4EC6A

Ntf2-like, potential transfer protein tram from gram-positive conjugative plasmid pip501
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
109
structure length
109
Chain Sequence
SQSKIDTFGRYFLTYYFSQEKNQENYQSSLRTYVSEKVDISDWKALGKTLKSVNYYGSEQTKKGYSVEYLLNVSVDNRSKMQKITFEVEPTKNGFLVTTQPKLTDFSFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The 2.5 A Structure of the Enterococcus Conjugation Protein TraM resembles VirB8 Type IV Secretion Proteins.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Unknown function
molecule keywords Putative uncharacterized protein
total genus 23
structure length 109
sequence length 109
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-03-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.540 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4ec6A00
3UB1A 4EC6A
chains in the Genus database with same CATH superfamily
3LYGA 3S5CA 1VQP3 2BT3A 5D83A 1VQQA 4Q53A 3Q3FA 3D5GA 3BNBA 3F7SA 1RGEA 3MYTA 4NHFA 2WOHA 4K61A 1FUTA 1N5PA 1B2UA 1M904 1IVWA 3K0ZA 2GU1A 2KF3A 2XSOB 3K63A 2JDIH 3SOYA 1JN5A 4N6LA 2YX9A 1UUWB 1R4YA 1CQSA 2RSXA 2W03A 1TIJA 2JQ5A 3PS8A 5BXQA 5IENA 3DZLA 3LT8A 5IEOA 1VZZA 4O3VA 2HMOB 3JUNA 1UCIA 3VSYA 2CWVA 1M1K4 1TJDA 1ZX2A 2STDA 2OQEC 4L7KA 1JV2B 1RRHA 3GAXA 1FUWA 1BRHA 4FMAA 1EG9B 2K54A 3EN8A 3OWSA 3X41A 4HYZA 1CYVA 2IUJA 1DYUA 1BNJA 3RNTA 1TP6A 2D1WA 3B7CA 3V98A 4N6OB 1RGLA 1MWTA 2FGTA 3EE1A 2YFIB 1QAKA 3FF2A 1PY3A 4HBRA 3PYJA 3CC73 1WQLB 2KF6A 1GOVA 2IY2A 3JUPA 3F14A 1YVSA 4STDA 1MWSA 2L4VA 4RNTA 3MG3A 1NWWA 2Z7AA 3CC43 3FG4A 3LOYA 2YFJB 1WTHA 1N9JA 2CK3H 4FMDA 1Y4KA 1RCKA 4KVHA 3MWZA 1AVLA 2KCDA 4FCZA 4I5QA 3AGNA 2XEPA 1NJI4 1IQYA 1FGRA 4X2HA 3U1WA 1LOWA 1KQS2 1WMNA 1LVNA 2UUGC 3GWRA 1VQM3 2C10A 1JB2A 1V58A 3NBBA 3FKAA 8RNTA 1VQO3 1RKYA 1RJOA 3BLZA 2RGQA 4BIRA 2Q07A 1STDA 1W02A 3HI7A 7RNTA 2E2VA 3AMOB 1O7NB 1V57A 1YHQ3 2XH9A 1RGCA 3ER7A 2P05A 3ECFA 1T2HA 1GOUA 1ROVA 3EQQB 2F5MA 4XBYA 4EV2A 1FW7A 5LC6A 4R1KA 1RGAA 2E2TA 1I3FA 1Q9EA 1STFI 4LYLB 1DMNA 3HIIA 3NQYA 5IG5A 2LQVA 2ZA4A 1FGQA 2E2UA 1B2XA 2GU3A 1VQ93 1BRNL 2F56A 1BSDA 5DRVA 3X42A 4N6TA 1DMMA 1IV9A 2ZDJA 4G1MB 4HM2B 3DM8A 5IERA 5CF1A 3K5TA 1FUSA 3Q90A 2HMLB 3EF8A 3OV4A 1ULIB 1W01A 3OX9A 4RNZA 5G2GA 3L0RA 1JBTA 1Q40A 3HZPA 3SVAA 5IG4A 1RN4A 1QALA 3CU3A 3I563 3NBRA 4J5KA 3AMOA 1Q7HA 1E3RA 4H61A 4WP5A 2BO9B 3FG3A 1K28A 5AIGA 3NHXA 1RSNA 4R9KA 1AY7A 2QEX3 4PEJA 4EXRA 3LTDA 1MGRA 4WWUC 3VF1A 1YNVX 2KF4A 4R4KA 1RDSA 1MNLA 3D79A 2IYJA 3MG2A 5ELUA 1HU9A 1YGWA 1TRQA 1VQL3 3MKIA 2O9UX 3CNMA 5HGRA 3Q1CA 1FYSA 1SIHA 1T3BA 1BRSA 3BNCA 4MEIA 4CCVA 3B8LA 3ZG0A 8CHOA 1RNBA 1DMQA 1ULJB 2O3OA 4N6V0 1BSEA 1UUVB 1R4CA 4RZMA 3CNXA 3SLUA 1BRIA 2B1XB 1AQZA 2ML6A 3K9MC 2F5WA 3D3LA 1DVCA 1A2VA 1OHSA 5CK6A 2BNGA 1WNHA 2H0GA 4MMYB 2W04A 4OVMA 2C11A 5D82A 1B2MA 3V99A 1HYFA 2UGIA 1RNTA 1YJ93 4OK0A 3ZFZA 1NO3A 4AKYA 5DREA 1V74A 1OH0A 1KC84 3X3ZA 2GXFA 1I70A 1M1XB 1OGXA 1IVUA 1X1WA 1B3SA 2FXTA 1RRLA 2UX0A 2Z77A 3FGYA 4H3UA 4XBTA 5GSPA 3T8NA 1K41A 3WOFB 2F4YA 3T8UA 5AIHA 3CCV3 1B27A 5AIFA 3G4S3 1NDOB 2WGQA 1PYLA 2KXGA 1VQK3 3NV0B 4GL6A 3SX1A 2RNTA 1Q814 1JKGA 1IT7A 1GD3A 1T5YA 1EA2A 4NPBA 3CME3 1KD14 4N6UA 1SIIA 1I8VA 4HZBB 1GMPA 2BMRB 3SXXA 3KN4A 1BSBA 2D42A 2RFRA 2W0QA 5ELJA 1OUNA 3GZBA 4WYKA 1JZDA 1S5AA 2OOVA 2CH9A 1TUHA 1UCLA 4KZ1A 3BU4A 5BIRA 1JJ22 3DGLA 1BUJA 1LOYA 5JPPA 1B20A 3PXMA 1E97A 2R41A 3BNEA 2HMMB 9RNTA 1EKMA 2MF7A 2OWPA 4K1UA 4HM6B 3FLJA 5D81A 3G713 1YIT3 1BSCA 1EQKA 1W2B2 1I2GA 2V1LA 2CFWA 1IVXA 3GZYB 3AHSA 4EYCA 3DXOA 3RGRA 3EX9A 4CPKA 5M1AA 3CCS3 4N3VA 2CC3A 5IF6A 3J7Yd 3B4PA 2A15A 1G0TA 3S27A 1F8NA 3RDEA 1BVIA 3NV0A 1I0VA 2CFDA 4DKIA 3S29A 1T2IA 4GB5A 3DMCA 3DGNA 3IMAB 1YVBI 1I2FA 2QA43 2RCDA 2CG0A 6GSPA 3FG1A 1OHPA 4FMBA 3N54B 1RTUA 4IPBA 1A2KA 2YFLB 3ROBA 3N9HA 3UL5A 1HKXA 1PU4A 1X1UA 1Q864 1VQ83 3TDGA 1UI7A 1BANA 3HIGA 3ZG5A 1BU4A 1YGEA 1GYBA 1W2ZA 2RBIA 3GRDA 2BMOB 1BRGA 5FW5A 1G96A 3LZAA 5I97A 1LNIA 4JRFA 5IW9A 5JPUA 1DE3A 1ZO2A 4J9AA 1BRKA 2CWUA 1G02A 1BOXA 3H3HA 2J8XB 2OTJ3 1IT8A 1O7WB 2IUKA 5KP1A 1OCVA 2CFKA 3EHCA 2Z76A 1IDPA 2Z6BA 4AKZA 1JBRA 1UW1A 1QAFA 1DETA 1D6UA 1OHOA 4AEQA 3EB8A 3JUMA 4MMZB 3JUOA 5AI1A 2PNCA 3DUKA 2L1SA 3X3YA 5BU4A 4XBXA 6RNTA 3CCL3 3CCU3 3OWYA 3CCR3 1FGTA 2INXA 3I0YA 3MSOA 4X2OA 3LTBA 5AIIA 4WYKB 3WHOA 1EEJA 3FSDA 3GSPA 4GSPA 4LEHA 1RGFA 3ALAA 1UCJA 1NNVA 4ILFA 4ORLA 3EN1B 2MC8A 1OGZA 1K9M4 2XGNA 2C4BA 1MWUA 5LC7A 4NREA 3LTCA 1FZUA 3UNLA 1IYYA 4HKVB 3EBTA 3S28A 3EC9A 1ZS7A 1W6GA 4CDLA 2M7OA 2OTL3 4BTWA 3B4OA 3A76A 3FH1A 3LT9A 4J8TA 4N6NB 1JRQA 1C54A 3FF0A 3IPTA 2CX1A 3HX8A 1RMSA 5EEOA 1RCLA 3OWUA 2BMQB 5AYRB 2H0IA 4HOHA 2XSHB 1BNEA 1UGIA 4HM7B 3E99A 3OW22 1KSIA 1N9EA 3KE7A 3UJMA 1JB4A 3WR2A 4EW5A 3NUVA 2W6JH 5EVHA 3KIIA 2W56A 1JKGB 2SARA 3BIRA 5CF2A 1FGOA 3V92A 2K0MA 1LQGC 4L8OA 4BL2A 5FGOA 1O7PB 3IJEB 1JN5B 4CJNA 3K7CA 3A5EA 3EBYA 4KT3B 1W00A 2WOFA 1K8A4 1NB5I 5G1KA 4RNYA 3FZWA 1IK3A 1OACA 1TU5A 1CH0A 3D4AA 2P38A 2KAAA 4GHOA 2P0MA 2B24B 1O7GB 2HMKB 1SARA 3G8ZA 1NB3I 3F9SA 1I3IA 2K3DA 4KFDA 1J2BA 4K1VA 2GEYA 4HM1B 1VQ63 4HM4B 1O7HB 3G16A 1RLSA 2GEXA 3M8CA 1Q7Y4 5RNTA 1N8R4 4O02B 2CG1A 2CX0A 2QIYA 4HAAA 1GMQA 4LGQA 3NXJA 5EQLA 1AV4A 1A2PA 2F98A 3VGNA 1TFOA 3X3XA 1QJGA 4KFEA 2LYXA 3H51A 4KFFA 1B21A 1SJWA 1SQWA 3CCE3 1RHLA 3NQZA 2W9QA 4BTXA 7STDA 3U97A 3WOEB 1BNFA 4L8PA 3LMLA 2CW9A 4LSOA 3LH4A 1B2SA 1N8QA 4HM8B 4WFOA 4XDVA 2AAEA 3S67A 5IG0A 1LOVA 2ZHXB 1S723 1W5ZA 3KSPA 1OF5B 1E3VA 3D5IA 3BNDA 1GY6A 4HJLB 3UL6A 1Q824 1VQ43 3CPW2 2CFLA 4R80A 5A0OB 4JF8A 4I4KA 3CCM3 3DGYA 1GY5A 5TGNA 2CWTA 2GBWB 2SBLA 3KCHA 3CCJ3 1GOYA 3PGBA 3G6E3 1TRPA 3KZTA 3I553 1X1YA 1ISKA 3PCRA 2OCTA 4XM4A 5BVBA 1CEWI 3MG1A 4K90B 1RGHA 2HOHA 3KSED 4HVNA 3MHEA 3JVCA 2CKFB 3WA2X 4EBGA 2ML5A 3DH2A 2W9PA 5AEWB 3CC23 1BRJA 1U5OA 1UDII 1VQ73 2BHMA 1B2ZA 2QGUA 4XDWA 5IEPA 3DGMA 4OUQA 3O8YA 1ZGXA 1MWRA 2HMNB 1CYUA 4ZM8A 2XFTA 1AVKA 1W7CA 2R4IA 1HZ1A 1LRAA 2CFGA 1M9GA 2HMJB 2IMJA 1ASKA 1GY7A 2CHCA 1IV7A 5KP4A 5M19A 1BIRA 2CIUA 3CCQ3 2OQEA 2GSPA 1KWIA 1O7MB 1I0XA 1BGSA 3URPA 1TTOA 1A90A 5KP3A 2GBXB 1MGWA 2KF5A 1BAOA 1GSPA 3AGOA 2IA7A 3G0KA 1UUGB 3GZRA 1EUIC 4QWTA 2WO0A 4FR9A 1GS3A 1YJN3 5AEUB 1RGKA 3GZXB 3BB9A 2XFSA 3F40A 3PCSA 2H0HA 3CMA3 1BNGA 1BSAA 3NBJA 1Z1SA 4FCMA 5IG3A 2Y73A 4U13A 2W2CA 3PZWA 3KFQC 3NM7A 1L5GB 3D9RA 3NX0A 3CD63 4R9LA 1FGMA 1LQMB 1US1A 1VQ53 3CXC2 4MMXB 3LTAA 1Q42A 2XRXB 1LNHA 1OPYA 1X1XA 2W56B 3F7XA 1VQN3 1DVDA 2XR8B 1Q40B 1I2EA 1D6YA 1GMRA 2WGOA 4RBNA 1LXEA 3HOHA 3QRDA 5JBSA 1IQ8A 5CXOA 2F86B 1JZOA 1D6ZA 4BL3A 1W4NA 1WMPA 1SPUA 3KKGA 4EC6A 1U8CB 4O2HA 2XGLA 4WHAA 4EV5A 2ZL8A 1JBSA 4XB5A 1QMAA 4FMCA 4LZIA 3JUQA 5STDA 5CLKA 3RGAA 3SEDA 1RGGA 3WMDA 4J5GA 1BNSA 2KRTA 4O8SA 1NU3A 1W6YA 3X40A 1LOXA 1TFKA 4FCJA 4LMIA 4IT7A 5G1LA 4MJDA 2AADA 6STDA 1ROAA 3DGOA 1FA3A 3Q2PA 4HM3B 1RN1A 1AR0A 2P0XA 1UGHI 1GD4A 1W6CA 1YIJ3 3LXUX 7GSPA 1A67A 3OXAA 4BTYA 1PFPA 2BU4A 2FNQA 2OOVC 2XF3A 3HK4A 1OF5A 3NM2A 4N6MA 1N5HA 3UB1A 1UCKA 3SOAA 3WODG 1WMOA 2Y74A 1IU7A 3MPHA 3QK9A 2P09A 2PZVA 3EJVA 4HM5B 2F99A 3WDGB 1IVVA 1JB5A 4IIAA 3T0UA 5M18A 5HOHA 4BU4A 1IQXA 1K734 1BNIA 1RN7A 5AYSC 1BUQA 2BIRA 1C7HA 3N8BA 3STDA 3CPOA 3WA3A 1YJW3 1JNQA 4HZ9B 3AHWA 3F8XA 1QVG2 2I9WA 1BNRA 4HM0B 1MOLA 1UI8A 1QVF2 3FCSB 3DY5A 4TX4A 3SYUA 1YI23 3F8HA
chains in the Genus database with same CATH topology
3LYGA 3S5CA 1VQP3 2BT3A 5D83A 4Q53A 3BNBA 3F7SA 3MYTA 4NHFA 2WOHA 4K61A 1N5PA 1M904 1IVWA 3K0ZA 2GU1A 2XSOB 3K63A 2JDIH 3SOYA 1JN5A 4N6LA 2YX9A 1UUWB 2RSXA 1CQSA 2W03A 1TIJA 2JQ5A 3PS8A 5BXQA 5IENA 3DZLA 3LT8A 5IEOA 1VZZA 4O3VA 2HMOB 3JUNA 3VSYA 2CWVA 1M1K4 2STDA 1ZX2A 2OQEC 4L7KA 1JV2B 1RRHA 3GAXA 1FUWA 4FMAA 1EG9B 2K54A 3EN8A 3OWSA 3X41A 4HYZA 1CYVA 2IUJA 1DYUA 1TP6A 2D1WA 3B7CA 3V98A 4N6OB 2FGTA 3EE1A 2YFIB 1QAKA 3FF2A 4HBRA 3PYJA 3CC73 1WQLB 3JUPA 3F14A 4STDA 2L4VA 3MG3A 1NWWA 2Z7AA 3CC43 3FG4A 3LOYA 2YFJB 1WTHA 1N9JA 2CK3H 4FMDA 1Y4KA 4KVHA 3MWZA 1AVLA 2KCDA 4FCZA 1NJI4 2XEPA 1IQYA 1FGRA 4X2HA 3U1WA 1KQS2 1WMNA 1LVNA 3GWRA 1VQM3 2C10A 1JB2A 3NBBA 1VQO3 3FKAA 1RKYA 1RJOA 3BLZA 2RGQA 2Q07A 1STDA 1W02A 3HI7A 2E2VA 3AMOB 1O7NB 1YHQ3 2XH9A 3ER7A 2P05A 3ECFA 3EQQB 1ROVA 4XBYA 4EV2A 5LC6A 4R1KA 2E2TA 1STFI 1DMNA 3HIIA 3NQYA 5IG5A 2LQVA 1FGQA 2E2UA 2GU3A 1VQ93 5DRVA 3X42A 4N6TA 1DMMA 1IV9A 2ZDJA 4G1MB 4HM2B 3DM8A 5IERA 5CF1A 3K5TA 3Q90A 2HMLB 3EF8A 3OV4A 1ULIB 1W01A 3OX9A 4RNZA 5G2GA 3L0RA 1Q40A 3HZPA 3SVAA 5IG4A 1QALA 3CU3A 3I563 3NBRA 4WP5A 3AMOA 4H61A 1E3RA 2BO9B 3FG3A 1K28A 5AIGA 3NHXA 4R9KA 2QEX3 4PEJA 4EXRA 3LTDA 4WWUC 3VF1A 4R4KA 1MNLA 3MG2A 5ELUA 1HU9A 1VQL3 3MKIA 2O9UX 3CNMA 5HGRA 3Q1CA 1SIHA 3BNCA 4MEIA 4CCVA 3B8LA 8CHOA 1DMQA 1ULJB 2O3OA 4N6V0 1UUVB 4RZMA 1R4CA 3CNXA 3SLUA 2B1XB 2ML6A 3K9MC 3D3LA 1DVCA 1A2VA 1OHSA 5CK6A 2BNGA 1WNHA 4MMYB 4OVMA 2W04A 5D82A 2C11A 3V99A 1YJ93 4OK0A 1NO3A 4AKYA 5DREA 1V74A 1OH0A 1KC84 3X3ZA 2GXFA 1M1XB 1OGXA 1IVUA 2FXTA 2Z77A 4XBTA 1RRLA 2UX0A 3FGYA 4H3UA 3T8NA 1K41A 3WOFB 3T8UA 5AIHA 3CCV3 5AIFA 3G4S3 1NDOB 2WGQA 2KXGA 1VQK3 3NV0B 4GL6A 3SX1A 1Q814 1JKGA 1IT7A 1GD3A 1T5YA 1EA2A 3CME3 1KD14 4N6UA 1SIIA 4HZBB 2BMRB 3SXXA 3KN4A 2D42A 2RFRA 2W0QA 5ELJA 1OUNA 3GZBA 4WYKA 1S5AA 2OOVA 2CH9A 1TUHA 4KZ1A 1JJ22 3DGLA 5JPPA 3PXMA 1E97A 3BNEA 2HMMB 1EKMA 2MF7A 2OWPA 4K1UA 4HM6B 3FLJA 5D81A 3G713 1YIT3 1EQKA 1W2B2 2V1LA 2CFWA 1IVXA 3GZYB 4EYCA 3DXOA 3RGRA 3EX9A 3CCS3 4N3VA 2CC3A 5IF6A 3J7Yd 3B4PA 2A15A 3S27A 1F8NA 3RDEA 3NV0A 2CFDA 3S29A 4GB5A 3DMCA 3DGNA 3IMAB 1YVBI 2QA43 2RCDA 2CG0A 3FG1A 1OHPA 4FMBA 3N54B 4IPBA 1A2KA 2YFLB 3ROBA 3N9HA 3UL5A 1HKXA 1PU4A 1Q864 1VQ83 3TDGA 1UI7A 3HIGA 1YGEA 1GYBA 1W2ZA 3GRDA 5FW5A 2BMOB 1G96A 3LZAA 5I97A 5JPUA 4JRFA 5IW9A 1ZO2A 4J9AA 2CWUA 3H3HA 2OTJ3 1IT8A 1O7WB 2IUKA 5KP1A 1OCVA 2CFKA 3EHCA 2Z76A 1IDPA 2Z6BA 4AKZA 1UW1A 1QAFA 1D6UA 1OHOA 4AEQA 3EB8A 3JUMA 4MMZB 3JUOA 5AI1A 2PNCA 3DUKA 3X3YA 4XBXA 3CCL3 3CCU3 3OWYA 3CCR3 1FGTA 2INXA 3I0YA 3MSOA 4X2OA 3LTBA 5AIIA 4WYKB 3FSDA 4LEHA 3ALAA 4ORLA 3EN1B 2MC8A 1OGZA 1K9M4 2XGNA 5LC7A 4NREA 3LTCA 3UNLA 4HKVB 3EBTA 3S28A 3EC9A 4CDLA 1W6GA 2M7OA 2OTL3 4BTWA 3B4OA 3A76A 3FH1A 3LT9A 4J8TA 4N6NB 1JRQA 3FF0A 3IPTA 3HX8A 5EEOA 3OWUA 2BMQB 5AYRB 2XSHB 4HM7B 3E99A 3OW22 1KSIA 1N9EA 3KE7A 3UJMA 1JB4A 3NUVA 2W6JH 5EVHA 3KIIA 2W56A 1JKGB 5CF2A 1FGOA 3V92A 2K0MA 4L8OA 5FGOA 1O7PB 3IJEB 1JN5B 3K7CA 3EBYA 1W00A 2WOFA 1K8A4 1NB5I 4RNYA 3FZWA 1IK3A 1OACA 1TU5A 2P38A 2P0MA 2B24B 1O7GB 2HMKB 3G8ZA 1NB3I 3F9SA 1J2BA 4KFDA 4K1VA 2GEYA 4HM1B 1VQ63 4HM4B 1O7HB 3G16A 2GEXA 3M8CA 1Q7Y4 1N8R4 4O02B 2CG1A 2QIYA 4LGQA 5EQLA 3NXJA 1AV4A 2F98A 3VGNA 1TFOA 3X3XA 1QJGA 4KFEA 2LYXA 3H51A 4KFFA 1SJWA 1SQWA 3CCE3 3NQZA 2W9QA 4BTXA 7STDA 3U97A 3WOEB 4L8PA 3LMLA 2CW9A 4LSOA 3LH4A 1N8QA 4HM8B 4WFOA 4XDVA 3S67A 5IG0A 1S723 1W5ZA 3KSPA 1OF5B 1E3VA 4HJLB 3BNDA 1GY6A 3UL6A 1Q824 1VQ43 3CPW2 2CFLA 4R80A 5A0OB 4JF8A 4I4KA 3CCM3 1GY5A 5TGNA 2CWTA 2GBWB 2SBLA 3CCJ3 3PGBA 3G6E3 3KZTA 3I553 1ISKA 3PCRA 2OCTA 4XM4A 5BVBA 1CEWI 3MG1A 4K90B 3KSED 4HVNA 3MHEA 3JVCA 2CKFB 3WA2X 4EBGA 2ML5A 5AEWB 2W9PA 3CC23 1U5OA 1VQ73 2BHMA 2QGUA 5IEPA 4XDWA 3DGMA 4OUQA 3O8YA 2HMNB 1CYUA 4ZM8A 2XFTA 1AVKA 1W7CA 2R4IA 2CFGA 1M9GA 2HMJB 2IMJA 1ASKA 1GY7A 2CHCA 1IV7A 5KP4A 2CIUA 3CCQ3 2OQEA 1KWIA 1O7MB 1A90A 5KP3A 2GBXB 3G0KA 3GZRA 4QWTA 2IA7A 2WO0A 4FR9A 1GS3A 1YJN3 5AEUB 3GZXB 3BB9A 2XFSA 3F40A 3PCSA 3CMA3 3NBJA 4FCMA 5IG3A 1Z1SA 2Y73A 4U13A 2W2CA 3PZWA 3KFQC 3NM7A 1L5GB 3D9RA 3NX0A 3CD63 4R9LA 1FGMA 1US1A 1VQ53 3CXC2 4MMXB 3LTAA 1Q42A 2XRXB 1LNHA 1OPYA 3F7XA 2W56B 1VQN3 1DVDA 2XR8B 1Q40B 1D6YA 2WGOA 4RBNA 1LXEA 3QRDA 5JBSA 1IQ8A 5CXOA 2F86B 1D6ZA 1W4NA 1WMPA 1SPUA 3KKGA 4EC6A 1U8CB 4O2HA 2XGLA 4WHAA 4EV5A 2ZL8A 4XB5A 1QMAA 4FMCA 4LZIA 3JUQA 5STDA 5CLKA 3RGAA 3SEDA 3WMDA 2KRTA 4O8SA 1NU3A 1W6YA 3X40A 1LOXA 1TFKA 4FCJA 4LMIA 4IT7A 4MJDA 6STDA 1ROAA 3DGOA 1FA3A 3Q2PA 4HM3B 1AR0A 2P0XA 1GD4A 1W6CA 1YIJ3 3LXUX 1A67A 3OXAA 4BTYA 1PFPA 2OOVC 2FNQA 2XF3A 3HK4A 1OF5A 3NM2A 4N6MA 1N5HA 3UB1A 3SOAA 3WODG 1WMOA 2Y74A 1IU7A 3MPHA 3QK9A 2P09A 2PZVA 3EJVA 4HM5B 2F99A 3WDGB 1IVVA 1JB5A 4IIAA 3T0UA 1IQXA 1K734 1RN7A 5AYSC 1BUQA 1C7HA 3N8BA 3STDA 3CPOA 3WA3A 1YJW3 1JNQA 4HZ9B 3F8XA 1QVG2 2I9WA 4HM0B 1MOLA 1UI8A 1QVF2 3FCSB 3DY5A 4TX4A 1YI23 3F8HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UB1 A;  4EC6 A; 
#chains in the Genus database with same CATH topology
 3LYG A;  3S5C A;  1VQP 3;  2BT3 A;  5D83 A;  1VQQ A;  4Q53 A;  3Q3F A;  3D5G A;  3BNB A;  3F7S A;  1RGE A;  3MYT A;  4NHF A;  2WOH A;  4K61 A;  1FUT A;  1N5P A;  1B2U A;  1M90 4;  1IVW A;  3K0Z A;  2GU1 A;  2KF3 A;  2XSO B;  3K63 A;  2JDI H;  3SOY A;  1JN5 A;  4N6L A;  2YX9 A;  1UUW B;  1R4Y A;  1CQS A;  2RSX A;  2W03 A;  1TIJ A;  2JQ5 A;  3PS8 A;  5BXQ A;  5IEN A;  3DZL A;  3LT8 A;  5IEO A;  1VZZ A;  4O3V A;  2HMO B;  3JUN A;  1UCI A;  3VSY A;  2CWV A;  1M1K 4;  1TJD A;  1ZX2 A;  2STD A;  2OQE C;  4L7K A;  1JV2 B;  1RRH A;  3GAX A;  1FUW A;  1BRH A;  4FMA A;  1EG9 B;  2K54 A;  3EN8 A;  3OWS A;  3X41 A;  4HYZ A;  1CYV A;  2IUJ A;  1DYU A;  1BNJ A;  3RNT A;  1TP6 A;  2D1W A;  3B7C A;  3V98 A;  4N6O B;  1RGL A;  1MWT A;  2FGT A;  3EE1 A;  2YFI B;  1QAK A;  3FF2 A;  1PY3 A;  4HBR A;  3PYJ A;  3CC7 3;  1WQL B;  2KF6 A;  1GOV A;  2IY2 A;  3JUP A;  3F14 A;  1YVS A;  4STD A;  1MWS A;  2L4V A;  4RNT A;  3MG3 A;  1NWW A;  2Z7A A;  3CC4 3;  3FG4 A;  3LOY A;  2YFJ B;  1WTH A;  1N9J A;  2CK3 H;  4FMD A;  1Y4K A;  1RCK A;  4KVH A;  3MWZ A;  1AVL A;  2KCD A;  4FCZ A;  4I5Q A;  3AGN A;  2XEP A;  1NJI 4;  1IQY A;  1FGR A;  4X2H A;  3U1W A;  1LOW A;  1KQS 2;  1WMN A;  1LVN A;  2UUG C;  3GWR A;  1VQM 3;  2C10 A;  1JB2 A;  1V58 A;  3NBB A;  3FKA A;  8RNT A;  1VQO 3;  1RKY A;  1RJO A;  3BLZ A;  2RGQ A;  4BIR A;  2Q07 A;  1STD A;  1W02 A;  3HI7 A;  7RNT A;  2E2V A;  3AMO B;  1O7N B;  1V57 A;  1YHQ 3;  2XH9 A;  1RGC A;  3ER7 A;  2P05 A;  3ECF A;  1T2H A;  1GOU A;  1ROV A;  3EQQ B;  2F5M A;  4XBY A;  4EV2 A;  1FW7 A;  5LC6 A;  4R1K A;  1RGA A;  2E2T A;  1I3F A;  1Q9E A;  1STF I;  4LYL B;  1DMN A;  3HII A;  3NQY A;  5IG5 A;  2LQV A;  2ZA4 A;  1FGQ A;  2E2U A;  1B2X A;  2GU3 A;  1VQ9 3;  1BRN L;  2F56 A;  1BSD A;  5DRV A;  3X42 A;  4N6T A;  1DMM A;  1IV9 A;  2ZDJ A;  4G1M B;  4HM2 B;  3DM8 A;  5IER A;  5CF1 A;  3K5T A;  1FUS A;  3Q90 A;  2HML B;  3EF8 A;  3OV4 A;  1ULI B;  1W01 A;  3OX9 A;  4RNZ A;  5G2G A;  3L0R A;  1JBT A;  1Q40 A;  3HZP A;  3SVA A;  5IG4 A;  1RN4 A;  1QAL A;  3CU3 A;  3I56 3;  3NBR A;  4J5K A;  3AMO A;  1Q7H A;  1E3R A;  4H61 A;  4WP5 A;  2BO9 B;  3FG3 A;  1K28 A;  5AIG A;  3NHX A;  1RSN A;  4R9K A;  1AY7 A;  2QEX 3;  4PEJ A;  4EXR A;  3LTD A;  1MGR A;  4WWU C;  3VF1 A;  1YNV X;  2KF4 A;  4R4K A;  1RDS A;  1MNL A;  3D79 A;  2IYJ A;  3MG2 A;  5ELU A;  1HU9 A;  1YGW A;  1TRQ A;  1VQL 3;  3MKI A;  2O9U X;  3CNM A;  5HGR A;  3Q1C A;  1FYS A;  1SIH A;  1T3B A;  1BRS A;  3BNC A;  4MEI A;  4CCV A;  3B8L A;  3ZG0 A;  8CHO A;  1RNB A;  1DMQ A;  1ULJ B;  2O3O A;  4N6V 0;  1BSE A;  1UUV B;  1R4C A;  4RZM A;  3CNX A;  3SLU A;  1BRI A;  2B1X B;  1AQZ A;  2ML6 A;  3K9M C;  2F5W A;  3D3L A;  1DVC A;  1A2V A;  1OHS A;  5CK6 A;  2BNG A;  1WNH A;  2H0G A;  4MMY B;  2W04 A;  4OVM A;  2C11 A;  5D82 A;  1B2M A;  3V99 A;  1HYF A;  2UGI A;  1RNT A;  1YJ9 3;  4OK0 A;  3ZFZ A;  1NO3 A;  4AKY A;  5DRE A;  1V74 A;  1OH0 A;  1KC8 4;  3X3Z A;  2GXF A;  1I70 A;  1M1X B;  1OGX A;  1IVU A;  1X1W A;  1B3S A;  2FXT A;  1RRL A;  2UX0 A;  2Z77 A;  3FGY A;  4H3U A;  4XBT A;  5GSP A;  3T8N A;  1K41 A;  3WOF B;  2F4Y A;  3T8U A;  5AIH A;  3CCV 3;  1B27 A;  5AIF A;  3G4S 3;  1NDO B;  2WGQ A;  1PYL A;  2KXG A;  1VQK 3;  3NV0 B;  4GL6 A;  3SX1 A;  2RNT A;  1Q81 4;  1JKG A;  1IT7 A;  1GD3 A;  1T5Y A;  1EA2 A;  4NPB A;  3CME 3;  1KD1 4;  4N6U A;  1SII A;  1I8V A;  4HZB B;  1GMP A;  2BMR B;  3SXX A;  3KN4 A;  1BSB A;  2D42 A;  2RFR A;  2W0Q A;  5ELJ A;  1OUN A;  3GZB A;  4WYK A;  1JZD A;  1S5A A;  2OOV A;  2CH9 A;  1TUH A;  1UCL A;  4KZ1 A;  3BU4 A;  5BIR A;  1JJ2 2;  3DGL A;  1BUJ A;  1LOY A;  5JPP A;  1B20 A;  3PXM A;  1E97 A;  2R41 A;  3BNE A;  2HMM B;  9RNT A;  1EKM A;  2MF7 A;  2OWP A;  4K1U A;  4HM6 B;  3FLJ A;  5D81 A;  3G71 3;  1YIT 3;  1BSC A;  1EQK A;  1W2B 2;  1I2G A;  2V1L A;  2CFW A;  1IVX A;  3GZY B;  3AHS A;  4EYC A;  3DXO A;  3RGR A;  3EX9 A;  4CPK A;  5M1A A;  3CCS 3;  4N3V A;  2CC3 A;  5IF6 A;  3J7Y d;  3B4P A;  2A15 A;  1G0T A;  3S27 A;  1F8N A;  3RDE A;  1BVI A;  3NV0 A;  1I0V A;  2CFD A;  4DKI A;  3S29 A;  1T2I A;  4GB5 A;  3DMC A;  3DGN A;  3IMA B;  1YVB I;  1I2F A;  2QA4 3;  2RCD A;  2CG0 A;  6GSP A;  3FG1 A;  1OHP A;  4FMB A;  3N54 B;  1RTU A;  4IPB A;  1A2K A;  2YFL B;  3ROB A;  3N9H A;  3UL5 A;  1HKX A;  1PU4 A;  1X1U A;  1Q86 4;  1VQ8 3;  3TDG A;  1UI7 A;  1BAN A;  3HIG A;  3ZG5 A;  1BU4 A;  1YGE A;  1GYB A;  1W2Z A;  2RBI A;  3GRD A;  2BMO B;  1BRG A;  5FW5 A;  1G96 A;  3LZA A;  5I97 A;  1LNI A;  4JRF A;  5IW9 A;  5JPU A;  1DE3 A;  1ZO2 A;  4J9A A;  1BRK A;  2CWU A;  1G02 A;  1BOX A;  3H3H A;  2J8X B;  2OTJ 3;  1IT8 A;  1O7W B;  2IUK A;  5KP1 A;  1OCV A;  2CFK A;  3EHC A;  2Z76 A;  1IDP A;  2Z6B A;  4AKZ A;  1JBR A;  1UW1 A;  1QAF A;  1DET A;  1D6U A;  1OHO A;  4AEQ A;  3EB8 A;  3JUM A;  4MMZ B;  3JUO A;  5AI1 A;  2PNC A;  3DUK A;  2L1S A;  3X3Y A;  5BU4 A;  4XBX A;  6RNT A;  3CCL 3;  3CCU 3;  3OWY A;  3CCR 3;  1FGT A;  2INX A;  3I0Y A;  3MSO A;  4X2O A;  3LTB A;  5AII A;  4WYK B;  3WHO A;  1EEJ A;  3FSD A;  3GSP A;  4GSP A;  4LEH A;  1RGF A;  3ALA A;  1UCJ A;  1NNV A;  4ILF A;  4ORL A;  3EN1 B;  2MC8 A;  1OGZ A;  1K9M 4;  2XGN A;  2C4B A;  1MWU A;  5LC7 A;  4NRE A;  3LTC A;  1FZU A;  3UNL A;  1IYY A;  4HKV B;  3EBT A;  3S28 A;  3EC9 A;  1ZS7 A;  1W6G A;  4CDL A;  2M7O A;  2OTL 3;  4BTW A;  3B4O A;  3A76 A;  3FH1 A;  3LT9 A;  4J8T A;  4N6N B;  1JRQ A;  1C54 A;  3FF0 A;  3IPT A;  2CX1 A;  3HX8 A;  1RMS A;  5EEO A;  1RCL A;  3OWU A;  2BMQ B;  5AYR B;  2H0I A;  4HOH A;  2XSH B;  1BNE A;  1UGI A;  4HM7 B;  3E99 A;  3OW2 2;  1KSI A;  1N9E A;  3KE7 A;  3UJM A;  1JB4 A;  3WR2 A;  4EW5 A;  3NUV A;  2W6J H;  5EVH A;  3KII A;  2W56 A;  1JKG B;  2SAR A;  3BIR A;  5CF2 A;  1FGO A;  3V92 A;  2K0M A;  1LQG C;  4L8O A;  4BL2 A;  5FGO A;  1O7P B;  3IJE B;  1JN5 B;  4CJN A;  3K7C A;  3A5E A;  3EBY A;  4KT3 B;  1W00 A;  2WOF A;  1K8A 4;  1NB5 I;  5G1K A;  4RNY A;  3FZW A;  1IK3 A;  1OAC A;  1TU5 A;  1CH0 A;  3D4A A;  2P38 A;  2KAA A;  4GHO A;  2P0M A;  2B24 B;  1O7G B;  2HMK B;  1SAR A;  3G8Z A;  1NB3 I;  3F9S A;  1I3I A;  2K3D A;  4KFD A;  1J2B A;  4K1V A;  2GEY A;  4HM1 B;  1VQ6 3;  4HM4 B;  1O7H B;  3G16 A;  1RLS A;  2GEX A;  3M8C A;  1Q7Y 4;  5RNT A;  1N8R 4;  4O02 B;  2CG1 A;  2CX0 A;  2QIY A;  4HAA A;  1GMQ A;  4LGQ A;  3NXJ A;  5EQL A;  1AV4 A;  1A2P A;  2F98 A;  3VGN A;  1TFO A;  3X3X A;  1QJG A;  4KFE A;  2LYX A;  3H51 A;  4KFF A;  1B21 A;  1SJW A;  1SQW A;  3CCE 3;  1RHL A;  3NQZ A;  2W9Q A;  4BTX A;  7STD A;  3U97 A;  3WOE B;  1BNF A;  4L8P A;  3LML A;  2CW9 A;  4LSO A;  3LH4 A;  1B2S A;  1N8Q A;  4HM8 B;  4WFO A;  4XDV A;  2AAE A;  3S67 A;  5IG0 A;  1LOV A;  2ZHX B;  1S72 3;  1W5Z A;  3KSP A;  1OF5 B;  1E3V A;  3D5I A;  3BND A;  1GY6 A;  4HJL B;  3UL6 A;  1Q82 4;  1VQ4 3;  3CPW 2;  2CFL A;  4R80 A;  5A0O B;  4JF8 A;  4I4K A;  3CCM 3;  3DGY A;  1GY5 A;  5TGN A;  2CWT A;  2GBW B;  2SBL A;  3KCH A;  3CCJ 3;  1GOY A;  3PGB A;  3G6E 3;  1TRP A;  3KZT A;  3I55 3;  1X1Y A;  1ISK A;  3PCR A;  2OCT A;  4XM4 A;  5BVB A;  1CEW I;  3MG1 A;  4K90 B;  1RGH A;  2HOH A;  3KSE D;  4HVN A;  3MHE A;  3JVC A;  2CKF B;  3WA2 X;  4EBG A;  2ML5 A;  3DH2 A;  2W9P A;  5AEW B;  3CC2 3;  1BRJ A;  1U5O A;  1UDI I;  1VQ7 3;  2BHM A;  1B2Z A;  2QGU A;  4XDW A;  5IEP A;  3DGM A;  4OUQ A;  3O8Y A;  1ZGX A;  1MWR A;  2HMN B;  1CYU A;  4ZM8 A;  2XFT A;  1AVK A;  1W7C A;  2R4I A;  1HZ1 A;  1LRA A;  2CFG A;  1M9G A;  2HMJ B;  2IMJ A;  1ASK A;  1GY7 A;  2CHC A;  1IV7 A;  5KP4 A;  5M19 A;  1BIR A;  2CIU A;  3CCQ 3;  2OQE A;  2GSP A;  1KWI A;  1O7M B;  1I0X A;  1BGS A;  3URP A;  1TTO A;  1A90 A;  5KP3 A;  2GBX B;  1MGW A;  2KF5 A;  1BAO A;  1GSP A;  3AGO A;  2IA7 A;  3G0K A;  1UUG B;  3GZR A;  1EUI C;  4QWT A;  2WO0 A;  4FR9 A;  1GS3 A;  1YJN 3;  5AEU B;  1RGK A;  3GZX B;  3BB9 A;  2XFS A;  3F40 A;  3PCS A;  2H0H A;  3CMA 3;  1BNG A;  1BSA A;  3NBJ A;  1Z1S A;  4FCM A;  5IG3 A;  2Y73 A;  4U13 A;  2W2C A;  3PZW A;  3KFQ C;  3NM7 A;  1L5G B;  3D9R A;  3NX0 A;  3CD6 3;  4R9L A;  1FGM A;  1LQM B;  1US1 A;  1VQ5 3;  3CXC 2;  4MMX B;  3LTA A;  1Q42 A;  2XRX B;  1LNH A;  1OPY A;  1X1X A;  2W56 B;  3F7X A;  1VQN 3;  1DVD A;  2XR8 B;  1Q40 B;  1I2E A;  1D6Y A;  1GMR A;  2WGO A;  4RBN A;  1LXE A;  3HOH A;  3QRD A;  5JBS A;  1IQ8 A;  5CXO A;  2F86 B;  1JZO A;  1D6Z A;  4BL3 A;  1W4N A;  1WMP A;  1SPU A;  3KKG A;  4EC6 A;  1U8C B;  4O2H A;  2XGL A;  4WHA A;  4EV5 A;  2ZL8 A;  1JBS A;  4XB5 A;  1QMA A;  4FMC A;  4LZI A;  3JUQ A;  5STD A;  5CLK A;  3RGA A;  3SED A;  1RGG A;  3WMD A;  4J5G A;  1BNS A;  2KRT A;  4O8S A;  1NU3 A;  1W6Y A;  3X40 A;  1LOX A;  1TFK A;  4FCJ A;  4LMI A;  4IT7 A;  5G1L A;  4MJD A;  2AAD A;  6STD A;  1ROA A;  3DGO A;  1FA3 A;  3Q2P A;  4HM3 B;  1RN1 A;  1AR0 A;  2P0X A;  1UGH I;  1GD4 A;  1W6C A;  1YIJ 3;  3LXU X;  7GSP A;  1A67 A;  3OXA A;  4BTY A;  1PFP A;  2BU4 A;  2FNQ A;  2OOV C;  2XF3 A;  3HK4 A;  1OF5 A;  3NM2 A;  4N6M A;  1N5H A;  3UB1 A;  1UCK A;  3SOA A;  3WOD G;  1WMO A;  2Y74 A;  1IU7 A;  3MPH A;  3QK9 A;  2P09 A;  2PZV A;  3EJV A;  4HM5 B;  2F99 A;  3WDG B;  1IVV A;  1JB5 A;  4IIA A;  3T0U A;  5M18 A;  5HOH A;  4BU4 A;  1IQX A;  1K73 4;  1BNI A;  1RN7 A;  5AYS C;  1BUQ A;  2BIR A;  1C7H A;  3N8B A;  3STD A;  3CPO A;  3WA3 A;  1YJW 3;  1JNQ A;  4HZ9 B;  3AHW A;  3F8X A;  1QVG 2;  2I9W A;  1BNR A;  4HM0 B;  1MOL A;  1UI8 A;  1QVF 2;  3FCS B;  3DY5 A;  4TX4 A;  3SYU A;  1YI2 3;  3F8H A; 
#chains in the Genus database with same CATH homology
 3LYG A;  3S5C A;  1VQP 3;  2BT3 A;  5D83 A;  4Q53 A;  3BNB A;  3F7S A;  3MYT A;  4NHF A;  2WOH A;  4K61 A;  1N5P A;  1M90 4;  1IVW A;  3K0Z A;  2GU1 A;  2XSO B;  3K63 A;  2JDI H;  3SOY A;  1JN5 A;  4N6L A;  2YX9 A;  1UUW B;  2RSX A;  1CQS A;  2W03 A;  1TIJ A;  2JQ5 A;  3PS8 A;  5BXQ A;  5IEN A;  3DZL A;  3LT8 A;  5IEO A;  1VZZ A;  4O3V A;  2HMO B;  3JUN A;  3VSY A;  2CWV A;  1M1K 4;  2STD A;  1ZX2 A;  2OQE C;  4L7K A;  1JV2 B;  1RRH A;  3GAX A;  1FUW A;  4FMA A;  1EG9 B;  2K54 A;  3EN8 A;  3OWS A;  3X41 A;  4HYZ A;  1CYV A;  2IUJ A;  1DYU A;  1TP6 A;  2D1W A;  3B7C A;  3V98 A;  4N6O B;  2FGT A;  3EE1 A;  2YFI B;  1QAK A;  3FF2 A;  4HBR A;  3PYJ A;  3CC7 3;  1WQL B;  3JUP A;  3F14 A;  4STD A;  2L4V A;  3MG3 A;  1NWW A;  2Z7A A;  3CC4 3;  3FG4 A;  3LOY A;  2YFJ B;  1WTH A;  1N9J A;  2CK3 H;  4FMD A;  1Y4K A;  4KVH A;  3MWZ A;  1AVL A;  2KCD A;  4FCZ A;  1NJI 4;  2XEP A;  1IQY A;  1FGR A;  4X2H A;  3U1W A;  1KQS 2;  1WMN A;  1LVN A;  3GWR A;  1VQM 3;  2C10 A;  1JB2 A;  3NBB A;  1VQO 3;  3FKA A;  1RKY A;  1RJO A;  3BLZ A;  2RGQ A;  2Q07 A;  1STD A;  1W02 A;  3HI7 A;  2E2V A;  3AMO B;  1O7N B;  1YHQ 3;  2XH9 A;  3ER7 A;  2P05 A;  3ECF A;  3EQQ B;  1ROV A;  4XBY A;  4EV2 A;  5LC6 A;  4R1K A;  2E2T A;  1STF I;  1DMN A;  3HII A;  3NQY A;  5IG5 A;  2LQV A;  1FGQ A;  2E2U A;  2GU3 A;  1VQ9 3;  5DRV A;  3X42 A;  4N6T A;  1DMM A;  1IV9 A;  2ZDJ A;  4G1M B;  4HM2 B;  3DM8 A;  5IER A;  5CF1 A;  3K5T A;  3Q90 A;  2HML B;  3EF8 A;  3OV4 A;  1ULI B;  1W01 A;  3OX9 A;  4RNZ A;  5G2G A;  3L0R A;  1Q40 A;  3HZP A;  3SVA A;  5IG4 A;  1QAL A;  3CU3 A;  3I56 3;  3NBR A;  4WP5 A;  3AMO A;  4H61 A;  1E3R A;  2BO9 B;  3FG3 A;  1K28 A;  5AIG A;  3NHX A;  4R9K A;  2QEX 3;  4PEJ A;  4EXR A;  3LTD A;  4WWU C;  3VF1 A;  4R4K A;  1MNL A;  3MG2 A;  5ELU A;  1HU9 A;  1VQL 3;  3MKI A;  2O9U X;  3CNM A;  5HGR A;  3Q1C A;  1SIH A;  3BNC A;  4MEI A;  4CCV A;  3B8L A;  8CHO A;  1DMQ A;  1ULJ B;  2O3O A;  4N6V 0;  1UUV B;  4RZM A;  1R4C A;  3CNX A;  3SLU A;  2B1X B;  2ML6 A;  3K9M C;  3D3L A;  1DVC A;  1A2V A;  1OHS A;  5CK6 A;  2BNG A;  1WNH A;  4MMY B;  4OVM A;  2W04 A;  5D82 A;  2C11 A;  3V99 A;  1YJ9 3;  4OK0 A;  1NO3 A;  4AKY A;  5DRE A;  1V74 A;  1OH0 A;  1KC8 4;  3X3Z A;  2GXF A;  1M1X B;  1OGX A;  1IVU A;  2FXT A;  2Z77 A;  4XBT A;  1RRL A;  2UX0 A;  3FGY A;  4H3U A;  3T8N A;  1K41 A;  3WOF B;  3T8U A;  5AIH A;  3CCV 3;  5AIF A;  3G4S 3;  1NDO B;  2WGQ A;  2KXG A;  1VQK 3;  3NV0 B;  4GL6 A;  3SX1 A;  1Q81 4;  1JKG A;  1IT7 A;  1GD3 A;  1T5Y A;  1EA2 A;  3CME 3;  1KD1 4;  4N6U A;  1SII A;  4HZB B;  2BMR B;  3SXX A;  3KN4 A;  2D42 A;  2RFR A;  2W0Q A;  5ELJ A;  1OUN A;  3GZB A;  4WYK A;  1S5A A;  2OOV A;  2CH9 A;  1TUH A;  4KZ1 A;  1JJ2 2;  3DGL A;  5JPP A;  3PXM A;  1E97 A;  3BNE A;  2HMM B;  1EKM A;  2MF7 A;  2OWP A;  4K1U A;  4HM6 B;  3FLJ A;  5D81 A;  3G71 3;  1YIT 3;  1EQK A;  1W2B 2;  2V1L A;  2CFW A;  1IVX A;  3GZY B;  4EYC A;  3DXO A;  3RGR A;  3EX9 A;  3CCS 3;  4N3V A;  2CC3 A;  5IF6 A;  3J7Y d;  3B4P A;  2A15 A;  3S27 A;  1F8N A;  3RDE A;  3NV0 A;  2CFD A;  3S29 A;  4GB5 A;  3DMC A;  3DGN A;  3IMA B;  1YVB I;  2QA4 3;  2RCD A;  2CG0 A;  3FG1 A;  1OHP A;  4FMB A;  3N54 B;  4IPB A;  1A2K A;  2YFL B;  3ROB A;  3N9H A;  3UL5 A;  1HKX A;  1PU4 A;  1Q86 4;  1VQ8 3;  3TDG A;  1UI7 A;  3HIG A;  1YGE A;  1GYB A;  1W2Z A;  3GRD A;  5FW5 A;  2BMO B;  1G96 A;  3LZA A;  5I97 A;  5JPU A;  4JRF A;  5IW9 A;  1ZO2 A;  4J9A A;  2CWU A;  3H3H A;  2OTJ 3;  1IT8 A;  1O7W B;  2IUK A;  5KP1 A;  1OCV A;  2CFK A;  3EHC A;  2Z76 A;  1IDP A;  2Z6B A;  4AKZ A;  1UW1 A;  1QAF A;  1D6U A;  1OHO A;  4AEQ A;  3EB8 A;  3JUM A;  4MMZ B;  3JUO A;  5AI1 A;  2PNC A;  3DUK A;  3X3Y A;  4XBX A;  3CCL 3;  3CCU 3;  3OWY A;  3CCR 3;  1FGT A;  2INX A;  3I0Y A;  3MSO A;  4X2O A;  3LTB A;  5AII A;  4WYK B;  3FSD A;  4LEH A;  3ALA A;  4ORL A;  3EN1 B;  2MC8 A;  1OGZ A;  1K9M 4;  2XGN A;  5LC7 A;  4NRE A;  3LTC A;  3UNL A;  4HKV B;  3EBT A;  3S28 A;  3EC9 A;  4CDL A;  1W6G A;  2M7O A;  2OTL 3;  4BTW A;  3B4O A;  3A76 A;  3FH1 A;  3LT9 A;  4J8T A;  4N6N B;  1JRQ A;  3FF0 A;  3IPT A;  3HX8 A;  5EEO A;  3OWU A;  2BMQ B;  5AYR B;  2XSH B;  4HM7 B;  3E99 A;  3OW2 2;  1KSI A;  1N9E A;  3KE7 A;  3UJM A;  1JB4 A;  3NUV A;  2W6J H;  5EVH A;  3KII A;  2W56 A;  1JKG B;  5CF2 A;  1FGO A;  3V92 A;  2K0M A;  4L8O A;  5FGO A;  1O7P B;  3IJE B;  1JN5 B;  3K7C A;  3EBY A;  1W00 A;  2WOF A;  1K8A 4;  1NB5 I;  4RNY A;  3FZW A;  1IK3 A;  1OAC A;  1TU5 A;  2P38 A;  2P0M A;  2B24 B;  1O7G B;  2HMK B;  3G8Z A;  1NB3 I;  3F9S A;  1J2B A;  4KFD A;  4K1V A;  2GEY A;  4HM1 B;  1VQ6 3;  4HM4 B;  1O7H B;  3G16 A;  2GEX A;  3M8C A;  1Q7Y 4;  1N8R 4;  4O02 B;  2CG1 A;  2QIY A;  4LGQ A;  5EQL A;  3NXJ A;  1AV4 A;  2F98 A;  3VGN A;  1TFO A;  3X3X A;  1QJG A;  4KFE A;  2LYX A;  3H51 A;  4KFF A;  1SJW A;  1SQW A;  3CCE 3;  3NQZ A;  2W9Q A;  4BTX A;  7STD A;  3U97 A;  3WOE B;  4L8P A;  3LML A;  2CW9 A;  4LSO A;  3LH4 A;  1N8Q A;  4HM8 B;  4WFO A;  4XDV A;  3S67 A;  5IG0 A;  1S72 3;  1W5Z A;  3KSP A;  1OF5 B;  1E3V A;  4HJL B;  3BND A;  1GY6 A;  3UL6 A;  1Q82 4;  1VQ4 3;  3CPW 2;  2CFL A;  4R80 A;  5A0O B;  4JF8 A;  4I4K A;  3CCM 3;  1GY5 A;  5TGN A;  2CWT A;  2GBW B;  2SBL A;  3CCJ 3;  3PGB A;  3G6E 3;  3KZT A;  3I55 3;  1ISK A;  3PCR A;  2OCT A;  4XM4 A;  5BVB A;  1CEW I;  3MG1 A;  4K90 B;  3KSE D;  4HVN A;  3MHE A;  3JVC A;  2CKF B;  3WA2 X;  4EBG A;  2ML5 A;  5AEW B;  2W9P A;  3CC2 3;  1U5O A;  1VQ7 3;  2BHM A;  2QGU A;  5IEP A;  4XDW A;  3DGM A;  4OUQ A;  3O8Y A;  2HMN B;  1CYU A;  4ZM8 A;  2XFT A;  1AVK A;  1W7C A;  2R4I A;  2CFG A;  1M9G A;  2HMJ B;  2IMJ A;  1ASK A;  1GY7 A;  2CHC A;  1IV7 A;  5KP4 A;  2CIU A;  3CCQ 3;  2OQE A;  1KWI A;  1O7M B;  1A90 A;  5KP3 A;  2GBX B;  3G0K A;  3GZR A;  4QWT A;  2IA7 A;  2WO0 A;  4FR9 A;  1GS3 A;  1YJN 3;  5AEU B;  3GZX B;  3BB9 A;  2XFS A;  3F40 A;  3PCS A;  3CMA 3;  3NBJ A;  4FCM A;  5IG3 A;  1Z1S A;  2Y73 A;  4U13 A;  2W2C A;  3PZW A;  3KFQ C;  3NM7 A;  1L5G B;  3D9R A;  3NX0 A;  3CD6 3;  4R9L A;  1FGM A;  1US1 A;  1VQ5 3;  3CXC 2;  4MMX B;  3LTA A;  1Q42 A;  2XRX B;  1LNH A;  1OPY A;  3F7X A;  2W56 B;  1VQN 3;  1DVD A;  2XR8 B;  1Q40 B;  1D6Y A;  2WGO A;  4RBN A;  1LXE A;  3QRD A;  5JBS A;  1IQ8 A;  5CXO A;  2F86 B;  1D6Z A;  1W4N A;  1WMP A;  1SPU A;  3KKG A;  4EC6 A;  1U8C B;  4O2H A;  2XGL A;  4WHA A;  4EV5 A;  2ZL8 A;  4XB5 A;  1QMA A;  4FMC A;  4LZI A;  3JUQ A;  5STD A;  5CLK A;  3RGA A;  3SED A;  3WMD A;  2KRT A;  4O8S A;  1NU3 A;  1W6Y A;  3X40 A;  1LOX A;  1TFK A;  4FCJ A;  4LMI A;  4IT7 A;  4MJD A;  6STD A;  1ROA A;  3DGO A;  1FA3 A;  3Q2P A;  4HM3 B;  1AR0 A;  2P0X A;  1GD4 A;  1W6C A;  1YIJ 3;  3LXU X;  1A67 A;  3OXA A;  4BTY A;  1PFP A;  2OOV C;  2FNQ A;  2XF3 A;  3HK4 A;  1OF5 A;  3NM2 A;  4N6M A;  1N5H A;  3UB1 A;  3SOA A;  3WOD G;  1WMO A;  2Y74 A;  1IU7 A;  3MPH A;  3QK9 A;  2P09 A;  2PZV A;  3EJV A;  4HM5 B;  2F99 A;  3WDG B;  1IVV A;  1JB5 A;  4IIA A;  3T0U A;  1IQX A;  1K73 4;  1RN7 A;  5AYS C;  1BUQ A;  1C7H A;  3N8B A;  3STD A;  3CPO A;  3WA3 A;  1YJW 3;  1JNQ A;  4HZ9 B;  3F8X A;  1QVG 2;  2I9W A;  4HM0 B;  1MOL A;  1UI8 A;  1QVF 2;  3FCS B;  3DY5 A;  4TX4 A;  1YI2 3;  3F8H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...