4EC6A

Ntf2-like, potential transfer protein tram from gram-positive conjugative plasmid pip501
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
109
structure length
109
Chain Sequence
SQSKIDTFGRYFLTYYFSQEKNQENYQSSLRTYVSEKVDISDWKALGKTLKSVNYYGSEQTKKGYSVEYLLNVSVDNRSKMQKITFEVEPTKNGFLVTTQPKLTDFSFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The 2.5 A Structure of the Enterococcus Conjugation Protein TraM resembles VirB8 Type IV Secretion Proteins.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Unknown function
molecule keywords Putative uncharacterized protein
total genus 23
structure length 109
sequence length 109
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-03-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.540 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4ec6A00
4EC6A 3UB1A
chains in the Genus database with same CATH superfamily
1UCJA 4FCZA 2YFIB 3AMOB 1WMNA 1OF5A 1SIHA 3RGRA 3SYUA 3CCR3 2LQVA 2SBLA 3BNDA 3LT8A 2W04A 2CFLA 1FUTA 1FA3A 5IW9A 3LT9A 2CC3A 3S29A 9RNTA 4PEJA 5IENA 2CG0A 3VF1A 3HK4A 5M1AA 1VQO3 4JRFA 1C54A 4ILFA 1VQ53 4CPKA 3FG3A 1FZUA 2W9QA 4BIRA 1BAOA 4RBNA 3ZFZA 1W6YA 1X1XA 1QVG2 1UDII 3FGYA 4HM3B 1KWIA 2XFSA 2BU4A 4KFDA 3DM8A 3EB8A 3EF8A 4LZIA 1CYUA 3A76A 1O7PB 2KF4A 1JZDA 1VQN3 3GWRA 3HOHA 1LNHA 1VQ73 2INXA 1BUQA 3CME3 3H3HA 2F99A 1NB3I 3FG4A 1RDSA 3LH4A 3S28A 1BSDA 1MGWA 1OCVA 2XSHB 1JB2A 3BU4A 1BSEA 1BRKA 1WNHA 1ASKA 2GBWB 3L0RA 2KXGA 4U13A 1PYLA 3X3YA 3PCRA 4HKVB 3EHCA 2O3OA 3N8BA 4J5GA 4HM7B 5JPUA 3WODG 2WO0A 2HMMB 3KN4A 5FGOA 3B7CA 4RNTA 5G2GA 3UNLA 2SARA 3NHXA 1YGWA 5ELUA 3WOEB 5IEPA 5M18A 3D5GA 1Q42A 3OWSA 1X1UA 4HYZA 1UW1A 2RSXA 3EBTA 4GB5A 1T2HA 1MNLA 2BHMA 5DREA 1NB5I 2F5WA 2GXFA 3CCV3 3B4OA 3Q3FA 5KP3A 1IT7A 3S5CA 1BRIA 3EC9A 2F5MA 1F8NA 3GSPA 3NXJA 1EA2A 4N3VA 4WP5A 5BIRA 1OHOA 2P09A 2BO9B 5EEOA 1LVNA 2CFDA 3WA2X 3CNXA 3K7CA 3SLUA 3FG1A 2XR8B 1BRHA 2K3DA 2WGOA 4O2HA 1D6UA 1DVDA 1MWRA 1UCKA 4FMDA 2ZHXB 1JV2B 1QAKA 3AMOA 1ZO2A 1K9M4 2KAAA 3OWYA 1BRGA 4FMCA 1M1XB 5IG5A 3AHWA 4O02B 4FCJA 2BT3A 4RNYA 1IQXA 1RNTA 4N6NB 2J8XB 1OACA 3K63A 4K1UA 4LSOA 1CH0A 4GHOA 2CFWA 2W2CA 1AV4A 3ZG0A 2P0MA 1FGTA 1X1WA 1Z1SA 2I9WA 1N5HA 3T8UA 2XGNA 3BNCA 3X3ZA 2L1SA 1O7HB 2W03A 4EXRA 1R4CA 1JNQA 4AKYA 2Z6BA 2XSOB 1YIJ3 3B4PA 3DGOA 1PFPA 2ZDJA 2Q07A 2XGLA 1PU4A 3CD63 1BSBA 4R1KA 1SARA 3T0UA 1RGFA 1BRJA 5AEWB 5JPPA 3K0ZA 1JN5A 3FCSB 3WHOA 1OUNA 1B3SA 1CYVA 1JRQA 8RNTA 2GEYA 1DMNA 3SOAA 2Z77A 4KZ1A 1IK3A 1HZ1A 2UGIA 1RHLA 3G0KA 3FH1A 1RSNA 2GBXB 5HGRA 1IVUA 1YGEA 1B20A 2KF3A 3U1WA 1JKGB 3JUNA 1ULJB 3NM7A 1B2MA 4CCVA 2E2VA 3PCSA 8CHOA 3CCM3 5JBSA 1S5AA 5AI1A 4BTYA 5IERA 4STDA 4N6MA 2W56A 3GZXB 2CWVA 1SJWA 3X41A 1B2SA 1RN7A 1OGXA 1MWSA 1RRHA 1U5OA 1N8QA 3A5EA 1VQK3 3OW22 3B8LA 4HBRA 2IUJA 2HOHA 3GRDA 1NWWA 4XDWA 3KZTA 1I70A 3AGOA 2K0MA 1EQKA 1B21A 2QA43 1SIIA 1DMMA 1O7WB 4HM0B 3F9SA 1K8A4 1I8VA 5A0OB 1LOXA 7STDA 1B2UA 1Y4KA 4CJNA 1A90A 4KFEA 1BSCA 1ROAA 1BGSA 3HIIA 5GSPA 1RJOA 3LTCA 1E3VA 6RNTA 4KFFA 1US1A 1W2ZA 1IQYA 3D5IA 3GZYB 5DRVA 5TGNA 2H0HA 3SX1A 2CWTA 1ULIB 4L8PA 5CXOA 2CX1A 4EC6A 4HM6B 3LZAA 2F4YA 1FUWA 5D83A 4R9KA 5IG3A 3CCJ3 1Q7Y4 2WOHA 5ELJA 1YI23 1BUJA 1MWUA 1GY7A 1FGRA 3D3LA 2CW9A 1BOXA 3PYJA 2JDIH 4HM8B 4XDVA 1NJI4 1WTHA 3MKIA 2HMJB 2CIUA 3CPOA 2AADA 4HOHA 4IT7A 1JZOA 3PZWA 3NV0A 1FUSA 1IYYA 1GMRA 4IIAA 3K5TA 2L4VA 1AY7A 4LEHA 1CQSA 1ROVA 2QGUA 4Q53A 3JUOA 4EV2A 3STDA 1A2VA 1NDOB 2ZL8A 5AIFA 1B27A 2CKFB 1BNJA 1STFI 3S27A 3WA3A 3FZWA 1JJ22 3DGYA 3PS8A 2STDA 3LOYA 1HYFA 5D82A 3G713 1OHSA 3TDGA 2B1XB 3NM2A 1RGKA 1K734 4BTWA 3HIGA 1EEJA 2W0QA 1PY3A 5EVHA 5AYSC 1TUHA 2R41A 3MWZA 3BLZA 3NQZA 3KKGA 1TRPA 1W6GA 2CK3H 1JB4A 4LMIA 2AAEA 3CC73 1BVIA 1RGGA 2BMRB 3F8HA 1KD14 1IDPA 2YFLB 2GEXA 1TIJA 1DMQA 4G1MB 5IEOA 4EYCA 1M904 1ZGXA 2F86B 2V1LA 1W7CA 2QIYA 1GD4A 1GY6A 1NU3A 3QRDA 1W2B2 1G96A 1GSPA 3GZBA 1TFOA 1E97A 1MWTA 3KSPA 4N6LA 2CG1A 2Y74A 2ML5A 2HMNB 1I0VA 1T2IA 3CU3A 3D79A 2PZVA 4FMBA 5M19A 3J7Yd 3NV0B 1Q7HA 2KRTA 4WHAA 3F8XA 1AVLA 1AQZA 1I3IA 2C11A 4HM4B 1VQ93 3X40A 5BXQA 3AHSA 1UCIA 3CC43 3FLJA 3QK9A 4LGQA 4BL3A 1YNVX 2XH9A 3I563 2WOFA 3MSOA 4EBGA 3UJMA 1DYUA 1YJ93 4O8SA 1NO3A 4HVNA 1M9GA 1RGEA 2IYJA 1FGQA 2GU1A 3FSDA 1RKYA 5STDA 3URPA 4KVHA 4J8TA 1QAFA 1LNIA 3DGLA 3EE1A 3JUQA 3NBBA 5G1KA 1MOLA 1RGAA 2HMKB 3CCL3 1C7HA 3G16A 4K1VA 4L7KA 3CC23 1V58A 1YHQ3 2FXTA 2B24B 2OOVA 3LMLA 1IVXA 1RN4A 1OHPA 1TFKA 3BIRA 4FR9A 1LRAA 2RGQA 4NREA 1DETA 3WMDA 1OF5B 1G0TA 1W4NA 3MG1A 4K61A 2P0XA 3WDGB 4MJDA 3V99A 3CCE3 2W56B 1UGHI 2A15A 5CLKA 3BNEA 1RGCA 3VSYA 3F40A 1I2GA 3FKAA 3JUMA 4HM2B 1WQLB 3CMA3 1VQL3 1E3RA 7RNTA 4J5KA 1OPYA 3IPTA 4EV5A 5AEUB 1QALA 3M8CA 1K41A 1GOUA 4WWUC 3T8NA 1O7NB 1SQWA 3G8ZA 5AYRB 1TRQA 1M1K4 5AIGA 5BU4A 2BNGA 3NBJA 4GSPA 4R80A 1RCLA 2XFTA 1GD3A 1UUWB 1BU4A 4RNZA 1FGOA 1UUVB 2D1WA 1TU5A 3F7SA 3NX0A 1VQ43 2XRXB 2R4IA 1LOVA 1VQQA 5CF1A 1A2KA 1QJGA 1Q40A 1RGHA 1HU9A 2F56A 4HM1B 4XBXA 3HX8A 2KCDA 5CF2A 4WYKB 1EUIC 3HZPA 3EJVA 1FW7A 2CHCA 3JVCA 1I3FA 1W5ZA 3OWUA 4HAAA 2WGQA 2RNTA 1G02A 1RCKA 4HM5B 4XM4A 3G4S3 2H0GA 4H3UA 2BMOB 1CEWI 1KSIA 2HMLB 1JB5A 1JBRA 1OH0A 3EN8A 2E2UA 1GMQA 6GSPA 1N9JA 2CWUA 1BNGA 2LYXA 2RCDA 1Q40B 3BB9A 3GZRA 1BNFA 1I2FA 3UL6A 4RZMA 4ZM8A 3RDEA 3SOYA 3KCHA 1HKXA 4HZBB 1OGZA 3WOFB 4I4KA 1KC84 3V98A 1LOYA 3LYGA 5G1LA 5LC6A 2OTL3 3OV4A 1B2XA 1RN1A 3EBYA 3PXMA 3FF2A 1UCLA 4WYKA 1IU7A 4OVMA 1YJW3 3DMCA 4H61A 4XBTA 3U97A 2JQ5A 4WFOA 1N5PA 3DH2A 3Q90A 1DVCA 2IMJA 4L8OA 4MMZB 3D4AA 3OX9A 5IF6A 3CPW2 4MMXB 2ZA4A 2K54A 2YX9A 3EN1B 2F98A 3F7XA 2CX0A 3IJEB 2OQEA 3WR2A 5AIIA 1UGIA 2PNCA 3DGMA 2QEX3 1ISKA 1IQ8A 2IY2A 2D42A 3NUVA 1U8CB 1YIT3 3IMAB 1RTUA 3CXC2 3EQQB 2OWPA 1RLSA 4XBYA 1GYBA 4N6UA 1GY5A 4N6TA 1BNSA 2OOVC 1X1YA 4J9AA 1DE3A 2C4BA 1N9EA 1EKMA 1LXEA 2GU3A 3MG3A 4LYLB 3I553 5HOHA 4FCMA 4ORLA 3LXUX 5FW5A 3N54B 1Q9EA 1W00A 1BSAA 3F14A 3KSED 3V92A 3CCS3 4CDLA 1LQGC 3S67A 1O7MB 4EW5A 1STDA 4TX4A 1UUGB 1GOYA 1EG9B 4I5QA 5IG4A 1IT8A 3KIIA 1GMPA 2W9PA 1L5GB 5IG0A 5KP4A 1W02A 5D81A 1D6YA 1T3BA 1K28A 4OK0A 4OUQA 2XEPA 1BNEA 3DY5A 1BRNL 1FGMA 2KF5A 3KE7A 1LOWA 4QWTA 4N6V0 4MEIA 3ZG5A 1Q814 1BNRA 2P38A 4NHFA 1QMAA 1Q864 7GSPA 2RBIA 3X3XA 1ZS7A 2UX0A 2W6JH 3OXAA 3FF0A 3PGBA 5LC7A 1S723 4N6OB 5RNTA 4O3VA 1VZZA 1VQM3 1BNIA 1RGLA 1MGRA 1VQP3 1BRSA 2O9UX 3MYTA 3HI7A 1N8R4 5I97A 1BIRA 2MF7A 2Z7AA 1WMPA 3NBRA 4IPBA 4NPBA 1YVSA 2RFRA 3ER7A 1R4YA 1IV9A 3O8YA 4BTXA 1VQ63 3D9RA 4X2OA 5BVBA 2UUGC 3MG2A 1YVBI 4HZ9B 4X2HA 1AVKA 1J2BA 3H51A 3SEDA 1JKGA 2BIRA 1GS3A 3CNMA 2BMQB 1RRLA 2HMOB 3DUKA 2CFGA 3LTDA 1IV7A 1IVVA 1FYSA 1O7GB 2YFJB 2CFKA 5KP1A 1NNVA 1UI8A 2M7OA 4KT3B 2OTJ3 3AGNA 3E99A 3JUPA 3ROBA 3UB1A 3LTAA 1V57A 4R9LA 2OCTA 1BANA 3SXXA 4HJLB 1Q824 1JBSA 3DZLA 1KQS2 1B2ZA 1V74A 1LQMB 4FMAA 4XB5A 1RMSA 1I0XA 2P05A 3SVAA 3GAXA 3LTBA 3CCU3 4DKIA 1D6ZA 1ZX2A 3BNBA 3CCQ3 1YJN3 2OQEC 1RNBA 3RNTA 1UI7A 1SPUA 2C10A 2XF3A 4MMYB 1A67A 3ECFA 2ML6A 4K90B 2IA7A 1AR0A 2GSPA 4GL6A 3ALAA 2Z76A 3DGNA 3NQYA 3EX9A 1QVF2 3K9MC 1GOVA 4BU4A 6STDA 1TJDA 3N9HA 3Q1CA 3G6E3 5CK6A 3VGNA 1WMOA 5EQLA 1I2EA 3RGAA 2E2TA 2MC8A 2FNQA 1TP6A 3Q2PA 4R4KA 5AIHA 1W01A 2IUKA 3DXOA 3KFQC 3MPHA 2KF6A 1VQ83 4BL2A 1T5YA 2H0IA 1JBTA 4AEQA 2Y73A 1A2PA 4AKZA 1W6CA 2CH9A 2FGTA 3MHEA 1IVWA 1JN5B 3X42A 4JF8A 3I0YA 1TTOA 3UL5A
chains in the Genus database with same CATH topology
4FCZA 2YFIB 3AMOB 1WMNA 1OF5A 1SIHA 3RGRA 3CCR3 2LQVA 2SBLA 3BNDA 3LT8A 2W04A 2CFLA 1FA3A 5IW9A 3LT9A 2CC3A 3S29A 4PEJA 5IENA 2CG0A 3VF1A 3HK4A 1VQO3 4JRFA 1VQ53 3FG3A 2W9QA 4RBNA 1W6YA 1QVG2 3FGYA 4HM3B 1KWIA 2XFSA 4LZIA 4KFDA 3DM8A 3EB8A 3EF8A 1CYUA 3A76A 1O7PB 3GWRA 1VQ73 1LNHA 2INXA 1BUQA 3CME3 3H3HA 2F99A 1NB3I 3FG4A 3LH4A 3S28A 1OCVA 2XSHB 1JB2A 1WNHA 1ASKA 2GBWB 3L0RA 2KXGA 4U13A 3PCRA 4HKVB 3EHCA 2O3OA 3N8BA 5JPUA 4HM7B 3WODG 2WO0A 2HMMB 3KN4A 5FGOA 3B7CA 5G2GA 3UNLA 3NHXA 3WOEB 5ELUA 5IEPA 1Q42A 3OWSA 4HYZA 3EBTA 1UW1A 2RSXA 4GB5A 1NB5I 1MNLA 2BHMA 5DREA 2GXFA 3CCV3 3B4OA 5KP3A 1IT7A 3S5CA 3EC9A 1F8NA 3NXJA 4WP5A 1EA2A 4N3VA 1OHOA 2P09A 2BO9B 5EEOA 1LVNA 2CFDA 3WA2X 3CNXA 3K7CA 3SLUA 3FG1A 2XR8B 4O2HA 1DVDA 2WGOA 1D6UA 4FMDA 1JV2B 1QAKA 3AMOA 1ZO2A 1K9M4 3OWYA 4FMCA 1M1XB 5IG5A 4O02B 4FCJA 2BT3A 4RNYA 1IQXA 4N6NB 1OACA 3K63A 4K1UA 4LSOA 2CFWA 2W2CA 1AV4A 2P0MA 1FGTA 1Z1SA 2I9WA 1N5HA 3T8UA 2XGNA 3BNCA 3X3ZA 1O7HB 2W03A 4EXRA 1R4CA 1JNQA 4AKYA 2Z6BA 2XSOB 1YIJ3 3B4PA 3DGOA 1PFPA 2ZDJA 2Q07A 2XGLA 1PU4A 3CD63 4R1KA 3T0UA 5JPPA 5AEWB 3K0ZA 1JN5A 3FCSB 1OUNA 1CYVA 1JRQA 2GEYA 1DMNA 3SOAA 2Z77A 4KZ1A 1IK3A 3G0KA 3FH1A 2GBXB 5HGRA 1IVUA 1YGEA 3U1WA 1JKGB 3JUNA 1ULJB 3NM7A 4CCVA 2E2VA 3PCSA 8CHOA 3CCM3 5JBSA 1S5AA 5AI1A 4BTYA 5IERA 4STDA 4N6MA 2W56A 3GZXB 2CWVA 1SJWA 3X41A 1RN7A 1OGXA 1RRHA 1U5OA 1N8QA 1VQK3 3OW22 3B8LA 4HBRA 2IUJA 3GRDA 1NWWA 4XDWA 3KZTA 2K0MA 1EQKA 2QA43 1SIIA 1DMMA 1O7WB 4HM0B 3F9SA 1K8A4 5A0OB 1LOXA 7STDA 1Y4KA 1A90A 4KFEA 1ROAA 3HIIA 1RJOA 3LTCA 1E3VA 4KFFA 1US1A 1W2ZA 1IQYA 5TGNA 3GZYB 5DRVA 3SX1A 2CWTA 1ULIB 4L8PA 5CXOA 4EC6A 1FUWA 4HM6B 3LZAA 5D83A 4R9KA 5IG3A 3CCJ3 1Q7Y4 2WOHA 5ELJA 1YI23 3D3LA 1GY7A 1FGRA 2CW9A 3PYJA 4HM8B 2JDIH 4XDVA 1NJI4 1WTHA 3MKIA 2HMJB 2CIUA 3CPOA 4IT7A 3PZWA 3NV0A 4IIAA 3K5TA 2L4VA 4LEHA 4Q53A 1CQSA 1ROVA 2QGUA 3JUOA 4EV2A 3STDA 1A2VA 1NDOB 2ZL8A 5AIFA 2CKFB 1STFI 3WA3A 3S27A 1JJ22 3FZWA 3PS8A 2STDA 3LOYA 5D82A 3G713 1OHSA 3TDGA 2B1XB 3NM2A 1K734 4BTWA 3HIGA 2W0QA 5EVHA 5AYSC 1TUHA 3MWZA 3BLZA 3NQZA 3KKGA 1W6GA 2CK3H 1JB4A 4LMIA 3CC73 2BMRB 3F8HA 1KD14 1IDPA 2YFLB 2GEXA 1TIJA 1DMQA 4G1MB 5IEOA 4EYCA 1M904 2F86B 2V1LA 1W7CA 2QIYA 1GD4A 1GY6A 1NU3A 3QRDA 1W2B2 1G96A 3GZBA 1TFOA 1E97A 3KSPA 4N6LA 2CG1A 2Y74A 2ML5A 2HMNB 4FMBA 3CU3A 2PZVA 3J7Yd 3NV0B 2KRTA 4WHAA 3F8XA 1AVLA 2C11A 4HM4B 1VQ93 3X40A 5BXQA 3CC43 3FLJA 3QK9A 4LGQA 3I563 2XH9A 2WOFA 3MSOA 4EBGA 3UJMA 1DYUA 1YJ93 4O8SA 1NO3A 4HVNA 1M9GA 3FSDA 1FGQA 2GU1A 1RKYA 5STDA 4KVHA 4J8TA 1QAFA 3DGLA 3EE1A 3JUQA 3NBBA 3X3YA 1MOLA 2HMKB 3CCL3 1C7HA 3G16A 4K1VA 4L7KA 3CC23 1YHQ3 2FXTA 2B24B 2OOVA 3LMLA 1IVXA 1OHPA 1TFKA 4FR9A 2RGQA 4NREA 3WMDA 1OF5B 1W4NA 3MG1A 4K61A 2P0XA 3WDGB 4MJDA 3V99A 3CCE3 2W56B 2A15A 5CLKA 3BNEA 3VSYA 3CMA3 3F40A 3FKAA 3JUMA 4HM2B 1WQLB 1VQL3 1E3RA 1OPYA 3IPTA 4EV5A 5AEUB 1QALA 3M8CA 1K41A 4WWUC 3T8NA 1O7NB 1SQWA 3G8ZA 5AYRB 1M1K4 5AIGA 2BNGA 3NBJA 4R80A 2XFTA 1GD3A 1UUWB 4RNZA 1FGOA 1UUVB 2D1WA 1TU5A 3F7SA 3NX0A 1VQ43 2XRXB 2R4IA 5CF1A 1A2KA 1QJGA 1Q40A 1HU9A 4HM1B 4XBXA 3HX8A 2KCDA 5CF2A 4WYKB 3HZPA 3EJVA 2CHCA 3JVCA 1W5ZA 3OWUA 2WGQA 4HM5B 4XM4A 3G4S3 4H3UA 2BMOB 1CEWI 1KSIA 2HMLB 1JB5A 1OH0A 3EN8A 2E2UA 1N9JA 2CWUA 2LYXA 2RCDA 1Q40B 3BB9A 3GZRA 3UL6A 4RZMA 4ZM8A 3RDEA 3SOYA 1HKXA 4HZBB 1OGZA 3WOFB 4I4KA 1KC84 3V98A 3LYGA 5LC6A 2OTL3 3OV4A 3EBYA 3PXMA 3FF2A 4WYKA 1IU7A 4OVMA 1YJW3 3DMCA 4H61A 4XBTA 3U97A 2JQ5A 4WFOA 1N5PA 3Q90A 4L8OA 1DVCA 2IMJA 4MMZB 5IF6A 3OX9A 3CPW2 4MMXB 2K54A 2YX9A 3EN1B 2F98A 3F7XA 2OQEA 3IJEB 5AIIA 2PNCA 3DGMA 2QEX3 1ISKA 1IQ8A 2D42A 3NUVA 1U8CB 1YIT3 3IMAB 3CXC2 3EQQB 2OWPA 4XBYA 1GYBA 4N6UA 1GY5A 4N6TA 2OOVC 4J9AA 1N9EA 1EKMA 1LXEA 2GU3A 3MG3A 3I553 4FCMA 4ORLA 3LXUX 5FW5A 3N54B 3F14A 1W00A 3KSED 3CCS3 3V92A 4CDLA 3S67A 1O7MB 1STDA 4TX4A 1EG9B 5IG4A 1IT8A 3KIIA 2W9PA 1L5GB 5IG0A 5KP4A 1W02A 5D81A 1D6YA 4OK0A 1K28A 1VQN3 4OUQA 2XEPA 3DY5A 1FGMA 3KE7A 4QWTA 4N6V0 4MEIA 1Q814 2P38A 4NHFA 1QMAA 1Q864 3X3XA 2UX0A 2W6JH 3OXAA 3FF0A 3PGBA 5LC7A 1S723 4N6OB 4O3VA 1VZZA 1VQM3 1VQP3 2O9UX 3MYTA 3HI7A 1N8R4 5I97A 2MF7A 2Z7AA 1WMPA 3NBRA 4IPBA 3ER7A 2RFRA 1IV9A 3O8YA 4BTXA 1VQ63 3D9RA 4X2OA 5BVBA 3MG2A 1YVBI 4HZ9B 4X2HA 1AVKA 1J2BA 3H51A 3SEDA 1JKGA 3CNMA 1GS3A 2BMQB 1RRLA 2HMOB 3DUKA 2CFGA 3LTDA 1IV7A 1IVVA 1O7GB 2YFJB 2CFKA 5KP1A 1UI8A 2M7OA 2OTJ3 3E99A 3JUPA 3ROBA 3UB1A 3LTAA 4R9LA 2OCTA 3SXXA 4HJLB 1Q824 1KQS2 3DZLA 1V74A 4FMAA 4XB5A 2P05A 3SVAA 3GAXA 3LTBA 3CCU3 1D6ZA 1ZX2A 3BNBA 3CCQ3 1YJN3 2OQEC 1UI7A 1SPUA 2C10A 2XF3A 4MMYB 1A67A 3ECFA 2ML6A 4K90B 2IA7A 1AR0A 4GL6A 3ALAA 2Z76A 3DGNA 3NQYA 3EX9A 1QVF2 3K9MC 6STDA 3N9HA 3Q1CA 3G6E3 5CK6A 3VGNA 1WMOA 5EQLA 3RGAA 2E2TA 2MC8A 2FNQA 1TP6A 3Q2PA 4R4KA 5AIHA 1W01A 2IUKA 3DXOA 3KFQC 3MPHA 1VQ83 1T5YA 4AEQA 2Y73A 4AKZA 1W6CA 2CH9A 2FGTA 3MHEA 1IVWA 1JN5B 3X42A 4JF8A 3I0YA 3UL5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EC6 A;  3UB1 A; 
#chains in the Genus database with same CATH topology
 1UCJ A;  4FCZ A;  2YFI B;  3AMO B;  1WMN A;  1OF5 A;  1SIH A;  3RGR A;  3SYU A;  3CCR 3;  2LQV A;  2SBL A;  3BND A;  3LT8 A;  2W04 A;  2CFL A;  1FUT A;  1FA3 A;  5IW9 A;  3LT9 A;  2CC3 A;  3S29 A;  9RNT A;  4PEJ A;  5IEN A;  2CG0 A;  3VF1 A;  3HK4 A;  5M1A A;  1VQO 3;  4JRF A;  1C54 A;  4ILF A;  1VQ5 3;  4CPK A;  3FG3 A;  1FZU A;  2W9Q A;  4BIR A;  1BAO A;  4RBN A;  3ZFZ A;  1W6Y A;  1X1X A;  1QVG 2;  1UDI I;  3FGY A;  4HM3 B;  1KWI A;  2XFS A;  2BU4 A;  4KFD A;  3DM8 A;  3EB8 A;  3EF8 A;  4LZI A;  1CYU A;  3A76 A;  1O7P B;  2KF4 A;  1JZD A;  1VQN 3;  3GWR A;  3HOH A;  1LNH A;  1VQ7 3;  2INX A;  1BUQ A;  3CME 3;  3H3H A;  2F99 A;  1NB3 I;  3FG4 A;  1RDS A;  3LH4 A;  3S28 A;  1BSD A;  1MGW A;  1OCV A;  2XSH B;  1JB2 A;  3BU4 A;  1BSE A;  1BRK A;  1WNH A;  1ASK A;  2GBW B;  3L0R A;  2KXG A;  4U13 A;  1PYL A;  3X3Y A;  3PCR A;  4HKV B;  3EHC A;  2O3O A;  3N8B A;  4J5G A;  4HM7 B;  5JPU A;  3WOD G;  2WO0 A;  2HMM B;  3KN4 A;  5FGO A;  3B7C A;  4RNT A;  5G2G A;  3UNL A;  2SAR A;  3NHX A;  1YGW A;  5ELU A;  3WOE B;  5IEP A;  5M18 A;  3D5G A;  1Q42 A;  3OWS A;  1X1U A;  4HYZ A;  1UW1 A;  2RSX A;  3EBT A;  4GB5 A;  1T2H A;  1MNL A;  2BHM A;  5DRE A;  1NB5 I;  2F5W A;  2GXF A;  3CCV 3;  3B4O A;  3Q3F A;  5KP3 A;  1IT7 A;  3S5C A;  1BRI A;  3EC9 A;  2F5M A;  1F8N A;  3GSP A;  3NXJ A;  1EA2 A;  4N3V A;  4WP5 A;  5BIR A;  1OHO A;  2P09 A;  2BO9 B;  5EEO A;  1LVN A;  2CFD A;  3WA2 X;  3CNX A;  3K7C A;  3SLU A;  3FG1 A;  2XR8 B;  1BRH A;  2K3D A;  2WGO A;  4O2H A;  1D6U A;  1DVD A;  1MWR A;  1UCK A;  4FMD A;  2ZHX B;  1JV2 B;  1QAK A;  3AMO A;  1ZO2 A;  1K9M 4;  2KAA A;  3OWY A;  1BRG A;  4FMC A;  1M1X B;  5IG5 A;  3AHW A;  4O02 B;  4FCJ A;  2BT3 A;  4RNY A;  1IQX A;  1RNT A;  4N6N B;  2J8X B;  1OAC A;  3K63 A;  4K1U A;  4LSO A;  1CH0 A;  4GHO A;  2CFW A;  2W2C A;  1AV4 A;  3ZG0 A;  2P0M A;  1FGT A;  1X1W A;  1Z1S A;  2I9W A;  1N5H A;  3T8U A;  2XGN A;  3BNC A;  3X3Z A;  2L1S A;  1O7H B;  2W03 A;  4EXR A;  1R4C A;  1JNQ A;  4AKY A;  2Z6B A;  2XSO B;  1YIJ 3;  3B4P A;  3DGO A;  1PFP A;  2ZDJ A;  2Q07 A;  2XGL A;  1PU4 A;  3CD6 3;  1BSB A;  4R1K A;  1SAR A;  3T0U A;  1RGF A;  1BRJ A;  5AEW B;  5JPP A;  3K0Z A;  1JN5 A;  3FCS B;  3WHO A;  1OUN A;  1B3S A;  1CYV A;  1JRQ A;  8RNT A;  2GEY A;  1DMN A;  3SOA A;  2Z77 A;  4KZ1 A;  1IK3 A;  1HZ1 A;  2UGI A;  1RHL A;  3G0K A;  3FH1 A;  1RSN A;  2GBX B;  5HGR A;  1IVU A;  1YGE A;  1B20 A;  2KF3 A;  3U1W A;  1JKG B;  3JUN A;  1ULJ B;  3NM7 A;  1B2M A;  4CCV A;  2E2V A;  3PCS A;  8CHO A;  3CCM 3;  5JBS A;  1S5A A;  5AI1 A;  4BTY A;  5IER A;  4STD A;  4N6M A;  2W56 A;  3GZX B;  2CWV A;  1SJW A;  3X41 A;  1B2S A;  1RN7 A;  1OGX A;  1MWS A;  1RRH A;  1U5O A;  1N8Q A;  3A5E A;  1VQK 3;  3OW2 2;  3B8L A;  4HBR A;  2IUJ A;  2HOH A;  3GRD A;  1NWW A;  4XDW A;  3KZT A;  1I70 A;  3AGO A;  2K0M A;  1EQK A;  1B21 A;  2QA4 3;  1SII A;  1DMM A;  1O7W B;  4HM0 B;  3F9S A;  1K8A 4;  1I8V A;  5A0O B;  1LOX A;  7STD A;  1B2U A;  1Y4K A;  4CJN A;  1A90 A;  4KFE A;  1BSC A;  1ROA A;  1BGS A;  3HII A;  5GSP A;  1RJO A;  3LTC A;  1E3V A;  6RNT A;  4KFF A;  1US1 A;  1W2Z A;  1IQY A;  3D5I A;  3GZY B;  5DRV A;  5TGN A;  2H0H A;  3SX1 A;  2CWT A;  1ULI B;  4L8P A;  5CXO A;  2CX1 A;  4EC6 A;  4HM6 B;  3LZA A;  2F4Y A;  1FUW A;  5D83 A;  4R9K A;  5IG3 A;  3CCJ 3;  1Q7Y 4;  2WOH A;  5ELJ A;  1YI2 3;  1BUJ A;  1MWU A;  1GY7 A;  1FGR A;  3D3L A;  2CW9 A;  1BOX A;  3PYJ A;  2JDI H;  4HM8 B;  4XDV A;  1NJI 4;  1WTH A;  3MKI A;  2HMJ B;  2CIU A;  3CPO A;  2AAD A;  4HOH A;  4IT7 A;  1JZO A;  3PZW A;  3NV0 A;  1FUS A;  1IYY A;  1GMR A;  4IIA A;  3K5T A;  2L4V A;  1AY7 A;  4LEH A;  1CQS A;  1ROV A;  2QGU A;  4Q53 A;  3JUO A;  4EV2 A;  3STD A;  1A2V A;  1NDO B;  2ZL8 A;  5AIF A;  1B27 A;  2CKF B;  1BNJ A;  1STF I;  3S27 A;  3WA3 A;  3FZW A;  1JJ2 2;  3DGY A;  3PS8 A;  2STD A;  3LOY A;  1HYF A;  5D82 A;  3G71 3;  1OHS A;  3TDG A;  2B1X B;  3NM2 A;  1RGK A;  1K73 4;  4BTW A;  3HIG A;  1EEJ A;  2W0Q A;  1PY3 A;  5EVH A;  5AYS C;  1TUH A;  2R41 A;  3MWZ A;  3BLZ A;  3NQZ A;  3KKG A;  1TRP A;  1W6G A;  2CK3 H;  1JB4 A;  4LMI A;  2AAE A;  3CC7 3;  1BVI A;  1RGG A;  2BMR B;  3F8H A;  1KD1 4;  1IDP A;  2YFL B;  2GEX A;  1TIJ A;  1DMQ A;  4G1M B;  5IEO A;  4EYC A;  1M90 4;  1ZGX A;  2F86 B;  2V1L A;  1W7C A;  2QIY A;  1GD4 A;  1GY6 A;  1NU3 A;  3QRD A;  1W2B 2;  1G96 A;  1GSP A;  3GZB A;  1TFO A;  1E97 A;  1MWT A;  3KSP A;  4N6L A;  2CG1 A;  2Y74 A;  2ML5 A;  2HMN B;  1I0V A;  1T2I A;  3CU3 A;  3D79 A;  2PZV A;  4FMB A;  5M19 A;  3J7Y d;  3NV0 B;  1Q7H A;  2KRT A;  4WHA A;  3F8X A;  1AVL A;  1AQZ A;  1I3I A;  2C11 A;  4HM4 B;  1VQ9 3;  3X40 A;  5BXQ A;  3AHS A;  1UCI A;  3CC4 3;  3FLJ A;  3QK9 A;  4LGQ A;  4BL3 A;  1YNV X;  2XH9 A;  3I56 3;  2WOF A;  3MSO A;  4EBG A;  3UJM A;  1DYU A;  1YJ9 3;  4O8S A;  1NO3 A;  4HVN A;  1M9G A;  1RGE A;  2IYJ A;  1FGQ A;  2GU1 A;  3FSD A;  1RKY A;  5STD A;  3URP A;  4KVH A;  4J8T A;  1QAF A;  1LNI A;  3DGL A;  3EE1 A;  3JUQ A;  3NBB A;  5G1K A;  1MOL A;  1RGA A;  2HMK B;  3CCL 3;  1C7H A;  3G16 A;  4K1V A;  4L7K A;  3CC2 3;  1V58 A;  1YHQ 3;  2FXT A;  2B24 B;  2OOV A;  3LML A;  1IVX A;  1RN4 A;  1OHP A;  1TFK A;  3BIR A;  4FR9 A;  1LRA A;  2RGQ A;  4NRE A;  1DET A;  3WMD A;  1OF5 B;  1G0T A;  1W4N A;  3MG1 A;  4K61 A;  2P0X A;  3WDG B;  4MJD A;  3V99 A;  3CCE 3;  2W56 B;  1UGH I;  2A15 A;  5CLK A;  3BNE A;  1RGC A;  3VSY A;  3F40 A;  1I2G A;  3FKA A;  3JUM A;  4HM2 B;  1WQL B;  3CMA 3;  1VQL 3;  1E3R A;  7RNT A;  4J5K A;  1OPY A;  3IPT A;  4EV5 A;  5AEU B;  1QAL A;  3M8C A;  1K41 A;  1GOU A;  4WWU C;  3T8N A;  1O7N B;  1SQW A;  3G8Z A;  5AYR B;  1TRQ A;  1M1K 4;  5AIG A;  5BU4 A;  2BNG A;  3NBJ A;  4GSP A;  4R80 A;  1RCL A;  2XFT A;  1GD3 A;  1UUW B;  1BU4 A;  4RNZ A;  1FGO A;  1UUV B;  2D1W A;  1TU5 A;  3F7S A;  3NX0 A;  1VQ4 3;  2XRX B;  2R4I A;  1LOV A;  1VQQ A;  5CF1 A;  1A2K A;  1QJG A;  1Q40 A;  1RGH A;  1HU9 A;  2F56 A;  4HM1 B;  4XBX A;  3HX8 A;  2KCD A;  5CF2 A;  4WYK B;  1EUI C;  3HZP A;  3EJV A;  1FW7 A;  2CHC A;  3JVC A;  1I3F A;  1W5Z A;  3OWU A;  4HAA A;  2WGQ A;  2RNT A;  1G02 A;  1RCK A;  4HM5 B;  4XM4 A;  3G4S 3;  2H0G A;  4H3U A;  2BMO B;  1CEW I;  1KSI A;  2HML B;  1JB5 A;  1JBR A;  1OH0 A;  3EN8 A;  2E2U A;  1GMQ A;  6GSP A;  1N9J A;  2CWU A;  1BNG A;  2LYX A;  2RCD A;  1Q40 B;  3BB9 A;  3GZR A;  1BNF A;  1I2F A;  3UL6 A;  4RZM A;  4ZM8 A;  3RDE A;  3SOY A;  3KCH A;  1HKX A;  4HZB B;  1OGZ A;  3WOF B;  4I4K A;  1KC8 4;  3V98 A;  1LOY A;  3LYG A;  5G1L A;  5LC6 A;  2OTL 3;  3OV4 A;  1B2X A;  1RN1 A;  3EBY A;  3PXM A;  3FF2 A;  1UCL A;  4WYK A;  1IU7 A;  4OVM A;  1YJW 3;  3DMC A;  4H61 A;  4XBT A;  3U97 A;  2JQ5 A;  4WFO A;  1N5P A;  3DH2 A;  3Q90 A;  1DVC A;  2IMJ A;  4L8O A;  4MMZ B;  3D4A A;  3OX9 A;  5IF6 A;  3CPW 2;  4MMX B;  2ZA4 A;  2K54 A;  2YX9 A;  3EN1 B;  2F98 A;  3F7X A;  2CX0 A;  3IJE B;  2OQE A;  3WR2 A;  5AII A;  1UGI A;  2PNC A;  3DGM A;  2QEX 3;  1ISK A;  1IQ8 A;  2IY2 A;  2D42 A;  3NUV A;  1U8C B;  1YIT 3;  3IMA B;  1RTU A;  3CXC 2;  3EQQ B;  2OWP A;  1RLS A;  4XBY A;  1GYB A;  4N6U A;  1GY5 A;  4N6T A;  1BNS A;  2OOV C;  1X1Y A;  4J9A A;  1DE3 A;  2C4B A;  1N9E A;  1EKM A;  1LXE A;  2GU3 A;  3MG3 A;  4LYL B;  3I55 3;  5HOH A;  4FCM A;  4ORL A;  3LXU X;  5FW5 A;  3N54 B;  1Q9E A;  1W00 A;  1BSA A;  3F14 A;  3KSE D;  3V92 A;  3CCS 3;  4CDL A;  1LQG C;  3S67 A;  1O7M B;  4EW5 A;  1STD A;  4TX4 A;  1UUG B;  1GOY A;  1EG9 B;  4I5Q A;  5IG4 A;  1IT8 A;  3KII A;  1GMP A;  2W9P A;  1L5G B;  5IG0 A;  5KP4 A;  1W02 A;  5D81 A;  1D6Y A;  1T3B A;  1K28 A;  4OK0 A;  4OUQ A;  2XEP A;  1BNE A;  3DY5 A;  1BRN L;  1FGM A;  2KF5 A;  3KE7 A;  1LOW A;  4QWT A;  4N6V 0;  4MEI A;  3ZG5 A;  1Q81 4;  1BNR A;  2P38 A;  4NHF A;  1QMA A;  1Q86 4;  7GSP A;  2RBI A;  3X3X A;  1ZS7 A;  2UX0 A;  2W6J H;  3OXA A;  3FF0 A;  3PGB A;  5LC7 A;  1S72 3;  4N6O B;  5RNT A;  4O3V A;  1VZZ A;  1VQM 3;  1BNI A;  1RGL A;  1MGR A;  1VQP 3;  1BRS A;  2O9U X;  3MYT A;  3HI7 A;  1N8R 4;  5I97 A;  1BIR A;  2MF7 A;  2Z7A A;  1WMP A;  3NBR A;  4IPB A;  4NPB A;  1YVS A;  2RFR A;  3ER7 A;  1R4Y A;  1IV9 A;  3O8Y A;  4BTX A;  1VQ6 3;  3D9R A;  4X2O A;  5BVB A;  2UUG C;  3MG2 A;  1YVB I;  4HZ9 B;  4X2H A;  1AVK A;  1J2B A;  3H51 A;  3SED A;  1JKG A;  2BIR A;  1GS3 A;  3CNM A;  2BMQ B;  1RRL A;  2HMO B;  3DUK A;  2CFG A;  3LTD A;  1IV7 A;  1IVV A;  1FYS A;  1O7G B;  2YFJ B;  2CFK A;  5KP1 A;  1NNV A;  1UI8 A;  2M7O A;  4KT3 B;  2OTJ 3;  3AGN A;  3E99 A;  3JUP A;  3ROB A;  3UB1 A;  3LTA A;  1V57 A;  4R9L A;  2OCT A;  1BAN A;  3SXX A;  4HJL B;  1Q82 4;  1JBS A;  3DZL A;  1KQS 2;  1B2Z A;  1V74 A;  1LQM B;  4FMA A;  4XB5 A;  1RMS A;  1I0X A;  2P05 A;  3SVA A;  3GAX A;  3LTB A;  3CCU 3;  4DKI A;  1D6Z A;  1ZX2 A;  3BNB A;  3CCQ 3;  1YJN 3;  2OQE C;  1RNB A;  3RNT A;  1UI7 A;  1SPU A;  2C10 A;  2XF3 A;  4MMY B;  1A67 A;  3ECF A;  2ML6 A;  4K90 B;  2IA7 A;  1AR0 A;  2GSP A;  4GL6 A;  3ALA A;  2Z76 A;  3DGN A;  3NQY A;  3EX9 A;  1QVF 2;  3K9M C;  1GOV A;  4BU4 A;  6STD A;  1TJD A;  3N9H A;  3Q1C A;  3G6E 3;  5CK6 A;  3VGN A;  1WMO A;  5EQL A;  1I2E A;  3RGA A;  2E2T A;  2MC8 A;  2FNQ A;  1TP6 A;  3Q2P A;  4R4K A;  5AIH A;  1W01 A;  2IUK A;  3DXO A;  3KFQ C;  3MPH A;  2KF6 A;  1VQ8 3;  4BL2 A;  1T5Y A;  2H0I A;  1JBT A;  4AEQ A;  2Y73 A;  1A2P A;  4AKZ A;  1W6C A;  2CH9 A;  2FGT A;  3MHE A;  1IVW A;  1JN5 B;  3X42 A;  4JF8 A;  3I0Y A;  1TTO A;  3UL5 A; 
#chains in the Genus database with same CATH homology
 4FCZ A;  2YFI B;  3AMO B;  1WMN A;  1OF5 A;  1SIH A;  3RGR A;  3CCR 3;  2LQV A;  2SBL A;  3BND A;  3LT8 A;  2W04 A;  2CFL A;  1FA3 A;  5IW9 A;  3LT9 A;  2CC3 A;  3S29 A;  4PEJ A;  5IEN A;  2CG0 A;  3VF1 A;  3HK4 A;  1VQO 3;  4JRF A;  1VQ5 3;  3FG3 A;  2W9Q A;  4RBN A;  1W6Y A;  1QVG 2;  3FGY A;  4HM3 B;  1KWI A;  2XFS A;  4LZI A;  4KFD A;  3DM8 A;  3EB8 A;  3EF8 A;  1CYU A;  3A76 A;  1O7P B;  3GWR A;  1VQ7 3;  1LNH A;  2INX A;  1BUQ A;  3CME 3;  3H3H A;  2F99 A;  1NB3 I;  3FG4 A;  3LH4 A;  3S28 A;  1OCV A;  2XSH B;  1JB2 A;  1WNH A;  1ASK A;  2GBW B;  3L0R A;  2KXG A;  4U13 A;  3PCR A;  4HKV B;  3EHC A;  2O3O A;  3N8B A;  5JPU A;  4HM7 B;  3WOD G;  2WO0 A;  2HMM B;  3KN4 A;  5FGO A;  3B7C A;  5G2G A;  3UNL A;  3NHX A;  3WOE B;  5ELU A;  5IEP A;  1Q42 A;  3OWS A;  4HYZ A;  3EBT A;  1UW1 A;  2RSX A;  4GB5 A;  1NB5 I;  1MNL A;  2BHM A;  5DRE A;  2GXF A;  3CCV 3;  3B4O A;  5KP3 A;  1IT7 A;  3S5C A;  3EC9 A;  1F8N A;  3NXJ A;  4WP5 A;  1EA2 A;  4N3V A;  1OHO A;  2P09 A;  2BO9 B;  5EEO A;  1LVN A;  2CFD A;  3WA2 X;  3CNX A;  3K7C A;  3SLU A;  3FG1 A;  2XR8 B;  4O2H A;  1DVD A;  2WGO A;  1D6U A;  4FMD A;  1JV2 B;  1QAK A;  3AMO A;  1ZO2 A;  1K9M 4;  3OWY A;  4FMC A;  1M1X B;  5IG5 A;  4O02 B;  4FCJ A;  2BT3 A;  4RNY A;  1IQX A;  4N6N B;  1OAC A;  3K63 A;  4K1U A;  4LSO A;  2CFW A;  2W2C A;  1AV4 A;  2P0M A;  1FGT A;  1Z1S A;  2I9W A;  1N5H A;  3T8U A;  2XGN A;  3BNC A;  3X3Z A;  1O7H B;  2W03 A;  4EXR A;  1R4C A;  1JNQ A;  4AKY A;  2Z6B A;  2XSO B;  1YIJ 3;  3B4P A;  3DGO A;  1PFP A;  2ZDJ A;  2Q07 A;  2XGL A;  1PU4 A;  3CD6 3;  4R1K A;  3T0U A;  5JPP A;  5AEW B;  3K0Z A;  1JN5 A;  3FCS B;  1OUN A;  1CYV A;  1JRQ A;  2GEY A;  1DMN A;  3SOA A;  2Z77 A;  4KZ1 A;  1IK3 A;  3G0K A;  3FH1 A;  2GBX B;  5HGR A;  1IVU A;  1YGE A;  3U1W A;  1JKG B;  3JUN A;  1ULJ B;  3NM7 A;  4CCV A;  2E2V A;  3PCS A;  8CHO A;  3CCM 3;  5JBS A;  1S5A A;  5AI1 A;  4BTY A;  5IER A;  4STD A;  4N6M A;  2W56 A;  3GZX B;  2CWV A;  1SJW A;  3X41 A;  1RN7 A;  1OGX A;  1RRH A;  1U5O A;  1N8Q A;  1VQK 3;  3OW2 2;  3B8L A;  4HBR A;  2IUJ A;  3GRD A;  1NWW A;  4XDW A;  3KZT A;  2K0M A;  1EQK A;  2QA4 3;  1SII A;  1DMM A;  1O7W B;  4HM0 B;  3F9S A;  1K8A 4;  5A0O B;  1LOX A;  7STD A;  1Y4K A;  1A90 A;  4KFE A;  1ROA A;  3HII A;  1RJO A;  3LTC A;  1E3V A;  4KFF A;  1US1 A;  1W2Z A;  1IQY A;  5TGN A;  3GZY B;  5DRV A;  3SX1 A;  2CWT A;  1ULI B;  4L8P A;  5CXO A;  4EC6 A;  1FUW A;  4HM6 B;  3LZA A;  5D83 A;  4R9K A;  5IG3 A;  3CCJ 3;  1Q7Y 4;  2WOH A;  5ELJ A;  1YI2 3;  3D3L A;  1GY7 A;  1FGR A;  2CW9 A;  3PYJ A;  4HM8 B;  2JDI H;  4XDV A;  1NJI 4;  1WTH A;  3MKI A;  2HMJ B;  2CIU A;  3CPO A;  4IT7 A;  3PZW A;  3NV0 A;  4IIA A;  3K5T A;  2L4V A;  4LEH A;  4Q53 A;  1CQS A;  1ROV A;  2QGU A;  3JUO A;  4EV2 A;  3STD A;  1A2V A;  1NDO B;  2ZL8 A;  5AIF A;  2CKF B;  1STF I;  3WA3 A;  3S27 A;  1JJ2 2;  3FZW A;  3PS8 A;  2STD A;  3LOY A;  5D82 A;  3G71 3;  1OHS A;  3TDG A;  2B1X B;  3NM2 A;  1K73 4;  4BTW A;  3HIG A;  2W0Q A;  5EVH A;  5AYS C;  1TUH A;  3MWZ A;  3BLZ A;  3NQZ A;  3KKG A;  1W6G A;  2CK3 H;  1JB4 A;  4LMI A;  3CC7 3;  2BMR B;  3F8H A;  1KD1 4;  1IDP A;  2YFL B;  2GEX A;  1TIJ A;  1DMQ A;  4G1M B;  5IEO A;  4EYC A;  1M90 4;  2F86 B;  2V1L A;  1W7C A;  2QIY A;  1GD4 A;  1GY6 A;  1NU3 A;  3QRD A;  1W2B 2;  1G96 A;  3GZB A;  1TFO A;  1E97 A;  3KSP A;  4N6L A;  2CG1 A;  2Y74 A;  2ML5 A;  2HMN B;  4FMB A;  3CU3 A;  2PZV A;  3J7Y d;  3NV0 B;  2KRT A;  4WHA A;  3F8X A;  1AVL A;  2C11 A;  4HM4 B;  1VQ9 3;  3X40 A;  5BXQ A;  3CC4 3;  3FLJ A;  3QK9 A;  4LGQ A;  3I56 3;  2XH9 A;  2WOF A;  3MSO A;  4EBG A;  3UJM A;  1DYU A;  1YJ9 3;  4O8S A;  1NO3 A;  4HVN A;  1M9G A;  3FSD A;  1FGQ A;  2GU1 A;  1RKY A;  5STD A;  4KVH A;  4J8T A;  1QAF A;  3DGL A;  3EE1 A;  3JUQ A;  3NBB A;  3X3Y A;  1MOL A;  2HMK B;  3CCL 3;  1C7H A;  3G16 A;  4K1V A;  4L7K A;  3CC2 3;  1YHQ 3;  2FXT A;  2B24 B;  2OOV A;  3LML A;  1IVX A;  1OHP A;  1TFK A;  4FR9 A;  2RGQ A;  4NRE A;  3WMD A;  1OF5 B;  1W4N A;  3MG1 A;  4K61 A;  2P0X A;  3WDG B;  4MJD A;  3V99 A;  3CCE 3;  2W56 B;  2A15 A;  5CLK A;  3BNE A;  3VSY A;  3CMA 3;  3F40 A;  3FKA A;  3JUM A;  4HM2 B;  1WQL B;  1VQL 3;  1E3R A;  1OPY A;  3IPT A;  4EV5 A;  5AEU B;  1QAL A;  3M8C A;  1K41 A;  4WWU C;  3T8N A;  1O7N B;  1SQW A;  3G8Z A;  5AYR B;  1M1K 4;  5AIG A;  2BNG A;  3NBJ A;  4R80 A;  2XFT A;  1GD3 A;  1UUW B;  4RNZ A;  1FGO A;  1UUV B;  2D1W A;  1TU5 A;  3F7S A;  3NX0 A;  1VQ4 3;  2XRX B;  2R4I A;  5CF1 A;  1A2K A;  1QJG A;  1Q40 A;  1HU9 A;  4HM1 B;  4XBX A;  3HX8 A;  2KCD A;  5CF2 A;  4WYK B;  3HZP A;  3EJV A;  2CHC A;  3JVC A;  1W5Z A;  3OWU A;  2WGQ A;  4HM5 B;  4XM4 A;  3G4S 3;  4H3U A;  2BMO B;  1CEW I;  1KSI A;  2HML B;  1JB5 A;  1OH0 A;  3EN8 A;  2E2U A;  1N9J A;  2CWU A;  2LYX A;  2RCD A;  1Q40 B;  3BB9 A;  3GZR A;  3UL6 A;  4RZM A;  4ZM8 A;  3RDE A;  3SOY A;  1HKX A;  4HZB B;  1OGZ A;  3WOF B;  4I4K A;  1KC8 4;  3V98 A;  3LYG A;  5LC6 A;  2OTL 3;  3OV4 A;  3EBY A;  3PXM A;  3FF2 A;  4WYK A;  1IU7 A;  4OVM A;  1YJW 3;  3DMC A;  4H61 A;  4XBT A;  3U97 A;  2JQ5 A;  4WFO A;  1N5P A;  3Q90 A;  4L8O A;  1DVC A;  2IMJ A;  4MMZ B;  5IF6 A;  3OX9 A;  3CPW 2;  4MMX B;  2K54 A;  2YX9 A;  3EN1 B;  2F98 A;  3F7X A;  2OQE A;  3IJE B;  5AII A;  2PNC A;  3DGM A;  2QEX 3;  1ISK A;  1IQ8 A;  2D42 A;  3NUV A;  1U8C B;  1YIT 3;  3IMA B;  3CXC 2;  3EQQ B;  2OWP A;  4XBY A;  1GYB A;  4N6U A;  1GY5 A;  4N6T A;  2OOV C;  4J9A A;  1N9E A;  1EKM A;  1LXE A;  2GU3 A;  3MG3 A;  3I55 3;  4FCM A;  4ORL A;  3LXU X;  5FW5 A;  3N54 B;  3F14 A;  1W00 A;  3KSE D;  3CCS 3;  3V92 A;  4CDL A;  3S67 A;  1O7M B;  1STD A;  4TX4 A;  1EG9 B;  5IG4 A;  1IT8 A;  3KII A;  2W9P A;  1L5G B;  5IG0 A;  5KP4 A;  1W02 A;  5D81 A;  1D6Y A;  4OK0 A;  1K28 A;  1VQN 3;  4OUQ A;  2XEP A;  3DY5 A;  1FGM A;  3KE7 A;  4QWT A;  4N6V 0;  4MEI A;  1Q81 4;  2P38 A;  4NHF A;  1QMA A;  1Q86 4;  3X3X A;  2UX0 A;  2W6J H;  3OXA A;  3FF0 A;  3PGB A;  5LC7 A;  1S72 3;  4N6O B;  4O3V A;  1VZZ A;  1VQM 3;  1VQP 3;  2O9U X;  3MYT A;  3HI7 A;  1N8R 4;  5I97 A;  2MF7 A;  2Z7A A;  1WMP A;  3NBR A;  4IPB A;  3ER7 A;  2RFR A;  1IV9 A;  3O8Y A;  4BTX A;  1VQ6 3;  3D9R A;  4X2O A;  5BVB A;  3MG2 A;  1YVB I;  4HZ9 B;  4X2H A;  1AVK A;  1J2B A;  3H51 A;  3SED A;  1JKG A;  3CNM A;  1GS3 A;  2BMQ B;  1RRL A;  2HMO B;  3DUK A;  2CFG A;  3LTD A;  1IV7 A;  1IVV A;  1O7G B;  2YFJ B;  2CFK A;  5KP1 A;  1UI8 A;  2M7O A;  2OTJ 3;  3E99 A;  3JUP A;  3ROB A;  3UB1 A;  3LTA A;  4R9L A;  2OCT A;  3SXX A;  4HJL B;  1Q82 4;  1KQS 2;  3DZL A;  1V74 A;  4FMA A;  4XB5 A;  2P05 A;  3SVA A;  3GAX A;  3LTB A;  3CCU 3;  1D6Z A;  1ZX2 A;  3BNB A;  3CCQ 3;  1YJN 3;  2OQE C;  1UI7 A;  1SPU A;  2C10 A;  2XF3 A;  4MMY B;  1A67 A;  3ECF A;  2ML6 A;  4K90 B;  2IA7 A;  1AR0 A;  4GL6 A;  3ALA A;  2Z76 A;  3DGN A;  3NQY A;  3EX9 A;  1QVF 2;  3K9M C;  6STD A;  3N9H A;  3Q1C A;  3G6E 3;  5CK6 A;  3VGN A;  1WMO A;  5EQL A;  3RGA A;  2E2T A;  2MC8 A;  2FNQ A;  1TP6 A;  3Q2P A;  4R4K A;  5AIH A;  1W01 A;  2IUK A;  3DXO A;  3KFQ C;  3MPH A;  1VQ8 3;  1T5Y A;  4AEQ A;  2Y73 A;  4AKZ A;  1W6C A;  2CH9 A;  2FGT A;  3MHE A;  1IVW A;  1JN5 B;  3X42 A;  4JF8 A;  3I0Y A;  3UL5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...