1IYYA

Nmr structure of gln25-ribonuclease t1, 24 structures
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
104
structure length
104
Chain Sequence
b'ACDYTCGSNCYSSSDVSTAQAAGYQLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE T1
publication title Determination of the NMR structure of Gln25-ribonuclease T1.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
total genus 10
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2002-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1iyyA00
1GMRA 1GOVA 3DGYA 1BAOA 1RGKA 7GSPA 1BRHA 1FUTA 1RGEA 1X1WA 2BU4A 1G02A 1X1UA 1PY3A 3Q3FA 1UCLA 3DH2A 1BNIA 1X1XA 3HOHA 1I0VA 1GMQA 1FZUA 3BU4A 1RMSA 1RGFA 3AGNA 1FW7A 1RGGA 4HAAA 1DETA 2C4BA 2KAAA 1RCLA 4GSPA 1RGLA 1RDSA 4RNTA 1TTOA 1I2FA 1B21A 1I3IA 1B3SA 1LNIA 1BUJA 1BSAA 1R4YA 2KF4A 3D5IA 1PYLA 1X1YA 1BNFA 1BIRA 2F4YA 1AY7A 1MGRA 1MGWA 2RNTA 6GSPA 1T2HA 1JBSA 1BVIA 3AHSA 2SARA 1BOXA 1AQZA 1BRSA 1UCJA 1RSNA 5RNTA 2KF5A 1BSCA 3GSPA 5HOHA 1UCIA 2AADA 1RGCA 2ZA4A 1B2SA 2HOHA 3D4AA 1BGSA 3AGOA 4BU4A 1LOWA 1JBRA 5GSPA 4GHOA 1BSEA 3WHOA 1RGHA 1BNJA 2BIRA 1CH0A 1IYYA 2GSPA 1LOVA 1GOUA 1T2IA 1LOYA 1I8VA 3KCHA 1BRIA 1BRJA 1Q9EA 1BU4A 1TRQA 1DE3A 1A2PA 2RBIA 2F5MA 3URPA 2F5WA 2KF6A 1FYSA 1C54A 1RHLA 1I3FA 1ZGXA 1I2EA 7RNTA 4J5GA 1B27A 1RGAA 4BIRA 1FUSA 1B2ZA 1B20A 3D5GA 1BRNL 8RNTA 3SYUA 3BIRA 4J5KA 1RCKA 9RNTA 1B2UA 4HOHA 1RLSA 1GMPA 1BRKA 1TRPA 1JBTA 1BNEA 1I2GA 1RTUA 5BU4A 1BRGA 1YGWA 1RNBA 1BNGA 1SARA 3RNTA 3WR2A 1BNRA 1RNTA 1B2XA 1RN1A 1YNVX 1BNSA 1BSDA 2F56A 1YVSA 6RNTA 1B2MA 1GOYA 2AAEA 1I70A 5BIRA 1RN4A 1UCKA 1HZ1A 2KF3A 1GSPA 1BANA 3AHWA 1BSBA 3A5EA 1I0XA 1LRAA 1HYFA
chains in the Genus database with same CATH superfamily
3K0ZA 1US1A 4XB5A 1U5OA 1W2B2 1JJ22 2Z77A 1BRHA 1JB2A 3NV0B 4RNZA 1C7HA 1X1WA 4U13A 5AEWB 2CFDA 7STDA 2ZL8A 3EJVA 4HJLB 3ALAA 3DH2A 1BNIA 3NM7A 4HM4B 3G8ZA 1X1XA 4HM6B 4QWTA 1N5PA 2Q07A 3SVAA 2R4IA 3BU4A 4AEQA 1RMSA 4JF8A 4RBNA 5IEOA 4HAAA 1DETA 2C4BA 4GSPA 3UJMA 3HIGA 1KD14 4XM4A 1YHQ3 2CKFB 4N3VA 1I3IA 2XSHB 2GXFA 3ER7A 1JNQA 1LNIA 2KXGA 1AVLA 3LT9A 1BSAA 1OF5A 1R4YA 3HIIA 3BNBA 1DMMA 4J9AA 1BNFA 2HMKB 4TX4A 2XGLA 4O02B 1MGRA 4ILFA 3PZWA 4EXRA 1K28A 1Z1SA 5EQLA 2OCTA 3FG3A 4HM8B 3X3ZA 1TJDA 1W01A 3K5TA 3LTCA 3LT8A 2LYXA 5RNTA 3HI7A 3G0KA 2M7OA 4I5QA 1EKMA 3GAXA 1S5AA 3GZXB 1UI8A 3DGNA 1OUNA 1CYUA 4R1KA 1GD4A 3G713 3FSDA 4KFDA 1VQQA 4KZ1A 1CQSA 4EBGA 5LC7A 1LOXA 1W4NA 4L8OA 5D81A 4R80A 5GSPA 1D6UA 2CX1A 1NB5I 3D9RA 4RNYA 4IIAA 1EG9B 1LOVA 2LQVA 2UGIA 1I8VA 4NREA 4IT7A 1BRIA 3GZBA 1N8QA 2IUJA 3FLJA 1NU3A 2Y74A 4OUQA 4HM7B 1CYVA 1FUWA 4FMBA 1VQK3 3BLZA 2KF6A 1FYSA 3F8HA 3WODG 5G2GA 3SEDA 1Q814 3V99A 4AKZA 3Q90A 1MWUA 3D5GA 3CXC2 4MEIA 4EC6A 1VQ73 4GB5A 3X40A 1ULJB 3BIRA 4J5KA 9RNTA 3WDGB 3N9HA 1B2UA 4XBYA 1RKYA 1Q7Y4 1RRLA 2PZVA 1GD3A 3MG2A 1S723 1GMPA 1YGEA 2B24B 3BNCA 1QJGA 1JBTA 4PEJA 4ORLA 1NO3A 1I2GA 1JKGA 5BU4A 1IT7A 1YGWA 2IYJA 1RNBA 5CXOA 2INXA 1GY7A 2K0MA 4FMDA 3NQZA 1UGHI 5IG4A 2W04A 1BSDA 3J7Yd 4I4KA 3CCE3 1B2MA 3CCM3 1V57A 3SX1A 2AAEA 1I70A 1TFOA 3OXAA 1Q824 2MC8A 1ZO2A 3NUVA 2RSXA 5DREA 5KP1A 1I0XA 3EN1B 4HM1B 3LTAA 1ISKA 1DYUA 3CCQ3 3JUMA 1GMRA 7GSPA 1O7MB 1T5YA 3K9MC 3M8CA 4EV2A 4X2HA 1FUTA 3CCR3 3S5CA 3JUOA 1M9GA 1IVVA 1OACA 4HZ9B 3U1WA 1W7CA 1PY3A 2ZDJA 3RDEA 5ELJA 1JN5A 1IV9A 3LYGA 3MHEA 2OWPA 2CIUA 5IENA 3CNXA 3ZFZA 5D82A 1FZUA 2BO9B 4WYKA 3DXOA 4FCZA 1UW1A 2XSOB 3AGNA 1E3RA 1W6YA 1JZOA 2OTJ3 2KAAA 2CG0A 3OX9A 3O8YA 2CW9A 1SQWA 1QALA 3EHCA 1B21A 2CWTA 2BMOB 3VSYA 3FZWA 1QVF2 1OHSA 2GU1A 4N6LA 2WO0A 3D5IA 4WHAA 3RGRA 2CFLA 2UX0A 1A90A 3DUKA 1IQ8A 3I563 2SBLA 3JUPA 1T2HA 1DVCA 3AHSA 2ML6A 3S27A 2J8XB 2C10A 3IPTA 3DGMA 2QA43 1RSNA 2CHCA 3CPW2 1BSCA 4JRFA 4K1UA 4K90B 4KVHA 1OGXA 3WOFB 5IG5A 4FR9A 3MYTA 2AADA 3I553 1YJN3 1RGCA 1RN7A 8CHOA 3H3HA 1VQP3 1YIT3 1LXEA 4LYLB 2BT3A 4WWUC 3GZRA 2E2TA 1IVUA 1OH0A 2L4VA 1LOWA 3UL5A 3G6E3 2Z6BA 4MMZB 1BSEA 1BNJA 2OOVA 2BIRA 2JQ5A 3BB9A 2GSPA 1IVXA 3FF2A 4CJNA 2HMOB 2FGTA 3NBRA 1LOYA 4FMCA 1W6GA 5AIHA 2W03A 1KWIA 3JUQA 2W9PA 5BXQA 4HYZA 4OK0A 1A2PA 5AYRB 3ZG5A 1PFPA 2CG1A 5AI1A 1K734 2F98A 1RHLA 1I3FA 1G0TA 4O2HA 3OWSA 2QEX3 1O7NB 1Q40B 1OHPA 3EF8A 1B27A 1IQYA 1GY6A 1STFI 1W5ZA 1OPYA 4H61A 2C11A 3IJEB 3SOAA 5IG3A 2WOFA 3EC9A 1RCKA 4XDWA 1JN5B 2BMQB 2CFWA 3QRDA 3WMDA 1ROAA 1VQ63 1N5HA 4WYKB 3F7SA 1T3BA 2F86B 3AMOA 2IMJA 4K61A 3PGBA 1J2BA 1BNEA 1RTUA 4O8SA 4LMIA 1WTHA 3F14A 1HKXA 3GWRA 3JUNA 3V92A 1KSIA 3N8BA 1O7HB 4HZBB 2R41A 3FG4A 1RN1A 4MJDA 1IV7A 1NWWA 5M19A 5IERA 1GYBA 2YFIB 2P0XA 5JBSA 3CME3 1PU4A 2CWVA 1GOYA 3HX8A 1W2ZA 1ULIB 1RN4A 1WMNA 1HZ1A 4L8PA 1Q864 2KF3A 1DMQA 1W02A 3T0UA 2CWUA 1BSBA 3A5EA 1TFKA 1LRAA 1A67A 3G16A 3DGYA 3EX9A 1SJWA 1O7PB 1O7WB 2A15A 4EW5A 1YJ93 1Q7HA 3MWZA 1RGEA 1STDA 1UDII 2V1LA 1WQLB 3FH1A 2BU4A 1X1UA 2ML5A 3IMAB 3EBTA 1V74A 3LTDA 4L7KA 2OTL3 3CNMA 4O3VA 5HGRA 3NX0A 1I0VA 1OF5B 1GMQA 3MG1A 3PS8A 2GBXB 1CEWI 3NV0A 2XEPA 1FW7A 3KIIA 2CFGA 5IEPA 1QAKA 3DZLA 1RCLA 3CCS3 1RDSA 4RNTA 2STDA 5G1LA 1I2FA 4NPBA 1JB4A 3FKAA 5IW9A 1BUJA 3LZAA 5KP3A 3S28A 5AEUB 2KF4A 4MMYB 5JPPA 5A0OB 2F4YA 3CU3A 2E2UA 1MGWA 6GSPA 2QGUA 1RRHA 1G96A 2B1XB 5CF2A 1ZS7A 2SARA 5AYSC 3CCL3 4RZMA 1BOXA 3STDA 1UCJA 3HZPA 1IQXA 1LVNA 5IG0A 1UI7A 4CDLA 2XFSA 1ROVA 1GS3A 1IDPA 3MKIA 5HOHA 3WA3A 1EUIC 3X3YA 3CD63 1UUWB 1L5GB 2L1SA 2O9UX 3BNEA 1IU7A 3PXMA 1VQL3 3AMOB 1B2SA 1TP6A 3D4AA 2W6JH 1BGSA 3MSOA 3AGOA 2KRTA 1MNLA 1YVBI 1Y4KA 2Y73A 4XBXA 1RGHA 3WA2X 4HM2B 1GY5A 2I9WA 1M904 1T2IA 2P0MA 1VQN3 3B7CA 4AKYA 1UUVB 3L0RA 1WMPA 1BRJA 3FF0A 3G4S3 1TRQA 2XGNA 4STDA 1DE3A 1QAFA 3DM8A 2F5MA 3PCSA 1JV2B 1DMNA 1E97A 2F5WA 3A76A 4N6NB 1U8CB 2GU3A 3FCSB 3VGNA 3V98A 3UB1A 5IF6A 1ZGXA 3LMLA 1I2EA 2OOVC 3T8UA 5KP4A 2W9QA 2IA7A 7RNTA 4BIRA 4HM3B 1MWSA 2Z7AA 1IVWA 1FUSA 2W2CA 4LSOA 3U97A 1EQKA 1BRNL 1A2KA 1JKGB 1YJW3 3RGAA 3GRDA 1W00A 3SYUA 8RNTA 3KFQC 3Q2PA 2ZHXB 3WOEB 3LTBA 2RGQA 2CX0A 2D42A 3EQQB 5AIIA 4MMXB 1RLSA 3D3LA 3OV4A 2OQEA 1BRKA 1FGMA 1JRQA 2IY2A 3CPOA 3NXJA 1VQ83 4BL3A 2GEXA 5CF1A 3EE1A 1JZDA 1BRGA 3TDGA 4HVNA 3KN4A 4FMAA 1BNGA 1SARA 1W6CA 3RNTA 2CFKA 2GEYA 4KFFA 3WR2A 4ZM8A 3CC43 1RNTA 3FG1A 1B2XA 2FNQA 5M18A 1BNRA 3GZYB 1YNVX 1YIJ3 1EA2A 1MWTA 1BNSA 4X2OA 4H3UA 3D79A 1OCVA 6RNTA 2BNGA 3F40A 4HM0B 3KKGA 2UUGC 1SIHA 5BIRA 1UCKA 1N9EA 3MG3A 4N6UA 3KE7A 1GSPA 3S29A 1BANA 3AHWA 4LGQA 3VF1A 4DKIA 1K8A4 1B2ZA 2CC3A 4EYCA 1FGRA 2CH9A 1HU9A 1GOVA 2XH9A 1BAOA 1RGKA 3SXXA 1YI23 3UL6A 2P38A 3H51A 2W0QA 2GBWB 1UGIA 2W56A 1V58A 2H0HA 3K7CA 1G02A 4R9LA 5D83A 5ELUA 3Q3FA 1QMAA 1UCLA 3FGYA 3I0YA 3DMCA 3OWYA 1NNVA 3CCU3 3HOHA 3Q1CA 2IUKA 3X3XA 4WP5A 1OGZA 3F8XA 2BMRB 1K9M4 1VQM3 2XF3A 1RGFA 1IT8A 1M1XB 1UUGB 1RGGA 2H0IA 1AVKA 2WGQA 2XRXB 3ROBA 2E2VA 3S67A 4Q53A 1RGLA 2WOHA 4HM5B 3X41A 5FGOA 3OWUA 1TTOA 1MWRA 2HMNB 4BTXA 1B3SA 1AV4A 3DGLA 1N8R4 3SLUA 3ECFA 2Z76A 1PYLA 1X1YA 4R9KA 1KQS2 1BIRA 3QK9A 2JDIH 1AY7A 4LEHA 2RNTA 4WFOA 1VQ43 2YX9A 1O7GB 1JBSA 1BVIA 4R4KA 5DRVA 5G1KA 1N9JA 3CCV3 1AQZA 1BRSA 1MOLA 4N6TA 2KF5A 1LNHA 1ZX2A 2FXTA 3GSPA 2K54A 3LXUX 1UCIA 3E99A 4FCMA 4BTWA 2RFRA 1LQGC 5CK6A 1A2VA 1RJOA 2HMLB 2ZA4A 3UNLA 1BUQA 2HOHA 4EV5A 4N6OB 4N6MA 3BNDA 1VQO3 3EN8A 2P05A 4BU4A 1QVG2 1FA3A 1JBRA 5CLKA 3LOYA 4GHOA 2WGOA 4GL6A 3WHOA 3EB8A 1WMOA 1FGQA 1EEJA 4HKVB 1CH0A 1IYYA 3B4PA 3NBBA 4OVMA 1GOUA 3SOYA 4LZIA 4XBTA 2PNCA 4FCJA 1TIJA 3JVCA 1FGOA 3CCJ3 3KCHA 5EVHA 5LC6A 3CC73 3B4OA 1Q9EA 1BU4A 3DY5A 2RBIA 4IPBA 1VQ53 1JB5A 1ASKA 2KCDA 5AIGA 3URPA 4G1MB 3LH4A 1C54A 1E3VA 1WNHA 3NQYA 2YFJB 4XDVA 4CPKA 1LQMB 1VQ93 3NM2A 4J5GA 1RGAA 3PCRA 2MF7A 2W56B 1B20A 3NBJA 1TU5A 2RCDA 5JPUA 1NJI4 1M1K4 2HMMB 1SIIA 5BVBA 4HOHA 5EEOA 1KC84 2XR8B 2F99A 1Q42A 2YFLB 4NHFA 4J8TA 3T8NA 6STDA 2O3OA 3B8LA 1Q40A 4K1VA 1R4CA 1NB3I 1TRPA 4CCVA 1NDOB 1OHOA 4KFEA 5AIFA 4KT3B 3ZG0A 3F7XA 1D6YA 2XFTA 4BL2A 2P09A 1VZZA 3CC23 2QIYA 1SPUA 1F8NA 2H0GA 3KSPA 3HK4A 1TUHA 5TGNA 3N54B 2OQEC 1K41A 3KZTA 3K63A 5M1AA 5STDA 2F56A 1YVSA 3F9SA 3KSED 3DGOA 3X42A 4BTYA 5I97A 1DVDA 4HBRA 3OW22 2BHMA 5FW5A 1IK3A 3PYJA 1AR0A 2K3DA 2D1WA 3EBYA 1D6ZA 1FGTA 4N6V0 3CMA3 2HMJB 1HYFA 3NHXA 2CK3H 3MPHA
chains in the Genus database with same CATH topology
1GMRA 1GOVA 3DGYA 1BAOA 1RGKA 7GSPA 1BRHA 1FUTA 1RGEA 1X1WA 2BU4A 1G02A 1X1UA 1PY3A 3Q3FA 1UCLA 3DH2A 1BNIA 1X1XA 3HOHA 1I0VA 1GMQA 1FZUA 3BU4A 1RMSA 1RGFA 3AGNA 1FW7A 1RGGA 4HAAA 1DETA 2C4BA 2KAAA 1RCLA 4GSPA 1RGLA 1RDSA 4RNTA 1TTOA 1I2FA 1B21A 1I3IA 1B3SA 1LNIA 1BUJA 1BSAA 1R4YA 2KF4A 3D5IA 1PYLA 1X1YA 1BNFA 1BIRA 2F4YA 1AY7A 1MGRA 1MGWA 2RNTA 6GSPA 1T2HA 1JBSA 1BVIA 3AHSA 2SARA 1BOXA 1AQZA 1BRSA 1UCJA 1RSNA 5RNTA 2KF5A 1BSCA 3GSPA 5HOHA 1UCIA 2AADA 1RGCA 2ZA4A 1B2SA 2HOHA 3D4AA 1BGSA 3AGOA 4BU4A 1LOWA 1JBRA 5GSPA 4GHOA 1BSEA 3WHOA 1RGHA 1BNJA 2BIRA 1CH0A 1IYYA 2GSPA 1LOVA 1GOUA 1T2IA 1LOYA 1I8VA 3KCHA 1BRIA 1BRJA 1Q9EA 1BU4A 1TRQA 1DE3A 1A2PA 2RBIA 2F5MA 3URPA 2F5WA 2KF6A 1FYSA 1C54A 1RHLA 1I3FA 1ZGXA 1I2EA 7RNTA 4J5GA 1B27A 1RGAA 4BIRA 1FUSA 1B2ZA 1B20A 3D5GA 1BRNL 8RNTA 3SYUA 3BIRA 4J5KA 1RCKA 9RNTA 1B2UA 4HOHA 1RLSA 1GMPA 1BRKA 1TRPA 1JBTA 1BNEA 1I2GA 1RTUA 5BU4A 1BRGA 1YGWA 1RNBA 1BNGA 1SARA 3RNTA 3WR2A 1BNRA 1RNTA 1B2XA 1RN1A 1YNVX 1BNSA 1BSDA 2F56A 1YVSA 6RNTA 1B2MA 1GOYA 2AAEA 1I70A 5BIRA 1RN4A 1UCKA 1HZ1A 2KF3A 1GSPA 1BANA 3AHWA 1BSBA 3A5EA 1I0XA 1LRAA 1HYFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GMR A;  1GOV A;  3DGY A;  1BAO A;  1RGK A;  7GSP A;  1BRH A;  1FUT A;  1RGE A;  1X1W A;  2BU4 A;  1G02 A;  1X1U A;  1PY3 A;  3Q3F A;  1UCL A;  3DH2 A;  1BNI A;  1X1X A;  3HOH A;  1I0V A;  1GMQ A;  1FZU A;  3BU4 A;  1RMS A;  1RGF A;  3AGN A;  1FW7 A;  1RGG A;  4HAA A;  1DET A;  2C4B A;  2KAA A;  1RCL A;  4GSP A;  1RGL A;  1RDS A;  4RNT A;  1TTO A;  1I2F A;  1B21 A;  1I3I A;  1B3S A;  1LNI A;  1BUJ A;  1BSA A;  1R4Y A;  2KF4 A;  3D5I A;  1PYL A;  1X1Y A;  1BNF A;  1BIR A;  2F4Y A;  1AY7 A;  1MGR A;  1MGW A;  2RNT A;  6GSP A;  1T2H A;  1JBS A;  1BVI A;  3AHS A;  2SAR A;  1BOX A;  1AQZ A;  1BRS A;  1UCJ A;  1RSN A;  5RNT A;  2KF5 A;  1BSC A;  3GSP A;  5HOH A;  1UCI A;  2AAD A;  1RGC A;  2ZA4 A;  1B2S A;  2HOH A;  3D4A A;  1BGS A;  3AGO A;  4BU4 A;  1LOW A;  1JBR A;  5GSP A;  4GHO A;  1BSE A;  3WHO A;  1RGH A;  1BNJ A;  2BIR A;  1CH0 A;  1IYY A;  2GSP A;  1LOV A;  1GOU A;  1T2I A;  1LOY A;  1I8V A;  3KCH A;  1BRI A;  1BRJ A;  1Q9E A;  1BU4 A;  1TRQ A;  1DE3 A;  1A2P A;  2RBI A;  2F5M A;  3URP A;  2F5W A;  2KF6 A;  1FYS A;  1C54 A;  1RHL A;  1I3F A;  1ZGX A;  1I2E A;  7RNT A;  4J5G A;  1B27 A;  1RGA A;  4BIR A;  1FUS A;  1B2Z A;  1B20 A;  3D5G A;  1BRN L;  8RNT A;  3SYU A;  3BIR A;  4J5K A;  1RCK A;  9RNT A;  1B2U A;  4HOH A;  1RLS A;  1GMP A;  1BRK A;  1TRP A;  1JBT A;  1BNE A;  1I2G A;  1RTU A;  5BU4 A;  1BRG A;  1YGW A;  1RNB A;  1BNG A;  1SAR A;  3RNT A;  3WR2 A;  1BNR A;  1RNT A;  1B2X A;  1RN1 A;  1YNV X;  1BNS A;  1BSD A;  2F56 A;  1YVS A;  6RNT A;  1B2M A;  1GOY A;  2AAE A;  1I70 A;  5BIR A;  1RN4 A;  1UCK A;  1HZ1 A;  2KF3 A;  1GSP A;  1BAN A;  3AHW A;  1BSB A;  3A5E A;  1I0X A;  1LRA A;  1HYF A; 
#chains in the Genus database with same CATH topology
 3K0Z A;  1US1 A;  4XB5 A;  1U5O A;  1W2B 2;  1JJ2 2;  2Z77 A;  1BRH A;  1JB2 A;  3NV0 B;  4RNZ A;  1C7H A;  1X1W A;  4U13 A;  5AEW B;  2CFD A;  7STD A;  2ZL8 A;  3EJV A;  4HJL B;  3ALA A;  3DH2 A;  1BNI A;  3NM7 A;  4HM4 B;  3G8Z A;  1X1X A;  4HM6 B;  4QWT A;  1N5P A;  2Q07 A;  3SVA A;  2R4I A;  3BU4 A;  4AEQ A;  1RMS A;  4JF8 A;  4RBN A;  5IEO A;  4HAA A;  1DET A;  2C4B A;  4GSP A;  3UJM A;  3HIG A;  1KD1 4;  4XM4 A;  1YHQ 3;  2CKF B;  4N3V A;  1I3I A;  2XSH B;  2GXF A;  3ER7 A;  1JNQ A;  1LNI A;  2KXG A;  1AVL A;  3LT9 A;  1BSA A;  1OF5 A;  1R4Y A;  3HII A;  3BNB A;  1DMM A;  4J9A A;  1BNF A;  2HMK B;  4TX4 A;  2XGL A;  4O02 B;  1MGR A;  4ILF A;  3PZW A;  4EXR A;  1K28 A;  1Z1S A;  5EQL A;  2OCT A;  3FG3 A;  4HM8 B;  3X3Z A;  1TJD A;  1W01 A;  3K5T A;  3LTC A;  3LT8 A;  2LYX A;  5RNT A;  3HI7 A;  3G0K A;  2M7O A;  4I5Q A;  1EKM A;  3GAX A;  1S5A A;  3GZX B;  1UI8 A;  3DGN A;  1OUN A;  1CYU A;  4R1K A;  1GD4 A;  3G71 3;  3FSD A;  4KFD A;  1VQQ A;  4KZ1 A;  1CQS A;  4EBG A;  5LC7 A;  1LOX A;  1W4N A;  4L8O A;  5D81 A;  4R80 A;  5GSP A;  1D6U A;  2CX1 A;  1NB5 I;  3D9R A;  4RNY A;  4IIA A;  1EG9 B;  1LOV A;  2LQV A;  2UGI A;  1I8V A;  4NRE A;  4IT7 A;  1BRI A;  3GZB A;  1N8Q A;  2IUJ A;  3FLJ A;  1NU3 A;  2Y74 A;  4OUQ A;  4HM7 B;  1CYV A;  1FUW A;  4FMB A;  1VQK 3;  3BLZ A;  2KF6 A;  1FYS A;  3F8H A;  3WOD G;  5G2G A;  3SED A;  1Q81 4;  3V99 A;  4AKZ A;  3Q90 A;  1MWU A;  3D5G A;  3CXC 2;  4MEI A;  4EC6 A;  1VQ7 3;  4GB5 A;  3X40 A;  1ULJ B;  3BIR A;  4J5K A;  9RNT A;  3WDG B;  3N9H A;  1B2U A;  4XBY A;  1RKY A;  1Q7Y 4;  1RRL A;  2PZV A;  1GD3 A;  3MG2 A;  1S72 3;  1GMP A;  1YGE A;  2B24 B;  3BNC A;  1QJG A;  1JBT A;  4PEJ A;  4ORL A;  1NO3 A;  1I2G A;  1JKG A;  5BU4 A;  1IT7 A;  1YGW A;  2IYJ A;  1RNB A;  5CXO A;  2INX A;  1GY7 A;  2K0M A;  4FMD A;  3NQZ A;  1UGH I;  5IG4 A;  2W04 A;  1BSD A;  3J7Y d;  4I4K A;  3CCE 3;  1B2M A;  3CCM 3;  1V57 A;  3SX1 A;  2AAE A;  1I70 A;  1TFO A;  3OXA A;  1Q82 4;  2MC8 A;  1ZO2 A;  3NUV A;  2RSX A;  5DRE A;  5KP1 A;  1I0X A;  3EN1 B;  4HM1 B;  3LTA A;  1ISK A;  1DYU A;  3CCQ 3;  3JUM A;  1GMR A;  7GSP A;  1O7M B;  1T5Y A;  3K9M C;  3M8C A;  4EV2 A;  4X2H A;  1FUT A;  3CCR 3;  3S5C A;  3JUO A;  1M9G A;  1IVV A;  1OAC A;  4HZ9 B;  3U1W A;  1W7C A;  1PY3 A;  2ZDJ A;  3RDE A;  5ELJ A;  1JN5 A;  1IV9 A;  3LYG A;  3MHE A;  2OWP A;  2CIU A;  5IEN A;  3CNX A;  3ZFZ A;  5D82 A;  1FZU A;  2BO9 B;  4WYK A;  3DXO A;  4FCZ A;  1UW1 A;  2XSO B;  3AGN A;  1E3R A;  1W6Y A;  1JZO A;  2OTJ 3;  2KAA A;  2CG0 A;  3OX9 A;  3O8Y A;  2CW9 A;  1SQW A;  1QAL A;  3EHC A;  1B21 A;  2CWT A;  2BMO B;  3VSY A;  3FZW A;  1QVF 2;  1OHS A;  2GU1 A;  4N6L A;  2WO0 A;  3D5I A;  4WHA A;  3RGR A;  2CFL A;  2UX0 A;  1A90 A;  3DUK A;  1IQ8 A;  3I56 3;  2SBL A;  3JUP A;  1T2H A;  1DVC A;  3AHS A;  2ML6 A;  3S27 A;  2J8X B;  2C10 A;  3IPT A;  3DGM A;  2QA4 3;  1RSN A;  2CHC A;  3CPW 2;  1BSC A;  4JRF A;  4K1U A;  4K90 B;  4KVH A;  1OGX A;  3WOF B;  5IG5 A;  4FR9 A;  3MYT A;  2AAD A;  3I55 3;  1YJN 3;  1RGC A;  1RN7 A;  8CHO A;  3H3H A;  1VQP 3;  1YIT 3;  1LXE A;  4LYL B;  2BT3 A;  4WWU C;  3GZR A;  2E2T A;  1IVU A;  1OH0 A;  2L4V A;  1LOW A;  3UL5 A;  3G6E 3;  2Z6B A;  4MMZ B;  1BSE A;  1BNJ A;  2OOV A;  2BIR A;  2JQ5 A;  3BB9 A;  2GSP A;  1IVX A;  3FF2 A;  4CJN A;  2HMO B;  2FGT A;  3NBR A;  1LOY A;  4FMC A;  1W6G A;  5AIH A;  2W03 A;  1KWI A;  3JUQ A;  2W9P A;  5BXQ A;  4HYZ A;  4OK0 A;  1A2P A;  5AYR B;  3ZG5 A;  1PFP A;  2CG1 A;  5AI1 A;  1K73 4;  2F98 A;  1RHL A;  1I3F A;  1G0T A;  4O2H A;  3OWS A;  2QEX 3;  1O7N B;  1Q40 B;  1OHP A;  3EF8 A;  1B27 A;  1IQY A;  1GY6 A;  1STF I;  1W5Z A;  1OPY A;  4H61 A;  2C11 A;  3IJE B;  3SOA A;  5IG3 A;  2WOF A;  3EC9 A;  1RCK A;  4XDW A;  1JN5 B;  2BMQ B;  2CFW A;  3QRD A;  3WMD A;  1ROA A;  1VQ6 3;  1N5H A;  4WYK B;  3F7S A;  1T3B A;  2F86 B;  3AMO A;  2IMJ A;  4K61 A;  3PGB A;  1J2B A;  1BNE A;  1RTU A;  4O8S A;  4LMI A;  1WTH A;  3F14 A;  1HKX A;  3GWR A;  3JUN A;  3V92 A;  1KSI A;  3N8B A;  1O7H B;  4HZB B;  2R41 A;  3FG4 A;  1RN1 A;  4MJD A;  1IV7 A;  1NWW A;  5M19 A;  5IER A;  1GYB A;  2YFI B;  2P0X A;  5JBS A;  3CME 3;  1PU4 A;  2CWV A;  1GOY A;  3HX8 A;  1W2Z A;  1ULI B;  1RN4 A;  1WMN A;  1HZ1 A;  4L8P A;  1Q86 4;  2KF3 A;  1DMQ A;  1W02 A;  3T0U A;  2CWU A;  1BSB A;  3A5E A;  1TFK A;  1LRA A;  1A67 A;  3G16 A;  3DGY A;  3EX9 A;  1SJW A;  1O7P B;  1O7W B;  2A15 A;  4EW5 A;  1YJ9 3;  1Q7H A;  3MWZ A;  1RGE A;  1STD A;  1UDI I;  2V1L A;  1WQL B;  3FH1 A;  2BU4 A;  1X1U A;  2ML5 A;  3IMA B;  3EBT A;  1V74 A;  3LTD A;  4L7K A;  2OTL 3;  3CNM A;  4O3V A;  5HGR A;  3NX0 A;  1I0V A;  1OF5 B;  1GMQ A;  3MG1 A;  3PS8 A;  2GBX B;  1CEW I;  3NV0 A;  2XEP A;  1FW7 A;  3KII A;  2CFG A;  5IEP A;  1QAK A;  3DZL A;  1RCL A;  3CCS 3;  1RDS A;  4RNT A;  2STD A;  5G1L A;  1I2F A;  4NPB A;  1JB4 A;  3FKA A;  5IW9 A;  1BUJ A;  3LZA A;  5KP3 A;  3S28 A;  5AEU B;  2KF4 A;  4MMY B;  5JPP A;  5A0O B;  2F4Y A;  3CU3 A;  2E2U A;  1MGW A;  6GSP A;  2QGU A;  1RRH A;  1G96 A;  2B1X B;  5CF2 A;  1ZS7 A;  2SAR A;  5AYS C;  3CCL 3;  4RZM A;  1BOX A;  3STD A;  1UCJ A;  3HZP A;  1IQX A;  1LVN A;  5IG0 A;  1UI7 A;  4CDL A;  2XFS A;  1ROV A;  1GS3 A;  1IDP A;  3MKI A;  5HOH A;  3WA3 A;  1EUI C;  3X3Y A;  3CD6 3;  1UUW B;  1L5G B;  2L1S A;  2O9U X;  3BNE A;  1IU7 A;  3PXM A;  1VQL 3;  3AMO B;  1B2S A;  1TP6 A;  3D4A A;  2W6J H;  1BGS A;  3MSO A;  3AGO A;  2KRT A;  1MNL A;  1YVB I;  1Y4K A;  2Y73 A;  4XBX A;  1RGH A;  3WA2 X;  4HM2 B;  1GY5 A;  2I9W A;  1M90 4;  1T2I A;  2P0M A;  1VQN 3;  3B7C A;  4AKY A;  1UUV B;  3L0R A;  1WMP A;  1BRJ A;  3FF0 A;  3G4S 3;  1TRQ A;  2XGN A;  4STD A;  1DE3 A;  1QAF A;  3DM8 A;  2F5M A;  3PCS A;  1JV2 B;  1DMN A;  1E97 A;  2F5W A;  3A76 A;  4N6N B;  1U8C B;  2GU3 A;  3FCS B;  3VGN A;  3V98 A;  3UB1 A;  5IF6 A;  1ZGX A;  3LML A;  1I2E A;  2OOV C;  3T8U A;  5KP4 A;  2W9Q A;  2IA7 A;  7RNT A;  4BIR A;  4HM3 B;  1MWS A;  2Z7A A;  1IVW A;  1FUS A;  2W2C A;  4LSO A;  3U97 A;  1EQK A;  1BRN L;  1A2K A;  1JKG B;  1YJW 3;  3RGA A;  3GRD A;  1W00 A;  3SYU A;  8RNT A;  3KFQ C;  3Q2P A;  2ZHX B;  3WOE B;  3LTB A;  2RGQ A;  2CX0 A;  2D42 A;  3EQQ B;  5AII A;  4MMX B;  1RLS A;  3D3L A;  3OV4 A;  2OQE A;  1BRK A;  1FGM A;  1JRQ A;  2IY2 A;  3CPO A;  3NXJ A;  1VQ8 3;  4BL3 A;  2GEX A;  5CF1 A;  3EE1 A;  1JZD A;  1BRG A;  3TDG A;  4HVN A;  3KN4 A;  4FMA A;  1BNG A;  1SAR A;  1W6C A;  3RNT A;  2CFK A;  2GEY A;  4KFF A;  3WR2 A;  4ZM8 A;  3CC4 3;  1RNT A;  3FG1 A;  1B2X A;  2FNQ A;  5M18 A;  1BNR A;  3GZY B;  1YNV X;  1YIJ 3;  1EA2 A;  1MWT A;  1BNS A;  4X2O A;  4H3U A;  3D79 A;  1OCV A;  6RNT A;  2BNG A;  3F40 A;  4HM0 B;  3KKG A;  2UUG C;  1SIH A;  5BIR A;  1UCK A;  1N9E A;  3MG3 A;  4N6U A;  3KE7 A;  1GSP A;  3S29 A;  1BAN A;  3AHW A;  4LGQ A;  3VF1 A;  4DKI A;  1K8A 4;  1B2Z A;  2CC3 A;  4EYC A;  1FGR A;  2CH9 A;  1HU9 A;  1GOV A;  2XH9 A;  1BAO A;  1RGK A;  3SXX A;  1YI2 3;  3UL6 A;  2P38 A;  3H51 A;  2W0Q A;  2GBW B;  1UGI A;  2W56 A;  1V58 A;  2H0H A;  3K7C A;  1G02 A;  4R9L A;  5D83 A;  5ELU A;  3Q3F A;  1QMA A;  1UCL A;  3FGY A;  3I0Y A;  3DMC A;  3OWY A;  1NNV A;  3CCU 3;  3HOH A;  3Q1C A;  2IUK A;  3X3X A;  4WP5 A;  1OGZ A;  3F8X A;  2BMR B;  1K9M 4;  1VQM 3;  2XF3 A;  1RGF A;  1IT8 A;  1M1X B;  1UUG B;  1RGG A;  2H0I A;  1AVK A;  2WGQ A;  2XRX B;  3ROB A;  2E2V A;  3S67 A;  4Q53 A;  1RGL A;  2WOH A;  4HM5 B;  3X41 A;  5FGO A;  3OWU A;  1TTO A;  1MWR A;  2HMN B;  4BTX A;  1B3S A;  1AV4 A;  3DGL A;  1N8R 4;  3SLU A;  3ECF A;  2Z76 A;  1PYL A;  1X1Y A;  4R9K A;  1KQS 2;  1BIR A;  3QK9 A;  2JDI H;  1AY7 A;  4LEH A;  2RNT A;  4WFO A;  1VQ4 3;  2YX9 A;  1O7G B;  1JBS A;  1BVI A;  4R4K A;  5DRV A;  5G1K A;  1N9J A;  3CCV 3;  1AQZ A;  1BRS A;  1MOL A;  4N6T A;  2KF5 A;  1LNH A;  1ZX2 A;  2FXT A;  3GSP A;  2K54 A;  3LXU X;  1UCI A;  3E99 A;  4FCM A;  4BTW A;  2RFR A;  1LQG C;  5CK6 A;  1A2V A;  1RJO A;  2HML B;  2ZA4 A;  3UNL A;  1BUQ A;  2HOH A;  4EV5 A;  4N6O B;  4N6M A;  3BND A;  1VQO 3;  3EN8 A;  2P05 A;  4BU4 A;  1QVG 2;  1FA3 A;  1JBR A;  5CLK A;  3LOY A;  4GHO A;  2WGO A;  4GL6 A;  3WHO A;  3EB8 A;  1WMO A;  1FGQ A;  1EEJ A;  4HKV B;  1CH0 A;  1IYY A;  3B4P A;  3NBB A;  4OVM A;  1GOU A;  3SOY A;  4LZI A;  4XBT A;  2PNC A;  4FCJ A;  1TIJ A;  3JVC A;  1FGO A;  3CCJ 3;  3KCH A;  5EVH A;  5LC6 A;  3CC7 3;  3B4O A;  1Q9E A;  1BU4 A;  3DY5 A;  2RBI A;  4IPB A;  1VQ5 3;  1JB5 A;  1ASK A;  2KCD A;  5AIG A;  3URP A;  4G1M B;  3LH4 A;  1C54 A;  1E3V A;  1WNH A;  3NQY A;  2YFJ B;  4XDV A;  4CPK A;  1LQM B;  1VQ9 3;  3NM2 A;  4J5G A;  1RGA A;  3PCR A;  2MF7 A;  2W56 B;  1B20 A;  3NBJ A;  1TU5 A;  2RCD A;  5JPU A;  1NJI 4;  1M1K 4;  2HMM B;  1SII A;  5BVB A;  4HOH A;  5EEO A;  1KC8 4;  2XR8 B;  2F99 A;  1Q42 A;  2YFL B;  4NHF A;  4J8T A;  3T8N A;  6STD A;  2O3O A;  3B8L A;  1Q40 A;  4K1V A;  1R4C A;  1NB3 I;  1TRP A;  4CCV A;  1NDO B;  1OHO A;  4KFE A;  5AIF A;  4KT3 B;  3ZG0 A;  3F7X A;  1D6Y A;  2XFT A;  4BL2 A;  2P09 A;  1VZZ A;  3CC2 3;  2QIY A;  1SPU A;  1F8N A;  2H0G A;  3KSP A;  3HK4 A;  1TUH A;  5TGN A;  3N54 B;  2OQE C;  1K41 A;  3KZT A;  3K63 A;  5M1A A;  5STD A;  2F56 A;  1YVS A;  3F9S A;  3KSE D;  3DGO A;  3X42 A;  4BTY A;  5I97 A;  1DVD A;  4HBR A;  3OW2 2;  2BHM A;  5FW5 A;  1IK3 A;  3PYJ A;  1AR0 A;  2K3D A;  2D1W A;  3EBY A;  1D6Z A;  1FGT A;  4N6V 0;  3CMA 3;  2HMJ B;  1HYF A;  3NHX A;  2CK3 H;  3MPH A; 
#chains in the Genus database with same CATH homology
 1GMR A;  1GOV A;  3DGY A;  1BAO A;  1RGK A;  7GSP A;  1BRH A;  1FUT A;  1RGE A;  1X1W A;  2BU4 A;  1G02 A;  1X1U A;  1PY3 A;  3Q3F A;  1UCL A;  3DH2 A;  1BNI A;  1X1X A;  3HOH A;  1I0V A;  1GMQ A;  1FZU A;  3BU4 A;  1RMS A;  1RGF A;  3AGN A;  1FW7 A;  1RGG A;  4HAA A;  1DET A;  2C4B A;  2KAA A;  1RCL A;  4GSP A;  1RGL A;  1RDS A;  4RNT A;  1TTO A;  1I2F A;  1B21 A;  1I3I A;  1B3S A;  1LNI A;  1BUJ A;  1BSA A;  1R4Y A;  2KF4 A;  3D5I A;  1PYL A;  1X1Y A;  1BNF A;  1BIR A;  2F4Y A;  1AY7 A;  1MGR A;  1MGW A;  2RNT A;  6GSP A;  1T2H A;  1JBS A;  1BVI A;  3AHS A;  2SAR A;  1BOX A;  1AQZ A;  1BRS A;  1UCJ A;  1RSN A;  5RNT A;  2KF5 A;  1BSC A;  3GSP A;  5HOH A;  1UCI A;  2AAD A;  1RGC A;  2ZA4 A;  1B2S A;  2HOH A;  3D4A A;  1BGS A;  3AGO A;  4BU4 A;  1LOW A;  1JBR A;  5GSP A;  4GHO A;  1BSE A;  3WHO A;  1RGH A;  1BNJ A;  2BIR A;  1CH0 A;  1IYY A;  2GSP A;  1LOV A;  1GOU A;  1T2I A;  1LOY A;  1I8V A;  3KCH A;  1BRI A;  1BRJ A;  1Q9E A;  1BU4 A;  1TRQ A;  1DE3 A;  1A2P A;  2RBI A;  2F5M A;  3URP A;  2F5W A;  2KF6 A;  1FYS A;  1C54 A;  1RHL A;  1I3F A;  1ZGX A;  1I2E A;  7RNT A;  4J5G A;  1B27 A;  1RGA A;  4BIR A;  1FUS A;  1B2Z A;  1B20 A;  3D5G A;  1BRN L;  8RNT A;  3SYU A;  3BIR A;  4J5K A;  1RCK A;  9RNT A;  1B2U A;  4HOH A;  1RLS A;  1GMP A;  1BRK A;  1TRP A;  1JBT A;  1BNE A;  1I2G A;  1RTU A;  5BU4 A;  1BRG A;  1YGW A;  1RNB A;  1BNG A;  1SAR A;  3RNT A;  3WR2 A;  1BNR A;  1RNT A;  1B2X A;  1RN1 A;  1YNV X;  1BNS A;  1BSD A;  2F56 A;  1YVS A;  6RNT A;  1B2M A;  1GOY A;  2AAE A;  1I70 A;  5BIR A;  1RN4 A;  1UCK A;  1HZ1 A;  2KF3 A;  1GSP A;  1BAN A;  3AHW A;  1BSB A;  3A5E A;  1I0X A;  1LRA A;  1HYF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...