1IYYA

Nmr structure of gln25-ribonuclease t1, 24 structures
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYQLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords RIBONUCLEASE T1
publication title Determination of the NMR structure of Gln25-ribonuclease T1.
pubmed doi rcsb
source organism Aspergillus oryzae
total genus 10
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2002-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1iyyA00
1MGRA 1I3IA 1RCKA 2SARA 3D5IA 1BSCA 4GHOA 1RCLA 2RBIA 3WR2A 1C54A 1I0VA 1BANA 1RN4A 3AHWA 4HOHA 1RGGA 1LOVA 5BIRA 3SYUA 1B21A 1A2PA 1RGHA 4J5KA 1G02A 1DETA 1BSAA 1I0XA 1BNJA 1B2XA 1RNTA 7RNTA 2GSPA 5HOHA 1I2FA 1RGKA 2AAEA 1I2EA 1BNSA 6GSPA 1BSDA 1B2SA 2ZA4A 1LOYA 3Q3FA 1IYYA 1BGSA 1GOUA 5RNTA 1JBTA 3AHSA 1BRKA 1RSNA 3DGYA 3RNTA 1RTUA 1RHLA 1RGFA 4GSPA 8RNTA 1BRNL 1SARA 4RNTA 3BU4A 1BVIA 1X1XA 1Q9EA 2BIRA 1JBSA 4J5GA 2F5MA 1JBRA 1BRSA 1BU4A 1X1YA 6RNTA 1AQZA 1RGLA 1GMRA 1I8VA 2F4YA 1X1UA 1PY3A 1BAOA 2HOHA 2RNTA 1BNGA 1RNBA 1R4YA 1BRIA 3AGNA 1B20A 1RMSA 2C4BA 1GOVA 1YNVX 1BOXA 1FUSA 3D4AA 1BIRA 3WHOA 1TRPA 3HOHA 1HYFA 1T2IA 1B2MA 1BUJA 3A5EA 1RGAA 1YVSA 1GSPA 3AGOA 1RGCA 1UCLA 2KF3A 2BU4A 1RGEA 1BNIA 3URPA 1RDSA 3GSPA 2F5WA 3D5GA 1BNEA 1TRQA 1FUTA 1BNRA 9RNTA 1TTOA 1UCKA 1RN1A 1FYSA 1X1WA 3BIRA 5BU4A 1UCJA 2KF5A 4BIRA 1B27A 1GMQA 2AADA 1BSEA 1I3FA 4HAAA 1AY7A 1BRHA 1LRAA 1GMPA 1B2ZA 2KF6A 3KCHA 1FW7A 1I70A 1BRGA 1MGWA 1BNFA 1LNIA 1GOYA 1BRJA 4BU4A 1I2GA 1YGWA 1ZGXA 1T2HA 2KF4A 1B2UA 2F56A 5GSPA 7GSPA 1LOWA 1CH0A 1DE3A 2KAAA 1BSBA 1HZ1A 3DH2A 1FZUA 1RLSA 1B3SA 1UCIA 1PYLA
chains in the Genus database with same CATH superfamily
3EBYA 2L4VA 1FA3A 1UDII 2CWTA 1EUIC 5AIIA 3WR2A 3SLUA 1CQSA 3H3HA 6STDA 1BANA 2BNGA 1TFOA 1FGMA 1O7MB 1RGGA 5BIRA 5IEPA 1AVKA 3MG3A 3SYUA 4L7KA 3LT8A 1A2PA 1RGHA 3GRDA 3PXMA 1WNHA 4J5KA 1ROVA 1YJ93 1Q40B 1BNJA 2UUGC 3CU3A 1F8NA 2XRXB 3K63A 2YFIB 4OK0A 3CCU3 1VQO3 1IV7A 4MMZB 4R80A 2W03A 1QALA 3FLJA 3CCS3 1RGKA 2RGQA 4G1MB 4N6V0 1W7CA 1W6CA 3UNLA 1IVVA 4AEQA 3CNMA 3B4OA 3F7XA 1JZOA 3DGOA 3ER7A 3Q3FA 1IQ8A 2HMMB 3CCJ3 4N6MA 2XSHB 5RNTA 3FG1A 3NBJA 1BRKA 1RSNA 1WQLB 3I0YA 4X2OA 1RHLA 2GEYA 3KIIA 2K0MA 1STDA 5IG0A 2RCDA 2OTL3 1SARA 4HKVB 2LYXA 4OUQA 5ELJA 2CX0A 1Q9EA 1UW1A 1HU9A 4O2HA 1C54A 1JBRA 3JVCA 2BO9B 3X3YA 3WA3A 1AQZA 1O7NB 1GMRA 2E2VA 1I8VA 5A0OB 1PY3A 2Y73A 3Q1CA 4IPBA 4R9KA 2HMOB 2ZL8A 1ASKA 1MOLA 3KFQC 1U5OA 1JV2B 3FCSB 1BNGA 1RNBA 1VQK3 1QVG2 3U97A 4CPKA 5EEOA 4HZ9B 3KKGA 5IENA 2F99A 2W9QA 4FMBA 1NDOB 3D3LA 2C4BA 1IK3A 3JUOA 1FUSA 2XGNA 3CCV3 5KP3A 5AYSC 3K0ZA 3HOHA 1PFPA 4HM7B 1NNVA 2IUJA 5M18A 3B8LA 3AGOA 4CDLA 3FZWA 2BMQB 1HKXA 4EW5A 1QAFA 1C7HA 3HK4A 1BNIA 1OH0A 3URPA 3LTDA 3CCE3 4H61A 1FGTA 2F5WA 3D5GA 5AYRB 4XBXA 1TRQA 2M7OA 4MJDA 1UCKA 3LZAA 2OQEC 1US1A 4LMIA 3G713 4RBNA 1S723 1FYSA 3BIRA 3X3XA 5BU4A 1EKMA 1D6UA 1WMPA 3F8HA 1GYBA 3FSDA 4KFDA 1GY6A 1UGHI 2AADA 3LTAA 1BSEA 4HAAA 4HM1B 3SVAA 4L8PA 1DVDA 1JB4A 1N8QA 1MWRA 3B4PA 4EC6A 1AY7A 4LEHA 3JUNA 1IDPA 1RKYA 4HM3B 1IV9A 1BRGA 1MGWA 3JUQA 3OXAA 3LYGA 2IMJA 2XFTA 3FH1A 2H0HA 3NXJA 4O3VA 5IG4A 4BU4A 4RNZA 1Q824 3PCRA 1KWIA 1Y4KA 5LC6A 2GEXA 1I2GA 5EQLA 2C11A 1B2UA 4BL2A 1GD3A 1DE3A 1YHQ3 2GU1A 3LOYA 1YVBI 4WP5A 1AVLA 1E97A 2HMKB 2IA7A 3BB9A 5M19A 1FGOA 2HMNB 1B3SA 3BNCA 5DREA 3FGYA 1LOXA 2GXFA 1I3IA 2CKFB 3D5IA 4N6LA 3JUPA 1SIHA 1ZS7A 1I0VA 4HOHA 1RRHA 3BLZA 2OOVC 5CXOA 1M1K4 3V92A 3S28A 4N3VA 2KXGA 4MMXB 1JB5A 1WMNA 2K54A 4HM2B 2ZHXB 2OCTA 4HYZA 1W6GA 1G02A 3MHEA 1UGIA 1BSAA 3CPW2 1EG9B 1RNTA 3NHXA 4HBRA 1JN5B 1JB2A 1LQGC 5AIGA 1VQ43 2YX9A 4J9AA 4HM0B 2O3OA 3NV0B 3DUKA 1I2EA 4O02B 1BNSA 2WOHA 3CPOA 1A2VA 2E2UA 2FXTA 2YFLB 3LMLA 3LTCA 3NUVA 4KFFA 3WOFB 2ZA4A 4CJNA 1ROAA 1O7PB 2J8XB 1IYYA 1BGSA 2FNQA 1GOUA 4EXRA 1O7GB 3AHSA 1MNLA 3RNTA 3O8YA 4N6TA 2W6JH 1W2B2 1RGFA 4FR9A 5IG5A 5AEUB 1BRNL 4RNTA 3BU4A 5D83A 1BVIA 3T0UA 1JRQA 3DGNA 2F5MA 5CK6A 3ALAA 1S5AA 2CFKA 6RNTA 4FCJA 4N6OB 1VQP3 1RGLA 3CCQ3 4IIAA 1N9EA 4FMAA 5TGNA 4N6UA 2F4YA 1D6YA 1ZO2A 1G0TA 1EQKA 3GAXA 2A15A 4MMYB 2INXA 3K9MC 5AEWB 2HOHA 3LXUX 4WFOA 1IQXA 2MC8A 1RJOA 1R4YA 3AMOA 1K41A 1W00A 3X40A 3GZBA 2ML5A 4AKZA 3FKAA 4R9LA 3WMDA 1RMSA 2XFSA 3IPTA 3OX9A 3M8CA 1YJW3 1NU3A 1O7HB 5DRVA 1OHSA 1BOXA 2P0MA 3F40A 3SX1A 1LXEA 3LT9A 5G1KA 4CCVA 2BHMA 5AIFA 2CC3A 1B2MA 4KFEA 3EB8A 3EN1B 3CME3 1OHPA 2RSXA 1VQ53 1UCLA 2I9WA 2KF3A 4LSOA 1YGEA 3IMAB 4LYLB 1M9GA 2P0XA 2SBLA 3DY5A 3RDEA 2CG0A 2OWPA 1VQ83 2IY2A 4XBTA 2JDIH 4WYKB 2C10A 3MPHA 1BNEA 3X42A 2CX1A 1FUTA 3E99A 1BNRA 2R41A 3LH4A 1VZZA 2XGLA 2Z77A 4K61A 2WGQA 4HVNA 2QA43 3Q90A 3K7CA 4GB5A 3EE1A 4NHFA 1IVWA 1OF5B 4FMCA 2B1XB 1GMQA 2H0GA 1YJN3 3ROBA 3T8UA 3CD63 3GZRA 3QRDA 2W56B 1LQMB 1GMPA 1LRAA 3F9SA 3LTBA 1B2ZA 4EV5A 1NO3A 1JKGB 1NWWA 3DGLA 1I70A 1FGRA 1OUNA 3KCHA 1IT8A 3QK9A 3G6E3 1FW7A 1W6YA 3EQQB 3J7Yd 3HIGA 1LNIA 2GU3A 3G8ZA 5AI1A 1BRJA 1U8CB 2F86B 5IEOA 1E3RA 1VQQA 2IYJA 2D42A 4H3UA 3VF1A 1FGQA 2QIYA 1LOWA 3HZPA 1KQS2 1D6ZA 3DM8A 1HZ1A 4HM4B 1BUQA 3DH2A 3ZFZA 3NBBA 4TX4A 1RLSA 1UCIA 3WA2X 1MGRA 4HM5B 5KP4A 1R4CA 2W9PA 3OW22 2CH9A 2SARA 2CHCA 4LZIA 2CG1A 1BSCA 3CXC2 1SPUA 1RCLA 3CC73 5IG3A 1A2KA 2XR8B 3BNEA 1RN4A 4N6NB 1LOVA 3S27A 1AR0A 4X2HA 3B7CA 1Q40A 3FF2A 1TJDA 1ZX2A 1W5ZA 3KE7A 1O7WB 4GL6A 4JF8A 4EYCA 1DETA 4FCZA 4STDA 5LC7A 3SXXA 5IW9A 3PCSA 3HI7A 2L1SA 3MG2A 3T8NA 3UL5A 1I2FA 5HOHA 3S29A 2W04A 4HM6B 2BT3A 6GSPA 1SJWA 4U13A 1BSDA 5CLKA 1K8A4 1K9M4 5FW5A 2XF3A 2Z7AA 1LOYA 2YFJB 4PEJA 1GD4A 2WO0A 3D79A 2CW9A 3TDGA 4R1KA 3DGYA 1LVNA 2STDA 3X41A 1RTUA 1OGXA 1QVF2 5HGRA 4K1VA 1IVUA 2ML6A 3HX8A 8RNTA 1MWSA 1W01A 3EBTA 3F7SA 5STDA 1X1XA 1NJI4 1JBSA 1UUVB 3L0RA 4J5GA 4JRFA 4AKYA 1BU4A 3CC43 5IERA 1PU4A 4IT7A 3EN8A 3EJVA 3V99A 2Q07A 1GS3A 3JUMA 3NQZA 2P05A 3BNDA 1TUHA 2RNTA 1TP6A 2R4IA 1DVCA 3WOEB 5BVBA 1ISKA 3DMCA 4HZBB 1UUGB 4I4KA 1NB3I 2MF7A 3KSPA 1B20A 1T3BA 1AV4A 2BMOB 2FGTA 3D4AA 1BIRA 3WHOA 3OWYA 1QMAA 1TRPA 3WDGB 3UJMA 1HYFA 1OHOA 1BUJA 1EEJA 1RGAA 2Z6BA 3KN4A 4HJLB 2CFLA 2XSOB 4BTWA 3KZTA 3GZYB 1EA2A 3BNBA 5M1AA 5D81A 1CEWI 1W4NA 1RGEA 2BU4A 2KRTA 1YI23 5G2GA 2GBWB 2HMJB 1TU5A 4Q53A 1FUWA 1G96A 2CFWA 9RNTA 2CIUA 3GWRA 3SOAA 1Q814 1MWTA 1UCJA 2KF5A 2HMLB 1B27A 1WMOA 4LGQA 1TIJA 5CF1A 2B24B 3STDA 1OPYA 4XM4A 5FGOA 4NREA 3RGAA 3NM7A 3F8XA 2W0QA 4EBGA 4KZ1A 3A76A 1VQ73 5JBSA 3IJEB 1RN7A 3WODG 1QAKA 1VQL3 5BXQA 1KSIA 1BNFA 3CCM3 2P38A 2D1WA 2OQEA 4DKIA 3I563 3DZLA 4NPBA 5AIHA 3FG3A 2KF4A 1CYVA 1STFI 3PS8A 8CHOA 2CFDA 4MEIA 1BSBA 2UX0A 4BL3A 1V74A 1J2BA 5EVHA 3NQYA 1JNQA 1V57A 3MWZA 3MYTA 3OWSA 1RCKA 2P09A 5ELUA 4GHOA 3ZG0A 2RBIA 3I553 1VQ93 3ECFA 1QJGA 1DMNA 3UL6A 3VSYA 3PYJA 3AHWA 5JPUA 2QEX3 1VQM3 2ZDJA 3F14A 1IQYA 3MKIA 2OTJ3 1B21A 3FG4A 3N9HA 3NM2A 1M904 4L8OA 1KD14 3VGNA 3NBRA 1JN5A 1I0XA 2O9UX 1E3VA 1B2XA 5KP1A 3NV0A 7RNTA 2GSPA 1JZDA 3PGBA 4XB5A 5JPPA 3G4S3 4I5QA 2W2CA 2V1LA 4BTXA 1GY7A 1RRLA 2AAEA 2XH9A 5G1LA 1ULIB 1L5GB 1B2SA 4KT3B 1N5HA 4RZMA 2H0IA 3D9RA 3CNXA 2XEPA 3S67A 3G16A 2OOVA 1T5YA 4XDWA 1JBTA 3KSED 4K1UA 1IT7A 2LQVA 4GSPA 2GBXB 2RFRA 4WHAA 2BIRA 2QGUA 2WOFA 1YIT3 4XBYA 3N8BA 3FF0A 1BRSA 3DXOA 1X1YA 3RGRA 1DMMA 3SOYA 4O8SA 2BMRB 5CF2A 1KC84 1X1UA 1Z1SA 1YIJ3 1BAOA 2KCDA 1W2ZA 3SEDA 2JQ5A 1A90A 3OWUA 3EC9A 2E2TA 1N9JA 4FMDA 5I97A 1BRIA 1OCVA 2Y74A 1Q42A 3AGNA 3K5TA 1VQN3 3AMOB 4KVHA 1GOVA 1IU7A 1OGZA 1YNVX 2CWVA 2CWUA 3EF8A 1IVXA 4RNYA 7STDA 1VQ63 3OV4A 4BTYA 3CMA3 4R4KA 1T2IA 1M1XB 1UI7A 3MSOA 3A5EA 1UI8A 1YVSA 3S5CA 1GSPA 1RGCA 1N8R4 3V98A 2WGOA 5IF6A 1DYUA 1N5PA 4ILFA 4WYKA 3Q2PA 1Q7Y4 1RDSA 1WTHA 3GSPA 4WWUC 3HIIA 3GZXB 1Q7HA 1K734 3MG1A 1TTOA 1JJ22 1OF5A 4FCMA 2CFGA 1NB5I 1RN1A 3NX0A 1X1WA 1W02A 2PNCA 4HM8B 4J8TA 3UB1A 3H51A 4OVMA 2CK3H 4BIRA 2UGIA 2W56A 3EX9A 1I3FA 1CYUA 3G0KA 1JKGA 1K28A 1BRHA 4QWTA 3ZG5A 1SIIA 3CC23 3DGMA 4ORLA 3PZWA 3CCR3 4XDVA 1DMQA 1LNHA 2Z76A 2KF6A 1UUWB 2PZVA 1GY5A 3U1WA 1ULJB 1MWUA 1GOYA 2IUKA 3EHCA 1Q864 2K3DA 4EV2A 1YGWA 1ZGXA 2F98A 4ZM8A 1A67A 1T2HA 5GSPA 2F56A 1TFKA 7GSPA 1OACA 1CH0A 4K90B 3X3ZA 3N54B 2KAAA 5D82A 1SQWA 1FZUA 1V58A 3CCL3 1PYLA
chains in the Genus database with same CATH topology
1MGRA 1I3IA 1RCKA 2SARA 3D5IA 1BSCA 4GHOA 1RCLA 2RBIA 3WR2A 1C54A 1I0VA 1BANA 1RN4A 3AHWA 4HOHA 1RGGA 1LOVA 5BIRA 3SYUA 1B21A 1A2PA 1RGHA 4J5KA 1G02A 1DETA 1BSAA 1I0XA 1BNJA 1B2XA 1RNTA 7RNTA 2GSPA 5HOHA 1I2FA 1RGKA 2AAEA 1I2EA 1BNSA 6GSPA 1BSDA 1B2SA 2ZA4A 1LOYA 3Q3FA 1IYYA 1BGSA 1GOUA 5RNTA 1JBTA 3AHSA 1BRKA 1RSNA 3DGYA 3RNTA 1RTUA 1RHLA 1RGFA 4GSPA 8RNTA 1BRNL 1SARA 4RNTA 3BU4A 1BVIA 1X1XA 1Q9EA 2BIRA 1JBSA 4J5GA 2F5MA 1JBRA 1BRSA 1BU4A 1X1YA 6RNTA 1AQZA 1RGLA 1GMRA 1I8VA 2F4YA 1X1UA 1PY3A 1BAOA 2HOHA 2RNTA 1BNGA 1RNBA 1R4YA 1BRIA 3AGNA 1B20A 1RMSA 2C4BA 1GOVA 1YNVX 1BOXA 1FUSA 3D4AA 1BIRA 3WHOA 1TRPA 3HOHA 1HYFA 1T2IA 1B2MA 1BUJA 3A5EA 1RGAA 1YVSA 1GSPA 3AGOA 1RGCA 1UCLA 2KF3A 2BU4A 1RGEA 1BNIA 3URPA 1RDSA 3GSPA 2F5WA 3D5GA 1BNEA 1TRQA 1FUTA 1BNRA 9RNTA 1TTOA 1UCKA 1RN1A 1FYSA 1X1WA 3BIRA 5BU4A 1UCJA 2KF5A 4BIRA 1B27A 1GMQA 2AADA 1BSEA 1I3FA 4HAAA 1AY7A 1BRHA 1LRAA 1GMPA 1B2ZA 2KF6A 3KCHA 1FW7A 1I70A 1BRGA 1MGWA 1BNFA 1LNIA 1GOYA 1BRJA 4BU4A 1I2GA 1YGWA 1ZGXA 1T2HA 2KF4A 1B2UA 2F56A 5GSPA 7GSPA 1LOWA 1CH0A 1DE3A 2KAAA 1BSBA 1HZ1A 3DH2A 1FZUA 1RLSA 1B3SA 1UCIA 1PYLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MGR A;  1I3I A;  1RCK A;  2SAR A;  3D5I A;  1BSC A;  4GHO A;  1RCL A;  2RBI A;  3WR2 A;  1C54 A;  1I0V A;  1BAN A;  1RN4 A;  3AHW A;  4HOH A;  1RGG A;  1LOV A;  5BIR A;  3SYU A;  1B21 A;  1A2P A;  1RGH A;  4J5K A;  1G02 A;  1DET A;  1BSA A;  1I0X A;  1BNJ A;  1B2X A;  1RNT A;  7RNT A;  2GSP A;  5HOH A;  1I2F A;  1RGK A;  2AAE A;  1I2E A;  1BNS A;  6GSP A;  1BSD A;  1B2S A;  2ZA4 A;  1LOY A;  3Q3F A;  1IYY A;  1BGS A;  1GOU A;  5RNT A;  1JBT A;  3AHS A;  1BRK A;  1RSN A;  3DGY A;  3RNT A;  1RTU A;  1RHL A;  1RGF A;  4GSP A;  8RNT A;  1BRN L;  1SAR A;  4RNT A;  3BU4 A;  1BVI A;  1X1X A;  1Q9E A;  2BIR A;  1JBS A;  4J5G A;  2F5M A;  1JBR A;  1BRS A;  1BU4 A;  1X1Y A;  6RNT A;  1AQZ A;  1RGL A;  1GMR A;  1I8V A;  2F4Y A;  1X1U A;  1PY3 A;  1BAO A;  2HOH A;  2RNT A;  1BNG A;  1RNB A;  1R4Y A;  1BRI A;  3AGN A;  1B20 A;  1RMS A;  2C4B A;  1GOV A;  1YNV X;  1BOX A;  1FUS A;  3D4A A;  1BIR A;  3WHO A;  1TRP A;  3HOH A;  1HYF A;  1T2I A;  1B2M A;  1BUJ A;  3A5E A;  1RGA A;  1YVS A;  1GSP A;  3AGO A;  1RGC A;  1UCL A;  2KF3 A;  2BU4 A;  1RGE A;  1BNI A;  3URP A;  1RDS A;  3GSP A;  2F5W A;  3D5G A;  1BNE A;  1TRQ A;  1FUT A;  1BNR A;  9RNT A;  1TTO A;  1UCK A;  1RN1 A;  1FYS A;  1X1W A;  3BIR A;  5BU4 A;  1UCJ A;  2KF5 A;  4BIR A;  1B27 A;  1GMQ A;  2AAD A;  1BSE A;  1I3F A;  4HAA A;  1AY7 A;  1BRH A;  1LRA A;  1GMP A;  1B2Z A;  2KF6 A;  3KCH A;  1FW7 A;  1I70 A;  1BRG A;  1MGW A;  1BNF A;  1LNI A;  1GOY A;  1BRJ A;  4BU4 A;  1I2G A;  1YGW A;  1ZGX A;  1T2H A;  2KF4 A;  1B2U A;  2F56 A;  5GSP A;  7GSP A;  1LOW A;  1CH0 A;  1DE3 A;  2KAA A;  1BSB A;  1HZ1 A;  3DH2 A;  1FZU A;  1RLS A;  1B3S A;  1UCI A;  1PYL A; 
#chains in the Genus database with same CATH topology
 3EBY A;  2L4V A;  1FA3 A;  1UDI I;  2CWT A;  1EUI C;  5AII A;  3WR2 A;  3SLU A;  1CQS A;  3H3H A;  6STD A;  1BAN A;  2BNG A;  1TFO A;  1FGM A;  1O7M B;  1RGG A;  5BIR A;  5IEP A;  1AVK A;  3MG3 A;  3SYU A;  4L7K A;  3LT8 A;  1A2P A;  1RGH A;  3GRD A;  3PXM A;  1WNH A;  4J5K A;  1ROV A;  1YJ9 3;  1Q40 B;  1BNJ A;  2UUG C;  3CU3 A;  1F8N A;  2XRX B;  3K63 A;  2YFI B;  4OK0 A;  3CCU 3;  1VQO 3;  1IV7 A;  4MMZ B;  4R80 A;  2W03 A;  1QAL A;  3FLJ A;  3CCS 3;  1RGK A;  2RGQ A;  4G1M B;  4N6V 0;  1W7C A;  1W6C A;  3UNL A;  1IVV A;  4AEQ A;  3CNM A;  3B4O A;  3F7X A;  1JZO A;  3DGO A;  3ER7 A;  3Q3F A;  1IQ8 A;  2HMM B;  3CCJ 3;  4N6M A;  2XSH B;  5RNT A;  3FG1 A;  3NBJ A;  1BRK A;  1RSN A;  1WQL B;  3I0Y A;  4X2O A;  1RHL A;  2GEY A;  3KII A;  2K0M A;  1STD A;  5IG0 A;  2RCD A;  2OTL 3;  1SAR A;  4HKV B;  2LYX A;  4OUQ A;  5ELJ A;  2CX0 A;  1Q9E A;  1UW1 A;  1HU9 A;  4O2H A;  1C54 A;  1JBR A;  3JVC A;  2BO9 B;  3X3Y A;  3WA3 A;  1AQZ A;  1O7N B;  1GMR A;  2E2V A;  1I8V A;  5A0O B;  1PY3 A;  2Y73 A;  3Q1C A;  4IPB A;  4R9K A;  2HMO B;  2ZL8 A;  1ASK A;  1MOL A;  3KFQ C;  1U5O A;  1JV2 B;  3FCS B;  1BNG A;  1RNB A;  1VQK 3;  1QVG 2;  3U97 A;  4CPK A;  5EEO A;  4HZ9 B;  3KKG A;  5IEN A;  2F99 A;  2W9Q A;  4FMB A;  1NDO B;  3D3L A;  2C4B A;  1IK3 A;  3JUO A;  1FUS A;  2XGN A;  3CCV 3;  5KP3 A;  5AYS C;  3K0Z A;  3HOH A;  1PFP A;  4HM7 B;  1NNV A;  2IUJ A;  5M18 A;  3B8L A;  3AGO A;  4CDL A;  3FZW A;  2BMQ B;  1HKX A;  4EW5 A;  1QAF A;  1C7H A;  3HK4 A;  1BNI A;  1OH0 A;  3URP A;  3LTD A;  3CCE 3;  4H61 A;  1FGT A;  2F5W A;  3D5G A;  5AYR B;  4XBX A;  1TRQ A;  2M7O A;  4MJD A;  1UCK A;  3LZA A;  2OQE C;  1US1 A;  4LMI A;  3G71 3;  4RBN A;  1S72 3;  1FYS A;  3BIR A;  3X3X A;  5BU4 A;  1EKM A;  1D6U A;  1WMP A;  3F8H A;  1GYB A;  3FSD A;  4KFD A;  1GY6 A;  1UGH I;  2AAD A;  3LTA A;  1BSE A;  4HAA A;  4HM1 B;  3SVA A;  4L8P A;  1DVD A;  1JB4 A;  1N8Q A;  1MWR A;  3B4P A;  4EC6 A;  1AY7 A;  4LEH A;  3JUN A;  1IDP A;  1RKY A;  4HM3 B;  1IV9 A;  1BRG A;  1MGW A;  3JUQ A;  3OXA A;  3LYG A;  2IMJ A;  2XFT A;  3FH1 A;  2H0H A;  3NXJ A;  4O3V A;  5IG4 A;  4BU4 A;  4RNZ A;  1Q82 4;  3PCR A;  1KWI A;  1Y4K A;  5LC6 A;  2GEX A;  1I2G A;  5EQL A;  2C11 A;  1B2U A;  4BL2 A;  1GD3 A;  1DE3 A;  1YHQ 3;  2GU1 A;  3LOY A;  1YVB I;  4WP5 A;  1AVL A;  1E97 A;  2HMK B;  2IA7 A;  3BB9 A;  5M19 A;  1FGO A;  2HMN B;  1B3S A;  3BNC A;  5DRE A;  3FGY A;  1LOX A;  2GXF A;  1I3I A;  2CKF B;  3D5I A;  4N6L A;  3JUP A;  1SIH A;  1ZS7 A;  1I0V A;  4HOH A;  1RRH A;  3BLZ A;  2OOV C;  5CXO A;  1M1K 4;  3V92 A;  3S28 A;  4N3V A;  2KXG A;  4MMX B;  1JB5 A;  1WMN A;  2K54 A;  4HM2 B;  2ZHX B;  2OCT A;  4HYZ A;  1W6G A;  1G02 A;  3MHE A;  1UGI A;  1BSA A;  3CPW 2;  1EG9 B;  1RNT A;  3NHX A;  4HBR A;  1JN5 B;  1JB2 A;  1LQG C;  5AIG A;  1VQ4 3;  2YX9 A;  4J9A A;  4HM0 B;  2O3O A;  3NV0 B;  3DUK A;  1I2E A;  4O02 B;  1BNS A;  2WOH A;  3CPO A;  1A2V A;  2E2U A;  2FXT A;  2YFL B;  3LML A;  3LTC A;  3NUV A;  4KFF A;  3WOF B;  2ZA4 A;  4CJN A;  1ROA A;  1O7P B;  2J8X B;  1IYY A;  1BGS A;  2FNQ A;  1GOU A;  4EXR A;  1O7G B;  3AHS A;  1MNL A;  3RNT A;  3O8Y A;  4N6T A;  2W6J H;  1W2B 2;  1RGF A;  4FR9 A;  5IG5 A;  5AEU B;  1BRN L;  4RNT A;  3BU4 A;  5D83 A;  1BVI A;  3T0U A;  1JRQ A;  3DGN A;  2F5M A;  5CK6 A;  3ALA A;  1S5A A;  2CFK A;  6RNT A;  4FCJ A;  4N6O B;  1VQP 3;  1RGL A;  3CCQ 3;  4IIA A;  1N9E A;  4FMA A;  5TGN A;  4N6U A;  2F4Y A;  1D6Y A;  1ZO2 A;  1G0T A;  1EQK A;  3GAX A;  2A15 A;  4MMY B;  2INX A;  3K9M C;  5AEW B;  2HOH A;  3LXU X;  4WFO A;  1IQX A;  2MC8 A;  1RJO A;  1R4Y A;  3AMO A;  1K41 A;  1W00 A;  3X40 A;  3GZB A;  2ML5 A;  4AKZ A;  3FKA A;  4R9L A;  3WMD A;  1RMS A;  2XFS A;  3IPT A;  3OX9 A;  3M8C A;  1YJW 3;  1NU3 A;  1O7H B;  5DRV A;  1OHS A;  1BOX A;  2P0M A;  3F40 A;  3SX1 A;  1LXE A;  3LT9 A;  5G1K A;  4CCV A;  2BHM A;  5AIF A;  2CC3 A;  1B2M A;  4KFE A;  3EB8 A;  3EN1 B;  3CME 3;  1OHP A;  2RSX A;  1VQ5 3;  1UCL A;  2I9W A;  2KF3 A;  4LSO A;  1YGE A;  3IMA B;  4LYL B;  1M9G A;  2P0X A;  2SBL A;  3DY5 A;  3RDE A;  2CG0 A;  2OWP A;  1VQ8 3;  2IY2 A;  4XBT A;  2JDI H;  4WYK B;  2C10 A;  3MPH A;  1BNE A;  3X42 A;  2CX1 A;  1FUT A;  3E99 A;  1BNR A;  2R41 A;  3LH4 A;  1VZZ A;  2XGL A;  2Z77 A;  4K61 A;  2WGQ A;  4HVN A;  2QA4 3;  3Q90 A;  3K7C A;  4GB5 A;  3EE1 A;  4NHF A;  1IVW A;  1OF5 B;  4FMC A;  2B1X B;  1GMQ A;  2H0G A;  1YJN 3;  3ROB A;  3T8U A;  3CD6 3;  3GZR A;  3QRD A;  2W56 B;  1LQM B;  1GMP A;  1LRA A;  3F9S A;  3LTB A;  1B2Z A;  4EV5 A;  1NO3 A;  1JKG B;  1NWW A;  3DGL A;  1I70 A;  1FGR A;  1OUN A;  3KCH A;  1IT8 A;  3QK9 A;  3G6E 3;  1FW7 A;  1W6Y A;  3EQQ B;  3J7Y d;  3HIG A;  1LNI A;  2GU3 A;  3G8Z A;  5AI1 A;  1BRJ A;  1U8C B;  2F86 B;  5IEO A;  1E3R A;  1VQQ A;  2IYJ A;  2D42 A;  4H3U A;  3VF1 A;  1FGQ A;  2QIY A;  1LOW A;  3HZP A;  1KQS 2;  1D6Z A;  3DM8 A;  1HZ1 A;  4HM4 B;  1BUQ A;  3DH2 A;  3ZFZ A;  3NBB A;  4TX4 A;  1RLS A;  1UCI A;  3WA2 X;  1MGR A;  4HM5 B;  5KP4 A;  1R4C A;  2W9P A;  3OW2 2;  2CH9 A;  2SAR A;  2CHC A;  4LZI A;  2CG1 A;  1BSC A;  3CXC 2;  1SPU A;  1RCL A;  3CC7 3;  5IG3 A;  1A2K A;  2XR8 B;  3BNE A;  1RN4 A;  4N6N B;  1LOV A;  3S27 A;  1AR0 A;  4X2H A;  3B7C A;  1Q40 A;  3FF2 A;  1TJD A;  1ZX2 A;  1W5Z A;  3KE7 A;  1O7W B;  4GL6 A;  4JF8 A;  4EYC A;  1DET A;  4FCZ A;  4STD A;  5LC7 A;  3SXX A;  5IW9 A;  3PCS A;  3HI7 A;  2L1S A;  3MG2 A;  3T8N A;  3UL5 A;  1I2F A;  5HOH A;  3S29 A;  2W04 A;  4HM6 B;  2BT3 A;  6GSP A;  1SJW A;  4U13 A;  1BSD A;  5CLK A;  1K8A 4;  1K9M 4;  5FW5 A;  2XF3 A;  2Z7A A;  1LOY A;  2YFJ B;  4PEJ A;  1GD4 A;  2WO0 A;  3D79 A;  2CW9 A;  3TDG A;  4R1K A;  3DGY A;  1LVN A;  2STD A;  3X41 A;  1RTU A;  1OGX A;  1QVF 2;  5HGR A;  4K1V A;  1IVU A;  2ML6 A;  3HX8 A;  8RNT A;  1MWS A;  1W01 A;  3EBT A;  3F7S A;  5STD A;  1X1X A;  1NJI 4;  1JBS A;  1UUV B;  3L0R A;  4J5G A;  4JRF A;  4AKY A;  1BU4 A;  3CC4 3;  5IER A;  1PU4 A;  4IT7 A;  3EN8 A;  3EJV A;  3V99 A;  2Q07 A;  1GS3 A;  3JUM A;  3NQZ A;  2P05 A;  3BND A;  1TUH A;  2RNT A;  1TP6 A;  2R4I A;  1DVC A;  3WOE B;  5BVB A;  1ISK A;  3DMC A;  4HZB B;  1UUG B;  4I4K A;  1NB3 I;  2MF7 A;  3KSP A;  1B20 A;  1T3B A;  1AV4 A;  2BMO B;  2FGT A;  3D4A A;  1BIR A;  3WHO A;  3OWY A;  1QMA A;  1TRP A;  3WDG B;  3UJM A;  1HYF A;  1OHO A;  1BUJ A;  1EEJ A;  1RGA A;  2Z6B A;  3KN4 A;  4HJL B;  2CFL A;  2XSO B;  4BTW A;  3KZT A;  3GZY B;  1EA2 A;  3BNB A;  5M1A A;  5D81 A;  1CEW I;  1W4N A;  1RGE A;  2BU4 A;  2KRT A;  1YI2 3;  5G2G A;  2GBW B;  2HMJ B;  1TU5 A;  4Q53 A;  1FUW A;  1G96 A;  2CFW A;  9RNT A;  2CIU A;  3GWR A;  3SOA A;  1Q81 4;  1MWT A;  1UCJ A;  2KF5 A;  2HML B;  1B27 A;  1WMO A;  4LGQ A;  1TIJ A;  5CF1 A;  2B24 B;  3STD A;  1OPY A;  4XM4 A;  5FGO A;  4NRE A;  3RGA A;  3NM7 A;  3F8X A;  2W0Q A;  4EBG A;  4KZ1 A;  3A76 A;  1VQ7 3;  5JBS A;  3IJE B;  1RN7 A;  3WOD G;  1QAK A;  1VQL 3;  5BXQ A;  1KSI A;  1BNF A;  3CCM 3;  2P38 A;  2D1W A;  2OQE A;  4DKI A;  3I56 3;  3DZL A;  4NPB A;  5AIH A;  3FG3 A;  2KF4 A;  1CYV A;  1STF I;  3PS8 A;  8CHO A;  2CFD A;  4MEI A;  1BSB A;  2UX0 A;  4BL3 A;  1V74 A;  1J2B A;  5EVH A;  3NQY A;  1JNQ A;  1V57 A;  3MWZ A;  3MYT A;  3OWS A;  1RCK A;  2P09 A;  5ELU A;  4GHO A;  3ZG0 A;  2RBI A;  3I55 3;  1VQ9 3;  3ECF A;  1QJG A;  1DMN A;  3UL6 A;  3VSY A;  3PYJ A;  3AHW A;  5JPU A;  2QEX 3;  1VQM 3;  2ZDJ A;  3F14 A;  1IQY A;  3MKI A;  2OTJ 3;  1B21 A;  3FG4 A;  3N9H A;  3NM2 A;  1M90 4;  4L8O A;  1KD1 4;  3VGN A;  3NBR A;  1JN5 A;  1I0X A;  2O9U X;  1E3V A;  1B2X A;  5KP1 A;  3NV0 A;  7RNT A;  2GSP A;  1JZD A;  3PGB A;  4XB5 A;  5JPP A;  3G4S 3;  4I5Q A;  2W2C A;  2V1L A;  4BTX A;  1GY7 A;  1RRL A;  2AAE A;  2XH9 A;  5G1L A;  1ULI B;  1L5G B;  1B2S A;  4KT3 B;  1N5H A;  4RZM A;  2H0I A;  3D9R A;  3CNX A;  2XEP A;  3S67 A;  3G16 A;  2OOV A;  1T5Y A;  4XDW A;  1JBT A;  3KSE D;  4K1U A;  1IT7 A;  2LQV A;  4GSP A;  2GBX B;  2RFR A;  4WHA A;  2BIR A;  2QGU A;  2WOF A;  1YIT 3;  4XBY A;  3N8B A;  3FF0 A;  1BRS A;  3DXO A;  1X1Y A;  3RGR A;  1DMM A;  3SOY A;  4O8S A;  2BMR B;  5CF2 A;  1KC8 4;  1X1U A;  1Z1S A;  1YIJ 3;  1BAO A;  2KCD A;  1W2Z A;  3SED A;  2JQ5 A;  1A90 A;  3OWU A;  3EC9 A;  2E2T A;  1N9J A;  4FMD A;  5I97 A;  1BRI A;  1OCV A;  2Y74 A;  1Q42 A;  3AGN A;  3K5T A;  1VQN 3;  3AMO B;  4KVH A;  1GOV A;  1IU7 A;  1OGZ A;  1YNV X;  2CWV A;  2CWU A;  3EF8 A;  1IVX A;  4RNY A;  7STD A;  1VQ6 3;  3OV4 A;  4BTY A;  3CMA 3;  4R4K A;  1T2I A;  1M1X B;  1UI7 A;  3MSO A;  3A5E A;  1UI8 A;  1YVS A;  3S5C A;  1GSP A;  1RGC A;  1N8R 4;  3V98 A;  2WGO A;  5IF6 A;  1DYU A;  1N5P A;  4ILF A;  4WYK A;  3Q2P A;  1Q7Y 4;  1RDS A;  1WTH A;  3GSP A;  4WWU C;  3HII A;  3GZX B;  1Q7H A;  1K73 4;  3MG1 A;  1TTO A;  1JJ2 2;  1OF5 A;  4FCM A;  2CFG A;  1NB5 I;  1RN1 A;  3NX0 A;  1X1W A;  1W02 A;  2PNC A;  4HM8 B;  4J8T A;  3UB1 A;  3H51 A;  4OVM A;  2CK3 H;  4BIR A;  2UGI A;  2W56 A;  3EX9 A;  1I3F A;  1CYU A;  3G0K A;  1JKG A;  1K28 A;  1BRH A;  4QWT A;  3ZG5 A;  1SII A;  3CC2 3;  3DGM A;  4ORL A;  3PZW A;  3CCR 3;  4XDV A;  1DMQ A;  1LNH A;  2Z76 A;  2KF6 A;  1UUW B;  2PZV A;  1GY5 A;  3U1W A;  1ULJ B;  1MWU A;  1GOY A;  2IUK A;  3EHC A;  1Q86 4;  2K3D A;  4EV2 A;  1YGW A;  1ZGX A;  2F98 A;  4ZM8 A;  1A67 A;  1T2H A;  5GSP A;  2F56 A;  1TFK A;  7GSP A;  1OAC A;  1CH0 A;  4K90 B;  3X3Z A;  3N54 B;  2KAA A;  5D82 A;  1SQW A;  1FZU A;  1V58 A;  3CCL 3;  1PYL A; 
#chains in the Genus database with same CATH homology
 1MGR A;  1I3I A;  1RCK A;  2SAR A;  3D5I A;  1BSC A;  4GHO A;  1RCL A;  2RBI A;  3WR2 A;  1C54 A;  1I0V A;  1BAN A;  1RN4 A;  3AHW A;  4HOH A;  1RGG A;  1LOV A;  5BIR A;  3SYU A;  1B21 A;  1A2P A;  1RGH A;  4J5K A;  1G02 A;  1DET A;  1BSA A;  1I0X A;  1BNJ A;  1B2X A;  1RNT A;  7RNT A;  2GSP A;  5HOH A;  1I2F A;  1RGK A;  2AAE A;  1I2E A;  1BNS A;  6GSP A;  1BSD A;  1B2S A;  2ZA4 A;  1LOY A;  3Q3F A;  1IYY A;  1BGS A;  1GOU A;  5RNT A;  1JBT A;  3AHS A;  1BRK A;  1RSN A;  3DGY A;  3RNT A;  1RTU A;  1RHL A;  1RGF A;  4GSP A;  8RNT A;  1BRN L;  1SAR A;  4RNT A;  3BU4 A;  1BVI A;  1X1X A;  1Q9E A;  2BIR A;  1JBS A;  4J5G A;  2F5M A;  1JBR A;  1BRS A;  1BU4 A;  1X1Y A;  6RNT A;  1AQZ A;  1RGL A;  1GMR A;  1I8V A;  2F4Y A;  1X1U A;  1PY3 A;  1BAO A;  2HOH A;  2RNT A;  1BNG A;  1RNB A;  1R4Y A;  1BRI A;  3AGN A;  1B20 A;  1RMS A;  2C4B A;  1GOV A;  1YNV X;  1BOX A;  1FUS A;  3D4A A;  1BIR A;  3WHO A;  1TRP A;  3HOH A;  1HYF A;  1T2I A;  1B2M A;  1BUJ A;  3A5E A;  1RGA A;  1YVS A;  1GSP A;  3AGO A;  1RGC A;  1UCL A;  2KF3 A;  2BU4 A;  1RGE A;  1BNI A;  3URP A;  1RDS A;  3GSP A;  2F5W A;  3D5G A;  1BNE A;  1TRQ A;  1FUT A;  1BNR A;  9RNT A;  1TTO A;  1UCK A;  1RN1 A;  1FYS A;  1X1W A;  3BIR A;  5BU4 A;  1UCJ A;  2KF5 A;  4BIR A;  1B27 A;  1GMQ A;  2AAD A;  1BSE A;  1I3F A;  4HAA A;  1AY7 A;  1BRH A;  1LRA A;  1GMP A;  1B2Z A;  2KF6 A;  3KCH A;  1FW7 A;  1I70 A;  1BRG A;  1MGW A;  1BNF A;  1LNI A;  1GOY A;  1BRJ A;  4BU4 A;  1I2G A;  1YGW A;  1ZGX A;  1T2H A;  2KF4 A;  1B2U A;  2F56 A;  5GSP A;  7GSP A;  1LOW A;  1CH0 A;  1DE3 A;  2KAA A;  1BSB A;  1HZ1 A;  3DH2 A;  1FZU A;  1RLS A;  1B3S A;  1UCI A;  1PYL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...