTA 3F7XA 4L8PA 2OOVA 3G713 1O7NB 1VQM3 3NQYA 3PCSA 5IG4A 1ASKA 6STDA 1V74A 2P0XA 4AEQA 1E3VA 1TIJA 3EX9A 5JBSA 1O7GB 5IF6A 1OF5B 3FH1A 1WMNA 1LXEA 3NV0A 4GB5A 3I0YA 3HIIA 3SXXA 2OTL3 2XFTA 3MG1A 4HM4B 1BUQA 5CLKA 4EYCA 3S28A 2FGTA 2ZL8A 3NBJA 1JRQA 5ELJA 2ZDJA 3OWUA 5D83A 3EBTA 4H3UA 1VQN3 2IUKA 1D6YA 3DUKA 3A76A 1JKGA 4HM6B 2GBWB 4Q53A 8CHOA 2B1XB 2OQEC 4AKZA 3GRDA 3LT8A 2GEYA 1Q40B 3DGMA 2F99A 2R4IA 3CCE3 5IG0A 2XEPA 3NM2A 4HM8B 3BNEA 2D42A 3GZRA 2CIUA 3NM7A 3WODG 3I553 1TUHA 2INXA 3CD63 5BVBA 3CNXA 2C11A 4FMBA 1U5OA 3KIIA 1VQ43 5IG5A 3SOAA 5AIIA 1IQXA 3MPHA 4HM2B 1A2VA 2CWTA 1KD14 1ULJB 3EQQB 4BTYA 2OWPA 2L4VA 1KQS2 1E97A 4J9AA 2OTJ3 5AI1A 2K0MA 1OACA 4KVHA 3UNLA 1FGQA 4HM3B 5AYRB 2CKFB 5EQLA 3ROBA 4KFFA 4XBTA 2W9QA 4R1KA 2E2UA 1QVF2 1EG9B 1NWWA 4MEIA 2P09A 4K1UA 4N6LA 3E99A 3SVAA 2HMJB 2CFDA 2BMRB 1LVNA 1S723 1N8R4 1FGOA 3K9MC 4FMDA 1J2BA 5G2GA 1W6YA 3JUOA 3FF0A 1KC84 1VQ93 4XB5A 4HM5B 1YI23 3U97A 3EHCA 3F8XA 3OX9A 2RSXA 3NX0A 4NHFA 5AYSC 4LEHA 1FGRA 1Q42A 2P38A 3MG3A 2V1LA 1GY6A 4KZ1A 4G1MB 3BNBA 3JUNA 3G4S3 4NREA 1D6ZA 4H61A 3CCS3 1CEWI 4I4KA 3CC23 4EXRA 1RKYA 1OCVA 2JQ5A 5DRVA 3CC43 3PS8A 1FGTA 3CCM3 3CNMA 4XDWA 3S5CA 1YJN3 3LH4A 5LC7A 2YFLB 3CCQ3 1IU7A 4OK0A 1OUNA 2QGUA 3FGYA 1IDPA 1ROVA 4XBYA 3N54B 3LXUX 1Z1SA 3T8NA 1YIJ3 3F8HA 2XGLA 3G8ZA 2HMOB 3X42A 5AIFA 2RFRA 4HZBB 1A2KA 3EB8A 5FW5A 3CCR3 1TP6A 5CK6A 4RNYA 1OF5A 2OCTA 2WOHA 3VF1A 3KSED 1JNQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJ9 3;  3CCS 3;  1QVF 2;  1K9M 4;  1VQK 3;  3I55 3;  1VQ8 3;  3CC2 3;  1VQ7 3;  2QEX 3;  1YIT 3;  3CD6 3;  3CCJ 3;  3CCL 3;  3CC4 3;  1K8A 4;  1S72 3;  1N8R 4;  1JJ2 2;  3CCM 3;  2QA4 3;  1VQO 3;  1VQ4 3;  1YJN 3;  2OTL 3;  3CMA 3;  1VQL 3;  3CCQ 3;  1YHQ 3;  1VQ6 3;  1KC8 4;  1VQ9 3;  1M90 4;  3CCV 3;  1YI2 3;  1QVG 2;  1KD1 4;  1NJI 4;  1VQ5 3;  1YIJ 3;  1KQS 2;  3I56 3;  3CC7 3;  1VQN 3;  1W2B 2;  2OTJ 3;  1VQM 3;  1K73 4;  3CCU 3;  3G71 3;  1Q86 4;  3CME 3;  1M1K 4;  1Q7Y 4;  3CCR 3;  3G6E 3;  3G4S 3;  3OW2 2;  3CPW 2;  3CCE 3;  1Q82 4;  3CXC 2;  1YJW 3;  1VQP 3;  1Q81 4; 
#chains in the Genus database with same CATH topology
 1CH0 A;  1TTO A;  1CYU A;  3URP A;  2W04 A;  4L7K A;  1VQ8 3;  4LZI A;  1ISK A;  3EJV A;  1IYY A;  1I0X A;  3CCJ 3;  1MOL A;  1CQS A;  2BNG A;  3STD A;  1STD A;  2B24 B;  2W03 A;  3NQZ A;  2CFK A;  1IV9 A;  1BRS A;  1OGZ A;  1NDO B;  2K54 A;  1BSD A;  3K0Z A;  4HM1 B;  3DZL A;  3RGA A;  1SAR A;  5HOH A;  3OV4 A;  3O8Y A;  3DM8 A;  7STD A;  2L1S A;  5EEO A;  2F5M A;  1DYU A;  3SED A;  2GEX A;  2STD A;  2CWU A;  1YGW A;  2P05 A;  1Q40 A;  2F98 A;  1PU4 A;  1N9E A;  2GXF A;  1WMO A;  4WYK A;  1AY7 A;  1NO3 A;  1O7P B;  5KP1 A;  3FG4 A;  3UJM A;  4HOH A;  2JDI H;  2RNT A;  2F86 B;  2SBL A;  1QAK A;  1TRP A;  3HOH A;  3WOF B;  4BU4 A;  1Q81 4;  2BO9 B;  1N5P A;  2KF5 A;  3PZW A;  3X41 A;  3MSO A;  1RGE A;  3G16 A;  1RN7 A;  2YFJ B;  2P0M A;  1W2Z A;  3B8L A;  4DKI A;  3K5T A;  3F40 A;  1RDS A;  2Q07 A;  1W6G A;  1VQL 3;  2CFW A;  1ZX2 A;  5M1A A;  4FCM A;  2H0H A;  1RN1 A;  3OWS A;  3Q3F A;  5IER A;  1R4C A;  2BMQ B;  1DMN A;  2F5W A;  1EKM A;  1I3F A;  3GZY B;  3I56 3;  5AEW B;  5JPP A;  5D82 A;  1JB4 A;  1LRA A;  2OOV C;  1BVI A;  1X1W A;  1W01 A;  1X1Y A;  1BRI A;  1UUV B;  1JZD A;  1RCL A;  3D4A A;  3OW2 2;  3NBR A;  4WWU C;  1RRH A;  4XDV A;  7GSP A;  1BSA A;  1SIH A;  3B7C A;  4WYK B;  4N6T A;  3SOY A;  5IEN A;  3LTC A;  1RGH A;  1KWI A;  3X3Z A;  3ZG5 A;  4U13 A;  1A90 A;  1ZGX A;  3CCL 3;  1MGR A;  3WA3 A;  4R4K A;  1W6C A;  3DXO A;  1Q9E A;  1A67 A;  3CPO A;  3BNC A;  3U1W A;  2J8X B;  1BNI A;  3FZW A;  3NHX A;  1MNL A;  3EN8 A;  1RLS A;  1GMR A;  3H51 A;  3RGR A;  4CDL A;  4WHA A;  1I2F A;  1BGS A;  2HMN B;  1B2Z A;  1PFP A;  3KN4 A;  1WMP A;  4BIR A;  4R9L A;  1OPY A;  3ALA A;  1IVX A;  1TRQ A;  2XH9 A;  4CCV A;  2W9P A;  3FCS B;  1GMP A;  4RBN A;  1EEJ A;  3MG2 A;  1UCK A;  3ZG0 A;  3Q2P A;  1US1 A;  1VQK 3;  2HOH A;  2WGQ A;  1YIT 3;  1B21 A;  2IA7 A;  1SQW A;  5CXO A;  2CFL A;  5EVH A;  1IV7 A;  1JZO A;  3Q1C A;  1O7M B;  2R41 A;  1GYB A;  1BNS A;  2I9W A;  2Z7A A;  2E2T A;  3IMA B;  3MWZ A;  3T0U A;  1VZZ A;  1RGF A;  1HYF A;  5I97 A;  3QRD A;  1IVV A;  5FGO A;  1MGW A;  5STD A;  4N6O B;  2WOF A;  1EQK A;  3FKA A;  3WR2 A;  1RGG A;  1RMS A;  1TU5 A;  5KP3 A;  2Y73 A;  4FR9 A;  3SYU A;  3N9H A;  1UGI A;  1QAF A;  4LMI A;  1EA2 A;  1GOY A;  1OHO A;  2GSP A;  2Y74 A;  1VQ7 3;  1SPU A;  1GD4 A;  4OVM A;  3NUV A;  1YVB I;  4X2H A;  1AV4 A;  1NNV A;  3X40 A;  1ZS7 A;  4BTX A;  2QA4 3;  1JJ2 2;  2UUG C;  2W2C A;  1JN5 B;  4J5K A;  1YHQ 3;  1K8A 4;  1V57 A;  1C7H A;  1GD3 A;  1IQ8 A;  1M90 4;  2D1W A;  4HJL B;  1GOU A;  1GS3 A;  2XR8 B;  3BND A;  3WA2 X;  4EC6 A;  1NJI 4;  1G96 A;  4MMX B;  1B2S A;  1DMQ A;  1NU3 A;  1PYL A;  1ROA A;  1W02 A;  1TFK A;  1UCJ A;  2YX9 A;  3VSY A;  1YJW 3;  3SLU A;  1PY3 A;  3DH2 A;  2E2V A;  5IG3 A;  3DGY A;  1MWR A;  3GAX A;  3LTB A;  4FCJ A;  1WNH A;  2SAR A;  3KE7 A;  5CF1 A;  2CW9 A;  2H0I A;  1I8V A;  3F7S A;  2Z76 A;  2Z77 A;  3D3L A;  3UL6 A;  3JVC A;  3DMC A;  2KRT A;  3PGB A;  3WDG B;  3WOE B;  5AEU B;  3CMA 3;  3DGN A;  1I0V A;  3JUQ A;  4BL2 A;  1BUJ A;  1X1U A;  3LYG A;  4N6N B;  1BAO A;  1IVW A;  1M9G A;  3AHW A;  3EE1 A;  3FSD A;  5IEP A;  5JPU A;  3KKG A;  2W0Q A;  2BIR A;  3AGN A;  1RRL A;  3AMO B;  2QIY A;  4HBR A;  1UW1 A;  3LT9 A;  4JF8 A;  1M1K 4;  1T5Y A;  3BB9 A;  5G1K A;  3V98 A;  1TFO A;  2H0G A;  4IPB A;  1BRJ A;  4QWT A;  1MWS A;  5ELU A;  2CWV A;  6GSP A;  3IJE B;  2W6J H;  1BOX A;  2CG1 A;  2XSH B;  1AVL A;  5BXQ A;  2A15 A;  3PYJ A;  1UGH I;  1AVK A;  4MMY B;  1K9M 4;  3BLZ A;  1KSI A;  1AR0 A;  1W4N A;  1IQY A;  2M7O A;  3G0K A;  3KFQ C;  2Z6B A;  3EF8 A;  4AKY A;  3KSP A;  3SX1 A;  1I2G A;  2LQV A;  1W7C A;  4EV2 A;  3CU3 A;  1VQ6 3;  1GY5 A;  1RSN A;  3EBY A;  4NPB A;  2CH9 A;  2UX0 A;  3MHE A;  4ORL A;  3DGL A;  3LML A;  4KFE A;  2XFS A;  3F14 A;  4O3V A;  2AAD A;  4FMC A;  2BHM A;  4LSO A;  2O9U X;  3S67 A;  2OQE A;  1JB2 A;  1Q86 4;  1I3I A;  2KAA A;  2W56 B;  1GSP A;  1OH0 A;  9RNT A;  4N3V A;  3MYT A;  1FA3 A;  3G6E 3;  4R80 A;  3CPW 2;  1BSB A;  1Q82 4;  1BRG A;  3H3H A;  3CXC 2;  4HZ9 B;  5D81 A;  1F8N A;  1K41 A;  1GY7 A;  1V58 A;  4GHO A;  2XRX B;  4K1V A;  3TDG A;  4EV5 A;  4O8S A;  2QEX 3;  2BT3 A;  1UCL A;  3Q90 A;  2CFG A;  1D6U A;  1HKX A;  2WO0 A;  3L0R A;  3ER7 A;  4N6M A;  5TGN A;  2XF3 A;  1Y4K A;  2KF6 A;  3V99 A;  1B2M A;  3B4P A;  4GL6 A;  4JRF A;  1N5H A;  2ML6 A;  4K90 B;  1JV2 B;  2CHC A;  3LTA A;  1RGC A;  1X1X A;  4ZM8 A;  3OXA A;  2O3O A;  2F4Y A;  3J7Y d;  1RJO A;  4IIA A;  5BIR A;  1UDI I;  1K28 A;  3D5I A;  1T2I A;  1IT7 A;  3QK9 A;  4HKV B;  4BTW A;  3GZB A;  1RHL A;  2UGI A;  3D5G A;  3HZP A;  4J5G A;  3DGO A;  1BRH A;  4N6U A;  1RTU A;  2IUJ A;  2RGQ A;  1OHP A;  1W5Z A;  2PZV A;  1JBS A;  1QAL A;  1FUS A;  3NV0 B;  3NBB A;  1OHS A;  1I2E A;  1ULI B;  1DET A;  1JN5 A;  1MWT A;  1SII A;  1CYV A;  1LOX A;  2WGO A;  3AHS A;  3PCR A;  4HM0 B;  5AIH A;  4EBG A;  3UB1 A;  3FG3 A;  6RNT A;  2BMO B;  1BSC A;  2HMK B;  3CCV 3;  4HVN A;  3HK4 A;  4KT3 B;  1N9J A;  1B3S A;  3FG1 A;  4STD A;  4X2O A;  1OGX A;  1IT8 A;  2GU1 A;  4RNT A;  1BRK A;  3CME 3;  2GU3 A;  4XBX A;  2HMM B;  1JKG B;  4PEJ A;  7RNT A;  1Q7Y 4;  1JBT A;  3B4O A;  3D9R A;  2KF3 A;  2KXG A;  1UUW B;  4HM7 B;  1BAN A;  1VQ5 3;  1RNT A;  4RNZ A;  5M18 A;  1DE3 A;  2HML B;  4N6V 0;  3RDE A;  1G02 A;  3GZX B;  3VGN A;  5A0O B;  2C10 A;  2MC8 A;  2C4B A;  1JB5 A;  1LQG C;  5CF2 A;  3N8B A;  1M1X B;  2MF7 A;  3HIG A;  3HX8 A;  1B27 A;  2CG0 A;  5AIG A;  1DVD A;  1QMA A;  1HU9 A;  1ZO2 A;  5KP4 A;  4KFD A;  3FF2 A;  1O7W B;  3AMO A;  2KCD A;  1LOV A;  1FW7 A;  1FGM A;  3KZT A;  3CCU 3;  1E3R A;  3K63 A;  3F9S A;  4L8O A;  3LZA A;  4WFO A;  5DRE A;  3S27 A;  2CC3 A;  3LOY A;  2IMJ A;  3EC9 A;  2LYX A;  2CK3 H;  1LOY A;  1NB3 I;  2RCD A;  1YGE A;  2ML5 A;  3UL5 A;  3EN1 B;  3V92 A;  1VQP 3;  5HGR A;  3S29 A;  1W00 A;  4HYZ A;  1LQM B;  1UI7 A;  3HI7 A;  3NXJ A;  4FMA A;  1UUG B;  3T8U A;  3X3Y A;  4TX4 A;  1VQO 3;  2YFI B;  3LTD A;  4LGQ A;  4OUQ A;  1STF I;  5IW9 A;  1IK3 A;  1NB5 I;  1RGA A;  1U8C B;  3D79 A;  1SJW A;  1LOW A;  2PNC A;  3WMD A;  3CC7 3;  2GBX B;  3FLJ A;  1W2B 2;  3JUP A;  2W56 A;  1N8Q A;  1K73 4;  4J8T A;  1LNH A;  3MKI A;  4O02 B;  4XM4 A;  1O7H B;  1DVC A;  4K61 A;  1S5A A;  3M8C A;  1IVU A;  3GWR A;  4RZM A;  5LC6 A;  3K7C A;  3X3X A;  3BU4 A;  1DMM A;  1YJ9 3;  4HAA A;  5IEO A;  1I70 A;  1WTH A;  3ECF A;  3IPT A;  3PXM A;  4CJN A;  1FUW A;  2FNQ A;  3OWY A;  4R9K A;  1RGL A;  2XSO B;  3BIR A;  4IT7 A;  4MJD A;  1RCK A;  3GSP A;  1WQL B;  1L5G B;  1UI8 A;  4MMZ B;  1YVS A;  4FCZ A;  1QVG 2;  2XGN A;  1QJG A;  3JUM A;  4WP5 A;  1B20 A;  3DY5 A;  4O2H A;  1BNG A;  2ZA4 A;  2FXT A;  3F7X A;  1BNF A;  4L8P A;  2OOV A;  1O7N B;  3G71 3;  1VQM 3;  3NQY A;  3PCS A;  5IG4 A;  1BU4 A;  1ASK A;  2CX1 A;  1V74 A;  6STD A;  2P0X A;  4AEQ A;  1E3V A;  1TIJ A;  4EW5 A;  1B2U A;  3EX9 A;  5JBS A;  1O7G B;  5IF6 A;  1OF5 B;  3FH1 A;  2ZHX B;  1WMN A;  1LXE A;  3NV0 A;  1TJD A;  4GB5 A;  1VQQ A;  1GMQ A;  3I0Y A;  3HII A;  3SXX A;  2OTL 3;  2XFT A;  3MG1 A;  4HM4 B;  5RNT A;  5CLK A;  1BUQ A;  4EYC A;  3S28 A;  2F56 A;  2FGT A;  2ZL8 A;  2AAE A;  1JRQ A;  3NBJ A;  5ELJ A;  2ZDJ A;  3OWU A;  3ZFZ A;  5D83 A;  3EBT A;  1FYS A;  4H3U A;  1HZ1 A;  4ILF A;  2IUK A;  1D6Y A;  3DUK A;  3A76 A;  4CPK A;  1VQN 3;  1JKG A;  1YNV X;  4HM6 B;  2GBW B;  4Q53 A;  1FZU A;  8CHO A;  1EUI C;  1JBR A;  2B1X B;  2OQE C;  4AKZ A;  3GRD A;  3LT8 A;  2GEY A;  1Q40 B;  3DGM A;  2F99 A;  2R4I A;  3CCE 3;  5G1L A;  5IG0 A;  2XEP A;  2K3D A;  3NM2 A;  3BNE A;  4HM8 B;  4LYL B;  1GOV A;  2D42 A;  3AGO A;  3GZR A;  2CIU A;  3NM7 A;  5GSP A;  3WOD G;  3I55 3;  1TUH A;  1BNE A;  2INX A;  3CD6 3;  5BVB A;  3CNX A;  2C11 A;  4FMB A;  1U5O A;  3KII A;  1VQ4 3;  1A2P A;  5IG5 A;  3SOA A;  5AII A;  1IQX A;  3MPH A;  4HM2 B;  1A2V A;  2CWT A;  1KD1 4;  1ULJ B;  2IYJ A;  3EQQ B;  4BTY A;  2OWP A;  2L4V A;  1KQS 2;  1E97 A;  4J9A A;  1RGK A;  1T2H A;  2OTJ 3;  1B2X A;  5AI1 A;  2K0M A;  1OAC A;  4KVH A;  2RBI A;  3UNL A;  1FGQ A;  4HM3 B;  5AYR B;  2CKF B;  5EQL A;  5BU4 A;  3ROB A;  4KFF A;  1T3B A;  2W9Q A;  2BU4 A;  4R1K A;  4XBT A;  2E2U A;  1QVF 2;  1EG9 B;  1FUT A;  1NWW A;  1UCI A;  4MEI A;  2P09 A;  4K1U A;  4N6L A;  3E99 A;  3SVA A;  2HMJ B;  2CX0 A;  2CFD A;  1AQZ A;  1LVN A;  2BMR B;  1S72 3;  1N8R 4;  1FGO A;  1BIR A;  3K9M C;  4FMD A;  1J2B A;  5G2G A;  1W6Y A;  3JUO A;  3FF0 A;  1KC8 4;  1R4Y A;  4XB5 A;  4HM5 B;  1YI2 3;  3U97 A;  1VQ9 3;  3EHC A;  3F8X A;  4I5Q A;  3OX9 A;  1MWU A;  2RSX A;  3NX0 A;  4NHF A;  5AYS C;  4LEH A;  3RNT A;  1FGR A;  1LNI A;  1Q42 A;  2P38 A;  3MG3 A;  1RNB A;  2V1L A;  1GY6 A;  4KZ1 A;  1BNJ A;  4G1M B;  3BNB A;  1Q7H A;  3JUN A;  4NRE A;  3G4S 3;  1G0T A;  1D6Z A;  2IY2 A;  4H61 A;  3CCS 3;  1CEW I;  4I4K A;  3CC2 3;  3KCH A;  4EXR A;  2KF4 A;  4BL3 A;  1OCV A;  2JQ5 A;  5DRV A;  1RKY A;  3CC4 3;  3PS8 A;  1FGT A;  3CCM 3;  3CNM A;  4XDW A;  3S5C A;  8RNT A;  3LH4 A;  5LC7 A;  5M19 A;  1YJN 3;  2YFL B;  3CCQ 3;  1IU7 A;  4OK0 A;  1BNR A;  1OUN A;  2QGU A;  3FGY A;  1C54 A;  4GSP A;  1BSE A;  1IDP A;  1ROV A;  3N54 B;  4XBY A;  3LXU X;  1Z1S A;  3T8N A;  1YIJ 3;  1BRN L;  3A5E A;  3F8H A;  2XGL A;  1RN4 A;  3G8Z A;  2HMO B;  3X42 A;  5AIF A;  2RFR A;  4HZB B;  1A2K A;  3EB8 A;  5FW5 A;  3CCR 3;  1TP6 A;  5CK6 A;  4RNY A;  1OF5 A;  2OCT A;  2WOH A;  3VF1 A;  3KSE D;  1JNQ A;  3WHO A; 
#chains in the Genus database with same CATH homology
 1CYU A;  2W04 A;  4L7K A;  1VQ8 3;  4LZI A;  1ISK A;  3EJV A;  3CCJ 3;  1MOL A;  1CQS A;  2BNG A;  3STD A;  1STD A;  2B24 B;  2W03 A;  3NQZ A;  2CFK A;  1IV9 A;  1OGZ A;  1NDO B;  2K54 A;  4HM1 B;  3K0Z A;  3RGA A;  3DZL A;  3OV4 A;  3O8Y A;  3DM8 A;  7STD A;  5EEO A;  3SED A;  1DYU A;  2GEX A;  2STD A;  2CWU A;  2P05 A;  1Q40 A;  2F98 A;  1PU4 A;  1N9E A;  2GXF A;  1WMO A;  4WYK A;  1NO3 A;  5KP1 A;  1O7P B;  3FG4 A;  3UJM A;  2JDI H;  3WOF B;  2F86 B;  2SBL A;  1QAK A;  1Q81 4;  2BO9 B;  1N5P A;  3PZW A;  3X41 A;  3MSO A;  3G16 A;  1RN7 A;  2YFJ B;  2P0M A;  1W2Z A;  3B8L A;  3K5T A;  3F40 A;  2Q07 A;  1W6G A;  1VQL 3;  2CFW A;  1ZX2 A;  4FCM A;  3OWS A;  5IER A;  1R4C A;  2BMQ B;  1DMN A;  1EKM A;  3GZY B;  3I56 3;  5AEW B;  5JPP A;  5D82 A;  1JB4 A;  2OOV C;  1W01 A;  1UUV B;  3OW2 2;  3NBR A;  4WWU C;  1RRH A;  4XDV A;  1SIH A;  3B7C A;  4WYK B;  4N6T A;  3SOY A;  5IEN A;  3LTC A;  1KWI A;  3X3Z A;  4U13 A;  1A90 A;  3CCL 3;  3WA3 A;  4R4K A;  1W6C A;  3DXO A;  1A67 A;  3CPO A;  3BNC A;  3U1W A;  3FZW A;  3NHX A;  1MNL A;  3EN8 A;  3H51 A;  3RGR A;  4CDL A;  4WHA A;  2HMN B;  3KN4 A;  1PFP A;  1WMP A;  4R9L A;  1OPY A;  3ALA A;  1IVX A;  2XH9 A;  4CCV A;  2W9P A;  3FCS B;  4RBN A;  3MG2 A;  3Q2P A;  1US1 A;  1VQK 3;  2WGQ A;  1YIT 3;  2IA7 A;  1SQW A;  5CXO A;  2CFL A;  5EVH A;  1IV7 A;  3Q1C A;  1O7M B;  1GYB A;  2Z7A A;  2I9W A;  2E2T A;  3IMA B;  3MWZ A;  3T0U A;  1VZZ A;  5I97 A;  3QRD A;  1IVV A;  5FGO A;  5STD A;  4N6O B;  2WOF A;  1EQK A;  3FKA A;  1TU5 A;  5KP3 A;  2Y73 A;  4FR9 A;  3N9H A;  1QAF A;  4LMI A;  1EA2 A;  1OHO A;  2Y74 A;  1VQ7 3;  1SPU A;  1GD4 A;  4OVM A;  3NUV A;  1YVB I;  4X2H A;  1AV4 A;  1JJ2 2;  3X40 A;  4BTX A;  2QA4 3;  2W2C A;  1JN5 B;  1YHQ 3;  1C7H A;  1GD3 A;  1IQ8 A;  1M90 4;  2D1W A;  4HJL B;  1GS3 A;  2XR8 B;  3BND A;  3WA2 X;  4EC6 A;  1NJI 4;  1G96 A;  4MMX B;  1DMQ A;  1NU3 A;  1ROA A;  1W02 A;  1TFK A;  2YX9 A;  3VSY A;  1YJW 3;  3SLU A;  2E2V A;  5IG3 A;  3GAX A;  3LTB A;  4FCJ A;  1WNH A;  3KE7 A;  5CF1 A;  2CW9 A;  3F7S A;  2Z76 A;  2Z77 A;  3D3L A;  3UL6 A;  3JVC A;  3DMC A;  2KRT A;  3PGB A;  3WDG B;  3WOE B;  5AEU B;  3CMA 3;  3DGN A;  3JUQ A;  3LYG A;  4N6N B;  3EE1 A;  1IVW A;  1M9G A;  5IEP A;  3FSD A;  5JPU A;  3KKG A;  2W0Q A;  1RRL A;  3AMO B;  2QIY A;  4HBR A;  1UW1 A;  3LT9 A;  4JF8 A;  1M1K 4;  1T5Y A;  3BB9 A;  3V98 A;  1TFO A;  4IPB A;  5ELU A;  4QWT A;  2CWV A;  3IJE B;  2W6J H;  2CG1 A;  2XSH B;  1AVL A;  5BXQ A;  2A15 A;  3PYJ A;  1AVK A;  4MMY B;  1K9M 4;  3BLZ A;  1KSI A;  1AR0 A;  1W4N A;  1IQY A;  2M7O A;  3G0K A;  3KFQ C;  2Z6B A;  3EF8 A;  4AKY A;  3KSP A;  3SX1 A;  2LQV A;  1W7C A;  4EV2 A;  3CU3 A;  1VQ6 3;  1GY5 A;  3EBY A;  2CH9 A;  2UX0 A;  3MHE A;  4ORL A;  3DGL A;  3LML A;  4KFE A;  2XFS A;  3F14 A;  4O3V A;  4FMC A;  2BHM A;  4LSO A;  2O9U X;  3S67 A;  2OQE A;  1JB2 A;  1Q86 4;  2W56 B;  1OH0 A;  4N3V A;  3MYT A;  1FA3 A;  3G6E 3;  4R80 A;  3CPW 2;  1Q82 4;  3H3H A;  3CXC 2;  4HZ9 B;  5D81 A;  1F8N A;  1K41 A;  1GY7 A;  4K1V A;  2XRX B;  3TDG A;  4EV5 A;  4O8S A;  2QEX 3;  2BT3 A;  3Q90 A;  2CFG A;  1D6U A;  1HKX A;  2WO0 A;  3L0R A;  3ER7 A;  4N6M A;  5TGN A;  2XF3 A;  1Y4K A;  3V99 A;  3B4P A;  4GL6 A;  4JRF A;  1N5H A;  2ML6 A;  4K90 B;  1JV2 B;  2CHC A;  3LTA A;  4ZM8 A;  3OXA A;  2O3O A;  3J7Y d;  1RJO A;  4IIA A;  1K28 A;  1IT7 A;  3QK9 A;  4HKV B;  4BTW A;  3GZB A;  3HZP A;  3DGO A;  4N6U A;  2IUJ A;  2RGQ A;  1OHP A;  1W5Z A;  2PZV A;  1QAL A;  3NV0 B;  3NBB A;  1OHS A;  1ULI B;  1SII A;  1JN5 A;  1K8A 4;  2WGO A;  1CYV A;  1LOX A;  3PCR A;  4HM0 B;  5AIH A;  4EBG A;  3UB1 A;  3FG3 A;  2BMO B;  2HMK B;  3CCV 3;  4HVN A;  3HK4 A;  1N9J A;  3FG1 A;  4STD A;  4X2O A;  1OGX A;  1IT8 A;  2GU1 A;  3CME 3;  2GU3 A;  4XBX A;  2HMM B;  1JKG B;  4PEJ A;  1Q7Y 4;  3B4O A;  3D9R A;  2KXG A;  1UUW B;  4HM7 B;  1VQ5 3;  4RNZ A;  2HML B;  4N6V 0;  3RDE A;  3GZX B;  3VGN A;  5A0O B;  2C10 A;  2MC8 A;  1JB5 A;  5CF2 A;  3N8B A;  1M1X B;  2MF7 A;  3HIG A;  3HX8 A;  2CG0 A;  1DVD A;  5AIG A;  1QMA A;  1HU9 A;  1ZO2 A;  5KP4 A;  4KFD A;  3FF2 A;  1O7W B;  3AMO A;  2KCD A;  1FGM A;  3KZT A;  3CCU 3;  1E3R A;  3K63 A;  3F9S A;  4L8O A;  3LZA A;  4WFO A;  5DRE A;  3S27 A;  2CC3 A;  3LOY A;  2IMJ A;  3EC9 A;  2LYX A;  2CK3 H;  1NB3 I;  2RCD A;  1YGE A;  2ML5 A;  3UL5 A;  3EN1 B;  3V92 A;  1VQP 3;  5HGR A;  3S29 A;  1W00 A;  4HYZ A;  3HI7 A;  1UI7 A;  3NXJ A;  4FMA A;  3T8U A;  3X3Y A;  4TX4 A;  1VQO 3;  2YFI B;  3LTD A;  4LGQ A;  4OUQ A;  1STF I;  5IW9 A;  1IK3 A;  1NB5 I;  1U8C B;  3WMD A;  1SJW A;  2PNC A;  3CC7 3;  2GBX B;  3FLJ A;  1W2B 2;  3JUP A;  2W56 A;  1N8Q A;  1K73 4;  4J8T A;  1LNH A;  3MKI A;  4O02 B;  4XM4 A;  1O7H B;  1DVC A;  4K61 A;  1S5A A;  3M8C A;  1IVU A;  3GWR A;  4RZM A;  5LC6 A;  3K7C A;  3X3X A;  1DMM A;  1YJ9 3;  5IEO A;  1WTH A;  3ECF A;  3IPT A;  3PXM A;  1FUW A;  2FNQ A;  3OWY A;  4R9K A;  2XSO B;  4IT7 A;  4MJD A;  1L5G B;  1WQL B;  1UI8 A;  4MMZ B;  1QVG 2;  4FCZ A;  2XGN A;  1QJG A;  3JUM A;  4WP5 A;  3DY5 A;  4O2H A;  2FXT A;  3F7X A;  4L8P A;  2OOV A;  3G71 3;  1O7N B;  1VQM 3;  3NQY A;  3PCS A;  5IG4 A;  1ASK A;  6STD A;  1V74 A;  2P0X A;  4AEQ A;  1E3V A;  1TIJ A;  3EX9 A;  5JBS A;  1O7G B;  5IF6 A;  1OF5 B;  3FH1 A;  1WMN A;  1LXE A;  3NV0 A;  4GB5 A;  3I0Y A;  3HII A;  3SXX A;  2OTL 3;  2XFT A;  3MG1 A;  4HM4 B;  1BUQ A;  5CLK A;  4EYC A;  3S28 A;  2FGT A;  2ZL8 A;  3NBJ A;  1JRQ A;  5ELJ A;  2ZDJ A;  3OWU A;  5D83 A;  3EBT A;  4H3U A;  1VQN 3;  2IUK A;  1D6Y A;  3DUK A;  3A76 A;  1JKG A;  4HM6 B;  2GBW B;  4Q53 A;  8CHO A;  2B1X B;  2OQE C;  4AKZ A;  3GRD A;  3LT8 A;  2GEY A;  1Q40 B;  3DGM A;  2F99 A;  2R4I A;  3CCE 3;  5IG0 A;  2XEP A;  3NM2 A;  4HM8 B;  3BNE A;  2D42 A;  3GZR A;  2CIU A;  3NM7 A;  3WOD G;  3I55 3;  1TUH A;  2INX A;  3CD6 3;  5BVB A;  3CNX A;  2C11 A;  4FMB A;  1U5O A;  3KII A;  1VQ4 3;  5IG5 A;  3SOA A;  5AII A;  1IQX A;  3MPH A;  4HM2 B;  1A2V A;  2CWT A;  1KD1 4;  1ULJ B;  3EQQ B;  4BTY A;  2OWP A;  2L4V A;  1KQS 2;  1E97 A;  4J9A A;  2OTJ 3;  5AI1 A;  2K0M A;  1OAC A;  4KVH A;  3UNL A;  1FGQ A;  4HM3 B;  5AYR B;  2CKF B;  5EQL A;  3ROB A;  4KFF A;  4XBT A;  2W9Q A;  4R1K A;  2E2U A;  1QVF 2;  1EG9 B;  1NWW A;  4MEI A;  2P09 A;  4K1U A;  4N6L A;  3E99 A;  3SVA A;  2HMJ B;  2CFD A;  2BMR B;  1LVN A;  1S72 3;  1N8R 4;  1FGO A;  3K9M C;  4FMD A;  1J2B A;  5G2G A;  1W6Y A;  3JUO A;  3FF0 A;  1KC8 4;  1VQ9 3;  4XB5 A;  4HM5 B;  1YI2 3;  3U97 A;  3EHC A;  3F8X A;  3OX9 A;  2RSX A;  3NX0 A;  4NHF A;  5AYS C;  4LEH A;  1FGR A;  1Q42 A;  2P38 A;  3MG3 A;  2V1L A;  1GY6 A;  4KZ1 A;  4G1M B;  3BNB A;  3JUN A;  3G4S 3;  4NRE A;  1D6Z A;  4H61 A;  3CCS 3;  1CEW I;  4I4K A;  3CC2 3;  4EXR A;  1RKY A;  1OCV A;  2JQ5 A;  5DRV A;  3CC4 3;  3PS8 A;  1FGT A;  3CCM 3;  3CNM A;  4XDW A;  3S5C A;  1YJN 3;  3LH4 A;  5LC7 A;  2YFL B;  3CCQ 3;  1IU7 A;  4OK0 A;  1OUN A;  2QGU A;  3FGY A;  1IDP A;  1ROV A;  4XBY A;  3N54 B;  3LXU X;  1Z1S A;  3T8N A;  1YIJ 3;  3F8H A;  2XGL A;  3G8Z A;  2HMO B;  3X42 A;  5AIF A;  2RFR A;  4HZB B;  1A2K A;  3EB8 A;  5FW5 A;  3CCR 3;  1TP6 A;  5CK6 A;  4RNY A;  1OF5 A;  2OCT A;  2WOH A;  3VF1 A;  3KSE D;  1JNQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...