4EC6A

Ntf2-like, potential transfer protein tram from gram-positive conjugative plasmid pip501
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
109
structure length
109
Chain Sequence
SQSKIDTFGRYFLTYYFSQEKNQENYQSSLRTYVSEKVDISDWKALGKTLKSVNYYGSEQTKKGYSVEYLLNVSVDNRSKMQKITFEVEPTKNGFLVTTQPKLTDFSFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Unknown function
molecule keywords Putative uncharacterized protein
publication title The 2.5 A Structure of the Enterococcus Conjugation Protein TraM resembles VirB8 Type IV Secretion Proteins.
pubmed doi rcsb
source organism Enterococcus faecalis
total genus 23
structure length 109
sequence length 109
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-03-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.540 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4ec6A00
4EC6A 3UB1A
chains in the Genus database with same CATH superfamily
3IPTA 3EF8A 2OQEA 4KZ1A 1BUQA 1W02A 5CXOA 3AGNA 3V99A 3KZTA 3MHEA 4HJLB 3CMA3 1A2PA 1C54A 3D79A 1I0VA 3CCS3 3HOHA 5FGOA 2FNQA 5LC7A 1OHSA 5LC6A 1T5YA 1RJOA 3DMCA 1LOWA 1Q824 4N6V0 2HOHA 3CPOA 1M904 3CC23 1M9GA 3PS8A 3BNCA 4ILFA 4IPBA 1O7HB 2CX1A 1RGAA 1RGKA 5AI1A 1AY7A 2W0QA 3F8HA 1MGRA 3F40A 3FCSB 3VF1A 1V57A 4HKVB 1US1A 1BGSA 4BTWA 3NHXA 2XF3A 1DMNA 4GL6A 5IG4A 4KFFA 1NNVA 3JVCA 1KWIA 1GMPA 2ZL8A 1T2IA 3K7CA 3LYGA 1EUIC 1CQSA 4OK0A 1EEJA 4WP5A 1JKGA 1B2UA 4JF8A 1CYVA 3H51A 3JUNA 3UJMA 1O7WB 3CNMA 4FMDA 1I8VA 3F7SA 4LGQA 3F9SA 3J7Yd 2LQVA 2RSXA 3G0KA 3S29A 2P09A 1BNFA 2K3DA 3AMOA 1JNQA 2CX0A 1RRHA 3G6E3 1VQN3 1DYUA 1IDPA 3CPW2 3AHWA 1BSBA 3BNDA 5CF1A 7GSPA 1SJWA 2CHCA 1BRKA 2CG0A 4HM0B 4O02B 1BOXA 1B21A 1BRHA 4IT7A 5IG0A 4ZM8A 1UCLA 2CKFB 5KP1A 3GZYB 4H61A 5HOHA 2CFLA 3LH4A 5DRVA 3S67A 3NV0B 3Q2PA 2XSHB 5IG5A 3AGOA 2FGTA 4FCJA 3Q90A 3ECFA 1R4CA 4EXRA 5AIIA 1GY7A 1MGWA 4J9AA 3WA3A 3CCE3 2CW9A 1W6YA 3MG1A 2IYJA 2RNTA 3HZPA 1FGRA 2YFJB 1FUWA 3PGBA 1MWSA 2OTJ3 1MWUA 2CWVA 3EHCA 1UDII 2XR8B 3JUPA 3NQYA 3N8BA 1BUJA 1K28A 4LZIA 5AIGA 3SOAA 1Q42A 3SYUA 5M18A 1NDOB 2IY2A 1SQWA 4J8TA 3G8ZA 1VQK3 3EN1B 3KSED 2K0MA 1A2KA 2WO0A 1OF5A 2KF3A 1RHLA 5ELJA 4RNYA 1UGIA 1IVUA 2Z6BA 2O9UX 2Y73A 3WDGB 3KKGA 3CME3 3LT9A 1HYFA 1LNIA 1AR0A 1ROVA 1Z1SA 1LRAA 1E3RA 2QIYA 4BU4A 1GYBA 1UCJA 2JDIH 1I0XA 1WTHA 1VQ53 3MYTA 1ULJB 2CWUA 2HMLB 2YFIB 1FYSA 4IIAA 3T8NA 1JBRA 3DY5A 3SXXA 4J5GA 3GRDA 3D9RA 2KAAA 3O8YA 2H0GA 2P38A 2INXA 4HM4B 1TRPA 1X1XA 4HZBB 1GD4A 1DETA 1I3FA 2OCTA 3JUMA 4EBGA 1E97A 3LXUX 3GAXA 3MWZA 1RLSA 1M1K4 4EC6A 9RNTA 2OQEC 1VQL3 1RN1A 2P0XA 2SARA 3HK4A 5M19A 1ZGXA 4HM8B 1W2ZA 2F5MA 3OV4A 1W00A 1TFOA 1NWWA 3PXMA 4NPBA 2J8XB 1SIHA 5D83A 1EQKA 2D1WA 1MOLA 1VQ43 4MMXB 1GSPA 2ZHXB 3LTBA 3MPHA 4K61A 8CHOA 4N3VA 1W2B2 3FF0A 2FXTA 1GMRA 2JQ5A 2ML6A 4HM2B 3V92A 1RNTA 2OOVA 5JPUA 1KD14 2Q07A 4XB5A 4EW5A 2F56A 1PU4A 2R41A 4I5QA 2B1XB 1RCKA 2E2UA 1RGFA 3EJVA 5IERA 1NO3A 5IF6A 3KE7A 2PNCA 3A76A 3QRDA 1RTUA 1TUHA 1JN5A 1SIIA 3LMLA 4BTYA 3JUQA 1BANA 5IEPA 2W04A 3MG2A 4NREA 3SOYA 4R4KA 1IQYA 1STDA 4HM5B 2BIRA 1JRQA 3RGAA 4HM6B 1LQMB 1F8NA 1M1XB 1W5ZA 1I70A 1YVSA 3DM8A 3ZG0A 3CD63 1JKGB 4HZ9B 1YHQ3 1BNRA 1SPUA 1D6YA 1RGCA 4CDLA 2BMOB 3LTCA 2F4YA 4H3UA 3I553 1JBTA 5EEOA 1TRQA 3X3ZA 2ZA4A 4CPKA 3AMOB 1OACA 4FMCA 3CC73 3KFQC 4LSOA 1RGLA 4R80A 1BRJA 1BNGA 1TFKA 2GEYA 2ML5A 3KN4A 4WFOA 1IVVA 1QJGA 1R4YA 3EX9A 3PCSA 3ROBA 3T8UA 3WOEB 1LOYA 3EBTA 5BVBA 2O3OA 2CK3H 1FUSA 1RGHA 4HVNA 2UGIA 3KIIA 4O3VA 3GZRA 1IQ8A 3B7CA 1RDSA 4N6LA 3ER7A 4LEHA 3D3LA 7RNTA 5ELUA 1RGGA 3NM7A 1AV4A 4HM3B 1LQGC 2YX9A 1L5GB 2KF5A 3OW22 1ULIB 5D82A 3K9MC 3PCRA 4CCVA 5JBSA 5EQLA 1A67A 1N8QA 3IMAB 1A2VA 5GSPA 2H0HA 3LOYA 4RNZA 5KP4A 2OTL3 1IU7A 1YIT3 1BIRA 3VSYA 3G16A 1OF5B 1RN7A 3SEDA 3CCJ3 2BMQB 5FW5A 1YVBI 4GSPA 4AKYA 1RMSA 5TGNA 3H3HA 2AADA 1VQO3 3X3XA 1RKYA 1OGXA 1MWTA 1Q814 2CC3A 3NBJA 1QVF2 2STDA 1QMAA 4L8PA 3CCL3 4R9KA 1FGQA 2CH9A 3G4S3 4ORLA 3PYJA 4L7KA 3BLZA 6STDA 1Q864 4N6TA 1UGHI 2WGOA 5AEUB 3OWYA 1ZX2A 3MSOA 3FZWA 1GY5A 3M8CA 3D5IA 1BVIA 1FUTA 2CFWA 4K1UA 3TDGA 3S28A 4MMZB 2HMOB 1O7GB 1KSIA 4XBTA 5G1KA 3G713 4HBRA 2E2VA 3I0YA 4RZMA 4RBNA 1DE3A 4OVMA 3WOFB 4WYKA 3Q1CA 3Q3FA 1YJW3 2PZVA 2RCDA 3MG3A 1FA3A 1T2HA 3F8XA 2Z77A 1I2FA 2XEPA 3HIIA 1GOUA 2Z76A 3BNBA 2OOVC 1D6UA 1UUWB 2F5WA 2SBLA 3EE1A 4EYCA 1YGEA 3JUOA 1DVCA 3LT8A 1KC84 4K90B 2E2TA 2XGLA 2IUKA 3KCHA 3N54B 4FMAA 4JRFA 1ZO2A 4DKIA 1FGMA 1S5AA 1TIJA 3CCR3 1TP6A 1IT7A 2IA7A 2BNGA 1O7MB 1DMQA 1PYLA 3CNXA 3UL6A 4CJNA 1VQP3 1BSCA 3BU4A 1JV2B 1QAKA 5DREA 4MJDA 2IMJA 3URPA 2V1LA 3L0RA 1Q40A 2KXGA 5IENA 3DGMA 2CFKA 4O2HA 2HMJB 1QVG2 3U97A 4L8OA 1JN5B 1VQ73 1BNEA 3EC9A 1ZS7A 1B2SA 3D5GA 1N9EA 1T3BA 2F86B 3GZXB 1GMQA 4I4KA 2W56A 3GZBA 1BSAA 3NX0A 4XBXA 4OUQA 4MMYB 1LOXA 1CYUA 1B20A 1B2ZA 4AEQA 1IT8A 2W2CA 2QA43 1GS3A 3CCQ3 1W6GA 6GSPA 1N9JA 1JZOA 1LOVA 1VQ63 5A0OB 1Q9EA 1W6CA 3E99A 5RNTA 1IK3A 1AVKA 1K734 4BL3A 1W4NA 3AHSA 4FCZA 3FG1A 1BSEA 1G02A 3BIRA 4HYZA 1FZUA 4O8SA 1RSNA 1VQM3 1RGEA 1UI7A 4FCMA 1LNHA 4J5KA 4HM7B 3A5EA 4KT3B 4N6UA 3VGNA 7STDA 1UUVB 1FGTA 2F98A 5AIFA 4XBYA 3F7XA 3D4AA 1IVWA 3HX8A 3OWUA 3X3YA 3DZLA 3FKAA 4WHAA 1B3SA 1I2EA 1RCLA 2A15A 2CWTA 1SARA 2KRTA 3EN8A 4LYLB 4N6NB 1OHPA 4Q53A 3STDA 3BNEA 5KP3A 1DVDA 4EV5A 4G1MB 2P05A 1JB2A 1S723 1RNBA 1WMNA 2M7OA 1X1UA 2CFDA 2I9WA 1NU3A 1K9M4 1BRNL 1STFI 1ROAA 1IQXA 1UW1A 1TU5A 1HU9A 3FLJA 1IV9A 3KSPA 2LYXA 3OXAA 4XDVA 4LMIA 2RGQA 1E3VA 1JB4A 3ZG5A 2MF7A 1D6ZA 1OPYA 4FMBA 1NB5I 1IVXA 1QALA 1V74A 3NBRA 5G1LA 1BU4A 1RRLA 1X1WA 2IUJA 3WHOA 1U8CB 2C11A 2Z7AA 3WA2X 2QEX3 2GBWB 1YI23 1FW7A 1BRGA 5M1AA 3CC43 1I2GA 3B8LA 1LVNA 3RDEA 1UCKA 1CH0A 2GU3A 2RFRA 2QGUA 1X1YA 4HM1B 2CFGA 3X42A 5BXQA 3FG4A 2XH9A 1HKXA 1KQS2 1GOYA 2L1SA 4MEIA 3BB9A 3DGLA 1BRIA 4RNTA 5D81A 4GHOA 5EVHA 3U1WA 2BT3A 4N6MA 1IV7A 5HGRA 1B2XA 3DGNA 3MKIA 5IEOA 4N6OB 2WOFA 1Q7HA 2KF4A 4BIRA 5I97A 3DXOA 1YNVX 4X2HA 1O7NB 1FGOA 1UCIA 1TTOA 2GU1A 1NB3I 2C10A 1N5PA 3FH1A 2D42A 4WYKB 4XM4A 1OH0A 1MWRA 3HI7A 1QAFA 4GB5A 2P0MA 1C7HA 2W9QA 3X41A 3CCV3 2XRXB 2L4VA 1WNHA 2H0IA 3F14A 4PEJA 1RN4A 3QK9A 2C4BA 2UUGC 4X2OA 1W01A 2GSPA 1UI8A 1B2MA 2GEXA 1LXEA 3DH2A 1G96A 3ALAA 2BMRB 1CEWI 1GY6A 4U13A 1V58A 1Q7Y4 4R9LA 3ZFZA 2XGNA 4WWUC 3CCU3 2OWPA 3B4PA 2BU4A 5AIHA 8RNTA 2F99A 3WR2A 2HMNB 1GOVA 4FR9A 2K54A 5CF2A 1OUNA 2RBIA 4XDWA 1UUGB 5CK6A 3GWRA 1Q40B 3WMDA 1PFPA 5BU4A 4EV2A 3DUKA 1YGWA 1B27A 1VZZA 3NV0A 3IJEB 1N8R4 3SVAA 3NUVA 3OX9A 1EA2A 2BHMA 2KF6A 2W56B 3EBYA 2R4IA 3FGYA 3K63A 3SX1A 2YFLB 3FF2A 2XFSA 1EG9B 4HOHA 5AYRB 1YJ93 1GD3A 1NJI4 3S27A 1AQZA 1G0TA 2CIUA 1YIJ3 1VQ93 3SLUA 1BAOA 2W9PA 2WOHA 3GSPA 1HZ1A 1WMPA 1OGZA 5IG3A 3LTDA 1JZDA 4NHFA 2GBXB 2CG1A 2UX0A 3HIGA 4KFDA 3OWSA 3UNLA 6RNTA 1VQ83 1N5HA 2W03A 3WODG 1VQQA 3RGRA 4HAAA 4QWTA 4STDA 1WMOA 3CXC2 1BNSA 2BO9B 4KFEA 3DGOA 3FG3A 2KCDA 1DMMA 2WGQA 3B4OA 3FSDA 1JBSA 5JPPA 1W7CA 3V98A 5IW9A 1A90A 1ISKA 1J2BA 1BNIA 1U5OA 2HMKB 1K8A4 3NM2A 3NBBA 3NXJA 1JJ22 1O7PB 5STDA 2ZDJA 1IYYA 1AVLA 1BSDA 3CCM3 1BNJA 3EQQB 1BRSA 1ASKA 1YJN3 3K0ZA 3UB1A 2W6JH 2Y74A 4BL2A 5AYSC 1MNLA 2HMMB 3K5TA 4BTXA 2XFTA 5AEWB 1PY3A 3LZAA 3LTAA 4KVHA 3I563 4AKZA 4TX4A 3EB8A 3PZWA 3CU3A 1TJDA 5BIRA 3UL5A 1OCVA 2GXFA 1EKMA 1JB5A 2XSOB 4R1KA 1I3IA 4K1VA 5G2GA 3NQZA 3RNTA 3T0UA 3X40A 2MC8A 1WQLB 2AAEA 3S5CA 3N9HA 1K41A 1OHOA 5CLKA 1Y4KA 2B24B 3DGYA
chains in the Genus database with same CATH topology
3IPTA 3EF8A 2OQEA 4KZ1A 1BUQA 1W02A 5CXOA 3V99A 3KZTA 3MHEA 4HJLB 3CMA3 3CCS3 5FGOA 2FNQA 5LC7A 1OHSA 1T5YA 1RJOA 3DMCA 1Q824 4N6V0 3CPOA 1M904 3CC23 1M9GA 3PS8A 3BNCA 4IPBA 1O7HB 5AI1A 2W0QA 3F8HA 3F40A 3FCSB 3VF1A 4HKVB 1US1A 4BTWA 3NHXA 2XF3A 1DMNA 4GL6A 5IG4A 4KFFA 3JVCA 1KWIA 2ZL8A 1NB5I 5LC6A 3K7CA 3LYGA 4OK0A 1CQSA 4WP5A 3SXXA 1JJ22 1JKGA 4JF8A 1CYVA 3H51A 3JUNA 3UJMA 1O7WB 3CNMA 4FMDA 3F7SA 4LGQA 3F9SA 3J7Yd 2LQVA 2RSXA 3G0KA 3S29A 2P09A 3AMOA 1JNQA 1VQN3 1RRHA 3G6E3 1DYUA 1IDPA 3CPW2 3BNDA 5CF1A 1SJWA 2CHCA 2CG0A 4HM0B 4O02B 4IT7A 5IG0A 4ZM8A 2CKFB 5KP1A 3GZYB 4H61A 2CFLA 3LH4A 5DRVA 3S67A 3NV0B 3Q2PA 2XSHB 5IG5A 2FGTA 4FCJA 3Q90A 3ECFA 1R4CA 4EXRA 5AIIA 1GY7A 4J9AA 3WA3A 3CCE3 2CW9A 1W6YA 3MG1A 3HZPA 1FGRA 2YFJB 1FUWA 3PGBA 2OTJ3 2CWVA 3EHCA 2XR8B 3JUPA 3NQYA 3N8BA 1K28A 4LZIA 5AIGA 3SOAA 1Q42A 1NDOB 1SQWA 4J8TA 3G8ZA 1VQK3 3EN1B 3KSED 2K0MA 1A2KA 2WO0A 1OF5A 5ELJA 4RNYA 1IVUA 2Z6BA 2O9UX 2Y73A 3WDGB 3KKGA 3CME3 3LT9A 1AR0A 1ROVA 1Z1SA 2QIYA 1E3RA 1GYBA 2JDIH 1WTHA 1VQ53 3MYTA 1ULJB 2CWUA 2HMLB 2YFIB 4IIAA 3T8NA 3DY5A 3GRDA 3D9RA 3O8YA 2P38A 2INXA 4HM4B 4HZBB 1GD4A 2OCTA 3JUMA 4EBGA 1E97A 3LXUX 3GAXA 3MWZA 1M1K4 4EC6A 2OQEC 1VQL3 2P0XA 3HK4A 4HM8B 1W2ZA 3OV4A 1W00A 1TFOA 1NWWA 3PXMA 5D83A 1SIHA 1EQKA 2D1WA 1MOLA 1VQ43 4MMXB 3LTBA 3MPHA 4K61A 8CHOA 4N3VA 1W2B2 3FF0A 2FXTA 2JQ5A 2ML6A 4HM2B 3V92A 5JPUA 2OOVA 1KD14 2Q07A 4XB5A 1PU4A 2B1XB 2E2UA 3EJVA 5IERA 1NO3A 5IF6A 3KE7A 2PNCA 3A76A 3QRDA 1TUHA 1JN5A 1SIIA 3LMLA 4BTYA 3JUQA 5IEPA 2W04A 3MG2A 4NREA 3SOYA 4R4KA 1IQYA 1STDA 4HM5B 1JRQA 3RGAA 4HM6B 1F8NA 1M1XB 1W5ZA 3DM8A 3CD63 1JKGB 4HZ9B 1YHQ3 1SPUA 1D6YA 4CDLA 2BMOB 3LTCA 4H3UA 3I553 5EEOA 3X3ZA 3AMOB 1OACA 4FMCA 3CC73 3KFQC 4LSOA 4R80A 2GEYA 1TFKA 2ML5A 3KN4A 4WFOA 1IVVA 1QJGA 3EX9A 3PCSA 3ROBA 3T8UA 3WOEB 3EBTA 5BVBA 2O3OA 2CK3H 4HVNA 3KIIA 4O3VA 3GZRA 1IQ8A 3B7CA 4N6LA 3ER7A 4LEHA 3D3LA 5ELUA 3NM7A 1AV4A 4HM3B 2YX9A 1L5GB 3OW22 1ULIB 5D82A 3K9MC 3PCRA 4CCVA 5JBSA 5EQLA 1A67A 1N8QA 3IMAB 1A2VA 3LOYA 4RNZA 5KP4A 2OTL3 1IU7A 1YIT3 3VSYA 3G16A 1OF5B 1RN7A 3SEDA 3CCJ3 2BMQB 5FW5A 1YVBI 4AKYA 5TGNA 3H3HA 1VQO3 3X3XA 1RKYA 1OGXA 1Q814 2CC3A 3NBJA 1QVF2 2STDA 1QMAA 4L8PA 3CCL3 4R9KA 1FGQA 2CH9A 3G4S3 4ORLA 3PYJA 4L7KA 3BLZA 6STDA 1Q864 4N6TA 2WGOA 5AEUB 3OWYA 1ZX2A 3MSOA 3FZWA 1GY5A 3M8CA 2CFWA 4K1UA 3TDGA 3S28A 4MMZB 2HMOB 1O7GB 1KSIA 4XBTA 3G713 4HBRA 2E2VA 3I0YA 4RZMA 4RBNA 4OVMA 3WOFB 4WYKA 3Q1CA 1YJW3 2PZVA 2RCDA 3MG3A 1FA3A 3F8XA 2Z77A 3HIIA 2XEPA 2Z76A 3BNBA 2OOVC 1D6UA 1UUWB 2SBLA 3EE1A 4EYCA 1YGEA 3JUOA 1DVCA 3LT8A 1KC84 4K90B 2E2TA 2XGLA 2IUKA 3N54B 4FMAA 4JRFA 1ZO2A 1FGMA 1S5AA 1TIJA 3CCR3 1TP6A 1IT7A 2IA7A 2BNGA 1O7MB 1DMQA 3CNXA 3UL6A 1VQP3 1JV2B 1QAKA 5DREA 4MJDA 2IMJA 2V1LA 3L0RA 1Q40A 2KXGA 5IENA 3DGMA 2CFKA 4O2HA 2HMJB 1QVG2 3U97A 4L8OA 1JN5B 1VQ73 3EC9A 1N9EA 2F86B 3GZXB 4I4KA 2W56A 3GZBA 3NX0A 4XBXA 4OUQA 4MMYB 1LOXA 1CYUA 4AEQA 1IT8A 2W2CA 2QA43 1GS3A 3CCQ3 1W6GA 1N9JA 1VQ63 5A0OB 1W6CA 3E99A 1IK3A 1AVKA 1K734 1W4NA 4FCZA 3FG1A 4HYZA 4O8SA 1VQM3 1UI7A 4FCMA 1LNHA 4HM7B 4N6UA 3VGNA 7STDA 2F98A 1FGTA 1UUVB 5AIFA 4XBYA 3F7XA 1IVWA 3HX8A 3OWUA 3X3YA 3DZLA 3FKAA 4WHAA 2CWTA 2A15A 3EN8A 4N6NB 2KRTA 1OHPA 4Q53A 3STDA 3BNEA 5KP3A 1DVDA 4EV5A 4G1MB 2P05A 1JB2A 1S723 1WMNA 2M7OA 2CFDA 2I9WA 1NU3A 1K9M4 1STFI 1ROAA 1IQXA 1UW1A 1TU5A 1HU9A 3FLJA 1IV9A 3KSPA 2LYXA 3OXAA 4XDVA 4LMIA 2RGQA 1E3VA 1JB4A 2MF7A 1D6ZA 1OPYA 4FMBA 1IVXA 1QALA 1V74A 3NBRA 1RRLA 2IUJA 1U8CB 2C11A 2Z7AA 3WA2X 2GBWB 1YI23 3CC43 3B8LA 1LVNA 3RDEA 2RFRA 2GU3A 2QGUA 4HM1B 2CFGA 3X42A 5BXQA 3FG4A 2XH9A 1HKXA 1KQS2 4MEIA 3BB9A 3DGLA 3U1WA 5EVHA 5D81A 2BT3A 4N6MA 1IV7A 5HGRA 3DGNA 5IEOA 3MKIA 4N6OB 2WOFA 5I97A 3DXOA 4X2HA 1O7NB 1FGOA 2GU1A 1NB3I 2C10A 1N5PA 3FH1A 2D42A 4WYKB 4XM4A 1OH0A 3HI7A 1QAFA 4GB5A 2P0MA 1C7HA 2W9QA 3X41A 3CCV3 2XRXB 2L4VA 1WNHA 3F14A 4PEJA 3QK9A 4X2OA 1W01A 1UI8A 2GEXA 1LXEA 1G96A 3ALAA 2BMRB 1CEWI 1GY6A 4U13A 1Q7Y4 4R9LA 2XGNA 4WWUC 3CCU3 2OWPA 3B4PA 5AIHA 2F99A 2HMNB 4FR9A 2K54A 5CF2A 1OUNA 4XDWA 5CK6A 3GWRA 1Q40B 3WMDA 1PFPA 4EV2A 3DUKA 1VZZA 3NV0A 3IJEB 1N8R4 3SVAA 3NUVA 3OX9A 1EA2A 2BHMA 3EBYA 2W56B 3FGYA 2R4IA 3K63A 3SX1A 2QEX3 2YFLB 3FF2A 2XFSA 1EG9B 5AYRB 1YJ93 1GD3A 1NJI4 3S27A 2CIUA 1YIJ3 1VQ93 3SLUA 2W9PA 2WOHA 1WMPA 1OGZA 5IG3A 3LTDA 4NHFA 2GBXB 2CG1A 2UX0A 3HIGA 4KFDA 3OWSA 3UNLA 1VQ83 1N5HA 2W03A 3WODG 3RGRA 4QWTA 4STDA 1WMOA 3CXC2 2BO9B 4KFEA 3DGOA 3FG3A 2KCDA 1DMMA 2WGQA 3B4OA 3FSDA 5JPPA 1W7CA 3V98A 5IW9A 1A90A 1ISKA 1J2BA 1U5OA 2HMKB 1K8A4 3NM2A 3NBBA 3NXJA 1O7PB 5STDA 2ZDJA 1AVLA 3CCM3 3EQQB 1YJN3 1ASKA 3K0ZA 3UB1A 2W6JH 2Y74A 5AYSC 1MNLA 2HMMB 3K5TA 4BTXA 2XFTA 5AEWB 3LZAA 3LTAA 4KVHA 3I563 4AKZA 4TX4A 3EB8A 3PZWA 3CU3A 3UL5A 1OCVA 2GXFA 1EKMA 1JB5A 2XSOB 4R1KA 4K1VA 5G2GA 3NQZA 3T0UA 3X40A 2MC8A 1WQLB 3S5CA 3N9HA 1K41A 1OHOA 5CLKA 1Y4KA 2B24B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EC6 A;  3UB1 A; 
#chains in the Genus database with same CATH topology
 3IPT A;  3EF8 A;  2OQE A;  4KZ1 A;  1BUQ A;  1W02 A;  5CXO A;  3AGN A;  3V99 A;  3KZT A;  3MHE A;  4HJL B;  3CMA 3;  1A2P A;  1C54 A;  3D79 A;  1I0V A;  3CCS 3;  3HOH A;  5FGO A;  2FNQ A;  5LC7 A;  1OHS A;  5LC6 A;  1T5Y A;  1RJO A;  3DMC A;  1LOW A;  1Q82 4;  4N6V 0;  2HOH A;  3CPO A;  1M90 4;  3CC2 3;  1M9G A;  3PS8 A;  3BNC A;  4ILF A;  4IPB A;  1O7H B;  2CX1 A;  1RGA A;  1RGK A;  5AI1 A;  1AY7 A;  2W0Q A;  3F8H A;  1MGR A;  3F40 A;  3FCS B;  3VF1 A;  1V57 A;  4HKV B;  1US1 A;  1BGS A;  4BTW A;  3NHX A;  2XF3 A;  1DMN A;  4GL6 A;  5IG4 A;  4KFF A;  1NNV A;  3JVC A;  1KWI A;  1GMP A;  2ZL8 A;  1T2I A;  3K7C A;  3LYG A;  1EUI C;  1CQS A;  4OK0 A;  1EEJ A;  4WP5 A;  1JKG A;  1B2U A;  4JF8 A;  1CYV A;  3H51 A;  3JUN A;  3UJM A;  1O7W B;  3CNM A;  4FMD A;  1I8V A;  3F7S A;  4LGQ A;  3F9S A;  3J7Y d;  2LQV A;  2RSX A;  3G0K A;  3S29 A;  2P09 A;  1BNF A;  2K3D A;  3AMO A;  1JNQ A;  2CX0 A;  1RRH A;  3G6E 3;  1VQN 3;  1DYU A;  1IDP A;  3CPW 2;  3AHW A;  1BSB A;  3BND A;  5CF1 A;  7GSP A;  1SJW A;  2CHC A;  1BRK A;  2CG0 A;  4HM0 B;  4O02 B;  1BOX A;  1B21 A;  1BRH A;  4IT7 A;  5IG0 A;  4ZM8 A;  1UCL A;  2CKF B;  5KP1 A;  3GZY B;  4H61 A;  5HOH A;  2CFL A;  3LH4 A;  5DRV A;  3S67 A;  3NV0 B;  3Q2P A;  2XSH B;  5IG5 A;  3AGO A;  2FGT A;  4FCJ A;  3Q90 A;  3ECF A;  1R4C A;  4EXR A;  5AII A;  1GY7 A;  1MGW A;  4J9A A;  3WA3 A;  3CCE 3;  2CW9 A;  1W6Y A;  3MG1 A;  2IYJ A;  2RNT A;  3HZP A;  1FGR A;  2YFJ B;  1FUW A;  3PGB A;  1MWS A;  2OTJ 3;  1MWU A;  2CWV A;  3EHC A;  1UDI I;  2XR8 B;  3JUP A;  3NQY A;  3N8B A;  1BUJ A;  1K28 A;  4LZI A;  5AIG A;  3SOA A;  1Q42 A;  3SYU A;  5M18 A;  1NDO B;  2IY2 A;  1SQW A;  4J8T A;  3G8Z A;  1VQK 3;  3EN1 B;  3KSE D;  2K0M A;  1A2K A;  2WO0 A;  1OF5 A;  2KF3 A;  1RHL A;  5ELJ A;  4RNY A;  1UGI A;  1IVU A;  2Z6B A;  2O9U X;  2Y73 A;  3WDG B;  3KKG A;  3CME 3;  3LT9 A;  1HYF A;  1LNI A;  1AR0 A;  1ROV A;  1Z1S A;  1LRA A;  1E3R A;  2QIY A;  4BU4 A;  1GYB A;  1UCJ A;  2JDI H;  1I0X A;  1WTH A;  1VQ5 3;  3MYT A;  1ULJ B;  2CWU A;  2HML B;  2YFI B;  1FYS A;  4IIA A;  3T8N A;  1JBR A;  3DY5 A;  3SXX A;  4J5G A;  3GRD A;  3D9R A;  2KAA A;  3O8Y A;  2H0G A;  2P38 A;  2INX A;  4HM4 B;  1TRP A;  1X1X A;  4HZB B;  1GD4 A;  1DET A;  1I3F A;  2OCT A;  3JUM A;  4EBG A;  1E97 A;  3LXU X;  3GAX A;  3MWZ A;  1RLS A;  1M1K 4;  4EC6 A;  9RNT A;  2OQE C;  1VQL 3;  1RN1 A;  2P0X A;  2SAR A;  3HK4 A;  5M19 A;  1ZGX A;  4HM8 B;  1W2Z A;  2F5M A;  3OV4 A;  1W00 A;  1TFO A;  1NWW A;  3PXM A;  4NPB A;  2J8X B;  1SIH A;  5D83 A;  1EQK A;  2D1W A;  1MOL A;  1VQ4 3;  4MMX B;  1GSP A;  2ZHX B;  3LTB A;  3MPH A;  4K61 A;  8CHO A;  4N3V A;  1W2B 2;  3FF0 A;  2FXT A;  1GMR A;  2JQ5 A;  2ML6 A;  4HM2 B;  3V92 A;  1RNT A;  2OOV A;  5JPU A;  1KD1 4;  2Q07 A;  4XB5 A;  4EW5 A;  2F56 A;  1PU4 A;  2R41 A;  4I5Q A;  2B1X B;  1RCK A;  2E2U A;  1RGF A;  3EJV A;  5IER A;  1NO3 A;  5IF6 A;  3KE7 A;  2PNC A;  3A76 A;  3QRD A;  1RTU A;  1TUH A;  1JN5 A;  1SII A;  3LML A;  4BTY A;  3JUQ A;  1BAN A;  5IEP A;  2W04 A;  3MG2 A;  4NRE A;  3SOY A;  4R4K A;  1IQY A;  1STD A;  4HM5 B;  2BIR A;  1JRQ A;  3RGA A;  4HM6 B;  1LQM B;  1F8N A;  1M1X B;  1W5Z A;  1I70 A;  1YVS A;  3DM8 A;  3ZG0 A;  3CD6 3;  1JKG B;  4HZ9 B;  1YHQ 3;  1BNR A;  1SPU A;  1D6Y A;  1RGC A;  4CDL A;  2BMO B;  3LTC A;  2F4Y A;  4H3U A;  3I55 3;  1JBT A;  5EEO A;  1TRQ A;  3X3Z A;  2ZA4 A;  4CPK A;  3AMO B;  1OAC A;  4FMC A;  3CC7 3;  3KFQ C;  4LSO A;  1RGL A;  4R80 A;  1BRJ A;  1BNG A;  1TFK A;  2GEY A;  2ML5 A;  3KN4 A;  4WFO A;  1IVV A;  1QJG A;  1R4Y A;  3EX9 A;  3PCS A;  3ROB A;  3T8U A;  3WOE B;  1LOY A;  3EBT A;  5BVB A;  2O3O A;  2CK3 H;  1FUS A;  1RGH A;  4HVN A;  2UGI A;  3KII A;  4O3V A;  3GZR A;  1IQ8 A;  3B7C A;  1RDS A;  4N6L A;  3ER7 A;  4LEH A;  3D3L A;  7RNT A;  5ELU A;  1RGG A;  3NM7 A;  1AV4 A;  4HM3 B;  1LQG C;  2YX9 A;  1L5G B;  2KF5 A;  3OW2 2;  1ULI B;  5D82 A;  3K9M C;  3PCR A;  4CCV A;  5JBS A;  5EQL A;  1A67 A;  1N8Q A;  3IMA B;  1A2V A;  5GSP A;  2H0H A;  3LOY A;  4RNZ A;  5KP4 A;  2OTL 3;  1IU7 A;  1YIT 3;  1BIR A;  3VSY A;  3G16 A;  1OF5 B;  1RN7 A;  3SED A;  3CCJ 3;  2BMQ B;  5FW5 A;  1YVB I;  4GSP A;  4AKY A;  1RMS A;  5TGN A;  3H3H A;  2AAD A;  1VQO 3;  3X3X A;  1RKY A;  1OGX A;  1MWT A;  1Q81 4;  2CC3 A;  3NBJ A;  1QVF 2;  2STD A;  1QMA A;  4L8P A;  3CCL 3;  4R9K A;  1FGQ A;  2CH9 A;  3G4S 3;  4ORL A;  3PYJ A;  4L7K A;  3BLZ A;  6STD A;  1Q86 4;  4N6T A;  1UGH I;  2WGO A;  5AEU B;  3OWY A;  1ZX2 A;  3MSO A;  3FZW A;  1GY5 A;  3M8C A;  3D5I A;  1BVI A;  1FUT A;  2CFW A;  4K1U A;  3TDG A;  3S28 A;  4MMZ B;  2HMO B;  1O7G B;  1KSI A;  4XBT A;  5G1K A;  3G71 3;  4HBR A;  2E2V A;  3I0Y A;  4RZM A;  4RBN A;  1DE3 A;  4OVM A;  3WOF B;  4WYK A;  3Q1C A;  3Q3F A;  1YJW 3;  2PZV A;  2RCD A;  3MG3 A;  1FA3 A;  1T2H A;  3F8X A;  2Z77 A;  1I2F A;  2XEP A;  3HII A;  1GOU A;  2Z76 A;  3BNB A;  2OOV C;  1D6U A;  1UUW B;  2F5W A;  2SBL A;  3EE1 A;  4EYC A;  1YGE A;  3JUO A;  1DVC A;  3LT8 A;  1KC8 4;  4K90 B;  2E2T A;  2XGL A;  2IUK A;  3KCH A;  3N54 B;  4FMA A;  4JRF A;  1ZO2 A;  4DKI A;  1FGM A;  1S5A A;  1TIJ A;  3CCR 3;  1TP6 A;  1IT7 A;  2IA7 A;  2BNG A;  1O7M B;  1DMQ A;  1PYL A;  3CNX A;  3UL6 A;  4CJN A;  1VQP 3;  1BSC A;  3BU4 A;  1JV2 B;  1QAK A;  5DRE A;  4MJD A;  2IMJ A;  3URP A;  2V1L A;  3L0R A;  1Q40 A;  2KXG A;  5IEN A;  3DGM A;  2CFK A;  4O2H A;  2HMJ B;  1QVG 2;  3U97 A;  4L8O A;  1JN5 B;  1VQ7 3;  1BNE A;  3EC9 A;  1ZS7 A;  1B2S A;  3D5G A;  1N9E A;  1T3B A;  2F86 B;  3GZX B;  1GMQ A;  4I4K A;  2W56 A;  3GZB A;  1BSA A;  3NX0 A;  4XBX A;  4OUQ A;  4MMY B;  1LOX A;  1CYU A;  1B20 A;  1B2Z A;  4AEQ A;  1IT8 A;  2W2C A;  2QA4 3;  1GS3 A;  3CCQ 3;  1W6G A;  6GSP A;  1N9J A;  1JZO A;  1LOV A;  1VQ6 3;  5A0O B;  1Q9E A;  1W6C A;  3E99 A;  5RNT A;  1IK3 A;  1AVK A;  1K73 4;  4BL3 A;  1W4N A;  3AHS A;  4FCZ A;  3FG1 A;  1BSE A;  1G02 A;  3BIR A;  4HYZ A;  1FZU A;  4O8S A;  1RSN A;  1VQM 3;  1RGE A;  1UI7 A;  4FCM A;  1LNH A;  4J5K A;  4HM7 B;  3A5E A;  4KT3 B;  4N6U A;  3VGN A;  7STD A;  1UUV B;  1FGT A;  2F98 A;  5AIF A;  4XBY A;  3F7X A;  3D4A A;  1IVW A;  3HX8 A;  3OWU A;  3X3Y A;  3DZL A;  3FKA A;  4WHA A;  1B3S A;  1I2E A;  1RCL A;  2A15 A;  2CWT A;  1SAR A;  2KRT A;  3EN8 A;  4LYL B;  4N6N B;  1OHP A;  4Q53 A;  3STD A;  3BNE A;  5KP3 A;  1DVD A;  4EV5 A;  4G1M B;  2P05 A;  1JB2 A;  1S72 3;  1RNB A;  1WMN A;  2M7O A;  1X1U A;  2CFD A;  2I9W A;  1NU3 A;  1K9M 4;  1BRN L;  1STF I;  1ROA A;  1IQX A;  1UW1 A;  1TU5 A;  1HU9 A;  3FLJ A;  1IV9 A;  3KSP A;  2LYX A;  3OXA A;  4XDV A;  4LMI A;  2RGQ A;  1E3V A;  1JB4 A;  3ZG5 A;  2MF7 A;  1D6Z A;  1OPY A;  4FMB A;  1NB5 I;  1IVX A;  1QAL A;  1V74 A;  3NBR A;  5G1L A;  1BU4 A;  1RRL A;  1X1W A;  2IUJ A;  3WHO A;  1U8C B;  2C11 A;  2Z7A A;  3WA2 X;  2QEX 3;  2GBW B;  1YI2 3;  1FW7 A;  1BRG A;  5M1A A;  3CC4 3;  1I2G A;  3B8L A;  1LVN A;  3RDE A;  1UCK A;  1CH0 A;  2GU3 A;  2RFR A;  2QGU A;  1X1Y A;  4HM1 B;  2CFG A;  3X42 A;  5BXQ A;  3FG4 A;  2XH9 A;  1HKX A;  1KQS 2;  1GOY A;  2L1S A;  4MEI A;  3BB9 A;  3DGL A;  1BRI A;  4RNT A;  5D81 A;  4GHO A;  5EVH A;  3U1W A;  2BT3 A;  4N6M A;  1IV7 A;  5HGR A;  1B2X A;  3DGN A;  3MKI A;  5IEO A;  4N6O B;  2WOF A;  1Q7H A;  2KF4 A;  4BIR A;  5I97 A;  3DXO A;  1YNV X;  4X2H A;  1O7N B;  1FGO A;  1UCI A;  1TTO A;  2GU1 A;  1NB3 I;  2C10 A;  1N5P A;  3FH1 A;  2D42 A;  4WYK B;  4XM4 A;  1OH0 A;  1MWR A;  3HI7 A;  1QAF A;  4GB5 A;  2P0M A;  1C7H A;  2W9Q A;  3X41 A;  3CCV 3;  2XRX B;  2L4V A;  1WNH A;  2H0I A;  3F14 A;  4PEJ A;  1RN4 A;  3QK9 A;  2C4B A;  2UUG C;  4X2O A;  1W01 A;  2GSP A;  1UI8 A;  1B2M A;  2GEX A;  1LXE A;  3DH2 A;  1G96 A;  3ALA A;  2BMR B;  1CEW I;  1GY6 A;  4U13 A;  1V58 A;  1Q7Y 4;  4R9L A;  3ZFZ A;  2XGN A;  4WWU C;  3CCU 3;  2OWP A;  3B4P A;  2BU4 A;  5AIH A;  8RNT A;  2F99 A;  3WR2 A;  2HMN B;  1GOV A;  4FR9 A;  2K54 A;  5CF2 A;  1OUN A;  2RBI A;  4XDW A;  1UUG B;  5CK6 A;  3GWR A;  1Q40 B;  3WMD A;  1PFP A;  5BU4 A;  4EV2 A;  3DUK A;  1YGW A;  1B27 A;  1VZZ A;  3NV0 A;  3IJE B;  1N8R 4;  3SVA A;  3NUV A;  3OX9 A;  1EA2 A;  2BHM A;  2KF6 A;  2W56 B;  3EBY A;  2R4I A;  3FGY A;  3K63 A;  3SX1 A;  2YFL B;  3FF2 A;  2XFS A;  1EG9 B;  4HOH A;  5AYR B;  1YJ9 3;  1GD3 A;  1NJI 4;  3S27 A;  1AQZ A;  1G0T A;  2CIU A;  1YIJ 3;  1VQ9 3;  3SLU A;  1BAO A;  2W9P A;  2WOH A;  3GSP A;  1HZ1 A;  1WMP A;  1OGZ A;  5IG3 A;  3LTD A;  1JZD A;  4NHF A;  2GBX B;  2CG1 A;  2UX0 A;  3HIG A;  4KFD A;  3OWS A;  3UNL A;  6RNT A;  1VQ8 3;  1N5H A;  2W03 A;  3WOD G;  1VQQ A;  3RGR A;  4HAA A;  4QWT A;  4STD A;  1WMO A;  3CXC 2;  1BNS A;  2BO9 B;  4KFE A;  3DGO A;  3FG3 A;  2KCD A;  1DMM A;  2WGQ A;  3B4O A;  3FSD A;  1JBS A;  5JPP A;  1W7C A;  3V98 A;  5IW9 A;  1A90 A;  1ISK A;  1J2B A;  1BNI A;  1U5O A;  2HMK B;  1K8A 4;  3NM2 A;  3NBB A;  3NXJ A;  1JJ2 2;  1O7P B;  5STD A;  2ZDJ A;  1IYY A;  1AVL A;  1BSD A;  3CCM 3;  1BNJ A;  3EQQ B;  1BRS A;  1ASK A;  1YJN 3;  3K0Z A;  3UB1 A;  2W6J H;  2Y74 A;  4BL2 A;  5AYS C;  1MNL A;  2HMM B;  3K5T A;  4BTX A;  2XFT A;  5AEW B;  1PY3 A;  3LZA A;  3LTA A;  4KVH A;  3I56 3;  4AKZ A;  4TX4 A;  3EB8 A;  3PZW A;  3CU3 A;  1TJD A;  5BIR A;  3UL5 A;  1OCV A;  2GXF A;  1EKM A;  1JB5 A;  2XSO B;  4R1K A;  1I3I A;  4K1V A;  5G2G A;  3NQZ A;  3RNT A;  3T0U A;  3X40 A;  2MC8 A;  1WQL B;  2AAE A;  3S5C A;  3N9H A;  1K41 A;  1OHO A;  5CLK A;  1Y4K A;  2B24 B;  3DGY A; 
#chains in the Genus database with same CATH homology
 3IPT A;  3EF8 A;  2OQE A;  4KZ1 A;  1BUQ A;  1W02 A;  5CXO A;  3V99 A;  3KZT A;  3MHE A;  4HJL B;  3CMA 3;  3CCS 3;  5FGO A;  2FNQ A;  5LC7 A;  1OHS A;  1T5Y A;  1RJO A;  3DMC A;  1Q82 4;  4N6V 0;  3CPO A;  1M90 4;  3CC2 3;  1M9G A;  3PS8 A;  3BNC A;  4IPB A;  1O7H B;  5AI1 A;  2W0Q A;  3F8H A;  3F40 A;  3FCS B;  3VF1 A;  4HKV B;  1US1 A;  4BTW A;  3NHX A;  2XF3 A;  1DMN A;  4GL6 A;  5IG4 A;  4KFF A;  3JVC A;  1KWI A;  2ZL8 A;  1NB5 I;  5LC6 A;  3K7C A;  3LYG A;  4OK0 A;  1CQS A;  4WP5 A;  3SXX A;  1JJ2 2;  1JKG A;  4JF8 A;  1CYV A;  3H51 A;  3JUN A;  3UJM A;  1O7W B;  3CNM A;  4FMD A;  3F7S A;  4LGQ A;  3F9S A;  3J7Y d;  2LQV A;  2RSX A;  3G0K A;  3S29 A;  2P09 A;  3AMO A;  1JNQ A;  1VQN 3;  1RRH A;  3G6E 3;  1DYU A;  1IDP A;  3CPW 2;  3BND A;  5CF1 A;  1SJW A;  2CHC A;  2CG0 A;  4HM0 B;  4O02 B;  4IT7 A;  5IG0 A;  4ZM8 A;  2CKF B;  5KP1 A;  3GZY B;  4H61 A;  2CFL A;  3LH4 A;  5DRV A;  3S67 A;  3NV0 B;  3Q2P A;  2XSH B;  5IG5 A;  2FGT A;  4FCJ A;  3Q90 A;  3ECF A;  1R4C A;  4EXR A;  5AII A;  1GY7 A;  4J9A A;  3WA3 A;  3CCE 3;  2CW9 A;  1W6Y A;  3MG1 A;  3HZP A;  1FGR A;  2YFJ B;  1FUW A;  3PGB A;  2OTJ 3;  2CWV A;  3EHC A;  2XR8 B;  3JUP A;  3NQY A;  3N8B A;  1K28 A;  4LZI A;  5AIG A;  3SOA A;  1Q42 A;  1NDO B;  1SQW A;  4J8T A;  3G8Z A;  1VQK 3;  3EN1 B;  3KSE D;  2K0M A;  1A2K A;  2WO0 A;  1OF5 A;  5ELJ A;  4RNY A;  1IVU A;  2Z6B A;  2O9U X;  2Y73 A;  3WDG B;  3KKG A;  3CME 3;  3LT9 A;  1AR0 A;  1ROV A;  1Z1S A;  2QIY A;  1E3R A;  1GYB A;  2JDI H;  1WTH A;  1VQ5 3;  3MYT A;  1ULJ B;  2CWU A;  2HML B;  2YFI B;  4IIA A;  3T8N A;  3DY5 A;  3GRD A;  3D9R A;  3O8Y A;  2P38 A;  2INX A;  4HM4 B;  4HZB B;  1GD4 A;  2OCT A;  3JUM A;  4EBG A;  1E97 A;  3LXU X;  3GAX A;  3MWZ A;  1M1K 4;  4EC6 A;  2OQE C;  1VQL 3;  2P0X A;  3HK4 A;  4HM8 B;  1W2Z A;  3OV4 A;  1W00 A;  1TFO A;  1NWW A;  3PXM A;  5D83 A;  1SIH A;  1EQK A;  2D1W A;  1MOL A;  1VQ4 3;  4MMX B;  3LTB A;  3MPH A;  4K61 A;  8CHO A;  4N3V A;  1W2B 2;  3FF0 A;  2FXT A;  2JQ5 A;  2ML6 A;  4HM2 B;  3V92 A;  5JPU A;  2OOV A;  1KD1 4;  2Q07 A;  4XB5 A;  1PU4 A;  2B1X B;  2E2U A;  3EJV A;  5IER A;  1NO3 A;  5IF6 A;  3KE7 A;  2PNC A;  3A76 A;  3QRD A;  1TUH A;  1JN5 A;  1SII A;  3LML A;  4BTY A;  3JUQ A;  5IEP A;  2W04 A;  3MG2 A;  4NRE A;  3SOY A;  4R4K A;  1IQY A;  1STD A;  4HM5 B;  1JRQ A;  3RGA A;  4HM6 B;  1F8N A;  1M1X B;  1W5Z A;  3DM8 A;  3CD6 3;  1JKG B;  4HZ9 B;  1YHQ 3;  1SPU A;  1D6Y A;  4CDL A;  2BMO B;  3LTC A;  4H3U A;  3I55 3;  5EEO A;  3X3Z A;  3AMO B;  1OAC A;  4FMC A;  3CC7 3;  3KFQ C;  4LSO A;  4R80 A;  2GEY A;  1TFK A;  2ML5 A;  3KN4 A;  4WFO A;  1IVV A;  1QJG A;  3EX9 A;  3PCS A;  3ROB A;  3T8U A;  3WOE B;  3EBT A;  5BVB A;  2O3O A;  2CK3 H;  4HVN A;  3KII A;  4O3V A;  3GZR A;  1IQ8 A;  3B7C A;  4N6L A;  3ER7 A;  4LEH A;  3D3L A;  5ELU A;  3NM7 A;  1AV4 A;  4HM3 B;  2YX9 A;  1L5G B;  3OW2 2;  1ULI B;  5D82 A;  3K9M C;  3PCR A;  4CCV A;  5JBS A;  5EQL A;  1A67 A;  1N8Q A;  3IMA B;  1A2V A;  3LOY A;  4RNZ A;  5KP4 A;  2OTL 3;  1IU7 A;  1YIT 3;  3VSY A;  3G16 A;  1OF5 B;  1RN7 A;  3SED A;  3CCJ 3;  2BMQ B;  5FW5 A;  1YVB I;  4AKY A;  5TGN A;  3H3H A;  1VQO 3;  3X3X A;  1RKY A;  1OGX A;  1Q81 4;  2CC3 A;  3NBJ A;  1QVF 2;  2STD A;  1QMA A;  4L8P A;  3CCL 3;  4R9K A;  1FGQ A;  2CH9 A;  3G4S 3;  4ORL A;  3PYJ A;  4L7K A;  3BLZ A;  6STD A;  1Q86 4;  4N6T A;  2WGO A;  5AEU B;  3OWY A;  1ZX2 A;  3MSO A;  3FZW A;  1GY5 A;  3M8C A;  2CFW A;  4K1U A;  3TDG A;  3S28 A;  4MMZ B;  2HMO B;  1O7G B;  1KSI A;  4XBT A;  3G71 3;  4HBR A;  2E2V A;  3I0Y A;  4RZM A;  4RBN A;  4OVM A;  3WOF B;  4WYK A;  3Q1C A;  1YJW 3;  2PZV A;  2RCD A;  3MG3 A;  1FA3 A;  3F8X A;  2Z77 A;  3HII A;  2XEP A;  2Z76 A;  3BNB A;  2OOV C;  1D6U A;  1UUW B;  2SBL A;  3EE1 A;  4EYC A;  1YGE A;  3JUO A;  1DVC A;  3LT8 A;  1KC8 4;  4K90 B;  2E2T A;  2XGL A;  2IUK A;  3N54 B;  4FMA A;  4JRF A;  1ZO2 A;  1FGM A;  1S5A A;  1TIJ A;  3CCR 3;  1TP6 A;  1IT7 A;  2IA7 A;  2BNG A;  1O7M B;  1DMQ A;  3CNX A;  3UL6 A;  1VQP 3;  1JV2 B;  1QAK A;  5DRE A;  4MJD A;  2IMJ A;  2V1L A;  3L0R A;  1Q40 A;  2KXG A;  5IEN A;  3DGM A;  2CFK A;  4O2H A;  2HMJ B;  1QVG 2;  3U97 A;  4L8O A;  1JN5 B;  1VQ7 3;  3EC9 A;  1N9E A;  2F86 B;  3GZX B;  4I4K A;  2W56 A;  3GZB A;  3NX0 A;  4XBX A;  4OUQ A;  4MMY B;  1LOX A;  1CYU A;  4AEQ A;  1IT8 A;  2W2C A;  2QA4 3;  1GS3 A;  3CCQ 3;  1W6G A;  1N9J A;  1VQ6 3;  5A0O B;  1W6C A;  3E99 A;  1IK3 A;  1AVK A;  1K73 4;  1W4N A;  4FCZ A;  3FG1 A;  4HYZ A;  4O8S A;  1VQM 3;  1UI7 A;  4FCM A;  1LNH A;  4HM7 B;  4N6U A;  3VGN A;  7STD A;  2F98 A;  1FGT A;  1UUV B;  5AIF A;  4XBY A;  3F7X A;  1IVW A;  3HX8 A;  3OWU A;  3X3Y A;  3DZL A;  3FKA A;  4WHA A;  2CWT A;  2A15 A;  3EN8 A;  4N6N B;  2KRT A;  1OHP A;  4Q53 A;  3STD A;  3BNE A;  5KP3 A;  1DVD A;  4EV5 A;  4G1M B;  2P05 A;  1JB2 A;  1S72 3;  1WMN A;  2M7O A;  2CFD A;  2I9W A;  1NU3 A;  1K9M 4;  1STF I;  1ROA A;  1IQX A;  1UW1 A;  1TU5 A;  1HU9 A;  3FLJ A;  1IV9 A;  3KSP A;  2LYX A;  3OXA A;  4XDV A;  4LMI A;  2RGQ A;  1E3V A;  1JB4 A;  2MF7 A;  1D6Z A;  1OPY A;  4FMB A;  1IVX A;  1QAL A;  1V74 A;  3NBR A;  1RRL A;  2IUJ A;  1U8C B;  2C11 A;  2Z7A A;  3WA2 X;  2GBW B;  1YI2 3;  3CC4 3;  3B8L A;  1LVN A;  3RDE A;  2RFR A;  2GU3 A;  2QGU A;  4HM1 B;  2CFG A;  3X42 A;  5BXQ A;  3FG4 A;  2XH9 A;  1HKX A;  1KQS 2;  4MEI A;  3BB9 A;  3DGL A;  3U1W A;  5EVH A;  5D81 A;  2BT3 A;  4N6M A;  1IV7 A;  5HGR A;  3DGN A;  5IEO A;  3MKI A;  4N6O B;  2WOF A;  5I97 A;  3DXO A;  4X2H A;  1O7N B;  1FGO A;  2GU1 A;  1NB3 I;  2C10 A;  1N5P A;  3FH1 A;  2D42 A;  4WYK B;  4XM4 A;  1OH0 A;  3HI7 A;  1QAF A;  4GB5 A;  2P0M A;  1C7H A;  2W9Q A;  3X41 A;  3CCV 3;  2XRX B;  2L4V A;  1WNH A;  3F14 A;  4PEJ A;  3QK9 A;  4X2O A;  1W01 A;  1UI8 A;  2GEX A;  1LXE A;  1G96 A;  3ALA A;  2BMR B;  1CEW I;  1GY6 A;  4U13 A;  1Q7Y 4;  4R9L A;  2XGN A;  4WWU C;  3CCU 3;  2OWP A;  3B4P A;  5AIH A;  2F99 A;  2HMN B;  4FR9 A;  2K54 A;  5CF2 A;  1OUN A;  4XDW A;  5CK6 A;  3GWR A;  1Q40 B;  3WMD A;  1PFP A;  4EV2 A;  3DUK A;  1VZZ A;  3NV0 A;  3IJE B;  1N8R 4;  3SVA A;  3NUV A;  3OX9 A;  1EA2 A;  2BHM A;  3EBY A;  2W56 B;  3FGY A;  2R4I A;  3K63 A;  3SX1 A;  2QEX 3;  2YFL B;  3FF2 A;  2XFS A;  1EG9 B;  5AYR B;  1YJ9 3;  1GD3 A;  1NJI 4;  3S27 A;  2CIU A;  1YIJ 3;  1VQ9 3;  3SLU A;  2W9P A;  2WOH A;  1WMP A;  1OGZ A;  5IG3 A;  3LTD A;  4NHF A;  2GBX B;  2CG1 A;  2UX0 A;  3HIG A;  4KFD A;  3OWS A;  3UNL A;  1VQ8 3;  1N5H A;  2W03 A;  3WOD G;  3RGR A;  4QWT A;  4STD A;  1WMO A;  3CXC 2;  2BO9 B;  4KFE A;  3DGO A;  3FG3 A;  2KCD A;  1DMM A;  2WGQ A;  3B4O A;  3FSD A;  5JPP A;  1W7C A;  3V98 A;  5IW9 A;  1A90 A;  1ISK A;  1J2B A;  1U5O A;  2HMK B;  1K8A 4;  3NM2 A;  3NBB A;  3NXJ A;  1O7P B;  5STD A;  2ZDJ A;  1AVL A;  3CCM 3;  3EQQ B;  1YJN 3;  1ASK A;  3K0Z A;  3UB1 A;  2W6J H;  2Y74 A;  5AYS C;  1MNL A;  2HMM B;  3K5T A;  4BTX A;  2XFT A;  5AEW B;  3LZA A;  3LTA A;  4KVH A;  3I56 3;  4AKZ A;  4TX4 A;  3EB8 A;  3PZW A;  3CU3 A;  3UL5 A;  1OCV A;  2GXF A;  1EKM A;  1JB5 A;  2XSO B;  4R1K A;  4K1V A;  5G2G A;  3NQZ A;  3T0U A;  3X40 A;  2MC8 A;  1WQL B;  3S5C A;  3N9H A;  1K41 A;  1OHO A;  5CLK A;  1Y4K A;  2B24 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...