1IYYA

Nmr structure of gln25-ribonuclease t1, 24 structures
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYQLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE T1
publication title Determination of the NMR structure of Gln25-ribonuclease T1.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
total genus 10
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2002-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1iyyA00
1B27A 1CH0A 5BIRA 2F5WA 2KF6A 2BU4A 3Q3FA 2AADA 1YVSA 1ZGXA 8RNTA 1RGCA 1TRPA 1LOVA 1RHLA 3A5EA 1FUTA 1BRGA 9RNTA 3D5IA 4GHOA 1RGAA 3D5GA 3GSPA 1RCKA 1I3IA 1TRQA 1PY3A 1G02A 3KCHA 1A2PA 1RTUA 3URPA 4HAAA 1BGSA 1TTOA 1RLSA 5GSPA 2C4BA 2ZA4A 1R4YA 1YGWA 2KAAA 2KF4A 3SYUA 1FW7A 1BNEA 3AHWA 7GSPA 1X1YA 1FYSA 3AGOA 1BRJA 1FUSA 1HZ1A 2AAEA 2BIRA 1T2IA 1RSNA 1PYLA 2HOHA 1B2ZA 1BANA 1I2EA 1RGLA 4RNTA 3WR2A 1T2HA 1BRSA 1I2FA 1BSCA 1SARA 2F5MA 7RNTA 1BRNL 6GSPA 1I8VA 1RGFA 1BRKA 3D4AA 3DH2A 1AQZA 1RN4A 1GOVA 1RGHA 2RBIA 1FZUA 1LRAA 1B20A 1BNRA 1BNGA 3AHSA 1BIRA 1LNIA 1RCLA 2GSPA 1JBSA 1RGEA 4HOHA 1Q9EA 1HYFA 1B2UA 1DE3A 1YNVX 1I0XA 3RNTA 1RNBA 5HOHA 1BSDA 1RDSA 1B2SA 2KF3A 1B2MA 1JBTA 1LOYA 1BNSA 1I70A 1MGRA 1IYYA 1BUJA 5BU4A 1GMPA 1MGWA 1X1WA 1RMSA 1I2GA 1BVIA 1BAOA 1UCJA 4J5KA 3AGNA 1GOUA 1GMRA 1B21A 1BOXA 1B3SA 1UCIA 1DETA 1C54A 1RN1A 6RNTA 3DGYA 2RNTA 3HOHA 1JBRA 4BIRA 1GSPA 1RGGA 1BRIA 1X1XA 1BU4A 1UCLA 1BRHA 1BSEA 1BNFA 1B2XA 1BNJA 4GSPA 1RGKA 3WHOA 1RNTA 1X1UA 3BU4A 1GOYA 1AY7A 1BSBA 1LOWA 5RNTA 4J5GA 1I0VA 2F56A 1GMQA 1UCKA 2KF5A 4BU4A 1BNIA 1I3FA 1BSAA 3BIRA 2F4YA 2SARA
chains in the Genus database with same CATH superfamily
5D81A 2B24B 1CH0A 3CC23 4XB5A 2Z77A 2F5WA 5AIHA 5FGOA 3I0YA 4AKZA 2OOVC 3ROBA 2LQVA 3ECFA 3Q3FA 2B1XB 3K63A 1IVVA 4FMBA 3MG1A 3WOFB 3KFQC 1TRPA 1IDPA 2W04A 4XBYA 1YGEA 1E3VA 5JPUA 3FCSB 5IEPA 2KXGA 2O3OA 3F8HA 4O8SA 5M1AA 1TFOA 2CX1A 1UGIA 2D1WA 4I4KA 1O7NB 4FCJA 1RCKA 1N8R4 1K41A 1PY3A 3LT8A 4L8PA 1A90A 1DYUA 3MG3A 1TTOA 2RFRA 4ZM8A 2ZA4A 1W01A 1YGWA 4ILFA 3HX8A 4FMDA 1PU4A 1BNEA 4J8TA 7GSPA 1VQ53 1X1YA 3AGOA 1AVKA 1BRJA 1FUSA 1S5AA 4X2OA 2CWVA 2W03A 3F8XA 2BHMA 1SIHA 3GZBA 3T8UA 5IG3A 3KN4A 2YFIB 3AMOA 1JZDA 1RSNA 5KP1A 1MWUA 1QAKA 4K61A 4WP5A 1EEJA 2E2VA 7RNTA 2OTJ3 3CPOA 6GSPA 3DM8A 1OH0A 1RGFA 5M19A 1JN5B 3B4PA 4JRFA 2ZL8A 3B4OA 5AIIA 3HIIA 1VQ43 1W4NA 2MF7A 4FR9A 2RBIA 4EV2A 1Q7HA 2XEPA 1A67A 2XF3A 1NNVA 1MWSA 2QGUA 1BNGA 2H0GA 1BIRA 3CMA3 2QIYA 3F9SA 1RCLA 2GSPA 1RGEA 2PZVA 1M1XB 3UJMA 3CU3A 1Q9EA 4MEIA 1OACA 1YNVX 4XBXA 1US1A 2GU3A 5HOHA 1IQ8A 1HU9A 5G1LA 5LC6A 3B8LA 1IV7A 2WOHA 1VQQA 1BNSA 1WNHA 1W2B2 2W2CA 1X1WA 3EN1B 1IV9A 1TJDA 2P38A 4N6UA 1VQP3 3EQQB 1IT7A 1BAOA 5IEOA 2ZHXB 5AIGA 3U1WA 4RNYA 2K0MA 2ZDJA 4R9KA 1B3SA 4WYKB 5LC7A 4N6MA 1RN1A 4XM4A 1OHOA 1JKGB 3CCR3 3FLJA 3JVCA 1DMMA 3LTCA 2GBXB 3A76A 3GZXB 3IJEB 1X1XA 1UCLA 1W02A 3Q90A 3WA2X 1E97A 1QMAA 5CLKA 1B2XA 3NXJA 4BL3A 1GD3A 3O8YA 4WWUC 1BUQA 4BTXA 3EBTA 3MKIA 1X1UA 3GZYB 1GOYA 3CCE3 4N6TA 4TX4A 2HMJB 3F7SA 1QVF2 3MSOA 4FMCA 4J5GA 3S28A 1HKXA 1CYVA 2IYJA 2RCDA 3EN8A 5G2GA 1N5HA 4QWTA 5DRVA 2XRXB 2YX9A 1M1K4 1A2VA 1LQGC 5FW5A 2W9PA 2SARA 1B27A 4K1VA 3PYJA 1IQXA 4N6NB 1Q42A 1YHQ3 1UUVB 1DVDA 3BB9A 4I5QA 1SQWA 1S723 2AADA 3SVAA 4OUQA 3H3HA 1EA2A 1JB4A 1T5YA 2E2TA 2K54A 1RHLA 3KKGA 3UB1A 1GD4A 3CCL3 4K90B 3GZRA 1FUTA 1JZOA 1LVNA 1BRGA 3FH1A 2XR8B 4N6OB 3S5CA 1N9EA 3RDEA 9RNTA 2STDA 4HM2B 4WYKA 3LT9A 5IG4A 5AEUB 1JJ22 2CFWA 2UX0A 1G02A 3Q2PA 2IA7A 4MMXB 4DKIA 2Q07A 3JUPA 4LSOA 5CF2A 3CCM3 1YVBI 3KSED 3JUQA 3L0RA 4N6LA 3ZFZA 3SYUA 1JV2B 3X3YA 5STDA 1FW7A 3AHWA 1W00A 2CWUA 3HZPA 3FKAA 1O7HB 1O7GB 2KCDA 2WGOA 2ML5A 3KE7A 3I553 3S27A 1Q7Y4 3J7Yd 3EF8A 4L7KA 2HMOB 1WMPA 2E2UA 2XGLA 4HVNA 3FZWA 1MNLA 1T2IA 4HJLB 3SX1A 1PYLA 1VQ63 1B2ZA 1BANA 1AVLA 1E3RA 1GY5A 4LYLB 1BRSA 1I2FA 1LOXA 2CKFB 4IPBA 1BRNL 1I8VA 3JUNA 4JF8A 1WMOA 3FGYA 1AQZA 1JB5A 4H3UA 2H0HA 1FGOA 2Y73A 5ELUA 4AKYA 1W6GA 1VQL3 1VQ93 3CC73 2GEXA 1FZUA 1VQK3 3DUKA 5IW9A 4STDA 2D42A 2QA43 1AV4A 3UNLA 1VQ83 2OQEA 3UL5A 3CD63 4FMAA 2BMOB 3NM2A 4ORLA 1W7CA 2Z6BA 4HOHA 2OCTA 4CJNA 2GXFA 1W6YA 4IIAA 1B2SA 2KF3A 3CNXA 1EKMA 3SOAA 3D3LA 1B2MA 1JBTA 4WHAA 1LOYA 1I70A 1UDII 3KIIA 1TUHA 3QRDA 2K3DA 5IG5A 2QEX3 3CCU3 1VZZA 3JUOA 1GMPA 5AIFA 1R4CA 4CPKA 1BUJA 1UGHI 2CC3A 2INXA 1RMSA 3MYTA 1BVIA 1UUGB 4KFFA 2RSXA 3BNBA 1EG9B 3PXMA 1DMNA 3NX0A 1IVXA 1UCIA 2JDIH 1YJN3 3KSPA 2XSOB 6RNTA 4GB5A 1JRQA 1GY7A 1OUNA 2XFTA 3DGNA 1D6UA 4OVMA 1T3BA 1O7PB 1RGGA 3BLZA 4N3VA 1BNFA 1EQKA 3CPW2 4GSPA 4G1MB 1RGKA 4MJDA 1W6CA 1U8CB 5BXQA 1AY7A 1BSBA 1G96A 1M9GA 2A15A 2V1LA 3K7CA 3CCJ3 4N6V0 3IPTA 3V98A 4HM3B 1I0VA 1OHPA 2H0IA 3B7CA 1A2KA 3OXAA 4BU4A 4NREA 2WO0A 3PCSA 3KZTA 4K1UA 1I3FA 1BSAA 3BIRA 1IVWA 4MMZB 1IQYA 4BTWA 4EV5A 1NU3A 3DMCA 2GU1A 3NV0A 3CCS3 2YFLB 2RGQA 1J2BA 2R4IA 3Q1CA 1C7HA 5KP3A 4PEJA 3DXOA 3X3XA 8RNTA 1D6YA 3DY5A 1RGCA 1KD14 4HBRA 3N9HA 4XDWA 4KZ1A 1LOVA 3EC9A 3PCRA 2GBWB 1FGMA 4RZMA 3X42A 4AEQA 4CDLA 3EX9A 3MG2A 3I563 1NDOB 4BL2A 4HZBB 3D79A 3D5IA 2P05A 2GEYA 6STDA 3K0ZA 1RGAA 1W5ZA 1I3IA 1TRQA 5A0OB 2UUGC 1AR0A 1MWRA 3KCHA 3CC43 2MC8A 1RTUA 3HI7A 3G16A 3URPA 1KQS2 2O9UX 1F8NA 1BGSA 1K28A 1NB3I 1OPYA 1RLSA 2F98A 5GSPA 2C4BA 2JQ5A 1R4YA 1U5OA 5M18A 1QALA 3FG1A 4L8OA 2OOVA 4CCVA 5BVBA 2BMQB 3LTDA 3IMAB 1ZX2A 3NM7A 1FUWA 5AEWB 2CHCA 3QK9A 1HZ1A 3PGBA 1ZO2A 3OX9A 3WODG 2YFJB 1V58A 2P09A 4O3VA 3G4S3 3G0KA 3FG3A 2P0MA 3GWRA 1IK3A 2L4VA 4R4KA 2UGIA 3PS8A 3NBBA 1I2EA 1KSIA 3H51A 3MWZA 4HM6B 2FNQA 4HKVB 4RNTA 5DREA 3VF1A 1SARA 1BSCA 1RKYA 2F5MA 3U97A 2WOFA 1KWIA 3WDGB 3D4AA 3EJVA 1GS3A 3RGRA 4EC6A 4HM5B 1RN4A 3NBRA 1GOVA 4NPBA 1RGHA 1UI7A 1MOLA 3LTBA 1YI23 1NB5I 1ISKA 4EXRA 1ASKA 1LRAA 5JPPA 3V99A 1LQMB 3AHSA 4FCMA 5AYSC 1M904 2Y74A 2J8XB 3FSDA 1RRHA 4HM8B 4LEHA 3DGOA 3E99A 1LXEA 2R41A 2BT3A 1I0XA 3RNTA 1RNBA 1RDSA 1OGZA 2CW9A 1IU7A 2C11A 1K8A4 3GAXA 3LYGA 2HMLB 2OWPA 1IYYA 1Y4KA 3DZLA 4HM0B 1CYUA 1UUWB 8CHOA 5EQLA 5KP4A 5BU4A 1MGWA 1PFPA 2W6JH 1O7MB 2HMMB 4J5KA 1UCJA 2I9WA 3AGNA 1GMRA 2HMKB 2P0XA 3DGMA 3SLUA 3D9RA 1SJWA 3LZAA 1DETA 2WGQA 2CG0A 3CNMA 2RNTA 3HOHA 1DVCA 1OF5B 3FF0A 4R80A 1VQN3 3VSYA 2W9QA 3EHCA 4BIRA 1YIJ3 5JBSA 1BRIA 2XGNA 3M8CA 1FGRA 1BU4A 1ZS7A 3DGLA 2CFGA 1JB2A 3NV0B 1ULJB 2IUJA 4GL6A 3S67A 4LMIA 4X2HA 4IT7A 3V92A 1QAFA 1UI8A 3LXUX 5AI1A 3BU4A 1NJI4 1OGXA 3HK4A 4XBTA 1K734 5RNTA 3OW22 1TP6A 3LMLA 1GMQA 1UCKA 1L5GB 2KF5A 3N54B 1BNIA 3ZG5A 1Q864 1EUIC 1ULIB 4O2HA 2XFSA 2F4YA 2W56A 4EBGA 3GRDA 3SXXA 5IENA 2IMJA 2IY2A 4HZ9B 1RN7A 2XSHB 2L1SA 5BIRA 3VGNA 3ZG0A 1YJ93 2KF6A 2BU4A 2PNCA 1N9JA 1YIT3 3X41A 1YVSA 1ZGXA 1K9M4 4KFEA 3T8NA 1FA3A 2FGTA 4HM1B 3UL6A 2BNGA 2Z7AA 3A5EA 3SEDA 1QJGA 1Q40A 1ROVA 1LNHA 3CXC2 3FF2A 3G713 4GHOA 3LH4A 3SOYA 3FG4A 3D5GA 1FGQA 2FXTA 3GSPA 4RBNA 1NWWA 4FCZA 1OF5A 4WFOA 3T0UA 1Z1SA 1A2PA 1UW1A 3F14A 4HM7B 4J9AA 4HAAA 1VQM3 1RJOA 2CG1A 1KC84 3OV4A 4HYZA 2Z76A 3G6E3 2KAAA 2KF4A 2XH9A 3OWUA 5D82A 5CK6A 1STFI 1FYSA 2AAEA 2BIRA 1G0TA 2BO9B 1IVUA 1IT8A 2IUKA 2OQEC 2CH9A 2F86B 3BNCA 3STDA 3WOEB 2HOHA 3RGAA 5HGRA 2CFLA 1RGLA 5IERA 3WR2A 4HM4B 1T2HA 1STDA 3ER7A 4OK0A 1RRLA 3ALAA 1BNRA 1WMNA 3N8BA 5EEOA 1CQSA 3NQZA 1BRKA 3DH2A 3K9MC 3HIGA 2C10A 3CME3 3OWYA 4R1KA 1FGTA 5IG0A 1OCVA 3NBJA 3WA3A 1SIIA 4H61A 3NUVA 2CWTA 4LGQA 3G8ZA 4R9LA 1B20A 3TDGA 3CCQ3 4KFDA 4Q53A 3X40A 4EW5A 3EE1A 1TIJA 5TGNA 4LZIA 1GYBA 2CFDA 1CEWI 1LNIA 4KVHA 5EVHA 3F40A 1VQO3 1TFKA 1JBSA 3MHEA 5G1KA 1JN5A 2HMNB 1HYFA 1B2UA 3BNDA 2BMRB 1YJW3 1DE3A 1BSDA 2CFKA 2ML6A 4MMYB 4U13A 1JNQA 1GY6A 1O7WB 1V74A 4NHFA 2F99A 2CK3H 5D83A 7STDA 5AYRB 1MGRA 1D6ZA 3JUMA 3NHXA 2OTL3 3CCV3 1QVG2 4EYCA 4BTYA 2W0QA 4O02B 3X3ZA 1DMQA 1I2GA 1VQ73 1GOUA 1B21A 1BOXA 4RNZA 1C54A 1WTHA 4XDVA 3DGYA 2M7OA 5CF1A 1OHSA 1JBRA 1W2ZA 3BNEA 3PZWA 1GSPA 3EB8A 5I97A 3LTAA 1SPUA 2W56B 1BRHA 3K5TA 1BSEA 1MWTA 3NQYA 3OWSA 1NO3A 3WMDA 2LYXA 1ROAA 1BNJA 3F7XA 1WQLB 5CXOA 3WHOA 1RNTA 1N8QA 4KT3B 3LOYA 2SBLA 1LOWA 1Q824 2F56A 3AMOB 1JKGA 2KRTA 3S29A 1N5PA 2CX0A 1V57A 5ELJA 1TU5A 1Q40B 2CIUA 3MPHA 3EBYA 1Q814 5IF6A
chains in the Genus database with same CATH topology
1B27A 1CH0A 5BIRA 2F5WA 2KF6A 2BU4A 3Q3FA 2AADA 1YVSA 1ZGXA 8RNTA 1RGCA 1TRPA 1LOVA 1RHLA 3A5EA 1FUTA 1BRGA 9RNTA 3D5IA 4GHOA 1RGAA 3D5GA 3GSPA 1RCKA 1I3IA 1TRQA 1PY3A 1G02A 3KCHA 1A2PA 1RTUA 3URPA 4HAAA 1BGSA 1TTOA 1RLSA 5GSPA 2C4BA 2ZA4A 1R4YA 1YGWA 2KAAA 2KF4A 3SYUA 1FW7A 1BNEA 3AHWA 7GSPA 1X1YA 1FYSA 3AGOA 1BRJA 1FUSA 1HZ1A 2AAEA 2BIRA 1T2IA 1RSNA 1PYLA 2HOHA 1B2ZA 1BANA 1I2EA 1RGLA 4RNTA 3WR2A 1T2HA 1BRSA 1I2FA 1BSCA 1SARA 2F5MA 7RNTA 1BRNL 6GSPA 1I8VA 1RGFA 1BRKA 3D4AA 3DH2A 1AQZA 1RN4A 1GOVA 1RGHA 2RBIA 1FZUA 1LRAA 1B20A 1BNRA 1BNGA 3AHSA 1BIRA 1LNIA 1RCLA 2GSPA 1JBSA 1RGEA 4HOHA 1Q9EA 1HYFA 1B2UA 1DE3A 1YNVX 1I0XA 3RNTA 1RNBA 5HOHA 1BSDA 1RDSA 1B2SA 2KF3A 1B2MA 1JBTA 1LOYA 1BNSA 1I70A 1MGRA 1IYYA 1BUJA 5BU4A 1GMPA 1MGWA 1X1WA 1RMSA 1I2GA 1BVIA 1BAOA 1UCJA 4J5KA 3AGNA 1GOUA 1GMRA 1B21A 1BOXA 1B3SA 1UCIA 1DETA 1C54A 1RN1A 6RNTA 3DGYA 2RNTA 3HOHA 1JBRA 4BIRA 1GSPA 1RGGA 1BRIA 1X1XA 1BU4A 1UCLA 1BRHA 1BSEA 1BNFA 1B2XA 1BNJA 4GSPA 1RGKA 3WHOA 1RNTA 1X1UA 3BU4A 1GOYA 1AY7A 1BSBA 1LOWA 5RNTA 4J5GA 1I0VA 2F56A 1GMQA 1UCKA 2KF5A 4BU4A 1BNIA 1I3FA 1BSAA 3BIRA 2F4YA 2SARA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B27 A;  1CH0 A;  5BIR A;  2F5W A;  2KF6 A;  2BU4 A;  3Q3F A;  2AAD A;  1YVS A;  1ZGX A;  8RNT A;  1RGC A;  1TRP A;  1LOV A;  1RHL A;  3A5E A;  1FUT A;  1BRG A;  9RNT A;  3D5I A;  4GHO A;  1RGA A;  3D5G A;  3GSP A;  1RCK A;  1I3I A;  1TRQ A;  1PY3 A;  1G02 A;  3KCH A;  1A2P A;  1RTU A;  3URP A;  4HAA A;  1BGS A;  1TTO A;  1RLS A;  5GSP A;  2C4B A;  2ZA4 A;  1R4Y A;  1YGW A;  2KAA A;  2KF4 A;  3SYU A;  1FW7 A;  1BNE A;  3AHW A;  7GSP A;  1X1Y A;  1FYS A;  3AGO A;  1BRJ A;  1FUS A;  1HZ1 A;  2AAE A;  2BIR A;  1T2I A;  1RSN A;  1PYL A;  2HOH A;  1B2Z A;  1BAN A;  1I2E A;  1RGL A;  4RNT A;  3WR2 A;  1T2H A;  1BRS A;  1I2F A;  1BSC A;  1SAR A;  2F5M A;  7RNT A;  1BRN L;  6GSP A;  1I8V A;  1RGF A;  1BRK A;  3D4A A;  3DH2 A;  1AQZ A;  1RN4 A;  1GOV A;  1RGH A;  2RBI A;  1FZU A;  1LRA A;  1B20 A;  1BNR A;  1BNG A;  3AHS A;  1BIR A;  1LNI A;  1RCL A;  2GSP A;  1JBS A;  1RGE A;  4HOH A;  1Q9E A;  1HYF A;  1B2U A;  1DE3 A;  1YNV X;  1I0X A;  3RNT A;  1RNB A;  5HOH A;  1BSD A;  1RDS A;  1B2S A;  2KF3 A;  1B2M A;  1JBT A;  1LOY A;  1BNS A;  1I70 A;  1MGR A;  1IYY A;  1BUJ A;  5BU4 A;  1GMP A;  1MGW A;  1X1W A;  1RMS A;  1I2G A;  1BVI A;  1BAO A;  1UCJ A;  4J5K A;  3AGN A;  1GOU A;  1GMR A;  1B21 A;  1BOX A;  1B3S A;  1UCI A;  1DET A;  1C54 A;  1RN1 A;  6RNT A;  3DGY A;  2RNT A;  3HOH A;  1JBR A;  4BIR A;  1GSP A;  1RGG A;  1BRI A;  1X1X A;  1BU4 A;  1UCL A;  1BRH A;  1BSE A;  1BNF A;  1B2X A;  1BNJ A;  4GSP A;  1RGK A;  3WHO A;  1RNT A;  1X1U A;  3BU4 A;  1GOY A;  1AY7 A;  1BSB A;  1LOW A;  5RNT A;  4J5G A;  1I0V A;  2F56 A;  1GMQ A;  1UCK A;  2KF5 A;  4BU4 A;  1BNI A;  1I3F A;  1BSA A;  3BIR A;  2F4Y A;  2SAR A; 
#chains in the Genus database with same CATH topology
 5D81 A;  2B24 B;  1CH0 A;  3CC2 3;  4XB5 A;  2Z77 A;  2F5W A;  5AIH A;  5FGO A;  3I0Y A;  4AKZ A;  2OOV C;  3ROB A;  2LQV A;  3ECF A;  3Q3F A;  2B1X B;  3K63 A;  1IVV A;  4FMB A;  3MG1 A;  3WOF B;  3KFQ C;  1TRP A;  1IDP A;  2W04 A;  4XBY A;  1YGE A;  1E3V A;  5JPU A;  3FCS B;  5IEP A;  2KXG A;  2O3O A;  3F8H A;  4O8S A;  5M1A A;  1TFO A;  2CX1 A;  1UGI A;  2D1W A;  4I4K A;  1O7N B;  4FCJ A;  1RCK A;  1N8R 4;  1K41 A;  1PY3 A;  3LT8 A;  4L8P A;  1A90 A;  1DYU A;  3MG3 A;  1TTO A;  2RFR A;  4ZM8 A;  2ZA4 A;  1W01 A;  1YGW A;  4ILF A;  3HX8 A;  4FMD A;  1PU4 A;  1BNE A;  4J8T A;  7GSP A;  1VQ5 3;  1X1Y A;  3AGO A;  1AVK A;  1BRJ A;  1FUS A;  1S5A A;  4X2O A;  2CWV A;  2W03 A;  3F8X A;  2BHM A;  1SIH A;  3GZB A;  3T8U A;  5IG3 A;  3KN4 A;  2YFI B;  3AMO A;  1JZD A;  1RSN A;  5KP1 A;  1MWU A;  1QAK A;  4K61 A;  4WP5 A;  1EEJ A;  2E2V A;  7RNT A;  2OTJ 3;  3CPO A;  6GSP A;  3DM8 A;  1OH0 A;  1RGF A;  5M19 A;  1JN5 B;  3B4P A;  4JRF A;  2ZL8 A;  3B4O A;  5AII A;  3HII A;  1VQ4 3;  1W4N A;  2MF7 A;  4FR9 A;  2RBI A;  4EV2 A;  1Q7H A;  2XEP A;  1A67 A;  2XF3 A;  1NNV A;  1MWS A;  2QGU A;  1BNG A;  2H0G A;  1BIR A;  3CMA 3;  2QIY A;  3F9S A;  1RCL A;  2GSP A;  1RGE A;  2PZV A;  1M1X B;  3UJM A;  3CU3 A;  1Q9E A;  4MEI A;  1OAC A;  1YNV X;  4XBX A;  1US1 A;  2GU3 A;  5HOH A;  1IQ8 A;  1HU9 A;  5G1L A;  5LC6 A;  3B8L A;  1IV7 A;  2WOH A;  1VQQ A;  1BNS A;  1WNH A;  1W2B 2;  2W2C A;  1X1W A;  3EN1 B;  1IV9 A;  1TJD A;  2P38 A;  4N6U A;  1VQP 3;  3EQQ B;  1IT7 A;  1BAO A;  5IEO A;  2ZHX B;  5AIG A;  3U1W A;  4RNY A;  2K0M A;  2ZDJ A;  4R9K A;  1B3S A;  4WYK B;  5LC7 A;  4N6M A;  1RN1 A;  4XM4 A;  1OHO A;  1JKG B;  3CCR 3;  3FLJ A;  3JVC A;  1DMM A;  3LTC A;  2GBX B;  3A76 A;  3GZX B;  3IJE B;  1X1X A;  1UCL A;  1W02 A;  3Q90 A;  3WA2 X;  1E97 A;  1QMA A;  5CLK A;  1B2X A;  3NXJ A;  4BL3 A;  1GD3 A;  3O8Y A;  4WWU C;  1BUQ A;  4BTX A;  3EBT A;  3MKI A;  1X1U A;  3GZY B;  1GOY A;  3CCE 3;  4N6T A;  4TX4 A;  2HMJ B;  3F7S A;  1QVF 2;  3MSO A;  4FMC A;  4J5G A;  3S28 A;  1HKX A;  1CYV A;  2IYJ A;  2RCD A;  3EN8 A;  5G2G A;  1N5H A;  4QWT A;  5DRV A;  2XRX B;  2YX9 A;  1M1K 4;  1A2V A;  1LQG C;  5FW5 A;  2W9P A;  2SAR A;  1B27 A;  4K1V A;  3PYJ A;  1IQX A;  4N6N B;  1Q42 A;  1YHQ 3;  1UUV B;  1DVD A;  3BB9 A;  4I5Q A;  1SQW A;  1S72 3;  2AAD A;  3SVA A;  4OUQ A;  3H3H A;  1EA2 A;  1JB4 A;  1T5Y A;  2E2T A;  2K54 A;  1RHL A;  3KKG A;  3UB1 A;  1GD4 A;  3CCL 3;  4K90 B;  3GZR A;  1FUT A;  1JZO A;  1LVN A;  1BRG A;  3FH1 A;  2XR8 B;  4N6O B;  3S5C A;  1N9E A;  3RDE A;  9RNT A;  2STD A;  4HM2 B;  4WYK A;  3LT9 A;  5IG4 A;  5AEU B;  1JJ2 2;  2CFW A;  2UX0 A;  1G02 A;  3Q2P A;  2IA7 A;  4MMX B;  4DKI A;  2Q07 A;  3JUP A;  4LSO A;  5CF2 A;  3CCM 3;  1YVB I;  3KSE D;  3JUQ A;  3L0R A;  4N6L A;  3ZFZ A;  3SYU A;  1JV2 B;  3X3Y A;  5STD A;  1FW7 A;  3AHW A;  1W00 A;  2CWU A;  3HZP A;  3FKA A;  1O7H B;  1O7G B;  2KCD A;  2WGO A;  2ML5 A;  3KE7 A;  3I55 3;  3S27 A;  1Q7Y 4;  3J7Y d;  3EF8 A;  4L7K A;  2HMO B;  1WMP A;  2E2U A;  2XGL A;  4HVN A;  3FZW A;  1MNL A;  1T2I A;  4HJL B;  3SX1 A;  1PYL A;  1VQ6 3;  1B2Z A;  1BAN A;  1AVL A;  1E3R A;  1GY5 A;  4LYL B;  1BRS A;  1I2F A;  1LOX A;  2CKF B;  4IPB A;  1BRN L;  1I8V A;  3JUN A;  4JF8 A;  1WMO A;  3FGY A;  1AQZ A;  1JB5 A;  4H3U A;  2H0H A;  1FGO A;  2Y73 A;  5ELU A;  4AKY A;  1W6G A;  1VQL 3;  1VQ9 3;  3CC7 3;  2GEX A;  1FZU A;  1VQK 3;  3DUK A;  5IW9 A;  4STD A;  2D42 A;  2QA4 3;  1AV4 A;  3UNL A;  1VQ8 3;  2OQE A;  3UL5 A;  3CD6 3;  4FMA A;  2BMO B;  3NM2 A;  4ORL A;  1W7C A;  2Z6B A;  4HOH A;  2OCT A;  4CJN A;  2GXF A;  1W6Y A;  4IIA A;  1B2S A;  2KF3 A;  3CNX A;  1EKM A;  3SOA A;  3D3L A;  1B2M A;  1JBT A;  4WHA A;  1LOY A;  1I70 A;  1UDI I;  3KII A;  1TUH A;  3QRD A;  2K3D A;  5IG5 A;  2QEX 3;  3CCU 3;  1VZZ A;  3JUO A;  1GMP A;  5AIF A;  1R4C A;  4CPK A;  1BUJ A;  1UGH I;  2CC3 A;  2INX A;  1RMS A;  3MYT A;  1BVI A;  1UUG B;  4KFF A;  2RSX A;  3BNB A;  1EG9 B;  3PXM A;  1DMN A;  3NX0 A;  1IVX A;  1UCI A;  2JDI H;  1YJN 3;  3KSP A;  2XSO B;  6RNT A;  4GB5 A;  1JRQ A;  1GY7 A;  1OUN A;  2XFT A;  3DGN A;  1D6U A;  4OVM A;  1T3B A;  1O7P B;  1RGG A;  3BLZ A;  4N3V A;  1BNF A;  1EQK A;  3CPW 2;  4GSP A;  4G1M B;  1RGK A;  4MJD A;  1W6C A;  1U8C B;  5BXQ A;  1AY7 A;  1BSB A;  1G96 A;  1M9G A;  2A15 A;  2V1L A;  3K7C A;  3CCJ 3;  4N6V 0;  3IPT A;  3V98 A;  4HM3 B;  1I0V A;  1OHP A;  2H0I A;  3B7C A;  1A2K A;  3OXA A;  4BU4 A;  4NRE A;  2WO0 A;  3PCS A;  3KZT A;  4K1U A;  1I3F A;  1BSA A;  3BIR A;  1IVW A;  4MMZ B;  1IQY A;  4BTW A;  4EV5 A;  1NU3 A;  3DMC A;  2GU1 A;  3NV0 A;  3CCS 3;  2YFL B;  2RGQ A;  1J2B A;  2R4I A;  3Q1C A;  1C7H A;  5KP3 A;  4PEJ A;  3DXO A;  3X3X A;  8RNT A;  1D6Y A;  3DY5 A;  1RGC A;  1KD1 4;  4HBR A;  3N9H A;  4XDW A;  4KZ1 A;  1LOV A;  3EC9 A;  3PCR A;  2GBW B;  1FGM A;  4RZM A;  3X42 A;  4AEQ A;  4CDL A;  3EX9 A;  3MG2 A;  3I56 3;  1NDO B;  4BL2 A;  4HZB B;  3D79 A;  3D5I A;  2P05 A;  2GEY A;  6STD A;  3K0Z A;  1RGA A;  1W5Z A;  1I3I A;  1TRQ A;  5A0O B;  2UUG C;  1AR0 A;  1MWR A;  3KCH A;  3CC4 3;  2MC8 A;  1RTU A;  3HI7 A;  3G16 A;  3URP A;  1KQS 2;  2O9U X;  1F8N A;  1BGS A;  1K28 A;  1NB3 I;  1OPY A;  1RLS A;  2F98 A;  5GSP A;  2C4B A;  2JQ5 A;  1R4Y A;  1U5O A;  5M18 A;  1QAL A;  3FG1 A;  4L8O A;  2OOV A;  4CCV A;  5BVB A;  2BMQ B;  3LTD A;  3IMA B;  1ZX2 A;  3NM7 A;  1FUW A;  5AEW B;  2CHC A;  3QK9 A;  1HZ1 A;  3PGB A;  1ZO2 A;  3OX9 A;  3WOD G;  2YFJ B;  1V58 A;  2P09 A;  4O3V A;  3G4S 3;  3G0K A;  3FG3 A;  2P0M A;  3GWR A;  1IK3 A;  2L4V A;  4R4K A;  2UGI A;  3PS8 A;  3NBB A;  1I2E A;  1KSI A;  3H51 A;  3MWZ A;  4HM6 B;  2FNQ A;  4HKV B;  4RNT A;  5DRE A;  3VF1 A;  1SAR A;  1BSC A;  1RKY A;  2F5M A;  3U97 A;  2WOF A;  1KWI A;  3WDG B;  3D4A A;  3EJV A;  1GS3 A;  3RGR A;  4EC6 A;  4HM5 B;  1RN4 A;  3NBR A;  1GOV A;  4NPB A;  1RGH A;  1UI7 A;  1MOL A;  3LTB A;  1YI2 3;  1NB5 I;  1ISK A;  4EXR A;  1ASK A;  1LRA A;  5JPP A;  3V99 A;  1LQM B;  3AHS A;  4FCM A;  5AYS C;  1M90 4;  2Y74 A;  2J8X B;  3FSD A;  1RRH A;  4HM8 B;  4LEH A;  3DGO A;  3E99 A;  1LXE A;  2R41 A;  2BT3 A;  1I0X A;  3RNT A;  1RNB A;  1RDS A;  1OGZ A;  2CW9 A;  1IU7 A;  2C11 A;  1K8A 4;  3GAX A;  3LYG A;  2HML B;  2OWP A;  1IYY A;  1Y4K A;  3DZL A;  4HM0 B;  1CYU A;  1UUW B;  8CHO A;  5EQL A;  5KP4 A;  5BU4 A;  1MGW A;  1PFP A;  2W6J H;  1O7M B;  2HMM B;  4J5K A;  1UCJ A;  2I9W A;  3AGN A;  1GMR A;  2HMK B;  2P0X A;  3DGM A;  3SLU A;  3D9R A;  1SJW A;  3LZA A;  1DET A;  2WGQ A;  2CG0 A;  3CNM A;  2RNT A;  3HOH A;  1DVC A;  1OF5 B;  3FF0 A;  4R80 A;  1VQN 3;  3VSY A;  2W9Q A;  3EHC A;  4BIR A;  1YIJ 3;  5JBS A;  1BRI A;  2XGN A;  3M8C A;  1FGR A;  1BU4 A;  1ZS7 A;  3DGL A;  2CFG A;  1JB2 A;  3NV0 B;  1ULJ B;  2IUJ A;  4GL6 A;  3S67 A;  4LMI A;  4X2H A;  4IT7 A;  3V92 A;  1QAF A;  1UI8 A;  3LXU X;  5AI1 A;  3BU4 A;  1NJI 4;  1OGX A;  3HK4 A;  4XBT A;  1K73 4;  5RNT A;  3OW2 2;  1TP6 A;  3LML A;  1GMQ A;  1UCK A;  1L5G B;  2KF5 A;  3N54 B;  1BNI A;  3ZG5 A;  1Q86 4;  1EUI C;  1ULI B;  4O2H A;  2XFS A;  2F4Y A;  2W56 A;  4EBG A;  3GRD A;  3SXX A;  5IEN A;  2IMJ A;  2IY2 A;  4HZ9 B;  1RN7 A;  2XSH B;  2L1S A;  5BIR A;  3VGN A;  3ZG0 A;  1YJ9 3;  2KF6 A;  2BU4 A;  2PNC A;  1N9J A;  1YIT 3;  3X41 A;  1YVS A;  1ZGX A;  1K9M 4;  4KFE A;  3T8N A;  1FA3 A;  2FGT A;  4HM1 B;  3UL6 A;  2BNG A;  2Z7A A;  3A5E A;  3SED A;  1QJG A;  1Q40 A;  1ROV A;  1LNH A;  3CXC 2;  3FF2 A;  3G71 3;  4GHO A;  3LH4 A;  3SOY A;  3FG4 A;  3D5G A;  1FGQ A;  2FXT A;  3GSP A;  4RBN A;  1NWW A;  4FCZ A;  1OF5 A;  4WFO A;  3T0U A;  1Z1S A;  1A2P A;  1UW1 A;  3F14 A;  4HM7 B;  4J9A A;  4HAA A;  1VQM 3;  1RJO A;  2CG1 A;  1KC8 4;  3OV4 A;  4HYZ A;  2Z76 A;  3G6E 3;  2KAA A;  2KF4 A;  2XH9 A;  3OWU A;  5D82 A;  5CK6 A;  1STF I;  1FYS A;  2AAE A;  2BIR A;  1G0T A;  2BO9 B;  1IVU A;  1IT8 A;  2IUK A;  2OQE C;  2CH9 A;  2F86 B;  3BNC A;  3STD A;  3WOE B;  2HOH A;  3RGA A;  5HGR A;  2CFL A;  1RGL A;  5IER A;  3WR2 A;  4HM4 B;  1T2H A;  1STD A;  3ER7 A;  4OK0 A;  1RRL A;  3ALA A;  1BNR A;  1WMN A;  3N8B A;  5EEO A;  1CQS A;  3NQZ A;  1BRK A;  3DH2 A;  3K9M C;  3HIG A;  2C10 A;  3CME 3;  3OWY A;  4R1K A;  1FGT A;  5IG0 A;  1OCV A;  3NBJ A;  3WA3 A;  1SII A;  4H61 A;  3NUV A;  2CWT A;  4LGQ A;  3G8Z A;  4R9L A;  1B20 A;  3TDG A;  3CCQ 3;  4KFD A;  4Q53 A;  3X40 A;  4EW5 A;  3EE1 A;  1TIJ A;  5TGN A;  4LZI A;  1GYB A;  2CFD A;  1CEW I;  1LNI A;  4KVH A;  5EVH A;  3F40 A;  1VQO 3;  1TFK A;  1JBS A;  3MHE A;  5G1K A;  1JN5 A;  2HMN B;  1HYF A;  1B2U A;  3BND A;  2BMR B;  1YJW 3;  1DE3 A;  1BSD A;  2CFK A;  2ML6 A;  4MMY B;  4U13 A;  1JNQ A;  1GY6 A;  1O7W B;  1V74 A;  4NHF A;  2F99 A;  2CK3 H;  5D83 A;  7STD A;  5AYR B;  1MGR A;  1D6Z A;  3JUM A;  3NHX A;  2OTL 3;  3CCV 3;  1QVG 2;  4EYC A;  4BTY A;  2W0Q A;  4O02 B;  3X3Z A;  1DMQ A;  1I2G A;  1VQ7 3;  1GOU A;  1B21 A;  1BOX A;  4RNZ A;  1C54 A;  1WTH A;  4XDV A;  3DGY A;  2M7O A;  5CF1 A;  1OHS A;  1JBR A;  1W2Z A;  3BNE A;  3PZW A;  1GSP A;  3EB8 A;  5I97 A;  3LTA A;  1SPU A;  2W56 B;  1BRH A;  3K5T A;  1BSE A;  1MWT A;  3NQY A;  3OWS A;  1NO3 A;  3WMD A;  2LYX A;  1ROA A;  1BNJ A;  3F7X A;  1WQL B;  5CXO A;  3WHO A;  1RNT A;  1N8Q A;  4KT3 B;  3LOY A;  2SBL A;  1LOW A;  1Q82 4;  2F56 A;  3AMO B;  1JKG A;  2KRT A;  3S29 A;  1N5P A;  2CX0 A;  1V57 A;  5ELJ A;  1TU5 A;  1Q40 B;  2CIU A;  3MPH A;  3EBY A;  1Q81 4;  5IF6 A; 
#chains in the Genus database with same CATH homology
 1B27 A;  1CH0 A;  5BIR A;  2F5W A;  2KF6 A;  2BU4 A;  3Q3F A;  2AAD A;  1YVS A;  1ZGX A;  8RNT A;  1RGC A;  1TRP A;  1LOV A;  1RHL A;  3A5E A;  1FUT A;  1BRG A;  9RNT A;  3D5I A;  4GHO A;  1RGA A;  3D5G A;  3GSP A;  1RCK A;  1I3I A;  1TRQ A;  1PY3 A;  1G02 A;  3KCH A;  1A2P A;  1RTU A;  3URP A;  4HAA A;  1BGS A;  1TTO A;  1RLS A;  5GSP A;  2C4B A;  2ZA4 A;  1R4Y A;  1YGW A;  2KAA A;  2KF4 A;  3SYU A;  1FW7 A;  1BNE A;  3AHW A;  7GSP A;  1X1Y A;  1FYS A;  3AGO A;  1BRJ A;  1FUS A;  1HZ1 A;  2AAE A;  2BIR A;  1T2I A;  1RSN A;  1PYL A;  2HOH A;  1B2Z A;  1BAN A;  1I2E A;  1RGL A;  4RNT A;  3WR2 A;  1T2H A;  1BRS A;  1I2F A;  1BSC A;  1SAR A;  2F5M A;  7RNT A;  1BRN L;  6GSP A;  1I8V A;  1RGF A;  1BRK A;  3D4A A;  3DH2 A;  1AQZ A;  1RN4 A;  1GOV A;  1RGH A;  2RBI A;  1FZU A;  1LRA A;  1B20 A;  1BNR A;  1BNG A;  3AHS A;  1BIR A;  1LNI A;  1RCL A;  2GSP A;  1JBS A;  1RGE A;  4HOH A;  1Q9E A;  1HYF A;  1B2U A;  1DE3 A;  1YNV X;  1I0X A;  3RNT A;  1RNB A;  5HOH A;  1BSD A;  1RDS A;  1B2S A;  2KF3 A;  1B2M A;  1JBT A;  1LOY A;  1BNS A;  1I70 A;  1MGR A;  1IYY A;  1BUJ A;  5BU4 A;  1GMP A;  1MGW A;  1X1W A;  1RMS A;  1I2G A;  1BVI A;  1BAO A;  1UCJ A;  4J5K A;  3AGN A;  1GOU A;  1GMR A;  1B21 A;  1BOX A;  1B3S A;  1UCI A;  1DET A;  1C54 A;  1RN1 A;  6RNT A;  3DGY A;  2RNT A;  3HOH A;  1JBR A;  4BIR A;  1GSP A;  1RGG A;  1BRI A;  1X1X A;  1BU4 A;  1UCL A;  1BRH A;  1BSE A;  1BNF A;  1B2X A;  1BNJ A;  4GSP A;  1RGK A;  3WHO A;  1RNT A;  1X1U A;  3BU4 A;  1GOY A;  1AY7 A;  1BSB A;  1LOW A;  5RNT A;  4J5G A;  1I0V A;  2F56 A;  1GMQ A;  1UCK A;  2KF5 A;  4BU4 A;  1BNI A;  1I3F A;  1BSA A;  3BIR A;  2F4Y A;  2SAR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...