4EC6A

Ntf2-like, potential transfer protein tram from gram-positive conjugative plasmid pip501
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
109
structure length
109
Chain Sequence
SQSKIDTFGRYFLTYYFSQEKNQENYQSSLRTYVSEKVDISDWKALGKTLKSVNYYGSEQTKKGYSVEYLLNVSVDNRSKMQKITFEVEPTKNGFLVTTQPKLTDFSFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative uncharacterized protein
publication title The 2.5 A Structure of the Enterococcus Conjugation Protein TraM resembles VirB8 Type IV Secretion Proteins.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Unknown function
total genus 23
structure length 109
sequence length 109
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-03-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.540 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4ec6A00
4EC6A 3UB1A
chains in the Genus database with same CATH superfamily
1I70A 3UB1A 1UGHI 2CFGA 2IY2A 2XH9A 2L4VA 3KZTA 4EXRA 2W0QA 3CCQ3 1MWSA 1GYBA 3CU3A 4R80A 1B2ZA 3CCR3 1RGEA 2CC3A 1RRLA 5AIFA 3KN4A 1UCIA 3NBJA 3NX0A 4DKIA 4WP5A 4R4KA 1Q864 7RNTA 3SOAA 3LTCA 1JJ22 1PYLA 2B1XB 3A5EA 4J8TA 1U8CB 2XSOB 3VF1A 1GOUA 2KF3A 2OOVC 1IDPA 1W00A 2CK3H 2WGQA 3PYJA 1VQK3 4HM3B 2BT3A 3EN1B 3SX1A 2CFLA 3ER7A 1IVWA 3QRDA 1BNFA 2KF6A 2XGLA 1RKYA 1HZ1A 4J5KA 1X1XA 1W4NA 1RGLA 4CCVA 5ELJA 5KP1A 1WQLB 4FMAA 4BL2A 3BB9A 5LC6A 4FMDA 1LQMB 5DRVA 1BNJA 1IT7A 1JKGA 3LT8A 2MF7A 5STDA 2Y73A 3X3YA 1ROAA 1DVDA 1BSEA 3LXUX 1LVNA 3WA2X 1AY7A 4EV5A 5HGRA 1IV9A 3MPHA 4HM1B 1WMPA 1TRQA 3G8ZA 4OK0A 1ULIB 4HYZA 3OXAA 1VQN3 4WWUC 1LOWA 2OQEA 1S723 1WTHA 1STDA 1YVBI 3M8CA 5CLKA 5TGNA 1BRSA 3DGLA 2CG1A 1I0VA 1BRNL 1IQYA 2W9PA 3GAXA 1TFOA 4KFEA 4K1VA 2W03A 1GOYA 3DGMA 3LH4A 3JUNA 2CIUA 1W5ZA 2INXA 2P05A 4GL6A 3MSOA 1ULJB 2AADA 2RBIA 4O3VA 3ROBA 4BU4A 5M19A 5AYRB 3CNXA 4X2OA 1O7GB 1D6ZA 3CCV3 2OWPA 1BNRA 1BRJA 3NBBA 1BSBA 1B2SA 1RMSA 3AHWA 1EA2A 2R4IA 4HZBB 1W02A 3HX8A 4HAAA 1U5OA 3AGNA 4KFFA 3WDGB 3X3ZA 1YIT3 2PNCA 2UGIA 3FKAA 4J5GA 1STFI 3RGRA 1KD14 1LXEA 3G6E3 3FF0A 3LT9A 1LOVA 2F86B 1CQSA 1AR0A 1MGRA 3K63A 5D81A 1DMNA 1BUJA 1D6YA 2CX1A 2LYXA 1SQWA 5KP4A 1YGWA 5M18A 2RCDA 1OF5B 3X42A 2SBLA 1LOXA 2BHMA 3BIRA 4WFOA 1MGWA 6GSPA 1K8A4 4L8PA 3OX9A 2BU4A 2H0IA 2ZL8A 3EBTA 3HOHA 1R4YA 2OQEC 3KFQC 3I0YA 3MG3A 4L7KA 1K28A 2K0MA 1A2VA 1IU7A 3K7CA 5IEOA 1G96A 1OHPA 1BU4A 1MNLA 2WOHA 1HU9A 1X1YA 1OF5A 5IENA 3SLUA 2BO9B 1NB5I 1DYUA 3WOFB 1B3SA 1UI7A 2A15A 1FA3A 4I4KA 1A90A 3PCSA 3BU4A 1QMAA 4R9LA 2GEXA 1YJN3 4WHAA 2LQVA 1EQKA 1JBTA 4CJNA 5CF2A 2KF4A 4FR9A 3WOEB 1GY5A 1BRGA 1T2HA 1SARA 3RDEA 1RHLA 3FG1A 3KKGA 1BOXA 4IT7A 1I3FA 3SXXA 1DMQA 2CWVA 5IEPA 4STDA 2CHCA 4NPBA 1DMMA 3OWUA 3SVAA 3FF2A 1NB3I 2WO0A 4BTWA 2OCTA 1BGSA 3FH1A 3HI7A 4R1KA 4KFDA 2AAEA 3CCJ3 1V74A 3ALAA 2GU3A 3JUQA 4O2HA 1VQQA 1FW7A 1TU5A 2KAAA 1ZX2A 1X1UA 3H3HA 5BIRA 5IERA 1RLSA 3MKIA 3CCL3 3NBRA 4NREA 1TJDA 5LC7A 3S27A 4WYKB 2F56A 5AI1A 1KC84 3GZYB 4K1UA 4RZMA 1EUIC 3SOYA 1JN5B 2CKFB 1JB5A 1Z1SA 2PZVA 1JZOA 2JQ5A 3FZWA 3Q2PA 3F7XA 3AMOA 2CWTA 3MG1A 3CXC2 2STDA 4CPKA 3CME3 3CCE3 3Q3FA 1TP6A 1W6CA 1E3VA 2QA43 1OHOA 4HM6B 4HBRA 1VQ43 5D83A 1NDOB 1Y4KA 1FUSA 3O8YA 4N6NB 3DM8A 1X1WA 3HIIA 1A2KA 5BU4A 3WA3A 1I2FA 1RJOA 3N9HA 2FGTA 1BNIA 5AEUB 4MMZB 4MMXB 3OW22 2ZDJA 1JB2A 4N3VA 3KE7A 3U97A 1VQ93 2MC8A 4NHFA 1T3BA 2C10A 3X3XA 2GXFA 4MEIA 6STDA 1UW1A 1R4CA 1ASKA 1JV2B 1TUHA 2CH9A 1UCJA 2BMQB 2CFWA 4LYLB 4QWTA 5G1KA 4N6V0 5JPUA 3CMA3 1A67A 3MG2A 1F8NA 3DH2A 4CDLA 3Q1CA 1EKMA 3VSYA 4BIRA 3B8LA 4RNTA 3RNTA 2J8XB 2F98A 2ML6A 2XEPA 3CPOA 2YFJB 3WMDA 3ZFZA 3EN8A 1T5YA 2CX0A 3GWRA 1Q7Y4 3X41A 1EG9B 2F99A 1Q814 5IG0A 3MYTA 3NQYA 1M1K4 1RN4A 1EEJA 1W2ZA 1K41A 2C4BA 2B24B 2K3DA 1FGRA 3D9RA 3B4OA 1SIHA 3NXJA 1J2BA 1QAKA 1BVIA 4RNZA 1Q9EA 2QGUA 5JBSA 1B27A 2GBXB 3DGOA 3LTBA 4BL3A 2P09A 3EJVA 1IK3A 4HJLB 1IYYA 5AEWB 5EVHA 1YIJ3 2W04A 3F8XA 4O02B 4AKYA 3L0RA 3STDA 3I563 4HKVB 3S29A 1VQO3 1OHSA 1Q7HA 5EEOA 3LOYA 3UL6A 5IG3A 1WNHA 2Z6BA 1Q42A 3LYGA 1GMPA 3V99A 1RCLA 2YX9A 4KVHA 1TFKA 3ZG5A 1B2UA 3JUMA 4HM2B 1RGGA 1OGXA 1E3RA 2WOFA 1RNTA 3CNMA 4XBXA 3VGNA 3KIIA 1O7WB 3PZWA 1M9GA 2H0HA 2SARA 4R9KA 2CFDA 1OUNA 3EE1A 1TIJA 4LGQA 4EV2A 3CCU3 2CWUA 1JZDA 4G1MB 5HOHA 2XF3A 3FSDA 1BNSA 1NWWA 1CEWI 1SJWA 2HMLB 3EBYA 5EQLA 3T8NA 3CD63 4TX4A 2O3OA 3N8BA 5JPPA 1RGCA 3KCHA 1RGHA 8CHOA 5FGOA 2XGNA 1D6UA 1SPUA 1JRQA 2P0MA 7GSPA 3UL5A 3F40A 3NM2A 2KRTA 3S5CA 1FGQA 3B7CA 3GZBA 1B20A 1FUTA 1RTUA 3GSPA 1RNBA 1VQ63 1RGFA 3RGAA 1W01A 1GD4A 1RDSA 3BNDA 1UCLA 4FMBA 4IIAA 4XB5A 1O7MB 2H0GA 5BVBA 1V58A 3FLJA 2M7OA 4LSOA 1VZZA 1YNVX 2FXTA 4N6LA 3ZG0A 2RSXA 4GSPA 1RN7A 5AYSC 2W6JH 3UJMA 1M904 2HOHA 3DY5A 1N5PA 2D1WA 3EQQB 3PS8A 1W7CA 3CC73 4AKZA 5G1LA 4K61A 5FW5A 2BMOB 2P38A 1I2EA 1NU3A 2Z77A 4LEHA 3G4S3 1VQ83 1GOVA 4EC6A 2Z76A 3DUKA 2WGOA 2R41A 4HM7B 1VQP3 1UCKA 2KXGA 3CCM3 3CPW2 7STDA 1ZO2A 5IG5A 1IV7A 3FCSB 2V1LA 3PCRA 2GEYA 3NUVA 5GSPA 4HM4B 1OGZA 1UUGB 1LNHA 1Q40B 1ROVA 5IG4A 3B4PA 1BSDA 1FGMA 2E2TA 3D4AA 3F7SA 1I8VA 3OWYA 2E2VA 2F5MA 3JUPA 4O8SA 1PU4A 2F4YA 2XR8B 3I553 1DE3A 2IUKA 1LOYA 2W9QA 1VQM3 1N8QA 3CC43 3T8UA 2O9UX 3WHOA 2HMKB 3ECFA 1BRHA 1O7HB 1UGIA 2HMNB 4FCMA 2CW9A 1TTOA 2ZHXB 2CG0A 2P0XA 1OPYA 3DZLA 3F14A 2FNQA 1Q40A 3HZPA 1MWUA 4FMCA 5IF6A 1JBRA 4WYKA 1CYVA 3F9SA 3WR2A 3TDGA 3MWZA 1G02A 2D42A 3N54B 3PGBA 2L1SA 2RFRA 1JN5A 2ML5A 3D5GA 1JB4A 3SEDA 3K5TA 1BAOA 4N6TA 1KQS2 1C54A 5BXQA 1QJGA 2I9WA 3AGOA 1QVF2 1WMOA 3WODG 4IPBA 5A0OB 5CF1A 1BANA 1CH0A 1IVUA 3OWSA 1GY6A 2GU1A 5RNTA 1W2B2 2W56B 1O7NB 1BNEA 4XM4A 3UNLA 1MOLA 4EBGA 4RNYA 1FYSA 1AV4A 1JKGB 1I2GA 5CK6A 1GMRA 2YFLB 1IVVA 2QEX3 4U13A 4HZ9B 1K9M4 1NJI4 1JNQA 3NV0B 3V98A 8RNTA 1GMQA 1RGAA 2UX0A 3BNBA 1IQ8A 1FGOA 2CFKA 2ZA4A 4OVMA 5CXOA 1N8R4 1VQL3 4X2HA 2XFSA 1VQ53 2BIRA 2W56A 5AIGA 3D79A 2Q07A 2JDIH 3D3LA 1GY7A 2RNTA 1DVCA 3X40A 1V57A 1B21A 3FGYA 3U1WA 2E2UA 3NM7A 3CCS3 3EHCA 3EC9A 1E97A 4KZ1A 4XDVA 1GSPA 2KF5A 5DREA 1UUVB 1NO3A 1PY3A 1OACA 1ZGXA 1IQXA 3BLZA 3G0KA 2HMJB 2XRXB 2RGQA 3NV0A 4KT3B 1Q824 1B2MA 2IYJA 1QVG2 3S28A 3Q90A 3H51A 1N9JA 4GHOA 5D82A 2IUJA 1HKXA 1UUWB 4GB5A 5AIHA 1OH0A 1BNGA 1AQZA 1MWRA 3DMCA 1BRIA 1PFPA 1YGEA 2BNGA 2C11A 3G16A 3PXMA 3V92A 2Y74A 4XDWA 1TRPA 9RNTA 1BSCA 1AVLA 4Q53A 1YHQ3 1C7HA 1GD3A 1LRAA 4N6OB 3IMAB 1CYUA 1HYFA 4H61A 3G713 1O7PB 3LZAA 3IJEB 3MHEA 3GRDA 3EX9A 4EYCA 3FG3A 4XBTA 2HMOB 3BNEA 1RN1A 4HOHA 2IA7A 4HM8B 3KSPA 1AVKA 3LMLA 4HVNA 1KWIA 1I0XA 4ZM8A 3AHSA 1B2XA 1M1XB 4J9AA 4N6MA 1W6YA 1ISKA 1BSAA 2XFTA 1LQGC 1WMNA 2BMRB 1T2IA 3OV4A 4LZIA 2IMJA 2W2CA 6RNTA 1YJW3 3EB8A 1FZUA 3LTAA 1K734 1RSNA 3HIGA 1QALA 3GZXB 4XBYA 3URPA 3S67A 4AEQA 4EW5A 4PEJA 2UUGC 1OCVA 3JUOA 4MMYB 2XSHB 3A76A 1RRHA 4OUQA 2KCDA 4MJDA 3DGNA 4L8OA 2F5WA 4K90B 4I5QA 1UI8A 1YJ93 3KSED 3K0ZA 4JRFA 4RBNA 4ILFA 1NNVA 4HM5B 1RCKA 4ORLA 4FCJA 2HMMB 1I3IA 3E99A 3D5IA 3JVCA 4JF8A 1L5GB 1YVSA 1BRKA 3NQZA 4BTXA 2GBWB 3K9MC 4LMIA 3F8HA 1A2PA 2K54A 2QIYA 2Z7AA 2OTJ3 4H3UA 1VQ73 3LTDA 5IW9A 1S5AA 4FCZA 1US1A 1UDII 2OOVA 3T0UA 2YFIB 3J7Yd 3BNCA 1IVXA 1G0TA 1MWTA 1W6GA 4HM0B 1FUWA 1SIIA 5KP3A 1JBSA 3QK9A 5ELUA 1YI23 2GSPA 3DGYA 3GZRA 3SYUA 5AIIA 1BIRA 5M1AA 1RGKA 1FGTA 1KSIA 1ZS7A 3EF8A 1IT8A 3IPTA 4N6UA 3CC23 1N9EA 3DXOA 3FG4A 1DETA 3NHXA 3HK4A 4BTYA 2OTL3 5G2GA 3AMOB 1GS3A 1LNIA 5I97A 1BUQA 1N5HA 1QAFA
chains in the Genus database with same CATH topology
3UB1A 2CFGA 4EXRA 2XH9A 2L4VA 3KZTA 3CCQ3 2W0QA 3CCR3 1GYBA 3CU3A 4R80A 2CC3A 1RRLA 5AIFA 3KN4A 3NX0A 3NBJA 4WP5A 4R4KA 1Q864 3SOAA 3LTCA 1JJ22 2B1XB 4J8TA 1U8CB 2XSOB 3VF1A 2OOVC 1IDPA 1W00A 2CK3H 2WGQA 3PYJA 1VQK3 4HM3B 2BT3A 3EN1B 3SX1A 2CFLA 3ER7A 1IVWA 3QRDA 2XGLA 1RKYA 1W4NA 5KP1A 4CCVA 5ELJA 1WQLB 4FMAA 3BB9A 5LC6A 4FMDA 5DRVA 3X3YA 1IT7A 1JKGA 3LT8A 2MF7A 5STDA 2Y73A 1DVDA 1ROAA 3LXUX 1LVNA 3WA2X 4EV5A 5HGRA 1IV9A 3MPHA 4HM1B 1WMPA 4OK0A 3G8ZA 1ULIB 4HYZA 3OXAA 1VQN3 4WWUC 2OQEA 1S723 1WTHA 1STDA 1YVBI 3M8CA 5CLKA 5TGNA 3DGLA 2CG1A 1IQYA 2W9PA 3GAXA 1TFOA 4KFEA 4K1VA 2W03A 3DGMA 3LH4A 3JUNA 2CIUA 1W5ZA 2INXA 2P05A 4GL6A 3MSOA 1ULJB 4O3VA 3ROBA 5AYRB 3CNXA 4X2OA 1O7GB 1D6ZA 3CCV3 2OWPA 3NBBA 1EA2A 2R4IA 4HZBB 1W02A 3HX8A 1U5OA 4KFFA 3WDGB 3X3ZA 1YIT3 2PNCA 3FKAA 1KD14 1STFI 3RGRA 1LXEA 3G6E3 3FF0A 3LT9A 2F86B 1CQSA 1AR0A 3K63A 5D81A 1DMNA 1D6YA 2LYXA 1SQWA 5KP4A 2RCDA 1OF5B 3X42A 2SBLA 1LOXA 2BHMA 4WFOA 1K8A4 4L8PA 3OX9A 3EBTA 2ZL8A 2OQEC 3KFQC 3I0YA 3MG3A 4L7KA 1K28A 2K0MA 1A2VA 1IU7A 3K7CA 5IEOA 1G96A 1OHPA 1MNLA 2WOHA 1HU9A 1OF5A 5IENA 3SLUA 2BO9B 1DYUA 3WOFB 2A15A 1UI7A 4I4KA 1A90A 3PCSA 1QMAA 4R9LA 2GEXA 1YJN3 4WHAA 2LQVA 1EQKA 5CF2A 4FR9A 3WOEB 1GY5A 3RDEA 3FG1A 3KKGA 4IT7A 3SXXA 5IEPA 1NB5I 1DMQA 2CWVA 4STDA 2CHCA 1DMMA 3OWUA 3SVAA 3FF2A 1NB3I 2WO0A 4BTWA 2OCTA 3FH1A 3HI7A 4R1KA 4KFDA 3CCJ3 1V74A 3ALAA 2GU3A 3JUQA 4O2HA 1TU5A 1ZX2A 3H3HA 5IERA 3MKIA 3CCL3 3NBRA 4NREA 5LC7A 3S27A 4WYKB 5AI1A 1KC84 3GZYB 4K1UA 4RZMA 3SOYA 1JN5B 2CKFB 1JB5A 1Z1SA 2PZVA 2JQ5A 3FZWA 3Q2PA 3F7XA 3AMOA 2CWTA 3MG1A 3CXC2 2STDA 3CME3 3CCE3 1TP6A 1W6CA 1E3VA 1OHOA 4HM6B 4HBRA 1VQ43 5D83A 1NDOB 1Y4KA 3O8YA 4N6NB 3DM8A 3HIIA 1A2KA 3WA3A 1RJOA 3N9HA 2FGTA 5AEUB 4MMZB 4MMXB 3OW22 2ZDJA 1JB2A 4N3VA 3KE7A 3U97A 1VQ93 2MC8A 4NHFA 3X3XA 2C10A 2GXFA 4MEIA 6STDA 1UW1A 1R4CA 1ASKA 1JV2B 1TUHA 2CH9A 2BMQB 2CFWA 4QWTA 3CMA3 4N6V0 5JPUA 1A67A 3MG2A 1F8NA 4CDLA 3Q1CA 1EKMA 3VSYA 3B8LA 2F98A 2ML6A 2XEPA 3CPOA 2YFJB 3WMDA 3EN8A 1T5YA 1Q7Y4 3GWRA 3X41A 1EG9B 2F99A 1Q814 5IG0A 3MYTA 3NQYA 1M1K4 1W2ZA 1K41A 2B24B 3D9RA 1FGRA 3B4OA 1SIHA 3NXJA 1J2BA 1QAKA 4RNZA 2QGUA 5JBSA 2GBXB 3DGOA 3LTBA 1IK3A 2P09A 3EJVA 4HJLB 5AEWB 5EVHA 1YIJ3 2W04A 3F8XA 4O02B 4AKYA 3L0RA 3STDA 3I563 4HKVB 3S29A 1VQO3 1OHSA 5EEOA 3LOYA 3UL6A 5IG3A 1WNHA 2Z6BA 1Q42A 3LYGA 3V99A 2YX9A 4KVHA 1TFKA 3JUMA 4HM2B 1OGXA 1E3RA 2WOFA 3CNMA 4XBXA 3VGNA 3KIIA 1O7WB 3PZWA 1M9GA 4R9KA 2CFDA 1OUNA 3EE1A 1TIJA 4LGQA 4EV2A 3CCU3 2CWUA 4G1MB 2XF3A 3FSDA 3CD63 1NWWA 1CEWI 1SJWA 2HMLB 3EBYA 5EQLA 3T8NA 1FA3A 4TX4A 2O3OA 3N8BA 5JPPA 8CHOA 5FGOA 2XGNA 1D6UA 1SPUA 1JRQA 2P0MA 3UL5A 3F40A 3NM2A 2KRTA 3S5CA 1FGQA 3B7CA 3GZBA 1VQ63 3RGAA 1W01A 1GD4A 3BNDA 4FMBA 4IIAA 4XB5A 1O7MB 5BVBA 3FLJA 2M7OA 4LSOA 1VZZA 2FXTA 4N6LA 2RSXA 1M904 1RN7A 5AYSC 2W6JH 3UJMA 3DY5A 1N5PA 2D1WA 3EQQB 3PS8A 1W7CA 3CC73 4AKZA 4K61A 5FW5A 2BMOB 2P38A 1NU3A 2Z77A 4LEHA 3G4S3 1VQ83 4EC6A 2Z76A 3DUKA 2WGOA 4HM7B 1VQP3 2KXGA 3CCM3 3CPW2 7STDA 1ZO2A 5IG5A 1IV7A 3FCSB 2V1LA 3PCRA 2GEYA 3NUVA 4HM4B 1OGZA 1LNHA 1Q40B 1ROVA 5IG4A 3B4PA 1FGMA 2E2TA 3F7SA 2QA43 3OWYA 2E2VA 1PU4A 3JUPA 4O8SA 2XR8B 3I553 2IUKA 3CC43 2W9QA 1VQM3 1N8QA 3T8UA 2O9UX 2HMKB 3ECFA 1O7HB 2HMNB 4FCMA 2CW9A 2CG0A 2P0XA 1OPYA 3DZLA 3F14A 2FNQA 1Q40A 3HZPA 4FMCA 5IF6A 4WYKA 1CYVA 3F9SA 3TDGA 3MWZA 2D42A 3N54B 3PGBA 2RFRA 1JN5A 2ML5A 1JB4A 3SEDA 3K5TA 4N6TA 1KQS2 5BXQA 1QJGA 2I9WA 1QVF2 1WMOA 3WODG 4IPBA 5A0OB 5CF1A 3OWSA 1IVUA 1GY6A 2GU1A 1W2B2 2W56B 1O7NB 4XM4A 3UNLA 1MOLA 4EBGA 4RNYA 1AV4A 1JKGB 5CK6A 2YFLB 1IVVA 2QEX3 4U13A 4HZ9B 1K9M4 1NJI4 1JNQA 3NV0B 3V98A 2UX0A 4OVMA 3BNBA 1IQ8A 2CFKA 1FGOA 5CXOA 1N8R4 1VQL3 4X2HA 2XFSA 1VQ53 2W56A 5AIGA 2Q07A 2JDIH 3D3LA 1GY7A 1DVCA 3X40A 3FGYA 3U1WA 3CCS3 2E2UA 3NM7A 3EHCA 3EC9A 1E97A 4KZ1A 4XDVA 5DREA 1UUVB 1NO3A 1OACA 1IQXA 3BLZA 3G0KA 2HMJB 2XRXB 2RGQA 3NV0A 1Q824 1QVG2 3S28A 3Q90A 3H51A 1N9JA 5D82A 2IUJA 1HKXA 1UUWB 4GB5A 5AIHA 1OH0A 3DMCA 1PFPA 2BNGA 1YGEA 2C11A 3G16A 3PXMA 3V92A 2Y74A 4XDWA 1AVLA 4Q53A 1YHQ3 1C7HA 1GD3A 4N6OB 1CYUA 3IMAB 4H61A 3G713 1O7PB 3LZAA 3IJEB 3MHEA 3GRDA 3EX9A 4EYCA 3FG3A 4XBTA 2HMOB 3BNEA 2IA7A 4HM8B 3KSPA 1AVKA 3LMLA 4HVNA 1KWIA 4ZM8A 1M1XB 4J9AA 4N6MA 1W6YA 1ISKA 2XFTA 1WMNA 2BMRB 3OV4A 4LZIA 2IMJA 2W2CA 1YJW3 1K734 3EB8A 3LTAA 3HIGA 1QALA 3GZXB 4XBYA 3S67A 4AEQA 4PEJA 1OCVA 3JUOA 4MMYB 2XSHB 3A76A 1RRHA 4OUQA 2KCDA 4MJDA 3DGNA 4L8OA 4K90B 1UI8A 1YJ93 3KSED 3K0ZA 4JRFA 4RBNA 4HM5B 4ORLA 4FCJA 2HMMB 3E99A 1L5GB 3JVCA 4JF8A 3NQZA 4BTXA 2GBWB 3K9MC 4LMIA 3F8HA 2K54A 2QIYA 2Z7AA 2OTJ3 4H3UA 1VQ73 3LTDA 5IW9A 1S5AA 4FCZA 1US1A 2OOVA 3T0UA 2YFIB 3J7Yd 3BNCA 1IVXA 4HM0B 1W6GA 1FUWA 1SIIA 5KP3A 3QK9A 5ELUA 1YI23 3GZRA 5AIIA 1FGTA 1KSIA 3EF8A 1IT8A 3IPTA 4N6UA 3CC23 1N9EA 3DXOA 3FG4A 3NHXA 3HK4A 4BTYA 2OTL3 5G2GA 3AMOB 1GS3A 5I97A 1BUQA 1N5HA 1QAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EC6 A;  3UB1 A; 
#chains in the Genus database with same CATH topology
 1I70 A;  3UB1 A;  1UGH I;  2CFG A;  2IY2 A;  2XH9 A;  2L4V A;  3KZT A;  4EXR A;  2W0Q A;  3CCQ 3;  1MWS A;  1GYB A;  3CU3 A;  4R80 A;  1B2Z A;  3CCR 3;  1RGE A;  2CC3 A;  1RRL A;  5AIF A;  3KN4 A;  1UCI A;  3NBJ A;  3NX0 A;  4DKI A;  4WP5 A;  4R4K A;  1Q86 4;  7RNT A;  3SOA A;  3LTC A;  1JJ2 2;  1PYL A;  2B1X B;  3A5E A;  4J8T A;  1U8C B;  2XSO B;  3VF1 A;  1GOU A;  2KF3 A;  2OOV C;  1IDP A;  1W00 A;  2CK3 H;  2WGQ A;  3PYJ A;  1VQK 3;  4HM3 B;  2BT3 A;  3EN1 B;  3SX1 A;  2CFL A;  3ER7 A;  1IVW A;  3QRD A;  1BNF A;  2KF6 A;  2XGL A;  1RKY A;  1HZ1 A;  4J5K A;  1X1X A;  1W4N A;  1RGL A;  4CCV A;  5ELJ A;  5KP1 A;  1WQL B;  4FMA A;  4BL2 A;  3BB9 A;  5LC6 A;  4FMD A;  1LQM B;  5DRV A;  1BNJ A;  1IT7 A;  1JKG A;  3LT8 A;  2MF7 A;  5STD A;  2Y73 A;  3X3Y A;  1ROA A;  1DVD A;  1BSE A;  3LXU X;  1LVN A;  3WA2 X;  1AY7 A;  4EV5 A;  5HGR A;  1IV9 A;  3MPH A;  4HM1 B;  1WMP A;  1TRQ A;  3G8Z A;  4OK0 A;  1ULI B;  4HYZ A;  3OXA A;  1VQN 3;  4WWU C;  1LOW A;  2OQE A;  1S72 3;  1WTH A;  1STD A;  1YVB I;  3M8C A;  5CLK A;  5TGN A;  1BRS A;  3DGL A;  2CG1 A;  1I0V A;  1BRN L;  1IQY A;  2W9P A;  3GAX A;  1TFO A;  4KFE A;  4K1V A;  2W03 A;  1GOY A;  3DGM A;  3LH4 A;  3JUN A;  2CIU A;  1W5Z A;  2INX A;  2P05 A;  4GL6 A;  3MSO A;  1ULJ B;  2AAD A;  2RBI A;  4O3V A;  3ROB A;  4BU4 A;  5M19 A;  5AYR B;  3CNX A;  4X2O A;  1O7G B;  1D6Z A;  3CCV 3;  2OWP A;  1BNR A;  1BRJ A;  3NBB A;  1BSB A;  1B2S A;  1RMS A;  3AHW A;  1EA2 A;  2R4I A;  4HZB B;  1W02 A;  3HX8 A;  4HAA A;  1U5O A;  3AGN A;  4KFF A;  3WDG B;  3X3Z A;  1YIT 3;  2PNC A;  2UGI A;  3FKA A;  4J5G A;  1STF I;  3RGR A;  1KD1 4;  1LXE A;  3G6E 3;  3FF0 A;  3LT9 A;  1LOV A;  2F86 B;  1CQS A;  1AR0 A;  1MGR A;  3K63 A;  5D81 A;  1DMN A;  1BUJ A;  1D6Y A;  2CX1 A;  2LYX A;  1SQW A;  5KP4 A;  1YGW A;  5M18 A;  2RCD A;  1OF5 B;  3X42 A;  2SBL A;  1LOX A;  2BHM A;  3BIR A;  4WFO A;  1MGW A;  6GSP A;  1K8A 4;  4L8P A;  3OX9 A;  2BU4 A;  2H0I A;  2ZL8 A;  3EBT A;  3HOH A;  1R4Y A;  2OQE C;  3KFQ C;  3I0Y A;  3MG3 A;  4L7K A;  1K28 A;  2K0M A;  1A2V A;  1IU7 A;  3K7C A;  5IEO A;  1G96 A;  1OHP A;  1BU4 A;  1MNL A;  2WOH A;  1HU9 A;  1X1Y A;  1OF5 A;  5IEN A;  3SLU A;  2BO9 B;  1NB5 I;  1DYU A;  3WOF B;  1B3S A;  1UI7 A;  2A15 A;  1FA3 A;  4I4K A;  1A90 A;  3PCS A;  3BU4 A;  1QMA A;  4R9L A;  2GEX A;  1YJN 3;  4WHA A;  2LQV A;  1EQK A;  1JBT A;  4CJN A;  5CF2 A;  2KF4 A;  4FR9 A;  3WOE B;  1GY5 A;  1BRG A;  1T2H A;  1SAR A;  3RDE A;  1RHL A;  3FG1 A;  3KKG A;  1BOX A;  4IT7 A;  1I3F A;  3SXX A;  1DMQ A;  2CWV A;  5IEP A;  4STD A;  2CHC A;  4NPB A;  1DMM A;  3OWU A;  3SVA A;  3FF2 A;  1NB3 I;  2WO0 A;  4BTW A;  2OCT A;  1BGS A;  3FH1 A;  3HI7 A;  4R1K A;  4KFD A;  2AAE A;  3CCJ 3;  1V74 A;  3ALA A;  2GU3 A;  3JUQ A;  4O2H A;  1VQQ A;  1FW7 A;  1TU5 A;  2KAA A;  1ZX2 A;  1X1U A;  3H3H A;  5BIR A;  5IER A;  1RLS A;  3MKI A;  3CCL 3;  3NBR A;  4NRE A;  1TJD A;  5LC7 A;  3S27 A;  4WYK B;  2F56 A;  5AI1 A;  1KC8 4;  3GZY B;  4K1U A;  4RZM A;  1EUI C;  3SOY A;  1JN5 B;  2CKF B;  1JB5 A;  1Z1S A;  2PZV A;  1JZO A;  2JQ5 A;  3FZW A;  3Q2P A;  3F7X A;  3AMO A;  2CWT A;  3MG1 A;  3CXC 2;  2STD A;  4CPK A;  3CME 3;  3CCE 3;  3Q3F A;  1TP6 A;  1W6C A;  1E3V A;  2QA4 3;  1OHO A;  4HM6 B;  4HBR A;  1VQ4 3;  5D83 A;  1NDO B;  1Y4K A;  1FUS A;  3O8Y A;  4N6N B;  3DM8 A;  1X1W A;  3HII A;  1A2K A;  5BU4 A;  3WA3 A;  1I2F A;  1RJO A;  3N9H A;  2FGT A;  1BNI A;  5AEU B;  4MMZ B;  4MMX B;  3OW2 2;  2ZDJ A;  1JB2 A;  4N3V A;  3KE7 A;  3U97 A;  1VQ9 3;  2MC8 A;  4NHF A;  1T3B A;  2C10 A;  3X3X A;  2GXF A;  4MEI A;  6STD A;  1UW1 A;  1R4C A;  1ASK A;  1JV2 B;  1TUH A;  2CH9 A;  1UCJ A;  2BMQ B;  2CFW A;  4LYL B;  4QWT A;  5G1K A;  4N6V 0;  5JPU A;  3CMA 3;  1A67 A;  3MG2 A;  1F8N A;  3DH2 A;  4CDL A;  3Q1C A;  1EKM A;  3VSY A;  4BIR A;  3B8L A;  4RNT A;  3RNT A;  2J8X B;  2F98 A;  2ML6 A;  2XEP A;  3CPO A;  2YFJ B;  3WMD A;  3ZFZ A;  3EN8 A;  1T5Y A;  2CX0 A;  3GWR A;  1Q7Y 4;  3X41 A;  1EG9 B;  2F99 A;  1Q81 4;  5IG0 A;  3MYT A;  3NQY A;  1M1K 4;  1RN4 A;  1EEJ A;  1W2Z A;  1K41 A;  2C4B A;  2B24 B;  2K3D A;  1FGR A;  3D9R A;  3B4O A;  1SIH A;  3NXJ A;  1J2B A;  1QAK A;  1BVI A;  4RNZ A;  1Q9E A;  2QGU A;  5JBS A;  1B27 A;  2GBX B;  3DGO A;  3LTB A;  4BL3 A;  2P09 A;  3EJV A;  1IK3 A;  4HJL B;  1IYY A;  5AEW B;  5EVH A;  1YIJ 3;  2W04 A;  3F8X A;  4O02 B;  4AKY A;  3L0R A;  3STD A;  3I56 3;  4HKV B;  3S29 A;  1VQO 3;  1OHS A;  1Q7H A;  5EEO A;  3LOY A;  3UL6 A;  5IG3 A;  1WNH A;  2Z6B A;  1Q42 A;  3LYG A;  1GMP A;  3V99 A;  1RCL A;  2YX9 A;  4KVH A;  1TFK A;  3ZG5 A;  1B2U A;  3JUM A;  4HM2 B;  1RGG A;  1OGX A;  1E3R A;  2WOF A;  1RNT A;  3CNM A;  4XBX A;  3VGN A;  3KII A;  1O7W B;  3PZW A;  1M9G A;  2H0H A;  2SAR A;  4R9K A;  2CFD A;  1OUN A;  3EE1 A;  1TIJ A;  4LGQ A;  4EV2 A;  3CCU 3;  2CWU A;  1JZD A;  4G1M B;  5HOH A;  2XF3 A;  3FSD A;  1BNS A;  1NWW A;  1CEW I;  1SJW A;  2HML B;  3EBY A;  5EQL A;  3T8N A;  3CD6 3;  4TX4 A;  2O3O A;  3N8B A;  5JPP A;  1RGC A;  3KCH A;  1RGH A;  8CHO A;  5FGO A;  2XGN A;  1D6U A;  1SPU A;  1JRQ A;  2P0M A;  7GSP A;  3UL5 A;  3F40 A;  3NM2 A;  2KRT A;  3S5C A;  1FGQ A;  3B7C A;  3GZB A;  1B20 A;  1FUT A;  1RTU A;  3GSP A;  1RNB A;  1VQ6 3;  1RGF A;  3RGA A;  1W01 A;  1GD4 A;  1RDS A;  3BND A;  1UCL A;  4FMB A;  4IIA A;  4XB5 A;  1O7M B;  2H0G A;  5BVB A;  1V58 A;  3FLJ A;  2M7O A;  4LSO A;  1VZZ A;  1YNV X;  2FXT A;  4N6L A;  3ZG0 A;  2RSX A;  4GSP A;  1RN7 A;  5AYS C;  2W6J H;  3UJM A;  1M90 4;  2HOH A;  3DY5 A;  1N5P A;  2D1W A;  3EQQ B;  3PS8 A;  1W7C A;  3CC7 3;  4AKZ A;  5G1L A;  4K61 A;  5FW5 A;  2BMO B;  2P38 A;  1I2E A;  1NU3 A;  2Z77 A;  4LEH A;  3G4S 3;  1VQ8 3;  1GOV A;  4EC6 A;  2Z76 A;  3DUK A;  2WGO A;  2R41 A;  4HM7 B;  1VQP 3;  1UCK A;  2KXG A;  3CCM 3;  3CPW 2;  7STD A;  1ZO2 A;  5IG5 A;  1IV7 A;  3FCS B;  2V1L A;  3PCR A;  2GEY A;  3NUV A;  5GSP A;  4HM4 B;  1OGZ A;  1UUG B;  1LNH A;  1Q40 B;  1ROV A;  5IG4 A;  3B4P A;  1BSD A;  1FGM A;  2E2T A;  3D4A A;  3F7S A;  1I8V A;  3OWY A;  2E2V A;  2F5M A;  3JUP A;  4O8S A;  1PU4 A;  2F4Y A;  2XR8 B;  3I55 3;  1DE3 A;  2IUK A;  1LOY A;  2W9Q A;  1VQM 3;  1N8Q A;  3CC4 3;  3T8U A;  2O9U X;  3WHO A;  2HMK B;  3ECF A;  1BRH A;  1O7H B;  1UGI A;  2HMN B;  4FCM A;  2CW9 A;  1TTO A;  2ZHX B;  2CG0 A;  2P0X A;  1OPY A;  3DZL A;  3F14 A;  2FNQ A;  1Q40 A;  3HZP A;  1MWU A;  4FMC A;  5IF6 A;  1JBR A;  4WYK A;  1CYV A;  3F9S A;  3WR2 A;  3TDG A;  3MWZ A;  1G02 A;  2D42 A;  3N54 B;  3PGB A;  2L1S A;  2RFR A;  1JN5 A;  2ML5 A;  3D5G A;  1JB4 A;  3SED A;  3K5T A;  1BAO A;  4N6T A;  1KQS 2;  1C54 A;  5BXQ A;  1QJG A;  2I9W A;  3AGO A;  1QVF 2;  1WMO A;  3WOD G;  4IPB A;  5A0O B;  5CF1 A;  1BAN A;  1CH0 A;  1IVU A;  3OWS A;  1GY6 A;  2GU1 A;  5RNT A;  1W2B 2;  2W56 B;  1O7N B;  1BNE A;  4XM4 A;  3UNL A;  1MOL A;  4EBG A;  4RNY A;  1FYS A;  1AV4 A;  1JKG B;  1I2G A;  5CK6 A;  1GMR A;  2YFL B;  1IVV A;  2QEX 3;  4U13 A;  4HZ9 B;  1K9M 4;  1NJI 4;  1JNQ A;  3NV0 B;  3V98 A;  8RNT A;  1GMQ A;  1RGA A;  2UX0 A;  3BNB A;  1IQ8 A;  1FGO A;  2CFK A;  2ZA4 A;  4OVM A;  5CXO A;  1N8R 4;  1VQL 3;  4X2H A;  2XFS A;  1VQ5 3;  2BIR A;  2W56 A;  5AIG A;  3D79 A;  2Q07 A;  2JDI H;  3D3L A;  1GY7 A;  2RNT A;  1DVC A;  3X40 A;  1V57 A;  1B21 A;  3FGY A;  3U1W A;  2E2U A;  3NM7 A;  3CCS 3;  3EHC A;  3EC9 A;  1E97 A;  4KZ1 A;  4XDV A;  1GSP A;  2KF5 A;  5DRE A;  1UUV B;  1NO3 A;  1PY3 A;  1OAC A;  1ZGX A;  1IQX A;  3BLZ A;  3G0K A;  2HMJ B;  2XRX B;  2RGQ A;  3NV0 A;  4KT3 B;  1Q82 4;  1B2M A;  2IYJ A;  1QVG 2;  3S28 A;  3Q90 A;  3H51 A;  1N9J A;  4GHO A;  5D82 A;  2IUJ A;  1HKX A;  1UUW B;  4GB5 A;  5AIH A;  1OH0 A;  1BNG A;  1AQZ A;  1MWR A;  3DMC A;  1BRI A;  1PFP A;  1YGE A;  2BNG A;  2C11 A;  3G16 A;  3PXM A;  3V92 A;  2Y74 A;  4XDW A;  1TRP A;  9RNT A;  1BSC A;  1AVL A;  4Q53 A;  1YHQ 3;  1C7H A;  1GD3 A;  1LRA A;  4N6O B;  3IMA B;  1CYU A;  1HYF A;  4H61 A;  3G71 3;  1O7P B;  3LZA A;  3IJE B;  3MHE A;  3GRD A;  3EX9 A;  4EYC A;  3FG3 A;  4XBT A;  2HMO B;  3BNE A;  1RN1 A;  4HOH A;  2IA7 A;  4HM8 B;  3KSP A;  1AVK A;  3LML A;  4HVN A;  1KWI A;  1I0X A;  4ZM8 A;  3AHS A;  1B2X A;  1M1X B;  4J9A A;  4N6M A;  1W6Y A;  1ISK A;  1BSA A;  2XFT A;  1LQG C;  1WMN A;  2BMR B;  1T2I A;  3OV4 A;  4LZI A;  2IMJ A;  2W2C A;  6RNT A;  1YJW 3;  3EB8 A;  1FZU A;  3LTA A;  1K73 4;  1RSN A;  3HIG A;  1QAL A;  3GZX B;  4XBY A;  3URP A;  3S67 A;  4AEQ A;  4EW5 A;  4PEJ A;  2UUG C;  1OCV A;  3JUO A;  4MMY B;  2XSH B;  3A76 A;  1RRH A;  4OUQ A;  2KCD A;  4MJD A;  3DGN A;  4L8O A;  2F5W A;  4K90 B;  4I5Q A;  1UI8 A;  1YJ9 3;  3KSE D;  3K0Z A;  4JRF A;  4RBN A;  4ILF A;  1NNV A;  4HM5 B;  1RCK A;  4ORL A;  4FCJ A;  2HMM B;  1I3I A;  3E99 A;  3D5I A;  3JVC A;  4JF8 A;  1L5G B;  1YVS A;  1BRK A;  3NQZ A;  4BTX A;  2GBW B;  3K9M C;  4LMI A;  3F8H A;  1A2P A;  2K54 A;  2QIY A;  2Z7A A;  2OTJ 3;  4H3U A;  1VQ7 3;  3LTD A;  5IW9 A;  1S5A A;  4FCZ A;  1US1 A;  1UDI I;  2OOV A;  3T0U A;  2YFI B;  3J7Y d;  3BNC A;  1IVX A;  1G0T A;  1MWT A;  1W6G A;  4HM0 B;  1FUW A;  1SII A;  5KP3 A;  1JBS A;  3QK9 A;  5ELU A;  1YI2 3;  2GSP A;  3DGY A;  3GZR A;  3SYU A;  5AII A;  1BIR A;  5M1A A;  1RGK A;  1FGT A;  1KSI A;  1ZS7 A;  3EF8 A;  1IT8 A;  3IPT A;  4N6U A;  3CC2 3;  1N9E A;  3DXO A;  3FG4 A;  1DET A;  3NHX A;  3HK4 A;  4BTY A;  2OTL 3;  5G2G A;  3AMO B;  1GS3 A;  1LNI A;  5I97 A;  1BUQ A;  1N5H A;  1QAF A; 
#chains in the Genus database with same CATH homology
 3UB1 A;  2CFG A;  4EXR A;  2XH9 A;  2L4V A;  3KZT A;  3CCQ 3;  2W0Q A;  3CCR 3;  1GYB A;  3CU3 A;  4R80 A;  2CC3 A;  1RRL A;  5AIF A;  3KN4 A;  3NX0 A;  3NBJ A;  4WP5 A;  4R4K A;  1Q86 4;  3SOA A;  3LTC A;  1JJ2 2;  2B1X B;  4J8T A;  1U8C B;  2XSO B;  3VF1 A;  2OOV C;  1IDP A;  1W00 A;  2CK3 H;  2WGQ A;  3PYJ A;  1VQK 3;  4HM3 B;  2BT3 A;  3EN1 B;  3SX1 A;  2CFL A;  3ER7 A;  1IVW A;  3QRD A;  2XGL A;  1RKY A;  1W4N A;  5KP1 A;  4CCV A;  5ELJ A;  1WQL B;  4FMA A;  3BB9 A;  5LC6 A;  4FMD A;  5DRV A;  3X3Y A;  1IT7 A;  1JKG A;  3LT8 A;  2MF7 A;  5STD A;  2Y73 A;  1DVD A;  1ROA A;  3LXU X;  1LVN A;  3WA2 X;  4EV5 A;  5HGR A;  1IV9 A;  3MPH A;  4HM1 B;  1WMP A;  4OK0 A;  3G8Z A;  1ULI B;  4HYZ A;  3OXA A;  1VQN 3;  4WWU C;  2OQE A;  1S72 3;  1WTH A;  1STD A;  1YVB I;  3M8C A;  5CLK A;  5TGN A;  3DGL A;  2CG1 A;  1IQY A;  2W9P A;  3GAX A;  1TFO A;  4KFE A;  4K1V A;  2W03 A;  3DGM A;  3LH4 A;  3JUN A;  2CIU A;  1W5Z A;  2INX A;  2P05 A;  4GL6 A;  3MSO A;  1ULJ B;  4O3V A;  3ROB A;  5AYR B;  3CNX A;  4X2O A;  1O7G B;  1D6Z A;  3CCV 3;  2OWP A;  3NBB A;  1EA2 A;  2R4I A;  4HZB B;  1W02 A;  3HX8 A;  1U5O A;  4KFF A;  3WDG B;  3X3Z A;  1YIT 3;  2PNC A;  3FKA A;  1KD1 4;  1STF I;  3RGR A;  1LXE A;  3G6E 3;  3FF0 A;  3LT9 A;  2F86 B;  1CQS A;  1AR0 A;  3K63 A;  5D81 A;  1DMN A;  1D6Y A;  2LYX A;  1SQW A;  5KP4 A;  2RCD A;  1OF5 B;  3X42 A;  2SBL A;  1LOX A;  2BHM A;  4WFO A;  1K8A 4;  4L8P A;  3OX9 A;  3EBT A;  2ZL8 A;  2OQE C;  3KFQ C;  3I0Y A;  3MG3 A;  4L7K A;  1K28 A;  2K0M A;  1A2V A;  1IU7 A;  3K7C A;  5IEO A;  1G96 A;  1OHP A;  1MNL A;  2WOH A;  1HU9 A;  1OF5 A;  5IEN A;  3SLU A;  2BO9 B;  1DYU A;  3WOF B;  2A15 A;  1UI7 A;  4I4K A;  1A90 A;  3PCS A;  1QMA A;  4R9L A;  2GEX A;  1YJN 3;  4WHA A;  2LQV A;  1EQK A;  5CF2 A;  4FR9 A;  3WOE B;  1GY5 A;  3RDE A;  3FG1 A;  3KKG A;  4IT7 A;  3SXX A;  5IEP A;  1NB5 I;  1DMQ A;  2CWV A;  4STD A;  2CHC A;  1DMM A;  3OWU A;  3SVA A;  3FF2 A;  1NB3 I;  2WO0 A;  4BTW A;  2OCT A;  3FH1 A;  3HI7 A;  4R1K A;  4KFD A;  3CCJ 3;  1V74 A;  3ALA A;  2GU3 A;  3JUQ A;  4O2H A;  1TU5 A;  1ZX2 A;  3H3H A;  5IER A;  3MKI A;  3CCL 3;  3NBR A;  4NRE A;  5LC7 A;  3S27 A;  4WYK B;  5AI1 A;  1KC8 4;  3GZY B;  4K1U A;  4RZM A;  3SOY A;  1JN5 B;  2CKF B;  1JB5 A;  1Z1S A;  2PZV A;  2JQ5 A;  3FZW A;  3Q2P A;  3F7X A;  3AMO A;  2CWT A;  3MG1 A;  3CXC 2;  2STD A;  3CME 3;  3CCE 3;  1TP6 A;  1W6C A;  1E3V A;  1OHO A;  4HM6 B;  4HBR A;  1VQ4 3;  5D83 A;  1NDO B;  1Y4K A;  3O8Y A;  4N6N B;  3DM8 A;  3HII A;  1A2K A;  3WA3 A;  1RJO A;  3N9H A;  2FGT A;  5AEU B;  4MMZ B;  4MMX B;  3OW2 2;  2ZDJ A;  1JB2 A;  4N3V A;  3KE7 A;  3U97 A;  1VQ9 3;  2MC8 A;  4NHF A;  3X3X A;  2C10 A;  2GXF A;  4MEI A;  6STD A;  1UW1 A;  1R4C A;  1ASK A;  1JV2 B;  1TUH A;  2CH9 A;  2BMQ B;  2CFW A;  4QWT A;  3CMA 3;  4N6V 0;  5JPU A;  1A67 A;  3MG2 A;  1F8N A;  4CDL A;  3Q1C A;  1EKM A;  3VSY A;  3B8L A;  2F98 A;  2ML6 A;  2XEP A;  3CPO A;  2YFJ B;  3WMD A;  3EN8 A;  1T5Y A;  1Q7Y 4;  3GWR A;  3X41 A;  1EG9 B;  2F99 A;  1Q81 4;  5IG0 A;  3MYT A;  3NQY A;  1M1K 4;  1W2Z A;  1K41 A;  2B24 B;  3D9R A;  1FGR A;  3B4O A;  1SIH A;  3NXJ A;  1J2B A;  1QAK A;  4RNZ A;  2QGU A;  5JBS A;  2GBX B;  3DGO A;  3LTB A;  1IK3 A;  2P09 A;  3EJV A;  4HJL B;  5AEW B;  5EVH A;  1YIJ 3;  2W04 A;  3F8X A;  4O02 B;  4AKY A;  3L0R A;  3STD A;  3I56 3;  4HKV B;  3S29 A;  1VQO 3;  1OHS A;  5EEO A;  3LOY A;  3UL6 A;  5IG3 A;  1WNH A;  2Z6B A;  1Q42 A;  3LYG A;  3V99 A;  2YX9 A;  4KVH A;  1TFK A;  3JUM A;  4HM2 B;  1OGX A;  1E3R A;  2WOF A;  3CNM A;  4XBX A;  3VGN A;  3KII A;  1O7W B;  3PZW A;  1M9G A;  4R9K A;  2CFD A;  1OUN A;  3EE1 A;  1TIJ A;  4LGQ A;  4EV2 A;  3CCU 3;  2CWU A;  4G1M B;  2XF3 A;  3FSD A;  3CD6 3;  1NWW A;  1CEW I;  1SJW A;  2HML B;  3EBY A;  5EQL A;  3T8N A;  1FA3 A;  4TX4 A;  2O3O A;  3N8B A;  5JPP A;  8CHO A;  5FGO A;  2XGN A;  1D6U A;  1SPU A;  1JRQ A;  2P0M A;  3UL5 A;  3F40 A;  3NM2 A;  2KRT A;  3S5C A;  1FGQ A;  3B7C A;  3GZB A;  1VQ6 3;  3RGA A;  1W01 A;  1GD4 A;  3BND A;  4FMB A;  4IIA A;  4XB5 A;  1O7M B;  5BVB A;  3FLJ A;  2M7O A;  4LSO A;  1VZZ A;  2FXT A;  4N6L A;  2RSX A;  1M90 4;  1RN7 A;  5AYS C;  2W6J H;  3UJM A;  3DY5 A;  1N5P A;  2D1W A;  3EQQ B;  3PS8 A;  1W7C A;  3CC7 3;  4AKZ A;  4K61 A;  5FW5 A;  2BMO B;  2P38 A;  1NU3 A;  2Z77 A;  4LEH A;  3G4S 3;  1VQ8 3;  4EC6 A;  2Z76 A;  3DUK A;  2WGO A;  4HM7 B;  1VQP 3;  2KXG A;  3CCM 3;  3CPW 2;  7STD A;  1ZO2 A;  5IG5 A;  1IV7 A;  3FCS B;  2V1L A;  3PCR A;  2GEY A;  3NUV A;  4HM4 B;  1OGZ A;  1LNH A;  1Q40 B;  1ROV A;  5IG4 A;  3B4P A;  1FGM A;  2E2T A;  3F7S A;  2QA4 3;  3OWY A;  2E2V A;  1PU4 A;  3JUP A;  4O8S A;  2XR8 B;  3I55 3;  2IUK A;  3CC4 3;  2W9Q A;  1VQM 3;  1N8Q A;  3T8U A;  2O9U X;  2HMK B;  3ECF A;  1O7H B;  2HMN B;  4FCM A;  2CW9 A;  2CG0 A;  2P0X A;  1OPY A;  3DZL A;  3F14 A;  2FNQ A;  1Q40 A;  3HZP A;  4FMC A;  5IF6 A;  4WYK A;  1CYV A;  3F9S A;  3TDG A;  3MWZ A;  2D42 A;  3N54 B;  3PGB A;  2RFR A;  1JN5 A;  2ML5 A;  1JB4 A;  3SED A;  3K5T A;  4N6T A;  1KQS 2;  5BXQ A;  1QJG A;  2I9W A;  1QVF 2;  1WMO A;  3WOD G;  4IPB A;  5A0O B;  5CF1 A;  3OWS A;  1IVU A;  1GY6 A;  2GU1 A;  1W2B 2;  2W56 B;  1O7N B;  4XM4 A;  3UNL A;  1MOL A;  4EBG A;  4RNY A;  1AV4 A;  1JKG B;  5CK6 A;  2YFL B;  1IVV A;  2QEX 3;  4U13 A;  4HZ9 B;  1K9M 4;  1NJI 4;  1JNQ A;  3NV0 B;  3V98 A;  2UX0 A;  4OVM A;  3BNB A;  1IQ8 A;  2CFK A;  1FGO A;  5CXO A;  1N8R 4;  1VQL 3;  4X2H A;  2XFS A;  1VQ5 3;  2W56 A;  5AIG A;  2Q07 A;  2JDI H;  3D3L A;  1GY7 A;  1DVC A;  3X40 A;  3FGY A;  3U1W A;  3CCS 3;  2E2U A;  3NM7 A;  3EHC A;  3EC9 A;  1E97 A;  4KZ1 A;  4XDV A;  5DRE A;  1UUV B;  1NO3 A;  1OAC A;  1IQX A;  3BLZ A;  3G0K A;  2HMJ B;  2XRX B;  2RGQ A;  3NV0 A;  1Q82 4;  1QVG 2;  3S28 A;  3Q90 A;  3H51 A;  1N9J A;  5D82 A;  2IUJ A;  1HKX A;  1UUW B;  4GB5 A;  5AIH A;  1OH0 A;  3DMC A;  1PFP A;  2BNG A;  1YGE A;  2C11 A;  3G16 A;  3PXM A;  3V92 A;  2Y74 A;  4XDW A;  1AVL A;  4Q53 A;  1YHQ 3;  1C7H A;  1GD3 A;  4N6O B;  1CYU A;  3IMA B;  4H61 A;  3G71 3;  1O7P B;  3LZA A;  3IJE B;  3MHE A;  3GRD A;  3EX9 A;  4EYC A;  3FG3 A;  4XBT A;  2HMO B;  3BNE A;  2IA7 A;  4HM8 B;  3KSP A;  1AVK A;  3LML A;  4HVN A;  1KWI A;  4ZM8 A;  1M1X B;  4J9A A;  4N6M A;  1W6Y A;  1ISK A;  2XFT A;  1WMN A;  2BMR B;  3OV4 A;  4LZI A;  2IMJ A;  2W2C A;  1YJW 3;  1K73 4;  3EB8 A;  3LTA A;  3HIG A;  1QAL A;  3GZX B;  4XBY A;  3S67 A;  4AEQ A;  4PEJ A;  1OCV A;  3JUO A;  4MMY B;  2XSH B;  3A76 A;  1RRH A;  4OUQ A;  2KCD A;  4MJD A;  3DGN A;  4L8O A;  4K90 B;  1UI8 A;  1YJ9 3;  3KSE D;  3K0Z A;  4JRF A;  4RBN A;  4HM5 B;  4ORL A;  4FCJ A;  2HMM B;  3E99 A;  1L5G B;  3JVC A;  4JF8 A;  3NQZ A;  4BTX A;  2GBW B;  3K9M C;  4LMI A;  3F8H A;  2K54 A;  2QIY A;  2Z7A A;  2OTJ 3;  4H3U A;  1VQ7 3;  3LTD A;  5IW9 A;  1S5A A;  4FCZ A;  1US1 A;  2OOV A;  3T0U A;  2YFI B;  3J7Y d;  3BNC A;  1IVX A;  4HM0 B;  1W6G A;  1FUW A;  1SII A;  5KP3 A;  3QK9 A;  5ELU A;  1YI2 3;  3GZR A;  5AII A;  1FGT A;  1KSI A;  3EF8 A;  1IT8 A;  3IPT A;  4N6U A;  3CC2 3;  1N9E A;  3DXO A;  3FG4 A;  3NHX A;  3HK4 A;  4BTY A;  2OTL 3;  5G2G A;  3AMO B;  1GS3 A;  5I97 A;  1BUQ A;  1N5H A;  1QAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...