1IYYA

Nmr structure of gln25-ribonuclease t1, 24 structures
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYQLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Determination of the NMR structure of Gln25-ribonuclease T1.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
molecule keywords RIBONUCLEASE T1
total genus 10
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2002-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1iyyA00
2SARA 1SARA 1I2FA 1B2SA 2BIRA 1I3IA 1I0VA 1UCIA 1JBSA 4HOHA 4GSPA 1GOVA 1ZGXA 1BNRA 2BU4A 3D5IA 3DGYA 1BNSA 2KF6A 2HOHA 3AHWA 1UCJA 1BNJA 8RNTA 1I3FA 1B3SA 6GSPA 1B2MA 1MGRA 2ZA4A 1IYYA 2KF5A 1A2PA 1RN4A 1BGSA 1RGLA 1DETA 1RGEA 1R4YA 1BNFA 1AQZA 1PY3A 4GHOA 3GSPA 1FW7A 1BNIA 1RGGA 1B2ZA 5HOHA 1BIRA 3D4AA 1RNBA 2AADA 1BRJA 2F5MA 1LOWA 1GMRA 1GOUA 1RSNA 1RCLA 2KAAA 1BSAA 3WHOA 2F4YA 2RBIA 5GSPA 1BRKA 9RNTA 7GSPA 1BRGA 5BU4A 1BNEA 6RNTA 2KF3A 1RCKA 1T2IA 1DE3A 1CH0A 1TRQA 1RLSA 1Q9EA 1RDSA 1X1UA 4J5KA 1FYSA 1B2UA 1JBRA 1RGFA 1RHLA 4RNTA 1UCKA 1MGWA 1BANA 1BRHA 3WR2A 1BVIA 1B21A 2RNTA 1I2GA 3AHSA 3RNTA 4J5GA 1GMPA 1LOVA 2KF4A 1LRAA 4BIRA 3DH2A 1BU4A 1RGAA 1FUSA 1BSEA 2F5WA 1RN1A 1TRPA 7RNTA 1FUTA 1I2EA 4HAAA 1LNIA 3Q3FA 1B20A 3HOHA 1HZ1A 1T2HA 4BU4A 5BIRA 1RGCA 1X1WA 3URPA 1BRNL 3AGOA 3KCHA 1BNGA 1BRIA 1YNVX 1UCLA 1GOYA 1BUJA 1GMQA 2GSPA 1X1XA 3BIRA 5RNTA 1I70A 1RMSA 3D5GA 3SYUA 1RGKA 3AGNA 1YVSA 2F56A 1B27A 1RTUA 3A5EA 1BSBA 1LOYA 2AAEA 1I0XA 1X1YA 1G02A 1I8VA 1BSCA 3BU4A 1BAOA 1BSDA 1PYLA 1BRSA 1YGWA 1C54A 1FZUA 1RNTA 1BOXA 1TTOA 1RGHA 1JBTA 1GSPA 2C4BA 1AY7A 1HYFA 1B2XA
chains in the Genus database with same CATH superfamily
1MOLA 2IUKA 3UNLA 3K5TA 4LMIA 1IVXA 3DZLA 2OTL3 1SARA 3IJEB 3DM8A 1FGRA 1UI8A 1DMQA 1UCIA 2QGUA 4GSPA 1OGXA 1WNHA 1ZGXA 3Q90A 1Q7Y4 3EE1A 5AIFA 3RGAA 3DGYA 1IT8A 2HMKB 2XFSA 4BTWA 1BNRA 2B24B 2V1LA 8RNTA 2UUGC 1QVF2 2H0HA 3MG1A 1ISKA 2KF5A 1A2PA 3BNEA 4X2HA 3HIIA 1JB5A 1RGEA 1BNFA 2CW9A 1PY3A 4L7KA 1LNHA 3Q2PA 1BIRA 3NX0A 4R9LA 1NJI4 2F5MA 5CLKA 1LOWA 5IG0A 3RGRA 2XH9A 1RCLA 4NHFA 1UUVB 3LTDA 1Z1SA 2F4YA 2CG1A 5BVBA 4PEJA 3V92A 3NXJA 1TFKA 2BMQB 3N9HA 4EXRA 3G713 3WA3A 4CCVA 4LGQA 1ULJB 2F86B 2K0MA 1BRGA 2OQEA 5ELJA 1BNEA 5DREA 1FGQA 1W01A 3B4PA 1QMAA 1W7CA 4XB5A 3DGNA 4HM1B 1RLSA 4JF8A 3UL6A 3CXC2 4X2OA 1X1UA 2CX0A 4I5QA 1LXEA 1FYSA 1IK3A 4GL6A 4HVNA 1RHLA 4RNTA 3CCM3 1SPUA 3K7CA 2CWTA 2BNGA 1K734 5STDA 2JDIH 4HM8B 2RNTA 4STDA 3JUOA 1QAKA 4J5GA 1GMPA 1LOVA 1RRHA 4NREA 3H51A 2YFJB 1LRAA 3E99A 1NWWA 2C11A 4FCZA 1STDA 2W9PA 5CF2A 2RGQA 1JZOA 4KFFA 5IEPA 1N8QA 1TRPA 4DKIA 4O8SA 1T2HA 3L0RA 4FMBA 4WWUC 3CNXA 3URPA 2P0XA 2W9QA 2P0MA 4U13A 2L4VA 5IERA 3OWSA 5LC6A 5AEWB 1FGOA 1MWRA 3J7Yd 3LYGA 4Q53A 3X41A 3GWRA 4RBNA 4N6TA 2Z7AA 1OH0A 3S27A 3NBJA 5ELUA 2H0IA 5IENA 3EN1B 4JRFA 2OQEC 1C7HA 1IU7A 1WTHA 1WQLB 3BNDA 1OF5B 2GBXB 4MMZB 3H3HA 5KP3A 1YVSA 2HMJB 1A90A 1B27A 2YFLB 4CPKA 3LT8A 1K9M4 2OTJ3 1T3BA 5D82A 1DMMA 1I8VA 3BU4A 1N9EA 1W6YA 3EBYA 3G0KA 1R4CA 2W04A 1YGWA 2ZHXB 2O3OA 3EBTA 2Z76A 1ROAA 4HM0B 3LXUX 1VZZA 2BMOB 4BL3A 5FGOA 1A2VA 1B2XA 3DUKA 2HMOB 2B1XB 1O7MB 1Q42A 1RRLA 3LT9A 4K61A 1CYUA 1I2FA 1B2SA 2BIRA 3T8NA 1K8A4 3MKIA 4ZM8A 1I0VA 1GS3A 1MWTA 1Y4KA 4XBYA 3BNBA 1OGZA 1SIIA 4RZMA 2GEXA 1SQWA 2BU4A 1VQO3 3DGMA 3ALAA 2WOHA 4WHAA 3B7CA 1I3FA 3PGBA 6GSPA 1UUGB 1MGRA 3D9RA 1EEJA 2XR8B 3LMLA 3DMCA 1W00A 1NB3I 5CXOA 4R1KA 5IW9A 1RN4A 1RGLA 1R4YA 1ZS7A 1AQZA 3T0UA 2XGNA 1EKMA 4LSOA 1B2ZA 3F8HA 3D4AA 3D79A 2RFRA 1RSNA 1YI23 3IPTA 3CCU3 3WHOA 1MNLA 1VQL3 3CC43 3EJVA 3LTCA 4R9KA 1RN7A 5JBSA 1FUWA 2XEPA 2ZDJA 4BL2A 2W0QA 2P38A 3ZFZA 4FMDA 5BU4A 6RNTA 3F7SA 1T2IA 2FNQA 3HZPA 1TRQA 4HM4B 1O7HB 2FGTA 4XBTA 4GB5A 3WODG 3LOYA 3FZWA 1ROVA 2F98A 5M19A 1B2UA 3NM2A 1RGFA 1OHPA 3OX9A 1UCKA 1KSIA 1MGWA 1W6GA 2P09A 2E2TA 2Z77A 1BVIA 1NNVA 4HM2B 2OOVA 3TDGA 3NBBA 5JPPA 1PU4A 1M904 1W4NA 3FG1A 4I4KA 5BXQA 4N6LA 5IG5A 2GU1A 5G1KA 4QWTA 1W5ZA 2KF4A 3B4OA 1KD14 1SJWA 1DYUA 3F9SA 1VQ63 2HMMB 3EC9A 1ULIB 1BSEA 2C10A 2F5WA 3F7XA 1F8NA 1LQMB 1ZO2A 1JV2B 3EB8A 4O3VA 1I2EA 4HAAA 1US1A 1IDPA 2IYJA 1JN5B 1QVG2 3WA2X 4H61A 1VQ73 1HZ1A 4BU4A 1Q7HA 1EQKA 3F8XA 4IIAA 1L5GB 1AR0A 5AIHA 1QALA 3HI7A 4HM6B 4HM3B 3V99A 3NBRA 1YJN3 2BMRB 3AGOA 3LH4A 2UX0A 3N54B 1GD3A 1Q40B 2JQ5A 1UDII 3KCHA 4WYKA 5EVHA 3KSED 5IEOA 3U97A 1BRIA 4XBXA 3PCRA 1BUJA 2CFKA 3HIGA 3F14A 3M8CA 3UJMA 1VQ93 1MWUA 1W02A 1V57A 4NPBA 3WDGB 1O7GB 3DGLA 1G96A 3RDEA 1I70A 1J2BA 3SOYA 1RMSA 3D5GA 3KE7A 1AVLA 2Q07A 3AGNA 3LTAA 1AV4A 1YJW3 5LC7A 1RTUA 3A5EA 1K41A 2XFTA 4EW5A 5M18A 1S5AA 3KZTA 3B8LA 3X3YA 3OW22 1VQN3 3T8UA 1BAOA 3ER7A 3CCQ3 4FMAA 1VQQA 4MMYB 1BRSA 1C54A 1RNTA 1E97A 1W6CA 3QK9A 3CC23 1VQ43 1IV7A 1RGHA 1JBTA 1E3RA 4TX4A 3MHEA 3CU3A 1N5HA 2CH9A 5CF1A 3QRDA 3IMAB 2D1WA 4J9AA 2GBWB 2SARA 4FCJA 1JKGB 3D3LA 4FCMA 4K1UA 5CK6A 5IF6A 4G1MB 3UB1A 2HMNB 1W2B2 4HOHA 4OK0A 1VQ83 1IQ8A 2YFIB 3FH1A 5D81A 2CK3H 3D5IA 1BNSA 2KF6A 1IVVA 2GXFA 1BNJA 4HJLB 2A15A 3WMDA 3A76A 2XRXB 5AI1A 1B2MA 2ZA4A 3GZBA 2BT3A 1VQK3 3GZYB 3SEDA 3CCL3 1K28A 5M1AA 3CCS3 1BGSA 1DETA 4N6OB 1O7NB 3NUVA 2IY2A 3GZXB 4GHOA 1BNIA 3VGNA 2STDA 5D83A 5HOHA 1RNBA 3X3XA 2AADA 1BRJA 3UL5A 1Q814 2CWUA 2QA43 1UI7A 2KAAA 2CFGA 1BSAA 4N3VA 1YJ93 5FW5A 1W2ZA 2RBIA 3I553 2INXA 1ZX2A 1GD4A 1RKYA 1BRKA 1O7WB 9RNTA 3EX9A 7GSPA 2Z6BA 1IQYA 3SOAA 4KZ1A 2KF3A 1OUNA 1TP6A 1OACA 1YVBI 2LYXA 2F99A 1A2KA 3SXXA 4MEIA 3STDA 1VQM3 1RDSA 2GU3A 1LQGC 3PXMA 3SX1A 2O9UX 3GZRA 2RSXA 1N5PA 4HM7B 4KT3B 1KWIA 1V58A 4FMCA 3K63A 1EA2A 3EF8A 1AVKA 3X40A 2W2CA 2CG0A 1D6UA 3MYTA 1DVCA 1BRHA 3V98A 3WR2A 2W03A 4K1VA 1B21A 1MWSA 3AHSA 3KKGA 4N6NB 3G4S3 3K9MC 4MJDA 1S723 3JUMA 3JUNA 4KFEA 2BHMA 3DH2A 3EQQB 3EHCA 1GY5A 1KC84 3MPHA 1RGAA 1IVUA 1FUSA 3CCJ3 4XDWA 1VQP3 2CIUA 3FF0A 2IA7A 3KSPA 1DMNA 5AIGA 7RNTA 3CCR3 4RNZA 1IT7A 3I563 1TUHA 1LNIA 3Q3FA 1CQSA 2K3DA 4AKYA 2MF7A 3SLUA 1RGCA 1X1WA 4HKVB 4RNYA 1E3VA 2CFDA 4LEHA 5AEUB 4N6UA 1BRNL 4EV2A 5KP1A 1SIHA 1T5YA 2W6JH 3G6E3 1WMPA 2XSOB 1BNGA 2WGQA 2LQVA 2ZL8A 1GOYA 1JJ22 1ASKA 1QJGA 1GMQA 1D6ZA 1YIT3 2E2VA 3K0ZA 4IT7A 3BIRA 4CJNA 2I9WA 5G2GA 2CHCA 5RNTA 1RGKA 1WMNA 1IVWA 2F56A 4XDVA 2L1SA 3F40A 4HM5B 3JUQA 3VSYA 3MG2A 3X3ZA 3CME3 4ORLA 1X1YA 1G02A 3Q1CA 3VF1A 1BSDA 4EYCA 1GY7A 3FF2A 1UW1A 1HU9A 1N9JA 2PNCA 1FZUA 1BOXA 1TTOA 3U1WA 3CC73 1GY6A 4CDLA 4EBGA 2RCDA 3FGYA 2H0GA 2CX1A 1Q40A 3FG4A 1GSPA 2C4BA 2HMLB 1AY7A 1HYFA 2OCTA 3FSDA 1EG9B 3CMA3 3MWZA 1LVNA 2ML5A 2Y73A 1NO3A 3BLZA 4H3UA 1M1XB 1G0TA 3CD63 1IQXA 1JN5A 1I3IA 4AKZA 3CPW2 1JBSA 3JVCA 1PFPA 1GOVA 1YHQ3 2PZVA 1TJDA 1STFI 4HBRA 4WP5A 2CKFB 2HOHA 3AHWA 1UCJA 3FKAA 4MMXB 1EUIC 4KFDA 1Q864 1B3SA 4J8TA 3PZWA 1IYYA 3ZG5A 2WO0A 4HZBB 3N8BA 4L8PA 1Q824 3GAXA 3JUPA 3GSPA 1FW7A 1RGGA 5EQLA 2QEX3 5A0OB 4WYKB 2MC8A 4EC6A 1OPYA 2R41A 1GMRA 1GOUA 2KRTA 5AYRB 4R80A 3DXOA 1KQS2 1IV9A 1JZDA 4KVHA 5GSPA 2OWPA 4N6MA 5AIIA 3MSOA 1TFOA 2KXGA 3G8ZA 3NHXA 5JPUA 1DE3A 1RCKA 2ML6A 4LZIA 2XF3A 1CH0A 3LZAA 3OXAA 3PS8A 2SBLA 1YGEA 3FG3A 3CCE3 4HZ9B 4ILFA 1Q9EA 3G16A 3CNMA 4N6V0 1LOXA 5EEOA 1OHOA 4J5KA 5AYSC 1UGHI 1JBRA 3KN4A 3EN8A 3HK4A 3AMOA 2P05A 1U5OA 3PYJA 1CEWI 3CPOA 1BANA 3ECFA 1JB2A 3CCV3 4FR9A 4EV5A 2GEYA 2W56A 4O02B 1YIJ3 1TU5A 1I2GA 3FLJA 3RNTA 5HGRA 3WOEB 4IPBA 5KP4A 1D6YA 3OWUA 3PCSA 4HYZA 3X42A 2R4IA 2OOVC 1JRQA 1OF5A 3S67A 4BIRA 1A67A 5I97A 1WMOA 1BU4A 1NU3A 3BNCA 2XSHB 2WOFA 4OUQA 4BTYA 2FXTA 3FCSB 2K54A 4WFOA 2Y74A 4AEQA 7STDA 3NQZA 1UGIA 1JB4A 1OHSA 4XM4A 1DVDA 1RN1A 2YX9A 3S5CA 1CYVA 3NV0B 3SVAA 4K90B 1FUTA 3ROBA 6STDA 3KIIA 1B20A 3HOHA 4O2HA 3MG3A 5BIRA 4OVMA 4R4KA 1RJOA 1OCVA 1UUWB 2CFLA 3AMOB 1V74A 1M9GA 2M7OA 5IG4A 3I0YA 2QIYA 3S28A 2D42A 3NQYA 3ZG0A 1YNVX 1UCLA 2GSPA 3NV0A 1FGTA 1GYBA 2XGLA 1X1XA 3WOFB 1HKXA 2CFWA 1TIJA 3SYUA 3HX8A 1N8R4 1NDOB 3OWYA 5G1LA 1M1K4 2UGIA 1U8CB 3DGOA 2CC3A 3LTBA 1BSBA 1QAFA 1LOYA 3BB9A 2AAEA 1I0XA 2BO9B 2WGOA 3KFQC 2IUJA 1BSCA 1FGMA 4L8OA 1JKGA 2E2UA 2J8XB 3NM7A 1FA3A 2IMJA 1O7PB 1PYLA 4LYLB 8CHOA 3OV4A 1VQ53 5DRVA 3GRDA 5IG3A 2CWVA 1NB5I 3DY5A 1BUQA 2W56B 1JNQA 3S29A 4BTXA 3O8YA 5TGNA 2KCDA
chains in the Genus database with same CATH topology
2SARA 1SARA 1I2FA 1B2SA 2BIRA 1I3IA 1I0VA 1UCIA 1JBSA 4HOHA 4GSPA 1GOVA 1ZGXA 1BNRA 2BU4A 3D5IA 3DGYA 1BNSA 2KF6A 2HOHA 3AHWA 1UCJA 1BNJA 8RNTA 1I3FA 1B3SA 6GSPA 1B2MA 1MGRA 2ZA4A 1IYYA 2KF5A 1A2PA 1RN4A 1BGSA 1RGLA 1DETA 1RGEA 1R4YA 1BNFA 1AQZA 1PY3A 4GHOA 3GSPA 1FW7A 1BNIA 1RGGA 1B2ZA 5HOHA 1BIRA 3D4AA 1RNBA 2AADA 1BRJA 2F5MA 1LOWA 1GMRA 1GOUA 1RSNA 1RCLA 2KAAA 1BSAA 3WHOA 2F4YA 2RBIA 5GSPA 1BRKA 9RNTA 7GSPA 1BRGA 5BU4A 1BNEA 6RNTA 2KF3A 1RCKA 1T2IA 1DE3A 1CH0A 1TRQA 1RLSA 1Q9EA 1RDSA 1X1UA 4J5KA 1FYSA 1B2UA 1JBRA 1RGFA 1RHLA 4RNTA 1UCKA 1MGWA 1BANA 1BRHA 3WR2A 1BVIA 1B21A 2RNTA 1I2GA 3AHSA 3RNTA 4J5GA 1GMPA 1LOVA 2KF4A 1LRAA 4BIRA 3DH2A 1BU4A 1RGAA 1FUSA 1BSEA 2F5WA 1RN1A 1TRPA 7RNTA 1FUTA 1I2EA 4HAAA 1LNIA 3Q3FA 1B20A 3HOHA 1HZ1A 1T2HA 4BU4A 5BIRA 1RGCA 1X1WA 3URPA 1BRNL 3AGOA 3KCHA 1BNGA 1BRIA 1YNVX 1UCLA 1GOYA 1BUJA 1GMQA 2GSPA 1X1XA 3BIRA 5RNTA 1I70A 1RMSA 3D5GA 3SYUA 1RGKA 3AGNA 1YVSA 2F56A 1B27A 1RTUA 3A5EA 1BSBA 1LOYA 2AAEA 1I0XA 1X1YA 1G02A 1I8VA 1BSCA 3BU4A 1BAOA 1BSDA 1PYLA 1BRSA 1YGWA 1C54A 1FZUA 1RNTA 1BOXA 1TTOA 1RGHA 1JBTA 1GSPA 2C4BA 1AY7A 1HYFA 1B2XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2SAR A;  1SAR A;  1I2F A;  1B2S A;  2BIR A;  1I3I A;  1I0V A;  1UCI A;  1JBS A;  4HOH A;  4GSP A;  1GOV A;  1ZGX A;  1BNR A;  2BU4 A;  3D5I A;  3DGY A;  1BNS A;  2KF6 A;  2HOH A;  3AHW A;  1UCJ A;  1BNJ A;  8RNT A;  1I3F A;  1B3S A;  6GSP A;  1B2M A;  1MGR A;  2ZA4 A;  1IYY A;  2KF5 A;  1A2P A;  1RN4 A;  1BGS A;  1RGL A;  1DET A;  1RGE A;  1R4Y A;  1BNF A;  1AQZ A;  1PY3 A;  4GHO A;  3GSP A;  1FW7 A;  1BNI A;  1RGG A;  1B2Z A;  5HOH A;  1BIR A;  3D4A A;  1RNB A;  2AAD A;  1BRJ A;  2F5M A;  1LOW A;  1GMR A;  1GOU A;  1RSN A;  1RCL A;  2KAA A;  1BSA A;  3WHO A;  2F4Y A;  2RBI A;  5GSP A;  1BRK A;  9RNT A;  7GSP A;  1BRG A;  5BU4 A;  1BNE A;  6RNT A;  2KF3 A;  1RCK A;  1T2I A;  1DE3 A;  1CH0 A;  1TRQ A;  1RLS A;  1Q9E A;  1RDS A;  1X1U A;  4J5K A;  1FYS A;  1B2U A;  1JBR A;  1RGF A;  1RHL A;  4RNT A;  1UCK A;  1MGW A;  1BAN A;  1BRH A;  3WR2 A;  1BVI A;  1B21 A;  2RNT A;  1I2G A;  3AHS A;  3RNT A;  4J5G A;  1GMP A;  1LOV A;  2KF4 A;  1LRA A;  4BIR A;  3DH2 A;  1BU4 A;  1RGA A;  1FUS A;  1BSE A;  2F5W A;  1RN1 A;  1TRP A;  7RNT A;  1FUT A;  1I2E A;  4HAA A;  1LNI A;  3Q3F A;  1B20 A;  3HOH A;  1HZ1 A;  1T2H A;  4BU4 A;  5BIR A;  1RGC A;  1X1W A;  3URP A;  1BRN L;  3AGO A;  3KCH A;  1BNG A;  1BRI A;  1YNV X;  1UCL A;  1GOY A;  1BUJ A;  1GMQ A;  2GSP A;  1X1X A;  3BIR A;  5RNT A;  1I70 A;  1RMS A;  3D5G A;  3SYU A;  1RGK A;  3AGN A;  1YVS A;  2F56 A;  1B27 A;  1RTU A;  3A5E A;  1BSB A;  1LOY A;  2AAE A;  1I0X A;  1X1Y A;  1G02 A;  1I8V A;  1BSC A;  3BU4 A;  1BAO A;  1BSD A;  1PYL A;  1BRS A;  1YGW A;  1C54 A;  1FZU A;  1RNT A;  1BOX A;  1TTO A;  1RGH A;  1JBT A;  1GSP A;  2C4B A;  1AY7 A;  1HYF A;  1B2X A; 
#chains in the Genus database with same CATH topology
 1MOL A;  2IUK A;  3UNL A;  3K5T A;  4LMI A;  1IVX A;  3DZL A;  2OTL 3;  1SAR A;  3IJE B;  3DM8 A;  1FGR A;  1UI8 A;  1DMQ A;  1UCI A;  2QGU A;  4GSP A;  1OGX A;  1WNH A;  1ZGX A;  3Q90 A;  1Q7Y 4;  3EE1 A;  5AIF A;  3RGA A;  3DGY A;  1IT8 A;  2HMK B;  2XFS A;  4BTW A;  1BNR A;  2B24 B;  2V1L A;  8RNT A;  2UUG C;  1QVF 2;  2H0H A;  3MG1 A;  1ISK A;  2KF5 A;  1A2P A;  3BNE A;  4X2H A;  3HII A;  1JB5 A;  1RGE A;  1BNF A;  2CW9 A;  1PY3 A;  4L7K A;  1LNH A;  3Q2P A;  1BIR A;  3NX0 A;  4R9L A;  1NJI 4;  2F5M A;  5CLK A;  1LOW A;  5IG0 A;  3RGR A;  2XH9 A;  1RCL A;  4NHF A;  1UUV B;  3LTD A;  1Z1S A;  2F4Y A;  2CG1 A;  5BVB A;  4PEJ A;  3V92 A;  3NXJ A;  1TFK A;  2BMQ B;  3N9H A;  4EXR A;  3G71 3;  3WA3 A;  4CCV A;  4LGQ A;  1ULJ B;  2F86 B;  2K0M A;  1BRG A;  2OQE A;  5ELJ A;  1BNE A;  5DRE A;  1FGQ A;  1W01 A;  3B4P A;  1QMA A;  1W7C A;  4XB5 A;  3DGN A;  4HM1 B;  1RLS A;  4JF8 A;  3UL6 A;  3CXC 2;  4X2O A;  1X1U A;  2CX0 A;  4I5Q A;  1LXE A;  1FYS A;  1IK3 A;  4GL6 A;  4HVN A;  1RHL A;  4RNT A;  3CCM 3;  1SPU A;  3K7C A;  2CWT A;  2BNG A;  1K73 4;  5STD A;  2JDI H;  4HM8 B;  2RNT A;  4STD A;  3JUO A;  1QAK A;  4J5G A;  1GMP A;  1LOV A;  1RRH A;  4NRE A;  3H51 A;  2YFJ B;  1LRA A;  3E99 A;  1NWW A;  2C11 A;  4FCZ A;  1STD A;  2W9P A;  5CF2 A;  2RGQ A;  1JZO A;  4KFF A;  5IEP A;  1N8Q A;  1TRP A;  4DKI A;  4O8S A;  1T2H A;  3L0R A;  4FMB A;  4WWU C;  3CNX A;  3URP A;  2P0X A;  2W9Q A;  2P0M A;  4U13 A;  2L4V A;  5IER A;  3OWS A;  5LC6 A;  5AEW B;  1FGO A;  1MWR A;  3J7Y d;  3LYG A;  4Q53 A;  3X41 A;  3GWR A;  4RBN A;  4N6T A;  2Z7A A;  1OH0 A;  3S27 A;  3NBJ A;  5ELU A;  2H0I A;  5IEN A;  3EN1 B;  4JRF A;  2OQE C;  1C7H A;  1IU7 A;  1WTH A;  1WQL B;  3BND A;  1OF5 B;  2GBX B;  4MMZ B;  3H3H A;  5KP3 A;  1YVS A;  2HMJ B;  1A90 A;  1B27 A;  2YFL B;  4CPK A;  3LT8 A;  1K9M 4;  2OTJ 3;  1T3B A;  5D82 A;  1DMM A;  1I8V A;  3BU4 A;  1N9E A;  1W6Y A;  3EBY A;  3G0K A;  1R4C A;  2W04 A;  1YGW A;  2ZHX B;  2O3O A;  3EBT A;  2Z76 A;  1ROA A;  4HM0 B;  3LXU X;  1VZZ A;  2BMO B;  4BL3 A;  5FGO A;  1A2V A;  1B2X A;  3DUK A;  2HMO B;  2B1X B;  1O7M B;  1Q42 A;  1RRL A;  3LT9 A;  4K61 A;  1CYU A;  1I2F A;  1B2S A;  2BIR A;  3T8N A;  1K8A 4;  3MKI A;  4ZM8 A;  1I0V A;  1GS3 A;  1MWT A;  1Y4K A;  4XBY A;  3BNB A;  1OGZ A;  1SII A;  4RZM A;  2GEX A;  1SQW A;  2BU4 A;  1VQO 3;  3DGM A;  3ALA A;  2WOH A;  4WHA A;  3B7C A;  1I3F A;  3PGB A;  6GSP A;  1UUG B;  1MGR A;  3D9R A;  1EEJ A;  2XR8 B;  3LML A;  3DMC A;  1W00 A;  1NB3 I;  5CXO A;  4R1K A;  5IW9 A;  1RN4 A;  1RGL A;  1R4Y A;  1ZS7 A;  1AQZ A;  3T0U A;  2XGN A;  1EKM A;  4LSO A;  1B2Z A;  3F8H A;  3D4A A;  3D79 A;  2RFR A;  1RSN A;  1YI2 3;  3IPT A;  3CCU 3;  3WHO A;  1MNL A;  1VQL 3;  3CC4 3;  3EJV A;  3LTC A;  4R9K A;  1RN7 A;  5JBS A;  1FUW A;  2XEP A;  2ZDJ A;  4BL2 A;  2W0Q A;  2P38 A;  3ZFZ A;  4FMD A;  5BU4 A;  6RNT A;  3F7S A;  1T2I A;  2FNQ A;  3HZP A;  1TRQ A;  4HM4 B;  1O7H B;  2FGT A;  4XBT A;  4GB5 A;  3WOD G;  3LOY A;  3FZW A;  1ROV A;  2F98 A;  5M19 A;  1B2U A;  3NM2 A;  1RGF A;  1OHP A;  3OX9 A;  1UCK A;  1KSI A;  1MGW A;  1W6G A;  2P09 A;  2E2T A;  2Z77 A;  1BVI A;  1NNV A;  4HM2 B;  2OOV A;  3TDG A;  3NBB A;  5JPP A;  1PU4 A;  1M90 4;  1W4N A;  3FG1 A;  4I4K A;  5BXQ A;  4N6L A;  5IG5 A;  2GU1 A;  5G1K A;  4QWT A;  1W5Z A;  2KF4 A;  3B4O A;  1KD1 4;  1SJW A;  1DYU A;  3F9S A;  1VQ6 3;  2HMM B;  3EC9 A;  1ULI B;  1BSE A;  2C10 A;  2F5W A;  3F7X A;  1F8N A;  1LQM B;  1ZO2 A;  1JV2 B;  3EB8 A;  4O3V A;  1I2E A;  4HAA A;  1US1 A;  1IDP A;  2IYJ A;  1JN5 B;  1QVG 2;  3WA2 X;  4H61 A;  1VQ7 3;  1HZ1 A;  4BU4 A;  1Q7H A;  1EQK A;  3F8X A;  4IIA A;  1L5G B;  1AR0 A;  5AIH A;  1QAL A;  3HI7 A;  4HM6 B;  4HM3 B;  3V99 A;  3NBR A;  1YJN 3;  2BMR B;  3AGO A;  3LH4 A;  2UX0 A;  3N54 B;  1GD3 A;  1Q40 B;  2JQ5 A;  1UDI I;  3KCH A;  4WYK A;  5EVH A;  3KSE D;  5IEO A;  3U97 A;  1BRI A;  4XBX A;  3PCR A;  1BUJ A;  2CFK A;  3HIG A;  3F14 A;  3M8C A;  3UJM A;  1VQ9 3;  1MWU A;  1W02 A;  1V57 A;  4NPB A;  3WDG B;  1O7G B;  3DGL A;  1G96 A;  3RDE A;  1I70 A;  1J2B A;  3SOY A;  1RMS A;  3D5G A;  3KE7 A;  1AVL A;  2Q07 A;  3AGN A;  3LTA A;  1AV4 A;  1YJW 3;  5LC7 A;  1RTU A;  3A5E A;  1K41 A;  2XFT A;  4EW5 A;  5M18 A;  1S5A A;  3KZT A;  3B8L A;  3X3Y A;  3OW2 2;  1VQN 3;  3T8U A;  1BAO A;  3ER7 A;  3CCQ 3;  4FMA A;  1VQQ A;  4MMY B;  1BRS A;  1C54 A;  1RNT A;  1E97 A;  1W6C A;  3QK9 A;  3CC2 3;  1VQ4 3;  1IV7 A;  1RGH A;  1JBT A;  1E3R A;  4TX4 A;  3MHE A;  3CU3 A;  1N5H A;  2CH9 A;  5CF1 A;  3QRD A;  3IMA B;  2D1W A;  4J9A A;  2GBW B;  2SAR A;  4FCJ A;  1JKG B;  3D3L A;  4FCM A;  4K1U A;  5CK6 A;  5IF6 A;  4G1M B;  3UB1 A;  2HMN B;  1W2B 2;  4HOH A;  4OK0 A;  1VQ8 3;  1IQ8 A;  2YFI B;  3FH1 A;  5D81 A;  2CK3 H;  3D5I A;  1BNS A;  2KF6 A;  1IVV A;  2GXF A;  1BNJ A;  4HJL B;  2A15 A;  3WMD A;  3A76 A;  2XRX B;  5AI1 A;  1B2M A;  2ZA4 A;  3GZB A;  2BT3 A;  1VQK 3;  3GZY B;  3SED A;  3CCL 3;  1K28 A;  5M1A A;  3CCS 3;  1BGS A;  1DET A;  4N6O B;  1O7N B;  3NUV A;  2IY2 A;  3GZX B;  4GHO A;  1BNI A;  3VGN A;  2STD A;  5D83 A;  5HOH A;  1RNB A;  3X3X A;  2AAD A;  1BRJ A;  3UL5 A;  1Q81 4;  2CWU A;  2QA4 3;  1UI7 A;  2KAA A;  2CFG A;  1BSA A;  4N3V A;  1YJ9 3;  5FW5 A;  1W2Z A;  2RBI A;  3I55 3;  2INX A;  1ZX2 A;  1GD4 A;  1RKY A;  1BRK A;  1O7W B;  9RNT A;  3EX9 A;  7GSP A;  2Z6B A;  1IQY A;  3SOA A;  4KZ1 A;  2KF3 A;  1OUN A;  1TP6 A;  1OAC A;  1YVB I;  2LYX A;  2F99 A;  1A2K A;  3SXX A;  4MEI A;  3STD A;  1VQM 3;  1RDS A;  2GU3 A;  1LQG C;  3PXM A;  3SX1 A;  2O9U X;  3GZR A;  2RSX A;  1N5P A;  4HM7 B;  4KT3 B;  1KWI A;  1V58 A;  4FMC A;  3K63 A;  1EA2 A;  3EF8 A;  1AVK A;  3X40 A;  2W2C A;  2CG0 A;  1D6U A;  3MYT A;  1DVC A;  1BRH A;  3V98 A;  3WR2 A;  2W03 A;  4K1V A;  1B21 A;  1MWS A;  3AHS A;  3KKG A;  4N6N B;  3G4S 3;  3K9M C;  4MJD A;  1S72 3;  3JUM A;  3JUN A;  4KFE A;  2BHM A;  3DH2 A;  3EQQ B;  3EHC A;  1GY5 A;  1KC8 4;  3MPH A;  1RGA A;  1IVU A;  1FUS A;  3CCJ 3;  4XDW A;  1VQP 3;  2CIU A;  3FF0 A;  2IA7 A;  3KSP A;  1DMN A;  5AIG A;  7RNT A;  3CCR 3;  4RNZ A;  1IT7 A;  3I56 3;  1TUH A;  1LNI A;  3Q3F A;  1CQS A;  2K3D A;  4AKY A;  2MF7 A;  3SLU A;  1RGC A;  1X1W A;  4HKV B;  4RNY A;  1E3V A;  2CFD A;  4LEH A;  5AEU B;  4N6U A;  1BRN L;  4EV2 A;  5KP1 A;  1SIH A;  1T5Y A;  2W6J H;  3G6E 3;  1WMP A;  2XSO B;  1BNG A;  2WGQ A;  2LQV A;  2ZL8 A;  1GOY A;  1JJ2 2;  1ASK A;  1QJG A;  1GMQ A;  1D6Z A;  1YIT 3;  2E2V A;  3K0Z A;  4IT7 A;  3BIR A;  4CJN A;  2I9W A;  5G2G A;  2CHC A;  5RNT A;  1RGK A;  1WMN A;  1IVW A;  2F56 A;  4XDV A;  2L1S A;  3F40 A;  4HM5 B;  3JUQ A;  3VSY A;  3MG2 A;  3X3Z A;  3CME 3;  4ORL A;  1X1Y A;  1G02 A;  3Q1C A;  3VF1 A;  1BSD A;  4EYC A;  1GY7 A;  3FF2 A;  1UW1 A;  1HU9 A;  1N9J A;  2PNC A;  1FZU A;  1BOX A;  1TTO A;  3U1W A;  3CC7 3;  1GY6 A;  4CDL A;  4EBG A;  2RCD A;  3FGY A;  2H0G A;  2CX1 A;  1Q40 A;  3FG4 A;  1GSP A;  2C4B A;  2HML B;  1AY7 A;  1HYF A;  2OCT A;  3FSD A;  1EG9 B;  3CMA 3;  3MWZ A;  1LVN A;  2ML5 A;  2Y73 A;  1NO3 A;  3BLZ A;  4H3U A;  1M1X B;  1G0T A;  3CD6 3;  1IQX A;  1JN5 A;  1I3I A;  4AKZ A;  3CPW 2;  1JBS A;  3JVC A;  1PFP A;  1GOV A;  1YHQ 3;  2PZV A;  1TJD A;  1STF I;  4HBR A;  4WP5 A;  2CKF B;  2HOH A;  3AHW A;  1UCJ A;  3FKA A;  4MMX B;  1EUI C;  4KFD A;  1Q86 4;  1B3S A;  4J8T A;  3PZW A;  1IYY A;  3ZG5 A;  2WO0 A;  4HZB B;  3N8B A;  4L8P A;  1Q82 4;  3GAX A;  3JUP A;  3GSP A;  1FW7 A;  1RGG A;  5EQL A;  2QEX 3;  5A0O B;  4WYK B;  2MC8 A;  4EC6 A;  1OPY A;  2R41 A;  1GMR A;  1GOU A;  2KRT A;  5AYR B;  4R80 A;  3DXO A;  1KQS 2;  1IV9 A;  1JZD A;  4KVH A;  5GSP A;  2OWP A;  4N6M A;  5AII A;  3MSO A;  1TFO A;  2KXG A;  3G8Z A;  3NHX A;  5JPU A;  1DE3 A;  1RCK A;  2ML6 A;  4LZI A;  2XF3 A;  1CH0 A;  3LZA A;  3OXA A;  3PS8 A;  2SBL A;  1YGE A;  3FG3 A;  3CCE 3;  4HZ9 B;  4ILF A;  1Q9E A;  3G16 A;  3CNM A;  4N6V 0;  1LOX A;  5EEO A;  1OHO A;  4J5K A;  5AYS C;  1UGH I;  1JBR A;  3KN4 A;  3EN8 A;  3HK4 A;  3AMO A;  2P05 A;  1U5O A;  3PYJ A;  1CEW I;  3CPO A;  1BAN A;  3ECF A;  1JB2 A;  3CCV 3;  4FR9 A;  4EV5 A;  2GEY A;  2W56 A;  4O02 B;  1YIJ 3;  1TU5 A;  1I2G A;  3FLJ A;  3RNT A;  5HGR A;  3WOE B;  4IPB A;  5KP4 A;  1D6Y A;  3OWU A;  3PCS A;  4HYZ A;  3X42 A;  2R4I A;  2OOV C;  1JRQ A;  1OF5 A;  3S67 A;  4BIR A;  1A67 A;  5I97 A;  1WMO A;  1BU4 A;  1NU3 A;  3BNC A;  2XSH B;  2WOF A;  4OUQ A;  4BTY A;  2FXT A;  3FCS B;  2K54 A;  4WFO A;  2Y74 A;  4AEQ A;  7STD A;  3NQZ A;  1UGI A;  1JB4 A;  1OHS A;  4XM4 A;  1DVD A;  1RN1 A;  2YX9 A;  3S5C A;  1CYV A;  3NV0 B;  3SVA A;  4K90 B;  1FUT A;  3ROB A;  6STD A;  3KII A;  1B20 A;  3HOH A;  4O2H A;  3MG3 A;  5BIR A;  4OVM A;  4R4K A;  1RJO A;  1OCV A;  1UUW B;  2CFL A;  3AMO B;  1V74 A;  1M9G A;  2M7O A;  5IG4 A;  3I0Y A;  2QIY A;  3S28 A;  2D42 A;  3NQY A;  3ZG0 A;  1YNV X;  1UCL A;  2GSP A;  3NV0 A;  1FGT A;  1GYB A;  2XGL A;  1X1X A;  3WOF B;  1HKX A;  2CFW A;  1TIJ A;  3SYU A;  3HX8 A;  1N8R 4;  1NDO B;  3OWY A;  5G1L A;  1M1K 4;  2UGI A;  1U8C B;  3DGO A;  2CC3 A;  3LTB A;  1BSB A;  1QAF A;  1LOY A;  3BB9 A;  2AAE A;  1I0X A;  2BO9 B;  2WGO A;  3KFQ C;  2IUJ A;  1BSC A;  1FGM A;  4L8O A;  1JKG A;  2E2U A;  2J8X B;  3NM7 A;  1FA3 A;  2IMJ A;  1O7P B;  1PYL A;  4LYL B;  8CHO A;  3OV4 A;  1VQ5 3;  5DRV A;  3GRD A;  5IG3 A;  2CWV A;  1NB5 I;  3DY5 A;  1BUQ A;  2W56 B;  1JNQ A;  3S29 A;  4BTX A;  3O8Y A;  5TGN A;  2KCD A; 
#chains in the Genus database with same CATH homology
 2SAR A;  1SAR A;  1I2F A;  1B2S A;  2BIR A;  1I3I A;  1I0V A;  1UCI A;  1JBS A;  4HOH A;  4GSP A;  1GOV A;  1ZGX A;  1BNR A;  2BU4 A;  3D5I A;  3DGY A;  1BNS A;  2KF6 A;  2HOH A;  3AHW A;  1UCJ A;  1BNJ A;  8RNT A;  1I3F A;  1B3S A;  6GSP A;  1B2M A;  1MGR A;  2ZA4 A;  1IYY A;  2KF5 A;  1A2P A;  1RN4 A;  1BGS A;  1RGL A;  1DET A;  1RGE A;  1R4Y A;  1BNF A;  1AQZ A;  1PY3 A;  4GHO A;  3GSP A;  1FW7 A;  1BNI A;  1RGG A;  1B2Z A;  5HOH A;  1BIR A;  3D4A A;  1RNB A;  2AAD A;  1BRJ A;  2F5M A;  1LOW A;  1GMR A;  1GOU A;  1RSN A;  1RCL A;  2KAA A;  1BSA A;  3WHO A;  2F4Y A;  2RBI A;  5GSP A;  1BRK A;  9RNT A;  7GSP A;  1BRG A;  5BU4 A;  1BNE A;  6RNT A;  2KF3 A;  1RCK A;  1T2I A;  1DE3 A;  1CH0 A;  1TRQ A;  1RLS A;  1Q9E A;  1RDS A;  1X1U A;  4J5K A;  1FYS A;  1B2U A;  1JBR A;  1RGF A;  1RHL A;  4RNT A;  1UCK A;  1MGW A;  1BAN A;  1BRH A;  3WR2 A;  1BVI A;  1B21 A;  2RNT A;  1I2G A;  3AHS A;  3RNT A;  4J5G A;  1GMP A;  1LOV A;  2KF4 A;  1LRA A;  4BIR A;  3DH2 A;  1BU4 A;  1RGA A;  1FUS A;  1BSE A;  2F5W A;  1RN1 A;  1TRP A;  7RNT A;  1FUT A;  1I2E A;  4HAA A;  1LNI A;  3Q3F A;  1B20 A;  3HOH A;  1HZ1 A;  1T2H A;  4BU4 A;  5BIR A;  1RGC A;  1X1W A;  3URP A;  1BRN L;  3AGO A;  3KCH A;  1BNG A;  1BRI A;  1YNV X;  1UCL A;  1GOY A;  1BUJ A;  1GMQ A;  2GSP A;  1X1X A;  3BIR A;  5RNT A;  1I70 A;  1RMS A;  3D5G A;  3SYU A;  1RGK A;  3AGN A;  1YVS A;  2F56 A;  1B27 A;  1RTU A;  3A5E A;  1BSB A;  1LOY A;  2AAE A;  1I0X A;  1X1Y A;  1G02 A;  1I8V A;  1BSC A;  3BU4 A;  1BAO A;  1BSD A;  1PYL A;  1BRS A;  1YGW A;  1C54 A;  1FZU A;  1RNT A;  1BOX A;  1TTO A;  1RGH A;  1JBT A;  1GSP A;  2C4B A;  1AY7 A;  1HYF A;  1B2X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...