4EC6A

Ntf2-like, potential transfer protein tram from gram-positive conjugative plasmid pip501
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
109
structure length
109
Chain Sequence
SQSKIDTFGRYFLTYYFSQEKNQENYQSSLRTYVSEKVDISDWKALGKTLKSVNYYGSEQTKKGYSVEYLLNVSVDNRSKMQKITFEVEPTKNGFLVTTQPKLTDFSFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative uncharacterized protein
publication title The 2.5 A Structure of the Enterococcus Conjugation Protein TraM resembles VirB8 Type IV Secretion Proteins.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Unknown function
total genus 23
structure length 109
sequence length 109
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-03-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.540 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4ec6A00
3UB1A 4EC6A
chains in the Genus database with same CATH superfamily
1M1XB 1U8CB 2IA7A 1CH0A 4LGQA 3NBBA 1BSCA 1PFPA 1VQ73 4J5KA 5TGNA 4N6LA 3A5EA 2C11A 2F86B 3CU3A 1BSDA 3HIIA 1N8R4 3F8XA 1BUQA 1V58A 4HKVB 3CCR3 4FMDA 3UNLA 2MF7A 1NDOB 1VZZA 3JUMA 4O3VA 4WHAA 2OQEA 3SYUA 1E97A 3ZFZA 4O2HA 2D1WA 1UGIA 2KRTA 3CCM3 1JB2A 3FSDA 2XRXB 5LC7A 3JUNA 1Q9EA 1FZUA 4HM1B 4HM4B 3S27A 1IYYA 3MYTA 4K1VA 3LTBA 3FG1A 3EC9A 1Q824 3PZWA 1US1A 2B1XB 5IW9A 2F56A 1RN1A 1RGGA 1UW1A 1RHLA 3FG4A 4N6UA 1YHQ3 3ALAA 1K41A 2GU3A 4KFFA 4J9AA 4BTWA 1SARA 3DGLA 1GY6A 2W0QA 3SXXA 5G2GA 3EBTA 3DGNA 4J8TA 4XM4A 3EHCA 6STDA 1EG9B 2BMQB 1RCKA 1GD3A 3DGYA 3EX9A 1RNBA 1W6CA 1NO3A 1IDPA 4NREA 5IG5A 3CPW2 3RGRA 2BO9B 3DXOA 2KF5A 1UCKA 2ZA4A 5IENA 1B2SA 1LNIA 4HJLB 3UB1A 2Z7AA 2ZL8A 3IMAB 4EV2A 1RN7A 2CWUA 4FCMA 5DREA 5D81A 1X1UA 3SOYA 1Q814 1VQ83 1JNQA 1SIIA 3H51A 3PXMA 1RGFA 4OVMA 1C7HA 3HIGA 2W56B 4TX4A 3AGOA 3KN4A 3CCS3 1LXEA 1BUJA 2W2CA 3MSOA 3X42A 1JBRA 1E3RA 3X3XA 1W5ZA 4GL6A 5CK6A 1B3SA 1BAOA 4CPKA 3OXAA 1JB5A 1OHSA 1RGAA 2W56A 3G8ZA 4BTXA 1W6GA 1VQ93 3HOHA 3M8CA 1O7WB 1GMPA 1BVIA 4LYLB 1RTUA 3RDEA 1A67A 8RNTA 5HGRA 1BRNL 4HYZA 4BL2A 1G02A 1QALA 1UI7A 2YFLB 4RNYA 1Q7Y4 1I3IA 3ZG0A 1K8A4 1B20A 2SBLA 3CCV3 3CMA3 4DKIA 1MOLA 2E2VA 1W7CA 3Q3FA 1UUVB 2K54A 4OK0A 3EJVA 3GZRA 3WOFB 1RMSA 5BVBA 1B27A 2W9PA 3F7SA 3KZTA 3OWSA 3SVAA 3GSPA 3L0RA 2BIRA 2W9QA 3F9SA 1JRQA 3PCSA 1OHOA 4L8PA 5GSPA 1I0VA 1JV2B 3U97A 3WA3A 2JQ5A 2OQEC 2CKFB 1WMPA 1VQ63 2CX0A 5IERA 1T3BA 1EUIC 1HU9A 1I3FA 1IK3A 1B2MA 3EF8A 1W02A 5M19A 1OH0A 3AHWA 4XBXA 1ISKA 7GSPA 2STDA 4BTYA 1FUTA 3V99A 2F5MA 3AGNA 1JJ22 1L5GB 4FMBA 1YJN3 1GSPA 3GRDA 1O7HB 2YFJB 2ZHXB 2WOHA 1UDII 2FNQA 5ELJA 2Y73A 1QAKA 5KP1A 1GD4A 1BNFA 2QEX3 3BNDA 4BL3A 1IVWA 4HAAA 2AAEA 7RNTA 1EKMA 1HKXA 1W4NA 4FMCA 4O02B 4JF8A 1G96A 1PYLA 4XDWA 1FGMA 4H61A 2XSOB 3ECFA 4MJDA 1BNJA 2YX9A 2RNTA 1BSBA 5JPUA 1A90A 1QAFA 3NM7A 1D6UA 3STDA 1VQ53 1BANA 2IUKA 4L8OA 2Z6BA 4IT7A 1OCVA 1GOVA 3DGOA 3EN1B 2IMJA 3NXJA 2F98A 4K1UA 2CG1A 2JDIH 1MNLA 3CNMA 2GEYA 1RGKA 3H3HA 1TUHA 2GXFA 1GY5A 2CC3A 3D9RA 2W03A 2AADA 4AEQA 5BIRA 1RKYA 1N8QA 4N6OB 2P09A 5HOHA 1YVBI 1YGEA 1FYSA 1IVVA 2BMRB 4FCJA 1GMQA 3CCL3 3LXUX 1W01A 2J8XB 1SQWA 3DZLA 1OGXA 4I5QA 4LSOA 2XH9A 3X3YA 3ER7A 1STDA 1UCLA 5CXOA 3BIRA 2BU4A 5G1LA 2GEXA 1W6YA 4AKZA 5IF6A 3CC23 2OTL3 1AY7A 2CH9A 3F40A 3KFQC 1MWTA 3KKGA 4N6NB 3S28A 1MWUA 1V57A 3DH2A 4BU4A 4EYCA 2QA43 2OOVC 1FGOA 3EN8A 3Q90A 4GHOA 1I2GA 2CW9A 5IEPA 4EXRA 5AEWB 1A2VA 2FXTA 3QRDA 4R9KA 3N54B 3MPHA 1I2EA 3NM2A 3EE1A 1YGWA 3MG1A 1ZS7A 4K61A 4R80A 9RNTA 1QVG2 1WTHA 1GOUA 3PCRA 4HM0B 5A0OB 4FR9A 3LT9A 1OHPA 4QWTA 1K734 1LQGC 3BLZA 1IQ8A 1OF5B 3NBJA 5ELUA 1CQSA 6RNTA 1K9M4 2UX0A 1CYUA 3K9MC 1BNSA 2F99A 3SLUA 3WOEB 3MHEA 1Q7HA 1UUWB 1D6YA 1AR0A 1M904 2OTJ3 4HVNA 4HM6B 1OF5A 1LRAA 4KFDA 4WWUC 5IG3A 3CCE3 3N8BA 3LMLA 4XDVA 2BNGA 2Z77A 1DYUA 1NU3A 1TP6A 1BGSA 2R41A 5CF2A 3EB8A 3A76A 4R9LA 4NHFA 5KP4A 1F8NA 2E2TA 1NB3I 2FGTA 2XFTA 2CWVA 3KSPA 5RNTA 1JBTA 3F7XA 3OWUA 1BNEA 2CG0A 5AI1A 2V1LA 3VF1A 4XBYA 4HM3B 4RBNA 2WO0A 4LMIA 1RCLA 2GU1A 4MMYB 2F4YA 4AKYA 1BSAA 1YJ93 1O7NB 4R4KA 1R4CA 1VQP3 1FGTA 4N6V0 5M1AA 2IY2A 1UGHI 1DVDA 2K0MA 4HOHA 5FGOA 3LTAA 5KP3A 1A2KA 1E3VA 1HZ1A 2OOVA 2RGQA 3KIIA 1I2FA 3BB9A 2HMJB 3UJMA 1DVCA 4EV5A 1TFKA 2KXGA 3T8NA 4XBTA 3TDGA 3BNEA 2RCDA 3CME3 1BRSA 3JUPA 5IG4A 3FF0A 1U5OA 4BIRA 1RGCA 3NQYA 1I70A 3OX9A 2CHCA 4N3VA 5CF1A 2ML6A 1IVUA 1JKGB 2PZVA 3D5IA 2W04A 3LZAA 1RGEA 2BHMA 2KF3A 5LC6A 1ROVA 1UCIA 5JBSA 3QK9A 1YJW3 2CX1A 3FH1A 1IU7A 1RLSA 5D82A 3B4PA 4LZIA 4NPBA 4HM2B 1DETA 2KF6A 2KCDA 4R1KA 6GSPA 1M9GA 2IUJA 2LQVA 1JKGA 4LEHA 3CCJ3 1VQQA 1ZX2A 1DE3A 3JUQA 1RNTA 1ZO2A 1AQZA 4RNZA 1UI8A 1LNHA 2UUGC 3UL5A 8CHOA 3KSED 3V92A 1S5AA 5I97A 2CFWA 2BMOB 3G713 3Q1CA 1RRLA 2L4VA 3K7CA 1A2PA 1RGHA 1FA3A 3PYJA 1NJI4 1S723 1KC84 1B2ZA 3NX0A 2Q07A 1ULJB 1O7PB 1LOVA 1BRGA 2CFKA 2HMKB 1IT8A 1WNHA 3RNTA 3K63A 3CCU3 1DMQA 1Q42A 1YVSA 4FCZA 1RSNA 1IV7A 4KT3B 4KZ1A 1RRHA 3RGAA 1D6ZA 1YI23 1WMOA 1RJOA 3WA2X 4PEJA 3LH4A 3NBRA 1I0XA 1O7GB 3F14A 5D83A 3S67A 1VQ43 1IQXA 2BT3A 3CC73 2CFDA 2E2UA 2UGIA 4GSPA 1N9EA 3U1WA 1JN5B 2XEPA 1GYBA 3WDGB 2B24B 2WGQA 1Q40B 2HMNB 5AYSC 2P0XA 1W2B2 1KQS2 2O9UX 2CWTA 1RN4A 1OUNA 3AHSA 1BNRA 4ZM8A 1AVKA 1ROAA 1JN5A 4WFOA 1B2UA 3FLJA 2D42A 3OW22 2ZDJA 4JRFA 1Q40A 1G0TA 3X40A 3SX1A 1N9JA 1TRPA 3GZYB 1W2ZA 5AIFA 5G1KA 2P38A 1T2HA 3JVCA 3WHOA 5BXQA 1DMMA 1Z1SA 2W6JH 3MG3A 3EBYA 4Q53A 3KCHA 3OV4A 4X2OA 3DMCA 3CNXA 1EEJA 1NB5I 3WR2A 2MC8A 2I9WA 3GZXB 3LYGA 1BRJA 1TIJA 4N6TA 3SOAA 3URPA 1LOXA 1WQLB 2F5WA 1CEWI 4L7KA 3NQZA 3FZWA 1ZGXA 3GWRA 3K0ZA 4IPBA 1VQM3 1FUSA 5AIHA 2XR8B 4WYKB 3CPOA 3T8UA 5DRVA 3O8YA 4MEIA 1JB4A 3E99A 2LYXA 3FGYA 5AIIA 3DM8A 2XGNA 3MKIA 1PY3A 1AV4A 3I563 1X1WA 2XF3A 1J2BA 4J5GA 3ZG5A 1DMNA 4GB5A 4CCVA 3G4S3 2H0IA 2WGOA 2OCTA 1ULIB 1KSIA 4WYKA 5M18A 1Y4KA 3ROBA 3SEDA 2O3OA 1RGLA 3LTCA 1TRQA 1OACA 1FGQA 3IJEB 4CDLA 1LQMB 1BNGA 2Z76A 3I0YA 2HOHA 1BSEA 4CJNA 1C54A 3MG2A 1LVNA 3FG3A 1TTOA 5EVHA 1IV9A 1FGRA 4HM5B 1LOWA 3JUOA 1BRKA 2ML5A 1JZOA 1GS3A 3D3LA 3OWYA 1JZDA 3BNBA 2KAAA 1GY7A 4I4KA 1TJDA 3LTDA 2HMMB 1UUGB 3NUVA 1MWSA 4EW5A 4ILFA 3LOYA 1NNVA 1VQN3 3S5CA 1IQYA 5IG0A 1I8VA 3FCSB 1IVXA 3D79A 1BOXA 3EQQB 3KE7A 2CFLA 3HZPA 4HM8B 1YIT3 1EQKA 1MGRA 1SIHA 1B21A 3G0KA 5FW5A 2CIUA 1OPYA 2KF4A 2HMLB 1BRHA 3V98A 2GBWB 2RSXA 3DY5A 1QJGA 3K5TA 2P05A 2XFSA 3HK4A 3PS8A 3Q2PA 4STDA 3B4OA 3VSYA 3VGNA 1O7MB 4N6MA 1MWRA 3BNCA 1BRIA 1FUWA 1W00A 4HZBB 1SJWA 4OUQA 2CK3H 3G16A 1BNIA 1FW7A 2H0GA 3S29A 1KD14 3B8LA 1VQL3 3F8HA 4RNTA 1X1YA 2L1SA 2YFIB 4FMAA 2Y74A 1OGZA 4KVHA 4ORLA 3D4AA 1PU4A 1UCJA 1MGWA 5STDA 3HI7A 1BU4A 4H3UA 1TU5A 1KWIA 1QVF2 3WMDA 4WP5A 1YNVX 3J7Yd 2K3DA 2SARA 3FKAA 1VQO3 4EBGA 1B2XA 2QGUA 3MWZA 1QMAA 4MMXB 1GMRA 3B7CA 5JPPA 3G6E3 2XGLA 3CC43 1N5HA 5AIGA 5BU4A 3CD63 4O8SA 3IPTA 4RZMA 4U13A 1N5PA 3D5GA 2IYJA 2P0MA 1HYFA 5IEOA 4EC6A 2RBIA 4HZ9B 2XSHB 5AEUB 3I553 4MMZB 2C4BA 3UL6A 1BIRA 2R4IA 3X3ZA 3BU4A 3X41A 2RFRA 3NV0B 1EA2A 1TFOA 2GSPA 1M1K4 2H0HA 1V74A 1JBSA 1Q864 3AMOB 1WMNA 3N9HA 2A15A 2C10A 2OWPA 2PNCA 3FF2A 5EEOA 3GAXA 1YIJ3 3T0UA 1STFI 3LT8A 4KFEA 3PGBA 2CFGA 4XB5A 1NWWA 2INXA 2HMOB 3DUKA 2M7OA 7STDA 1X1XA 2GBXB 2QIYA 4IIAA 3NV0A 3CXC2 1CYVA 1LOYA 3AMOA 1RDSA 1R4YA 1GOYA 1ASKA 5AYRB 3DGMA 1T5YA 5CLKA 4K90B 4G1MB 4X2HA 1VQK3 3NHXA 3HX8A 3WODG 1K28A 1IT7A 1AVLA 4HM7B 5EQLA 4HBRA 1T2IA 1SPUA 3CCQ3 2WOFA 3GZBA
chains in the Genus database with same CATH topology
1M1XB 1U8CB 2IA7A 4LGQA 3NBBA 1PFPA 1VQ73 5TGNA 4N6LA 3CU3A 2C11A 2F86B 3HIIA 1N8R4 1BUQA 3F8XA 4HKVB 3CCR3 4FMDA 3UNLA 2MF7A 1NDOB 1VZZA 3JUMA 4O3VA 4WHAA 2OQEA 1E97A 4O2HA 2D1WA 2KRTA 3CCM3 1JB2A 3FSDA 2XRXB 5LC7A 3JUNA 4HM4B 4HM1B 3S27A 3MYTA 4K1VA 3LTBA 3FG1A 3EC9A 1Q824 3PZWA 1US1A 2B1XB 5IW9A 1UW1A 3FG4A 4N6UA 1YHQ3 3ALAA 1K41A 2GU3A 4KFFA 4J9AA 4BTWA 3DGLA 1GY6A 2W0QA 3SXXA 5G2GA 3EBTA 3DGNA 4J8TA 4XM4A 3EHCA 6STDA 1EG9B 2BMQB 1GD3A 3EX9A 1W6CA 1NO3A 1IDPA 4NREA 5IG5A 3CPW2 3RGRA 2BO9B 3DXOA 5IENA 4HJLB 3UB1A 2Z7AA 2ZL8A 3IMAB 4EV2A 1RN7A 2CWUA 4FCMA 5DREA 5D81A 3SOYA 1Q814 1VQ83 1JNQA 1SIIA 3H51A 3PXMA 4OVMA 1C7HA 3HIGA 2W56B 4TX4A 3KN4A 3CCS3 1LXEA 2W2CA 3MSOA 3X42A 1E3RA 3X3XA 1W5ZA 4GL6A 5CK6A 3OXAA 1JB5A 1OHSA 2W56A 3G8ZA 4BTXA 1VQ93 1W6GA 3M8CA 1O7WB 3RDEA 1A67A 5HGRA 4HYZA 4RNYA 1QALA 1UI7A 2YFLB 1Q7Y4 1K8A4 2SBLA 3CCV3 3CMA3 1MOLA 2E2VA 1W7CA 4OK0A 1UUVB 2K54A 3EJVA 3GZRA 3WOFB 5BVBA 2W9PA 3F7SA 3KZTA 3OWSA 3SVAA 3L0RA 2W9QA 3F9SA 1JRQA 3PCSA 1OHOA 4L8PA 1JV2B 3U97A 3WA3A 2JQ5A 2OQEC 2CKFB 1WMPA 1VQ63 5IERA 1HU9A 1IK3A 3EF8A 1W02A 1ISKA 1OH0A 4XBXA 2STDA 4BTYA 3V99A 1JJ22 1L5GB 4FMBA 1YJN3 3GRDA 1O7HB 2YFJB 2WOHA 2FNQA 5ELJA 2Y73A 1QAKA 5KP1A 1GD4A 2QEX3 3BNDA 1IVWA 1EKMA 1HKXA 1W4NA 4FMCA 4O02B 4JF8A 1G96A 4XDWA 1FGMA 4H61A 2XSOB 3ECFA 4MJDA 2YX9A 5JPUA 1A90A 1QAFA 3NM7A 1D6UA 3STDA 1VQ53 2IUKA 4L8OA 2Z6BA 4IT7A 1OCVA 3DGOA 3EN1B 2IMJA 3NXJA 2F98A 4K1UA 2CG1A 2JDIH 1MNLA 3CNMA 2GEYA 3H3HA 1TUHA 2GXFA 1GY5A 2CC3A 3D9RA 2W03A 4AEQA 1RKYA 1N8QA 4N6OB 2P09A 1YVBI 1YGEA 1IVVA 2BMRB 4FCJA 3CCL3 3LXUX 1W01A 1SQWA 3DZLA 1OGXA 4LSOA 2XH9A 3X3YA 3ER7A 1STDA 5CXOA 2GEXA 1W6YA 4AKZA 5IF6A 3CC23 2OTL3 2CH9A 3F40A 3KFQC 3KKGA 4N6NB 3S28A 2QA43 4EYCA 2OOVC 1FGOA 3EN8A 3Q90A 5IEPA 2CW9A 4EXRA 5AEWB 1A2VA 2FXTA 3QRDA 4R9KA 3N54B 3MPHA 3NM2A 4K61A 3EE1A 4XBTA 3MG1A 4R80A 1QVG2 1WTHA 3PCRA 4HM0B 5A0OB 4FR9A 3LT9A 1OHPA 4QWTA 1K734 3BLZA 5ELUA 1IQ8A 1OF5B 3NBJA 1K9M4 1CQSA 2UX0A 1CYUA 3K9MC 3SLUA 2F99A 3WOEB 3MHEA 1UUWB 1D6YA 1AR0A 1M904 2OTJ3 4HVNA 4HM6B 1OF5A 4KFDA 4WWUC 5IG3A 3CCE3 3N8BA 3LMLA 4XDVA 2BNGA 2Z77A 1DYUA 1NU3A 1TP6A 5CF2A 3EB8A 3A76A 4R9LA 4NHFA 5KP4A 1F8NA 2E2TA 1NB3I 2FGTA 2XFTA 2CWVA 3KSPA 3F7XA 3OWUA 2CG0A 5AI1A 2V1LA 3VF1A 4XBYA 4HM3B 4RBNA 2WO0A 4LMIA 4MMYB 2GU1A 4AKYA 1YJ93 1O7NB 4R4KA 1R4CA 1VQP3 1FGTA 4N6V0 1DVDA 2K0MA 5FGOA 3LTAA 5KP3A 1A2KA 1E3VA 2OOVA 2RGQA 3KIIA 3BB9A 2HMJB 3UJMA 1DVCA 4EV5A 1TFKA 2KXGA 3T8NA 3TDGA 3CME3 3BNEA 2RCDA 3JUPA 5IG4A 3FF0A 1U5OA 5CF1A 3NQYA 3OX9A 2CHCA 4N3VA 2ML6A 1IVUA 1JKGB 2PZVA 3LZAA 2W04A 2BHMA 5LC6A 1ROVA 5JBSA 3QK9A 1YJW3 3FH1A 1IU7A 5D82A 3B4PA 4LZIA 4HM2B 2KCDA 4R1KA 1M9GA 2IUJA 2LQVA 1JKGA 4LEHA 3CCJ3 1ZX2A 3JUQA 1ZO2A 4RNZA 1UI8A 1LNHA 3UL5A 8CHOA 3KSED 3V92A 1S5AA 5I97A 2CFWA 2BMOB 3G713 3Q1CA 1RRLA 2L4VA 3K7CA 1FA3A 3PYJA 1NJI4 1S723 1KC84 3NX0A 2Q07A 1ULJB 1O7PB 2CFKA 2HMKB 1IT8A 1WNHA 3K63A 3CCU3 1DMQA 1Q42A 4FCZA 1IV7A 4KZ1A 3RGAA 1RRHA 1D6ZA 1YI23 1WMOA 1RJOA 3WA2X 4PEJA 3LH4A 3NBRA 3F14A 1O7GB 5D83A 3S67A 1VQ43 1IQXA 2BT3A 3CC73 2CFDA 2E2UA 3U1WA 1N9EA 1JN5B 2XEPA 1GYBA 3WDGB 2B24B 2WGQA 1Q40B 2HMNB 5AYSC 2P0XA 1W2B2 1KQS2 2O9UX 2CWTA 1OUNA 4ZM8A 1AVKA 1ROAA 1JN5A 4WFOA 3FLJA 2D42A 3OW22 2ZDJA 4JRFA 1Q40A 3X40A 3SX1A 1N9JA 3GZYB 5AIFA 1W2ZA 2P38A 3JVCA 5BXQA 1DMMA 1Z1SA 2W6JH 3MG3A 3EBYA 4Q53A 3OV4A 4X2OA 3DMCA 3CNXA 1NB5I 2MC8A 2I9WA 3GZXB 3LYGA 1TIJA 4N6TA 3SOAA 1LOXA 1WQLB 1CEWI 4L7KA 3NQZA 3FZWA 3GWRA 3K0ZA 4IPBA 1VQM3 5AIHA 2XR8B 4WYKB 3CPOA 3T8UA 5DRVA 3O8YA 4MEIA 1JB4A 3E99A 2LYXA 3FGYA 5AIIA 3DM8A 2XGNA 3MKIA 1AV4A 3I563 1J2BA 2XF3A 1DMNA 4GB5A 4CCVA 3G4S3 2WGOA 2OCTA 1ULIB 1KSIA 4WYKA 1Y4KA 3ROBA 3SEDA 2O3OA 3LTCA 1OACA 1FGQA 3IJEB 4CDLA 2Z76A 3I0YA 3MG2A 1LVNA 3FG3A 5EVHA 1IV9A 1FGRA 4HM5B 3JUOA 2ML5A 1GS3A 3D3LA 3OWYA 3BNBA 4I4KA 1GY7A 3LTDA 2HMMB 3NUVA 3LOYA 1VQN3 3S5CA 1IQYA 5IG0A 3FCSB 1IVXA 3KE7A 3EQQB 2CFLA 3HZPA 4HM8B 1YIT3 1EQKA 1SIHA 3G0KA 5FW5A 2CIUA 1OPYA 2HMLB 3V98A 2GBWB 2RSXA 3DY5A 1QJGA 3K5TA 2P05A 2XFSA 3HK4A 3PS8A 3Q2PA 4STDA 3B4OA 3VSYA 3VGNA 1O7MB 4N6MA 3BNCA 1FUWA 1W00A 4HZBB 1SJWA 4OUQA 2CK3H 3G16A 3S29A 1KD14 3B8LA 1VQL3 3F8HA 2YFIB 4FMAA 2Y74A 1OGZA 4KVHA 4ORLA 1PU4A 5STDA 3HI7A 4H3UA 1TU5A 1KWIA 1QVF2 3WMDA 4WP5A 3J7Yd 3FKAA 1VQO3 4EBGA 3G6E3 2QGUA 3MWZA 1QMAA 4MMXB 3B7CA 5JPPA 2XGLA 3CC43 1N5HA 5AIGA 3CD63 4O8SA 3IPTA 4RZMA 4U13A 1N5PA 5AEUB 2P0MA 5IEOA 4EC6A 4HZ9B 2XSHB 3I553 4MMZB 3UL6A 2R4IA 3X3ZA 3X41A 2RFRA 3NV0B 1EA2A 1TFOA 1M1K4 1V74A 1Q864 3AMOB 1WMNA 3N9HA 2A15A 2C10A 2OWPA 2PNCA 3FF2A 5EEOA 3GAXA 1YIJ3 3T0UA 1STFI 3LT8A 4KFEA 3PGBA 2CFGA 4XB5A 1NWWA 2INXA 2HMOB 3DUKA 2M7OA 7STDA 2QIYA 2GBXB 4IIAA 3NV0A 3CXC2 1CYVA 3AMOA 5AYRB 1ASKA 3DGMA 1T5YA 5CLKA 4K90B 4G1MB 4X2HA 1VQK3 3NHXA 3HX8A 3WODG 1K28A 1IT7A 1AVLA 4HM7B 5EQLA 4HBRA 1SPUA 3CCQ3 2WOFA 3GZBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UB1 A;  4EC6 A; 
#chains in the Genus database with same CATH topology
 1M1X B;  1U8C B;  2IA7 A;  1CH0 A;  4LGQ A;  3NBB A;  1BSC A;  1PFP A;  1VQ7 3;  4J5K A;  5TGN A;  4N6L A;  3A5E A;  2C11 A;  2F86 B;  3CU3 A;  1BSD A;  3HII A;  1N8R 4;  3F8X A;  1BUQ A;  1V58 A;  4HKV B;  3CCR 3;  4FMD A;  3UNL A;  2MF7 A;  1NDO B;  1VZZ A;  3JUM A;  4O3V A;  4WHA A;  2OQE A;  3SYU A;  1E97 A;  3ZFZ A;  4O2H A;  2D1W A;  1UGI A;  2KRT A;  3CCM 3;  1JB2 A;  3FSD A;  2XRX B;  5LC7 A;  3JUN A;  1Q9E A;  1FZU A;  4HM1 B;  4HM4 B;  3S27 A;  1IYY A;  3MYT A;  4K1V A;  3LTB A;  3FG1 A;  3EC9 A;  1Q82 4;  3PZW A;  1US1 A;  2B1X B;  5IW9 A;  2F56 A;  1RN1 A;  1RGG A;  1UW1 A;  1RHL A;  3FG4 A;  4N6U A;  1YHQ 3;  3ALA A;  1K41 A;  2GU3 A;  4KFF A;  4J9A A;  4BTW A;  1SAR A;  3DGL A;  1GY6 A;  2W0Q A;  3SXX A;  5G2G A;  3EBT A;  3DGN A;  4J8T A;  4XM4 A;  3EHC A;  6STD A;  1EG9 B;  2BMQ B;  1RCK A;  1GD3 A;  3DGY A;  3EX9 A;  1RNB A;  1W6C A;  1NO3 A;  1IDP A;  4NRE A;  5IG5 A;  3CPW 2;  3RGR A;  2BO9 B;  3DXO A;  2KF5 A;  1UCK A;  2ZA4 A;  5IEN A;  1B2S A;  1LNI A;  4HJL B;  3UB1 A;  2Z7A A;  2ZL8 A;  3IMA B;  4EV2 A;  1RN7 A;  2CWU A;  4FCM A;  5DRE A;  5D81 A;  1X1U A;  3SOY A;  1Q81 4;  1VQ8 3;  1JNQ A;  1SII A;  3H51 A;  3PXM A;  1RGF A;  4OVM A;  1C7H A;  3HIG A;  2W56 B;  4TX4 A;  3AGO A;  3KN4 A;  3CCS 3;  1LXE A;  1BUJ A;  2W2C A;  3MSO A;  3X42 A;  1JBR A;  1E3R A;  3X3X A;  1W5Z A;  4GL6 A;  5CK6 A;  1B3S A;  1BAO A;  4CPK A;  3OXA A;  1JB5 A;  1OHS A;  1RGA A;  2W56 A;  3G8Z A;  4BTX A;  1W6G A;  1VQ9 3;  3HOH A;  3M8C A;  1O7W B;  1GMP A;  1BVI A;  4LYL B;  1RTU A;  3RDE A;  1A67 A;  8RNT A;  5HGR A;  1BRN L;  4HYZ A;  4BL2 A;  1G02 A;  1QAL A;  1UI7 A;  2YFL B;  4RNY A;  1Q7Y 4;  1I3I A;  3ZG0 A;  1K8A 4;  1B20 A;  2SBL A;  3CCV 3;  3CMA 3;  4DKI A;  1MOL A;  2E2V A;  1W7C A;  3Q3F A;  1UUV B;  2K54 A;  4OK0 A;  3EJV A;  3GZR A;  3WOF B;  1RMS A;  5BVB A;  1B27 A;  2W9P A;  3F7S A;  3KZT A;  3OWS A;  3SVA A;  3GSP A;  3L0R A;  2BIR A;  2W9Q A;  3F9S A;  1JRQ A;  3PCS A;  1OHO A;  4L8P A;  5GSP A;  1I0V A;  1JV2 B;  3U97 A;  3WA3 A;  2JQ5 A;  2OQE C;  2CKF B;  1WMP A;  1VQ6 3;  2CX0 A;  5IER A;  1T3B A;  1EUI C;  1HU9 A;  1I3F A;  1IK3 A;  1B2M A;  3EF8 A;  1W02 A;  5M19 A;  1OH0 A;  3AHW A;  4XBX A;  1ISK A;  7GSP A;  2STD A;  4BTY A;  1FUT A;  3V99 A;  2F5M A;  3AGN A;  1JJ2 2;  1L5G B;  4FMB A;  1YJN 3;  1GSP A;  3GRD A;  1O7H B;  2YFJ B;  2ZHX B;  2WOH A;  1UDI I;  2FNQ A;  5ELJ A;  2Y73 A;  1QAK A;  5KP1 A;  1GD4 A;  1BNF A;  2QEX 3;  3BND A;  4BL3 A;  1IVW A;  4HAA A;  2AAE A;  7RNT A;  1EKM A;  1HKX A;  1W4N A;  4FMC A;  4O02 B;  4JF8 A;  1G96 A;  1PYL A;  4XDW A;  1FGM A;  4H61 A;  2XSO B;  3ECF A;  4MJD A;  1BNJ A;  2YX9 A;  2RNT A;  1BSB A;  5JPU A;  1A90 A;  1QAF A;  3NM7 A;  1D6U A;  3STD A;  1VQ5 3;  1BAN A;  2IUK A;  4L8O A;  2Z6B A;  4IT7 A;  1OCV A;  1GOV A;  3DGO A;  3EN1 B;  2IMJ A;  3NXJ A;  2F98 A;  4K1U A;  2CG1 A;  2JDI H;  1MNL A;  3CNM A;  2GEY A;  1RGK A;  3H3H A;  1TUH A;  2GXF A;  1GY5 A;  2CC3 A;  3D9R A;  2W03 A;  2AAD A;  4AEQ A;  5BIR A;  1RKY A;  1N8Q A;  4N6O B;  2P09 A;  5HOH A;  1YVB I;  1YGE A;  1FYS A;  1IVV A;  2BMR B;  4FCJ A;  1GMQ A;  3CCL 3;  3LXU X;  1W01 A;  2J8X B;  1SQW A;  3DZL A;  1OGX A;  4I5Q A;  4LSO A;  2XH9 A;  3X3Y A;  3ER7 A;  1STD A;  1UCL A;  5CXO A;  3BIR A;  2BU4 A;  5G1L A;  2GEX A;  1W6Y A;  4AKZ A;  5IF6 A;  3CC2 3;  2OTL 3;  1AY7 A;  2CH9 A;  3F40 A;  3KFQ C;  1MWT A;  3KKG A;  4N6N B;  3S28 A;  1MWU A;  1V57 A;  3DH2 A;  4BU4 A;  4EYC A;  2QA4 3;  2OOV C;  1FGO A;  3EN8 A;  3Q90 A;  4GHO A;  1I2G A;  2CW9 A;  5IEP A;  4EXR A;  5AEW B;  1A2V A;  2FXT A;  3QRD A;  4R9K A;  3N54 B;  3MPH A;  1I2E A;  3NM2 A;  3EE1 A;  1YGW A;  3MG1 A;  1ZS7 A;  4K61 A;  4R80 A;  9RNT A;  1QVG 2;  1WTH A;  1GOU A;  3PCR A;  4HM0 B;  5A0O B;  4FR9 A;  3LT9 A;  1OHP A;  4QWT A;  1K73 4;  1LQG C;  3BLZ A;  1IQ8 A;  1OF5 B;  3NBJ A;  5ELU A;  1CQS A;  6RNT A;  1K9M 4;  2UX0 A;  1CYU A;  3K9M C;  1BNS A;  2F99 A;  3SLU A;  3WOE B;  3MHE A;  1Q7H A;  1UUW B;  1D6Y A;  1AR0 A;  1M90 4;  2OTJ 3;  4HVN A;  4HM6 B;  1OF5 A;  1LRA A;  4KFD A;  4WWU C;  5IG3 A;  3CCE 3;  3N8B A;  3LML A;  4XDV A;  2BNG A;  2Z77 A;  1DYU A;  1NU3 A;  1TP6 A;  1BGS A;  2R41 A;  5CF2 A;  3EB8 A;  3A76 A;  4R9L A;  4NHF A;  5KP4 A;  1F8N A;  2E2T A;  1NB3 I;  2FGT A;  2XFT A;  2CWV A;  3KSP A;  5RNT A;  1JBT A;  3F7X A;  3OWU A;  1BNE A;  2CG0 A;  5AI1 A;  2V1L A;  3VF1 A;  4XBY A;  4HM3 B;  4RBN A;  2WO0 A;  4LMI A;  1RCL A;  2GU1 A;  4MMY B;  2F4Y A;  4AKY A;  1BSA A;  1YJ9 3;  1O7N B;  4R4K A;  1R4C A;  1VQP 3;  1FGT A;  4N6V 0;  5M1A A;  2IY2 A;  1UGH I;  1DVD A;  2K0M A;  4HOH A;  5FGO A;  3LTA A;  5KP3 A;  1A2K A;  1E3V A;  1HZ1 A;  2OOV A;  2RGQ A;  3KII A;  1I2F A;  3BB9 A;  2HMJ B;  3UJM A;  1DVC A;  4EV5 A;  1TFK A;  2KXG A;  3T8N A;  4XBT A;  3TDG A;  3BNE A;  2RCD A;  3CME 3;  1BRS A;  3JUP A;  5IG4 A;  3FF0 A;  1U5O A;  4BIR A;  1RGC A;  3NQY A;  1I70 A;  3OX9 A;  2CHC A;  4N3V A;  5CF1 A;  2ML6 A;  1IVU A;  1JKG B;  2PZV A;  3D5I A;  2W04 A;  3LZA A;  1RGE A;  2BHM A;  2KF3 A;  5LC6 A;  1ROV A;  1UCI A;  5JBS A;  3QK9 A;  1YJW 3;  2CX1 A;  3FH1 A;  1IU7 A;  1RLS A;  5D82 A;  3B4P A;  4LZI A;  4NPB A;  4HM2 B;  1DET A;  2KF6 A;  2KCD A;  4R1K A;  6GSP A;  1M9G A;  2IUJ A;  2LQV A;  1JKG A;  4LEH A;  3CCJ 3;  1VQQ A;  1ZX2 A;  1DE3 A;  3JUQ A;  1RNT A;  1ZO2 A;  1AQZ A;  4RNZ A;  1UI8 A;  1LNH A;  2UUG C;  3UL5 A;  8CHO A;  3KSE D;  3V92 A;  1S5A A;  5I97 A;  2CFW A;  2BMO B;  3G71 3;  3Q1C A;  1RRL A;  2L4V A;  3K7C A;  1A2P A;  1RGH A;  1FA3 A;  3PYJ A;  1NJI 4;  1S72 3;  1KC8 4;  1B2Z A;  3NX0 A;  2Q07 A;  1ULJ B;  1O7P B;  1LOV A;  1BRG A;  2CFK A;  2HMK B;  1IT8 A;  1WNH A;  3RNT A;  3K63 A;  3CCU 3;  1DMQ A;  1Q42 A;  1YVS A;  4FCZ A;  1RSN A;  1IV7 A;  4KT3 B;  4KZ1 A;  1RRH A;  3RGA A;  1D6Z A;  1YI2 3;  1WMO A;  1RJO A;  3WA2 X;  4PEJ A;  3LH4 A;  3NBR A;  1I0X A;  1O7G B;  3F14 A;  5D83 A;  3S67 A;  1VQ4 3;  1IQX A;  2BT3 A;  3CC7 3;  2CFD A;  2E2U A;  2UGI A;  4GSP A;  1N9E A;  3U1W A;  1JN5 B;  2XEP A;  1GYB A;  3WDG B;  2B24 B;  2WGQ A;  1Q40 B;  2HMN B;  5AYS C;  2P0X A;  1W2B 2;  1KQS 2;  2O9U X;  2CWT A;  1RN4 A;  1OUN A;  3AHS A;  1BNR A;  4ZM8 A;  1AVK A;  1ROA A;  1JN5 A;  4WFO A;  1B2U A;  3FLJ A;  2D42 A;  3OW2 2;  2ZDJ A;  4JRF A;  1Q40 A;  1G0T A;  3X40 A;  3SX1 A;  1N9J A;  1TRP A;  3GZY B;  1W2Z A;  5AIF A;  5G1K A;  2P38 A;  1T2H A;  3JVC A;  3WHO A;  5BXQ A;  1DMM A;  1Z1S A;  2W6J H;  3MG3 A;  3EBY A;  4Q53 A;  3KCH A;  3OV4 A;  4X2O A;  3DMC A;  3CNX A;  1EEJ A;  1NB5 I;  3WR2 A;  2MC8 A;  2I9W A;  3GZX B;  3LYG A;  1BRJ A;  1TIJ A;  4N6T A;  3SOA A;  3URP A;  1LOX A;  1WQL B;  2F5W A;  1CEW I;  4L7K A;  3NQZ A;  3FZW A;  1ZGX A;  3GWR A;  3K0Z A;  4IPB A;  1VQM 3;  1FUS A;  5AIH A;  2XR8 B;  4WYK B;  3CPO A;  3T8U A;  5DRV A;  3O8Y A;  4MEI A;  1JB4 A;  3E99 A;  2LYX A;  3FGY A;  5AII A;  3DM8 A;  2XGN A;  3MKI A;  1PY3 A;  1AV4 A;  3I56 3;  1X1W A;  2XF3 A;  1J2B A;  4J5G A;  3ZG5 A;  1DMN A;  4GB5 A;  4CCV A;  3G4S 3;  2H0I A;  2WGO A;  2OCT A;  1ULI B;  1KSI A;  4WYK A;  5M18 A;  1Y4K A;  3ROB A;  3SED A;  2O3O A;  1RGL A;  3LTC A;  1TRQ A;  1OAC A;  1FGQ A;  3IJE B;  4CDL A;  1LQM B;  1BNG A;  2Z76 A;  3I0Y A;  2HOH A;  1BSE A;  4CJN A;  1C54 A;  3MG2 A;  1LVN A;  3FG3 A;  1TTO A;  5EVH A;  1IV9 A;  1FGR A;  4HM5 B;  1LOW A;  3JUO A;  1BRK A;  2ML5 A;  1JZO A;  1GS3 A;  3D3L A;  3OWY A;  1JZD A;  3BNB A;  2KAA A;  1GY7 A;  4I4K A;  1TJD A;  3LTD A;  2HMM B;  1UUG B;  3NUV A;  1MWS A;  4EW5 A;  4ILF A;  3LOY A;  1NNV A;  1VQN 3;  3S5C A;  1IQY A;  5IG0 A;  1I8V A;  3FCS B;  1IVX A;  3D79 A;  1BOX A;  3EQQ B;  3KE7 A;  2CFL A;  3HZP A;  4HM8 B;  1YIT 3;  1EQK A;  1MGR A;  1SIH A;  1B21 A;  3G0K A;  5FW5 A;  2CIU A;  1OPY A;  2KF4 A;  2HML B;  1BRH A;  3V98 A;  2GBW B;  2RSX A;  3DY5 A;  1QJG A;  3K5T A;  2P05 A;  2XFS A;  3HK4 A;  3PS8 A;  3Q2P A;  4STD A;  3B4O A;  3VSY A;  3VGN A;  1O7M B;  4N6M A;  1MWR A;  3BNC A;  1BRI A;  1FUW A;  1W00 A;  4HZB B;  1SJW A;  4OUQ A;  2CK3 H;  3G16 A;  1BNI A;  1FW7 A;  2H0G A;  3S29 A;  1KD1 4;  3B8L A;  1VQL 3;  3F8H A;  4RNT A;  1X1Y A;  2L1S A;  2YFI B;  4FMA A;  2Y74 A;  1OGZ A;  4KVH A;  4ORL A;  3D4A A;  1PU4 A;  1UCJ A;  1MGW A;  5STD A;  3HI7 A;  1BU4 A;  4H3U A;  1TU5 A;  1KWI A;  1QVF 2;  3WMD A;  4WP5 A;  1YNV X;  3J7Y d;  2K3D A;  2SAR A;  3FKA A;  1VQO 3;  4EBG A;  1B2X A;  2QGU A;  3MWZ A;  1QMA A;  4MMX B;  1GMR A;  3B7C A;  5JPP A;  3G6E 3;  2XGL A;  3CC4 3;  1N5H A;  5AIG A;  5BU4 A;  3CD6 3;  4O8S A;  3IPT A;  4RZM A;  4U13 A;  1N5P A;  3D5G A;  2IYJ A;  2P0M A;  1HYF A;  5IEO A;  4EC6 A;  2RBI A;  4HZ9 B;  2XSH B;  5AEU B;  3I55 3;  4MMZ B;  2C4B A;  3UL6 A;  1BIR A;  2R4I A;  3X3Z A;  3BU4 A;  3X41 A;  2RFR A;  3NV0 B;  1EA2 A;  1TFO A;  2GSP A;  1M1K 4;  2H0H A;  1V74 A;  1JBS A;  1Q86 4;  3AMO B;  1WMN A;  3N9H A;  2A15 A;  2C10 A;  2OWP A;  2PNC A;  3FF2 A;  5EEO A;  3GAX A;  1YIJ 3;  3T0U A;  1STF I;  3LT8 A;  4KFE A;  3PGB A;  2CFG A;  4XB5 A;  1NWW A;  2INX A;  2HMO B;  3DUK A;  2M7O A;  7STD A;  1X1X A;  2GBX B;  2QIY A;  4IIA A;  3NV0 A;  3CXC 2;  1CYV A;  1LOY A;  3AMO A;  1RDS A;  1R4Y A;  1GOY A;  1ASK A;  5AYR B;  3DGM A;  1T5Y A;  5CLK A;  4K90 B;  4G1M B;  4X2H A;  1VQK 3;  3NHX A;  3HX8 A;  3WOD G;  1K28 A;  1IT7 A;  1AVL A;  4HM7 B;  5EQL A;  4HBR A;  1T2I A;  1SPU A;  3CCQ 3;  2WOF A;  3GZB A; 
#chains in the Genus database with same CATH homology
 1M1X B;  1U8C B;  2IA7 A;  4LGQ A;  3NBB A;  1PFP A;  1VQ7 3;  5TGN A;  4N6L A;  3CU3 A;  2C11 A;  2F86 B;  3HII A;  1N8R 4;  1BUQ A;  3F8X A;  4HKV B;  3CCR 3;  4FMD A;  3UNL A;  2MF7 A;  1NDO B;  1VZZ A;  3JUM A;  4O3V A;  4WHA A;  2OQE A;  1E97 A;  4O2H A;  2D1W A;  2KRT A;  3CCM 3;  1JB2 A;  3FSD A;  2XRX B;  5LC7 A;  3JUN A;  4HM4 B;  4HM1 B;  3S27 A;  3MYT A;  4K1V A;  3LTB A;  3FG1 A;  3EC9 A;  1Q82 4;  3PZW A;  1US1 A;  2B1X B;  5IW9 A;  1UW1 A;  3FG4 A;  4N6U A;  1YHQ 3;  3ALA A;  1K41 A;  2GU3 A;  4KFF A;  4J9A A;  4BTW A;  3DGL A;  1GY6 A;  2W0Q A;  3SXX A;  5G2G A;  3EBT A;  3DGN A;  4J8T A;  4XM4 A;  3EHC A;  6STD A;  1EG9 B;  2BMQ B;  1GD3 A;  3EX9 A;  1W6C A;  1NO3 A;  1IDP A;  4NRE A;  5IG5 A;  3CPW 2;  3RGR A;  2BO9 B;  3DXO A;  5IEN A;  4HJL B;  3UB1 A;  2Z7A A;  2ZL8 A;  3IMA B;  4EV2 A;  1RN7 A;  2CWU A;  4FCM A;  5DRE A;  5D81 A;  3SOY A;  1Q81 4;  1VQ8 3;  1JNQ A;  1SII A;  3H51 A;  3PXM A;  4OVM A;  1C7H A;  3HIG A;  2W56 B;  4TX4 A;  3KN4 A;  3CCS 3;  1LXE A;  2W2C A;  3MSO A;  3X42 A;  1E3R A;  3X3X A;  1W5Z A;  4GL6 A;  5CK6 A;  3OXA A;  1JB5 A;  1OHS A;  2W56 A;  3G8Z A;  4BTX A;  1VQ9 3;  1W6G A;  3M8C A;  1O7W B;  3RDE A;  1A67 A;  5HGR A;  4HYZ A;  4RNY A;  1QAL A;  1UI7 A;  2YFL B;  1Q7Y 4;  1K8A 4;  2SBL A;  3CCV 3;  3CMA 3;  1MOL A;  2E2V A;  1W7C A;  4OK0 A;  1UUV B;  2K54 A;  3EJV A;  3GZR A;  3WOF B;  5BVB A;  2W9P A;  3F7S A;  3KZT A;  3OWS A;  3SVA A;  3L0R A;  2W9Q A;  3F9S A;  1JRQ A;  3PCS A;  1OHO A;  4L8P A;  1JV2 B;  3U97 A;  3WA3 A;  2JQ5 A;  2OQE C;  2CKF B;  1WMP A;  1VQ6 3;  5IER A;  1HU9 A;  1IK3 A;  3EF8 A;  1W02 A;  1ISK A;  1OH0 A;  4XBX A;  2STD A;  4BTY A;  3V99 A;  1JJ2 2;  1L5G B;  4FMB A;  1YJN 3;  3GRD A;  1O7H B;  2YFJ B;  2WOH A;  2FNQ A;  5ELJ A;  2Y73 A;  1QAK A;  5KP1 A;  1GD4 A;  2QEX 3;  3BND A;  1IVW A;  1EKM A;  1HKX A;  1W4N A;  4FMC A;  4O02 B;  4JF8 A;  1G96 A;  4XDW A;  1FGM A;  4H61 A;  2XSO B;  3ECF A;  4MJD A;  2YX9 A;  5JPU A;  1A90 A;  1QAF A;  3NM7 A;  1D6U A;  3STD A;  1VQ5 3;  2IUK A;  4L8O A;  2Z6B A;  4IT7 A;  1OCV A;  3DGO A;  3EN1 B;  2IMJ A;  3NXJ A;  2F98 A;  4K1U A;  2CG1 A;  2JDI H;  1MNL A;  3CNM A;  2GEY A;  3H3H A;  1TUH A;  2GXF A;  1GY5 A;  2CC3 A;  3D9R A;  2W03 A;  4AEQ A;  1RKY A;  1N8Q A;  4N6O B;  2P09 A;  1YVB I;  1YGE A;  1IVV A;  2BMR B;  4FCJ A;  3CCL 3;  3LXU X;  1W01 A;  1SQW A;  3DZL A;  1OGX A;  4LSO A;  2XH9 A;  3X3Y A;  3ER7 A;  1STD A;  5CXO A;  2GEX A;  1W6Y A;  4AKZ A;  5IF6 A;  3CC2 3;  2OTL 3;  2CH9 A;  3F40 A;  3KFQ C;  3KKG A;  4N6N B;  3S28 A;  2QA4 3;  4EYC A;  2OOV C;  1FGO A;  3EN8 A;  3Q90 A;  5IEP A;  2CW9 A;  4EXR A;  5AEW B;  1A2V A;  2FXT A;  3QRD A;  4R9K A;  3N54 B;  3MPH A;  3NM2 A;  4K61 A;  3EE1 A;  4XBT A;  3MG1 A;  4R80 A;  1QVG 2;  1WTH A;  3PCR A;  4HM0 B;  5A0O B;  4FR9 A;  3LT9 A;  1OHP A;  4QWT A;  1K73 4;  3BLZ A;  5ELU A;  1IQ8 A;  1OF5 B;  3NBJ A;  1K9M 4;  1CQS A;  2UX0 A;  1CYU A;  3K9M C;  3SLU A;  2F99 A;  3WOE B;  3MHE A;  1UUW B;  1D6Y A;  1AR0 A;  1M90 4;  2OTJ 3;  4HVN A;  4HM6 B;  1OF5 A;  4KFD A;  4WWU C;  5IG3 A;  3CCE 3;  3N8B A;  3LML A;  4XDV A;  2BNG A;  2Z77 A;  1DYU A;  1NU3 A;  1TP6 A;  5CF2 A;  3EB8 A;  3A76 A;  4R9L A;  4NHF A;  5KP4 A;  1F8N A;  2E2T A;  1NB3 I;  2FGT A;  2XFT A;  2CWV A;  3KSP A;  3F7X A;  3OWU A;  2CG0 A;  5AI1 A;  2V1L A;  3VF1 A;  4XBY A;  4HM3 B;  4RBN A;  2WO0 A;  4LMI A;  4MMY B;  2GU1 A;  4AKY A;  1YJ9 3;  1O7N B;  4R4K A;  1R4C A;  1VQP 3;  1FGT A;  4N6V 0;  1DVD A;  2K0M A;  5FGO A;  3LTA A;  5KP3 A;  1A2K A;  1E3V A;  2OOV A;  2RGQ A;  3KII A;  3BB9 A;  2HMJ B;  3UJM A;  1DVC A;  4EV5 A;  1TFK A;  2KXG A;  3T8N A;  3TDG A;  3CME 3;  3BNE A;  2RCD A;  3JUP A;  5IG4 A;  3FF0 A;  1U5O A;  5CF1 A;  3NQY A;  3OX9 A;  2CHC A;  4N3V A;  2ML6 A;  1IVU A;  1JKG B;  2PZV A;  3LZA A;  2W04 A;  2BHM A;  5LC6 A;  1ROV A;  5JBS A;  3QK9 A;  1YJW 3;  3FH1 A;  1IU7 A;  5D82 A;  3B4P A;  4LZI A;  4HM2 B;  2KCD A;  4R1K A;  1M9G A;  2IUJ A;  2LQV A;  1JKG A;  4LEH A;  3CCJ 3;  1ZX2 A;  3JUQ A;  1ZO2 A;  4RNZ A;  1UI8 A;  1LNH A;  3UL5 A;  8CHO A;  3KSE D;  3V92 A;  1S5A A;  5I97 A;  2CFW A;  2BMO B;  3G71 3;  3Q1C A;  1RRL A;  2L4V A;  3K7C A;  1FA3 A;  3PYJ A;  1NJI 4;  1S72 3;  1KC8 4;  3NX0 A;  2Q07 A;  1ULJ B;  1O7P B;  2CFK A;  2HMK B;  1IT8 A;  1WNH A;  3K63 A;  3CCU 3;  1DMQ A;  1Q42 A;  4FCZ A;  1IV7 A;  4KZ1 A;  3RGA A;  1RRH A;  1D6Z A;  1YI2 3;  1WMO A;  1RJO A;  3WA2 X;  4PEJ A;  3LH4 A;  3NBR A;  3F14 A;  1O7G B;  5D83 A;  3S67 A;  1VQ4 3;  1IQX A;  2BT3 A;  3CC7 3;  2CFD A;  2E2U A;  3U1W A;  1N9E A;  1JN5 B;  2XEP A;  1GYB A;  3WDG B;  2B24 B;  2WGQ A;  1Q40 B;  2HMN B;  5AYS C;  2P0X A;  1W2B 2;  1KQS 2;  2O9U X;  2CWT A;  1OUN A;  4ZM8 A;  1AVK A;  1ROA A;  1JN5 A;  4WFO A;  3FLJ A;  2D42 A;  3OW2 2;  2ZDJ A;  4JRF A;  1Q40 A;  3X40 A;  3SX1 A;  1N9J A;  3GZY B;  5AIF A;  1W2Z A;  2P38 A;  3JVC A;  5BXQ A;  1DMM A;  1Z1S A;  2W6J H;  3MG3 A;  3EBY A;  4Q53 A;  3OV4 A;  4X2O A;  3DMC A;  3CNX A;  1NB5 I;  2MC8 A;  2I9W A;  3GZX B;  3LYG A;  1TIJ A;  4N6T A;  3SOA A;  1LOX A;  1WQL B;  1CEW I;  4L7K A;  3NQZ A;  3FZW A;  3GWR A;  3K0Z A;  4IPB A;  1VQM 3;  5AIH A;  2XR8 B;  4WYK B;  3CPO A;  3T8U A;  5DRV A;  3O8Y A;  4MEI A;  1JB4 A;  3E99 A;  2LYX A;  3FGY A;  5AII A;  3DM8 A;  2XGN A;  3MKI A;  1AV4 A;  3I56 3;  1J2B A;  2XF3 A;  1DMN A;  4GB5 A;  4CCV A;  3G4S 3;  2WGO A;  2OCT A;  1ULI B;  1KSI A;  4WYK A;  1Y4K A;  3ROB A;  3SED A;  2O3O A;  3LTC A;  1OAC A;  1FGQ A;  3IJE B;  4CDL A;  2Z76 A;  3I0Y A;  3MG2 A;  1LVN A;  3FG3 A;  5EVH A;  1IV9 A;  1FGR A;  4HM5 B;  3JUO A;  2ML5 A;  1GS3 A;  3D3L A;  3OWY A;  3BNB A;  4I4K A;  1GY7 A;  3LTD A;  2HMM B;  3NUV A;  3LOY A;  1VQN 3;  3S5C A;  1IQY A;  5IG0 A;  3FCS B;  1IVX A;  3KE7 A;  3EQQ B;  2CFL A;  3HZP A;  4HM8 B;  1YIT 3;  1EQK A;  1SIH A;  3G0K A;  5FW5 A;  2CIU A;  1OPY A;  2HML B;  3V98 A;  2GBW B;  2RSX A;  3DY5 A;  1QJG A;  3K5T A;  2P05 A;  2XFS A;  3HK4 A;  3PS8 A;  3Q2P A;  4STD A;  3B4O A;  3VSY A;  3VGN A;  1O7M B;  4N6M A;  3BNC A;  1FUW A;  1W00 A;  4HZB B;  1SJW A;  4OUQ A;  2CK3 H;  3G16 A;  3S29 A;  1KD1 4;  3B8L A;  1VQL 3;  3F8H A;  2YFI B;  4FMA A;  2Y74 A;  1OGZ A;  4KVH A;  4ORL A;  1PU4 A;  5STD A;  3HI7 A;  4H3U A;  1TU5 A;  1KWI A;  1QVF 2;  3WMD A;  4WP5 A;  3J7Y d;  3FKA A;  1VQO 3;  4EBG A;  3G6E 3;  2QGU A;  3MWZ A;  1QMA A;  4MMX B;  3B7C A;  5JPP A;  2XGL A;  3CC4 3;  1N5H A;  5AIG A;  3CD6 3;  4O8S A;  3IPT A;  4RZM A;  4U13 A;  1N5P A;  5AEU B;  2P0M A;  5IEO A;  4EC6 A;  4HZ9 B;  2XSH B;  3I55 3;  4MMZ B;  3UL6 A;  2R4I A;  3X3Z A;  3X41 A;  2RFR A;  3NV0 B;  1EA2 A;  1TFO A;  1M1K 4;  1V74 A;  1Q86 4;  3AMO B;  1WMN A;  3N9H A;  2A15 A;  2C10 A;  2OWP A;  2PNC A;  3FF2 A;  5EEO A;  3GAX A;  1YIJ 3;  3T0U A;  1STF I;  3LT8 A;  4KFE A;  3PGB A;  2CFG A;  4XB5 A;  1NWW A;  2INX A;  2HMO B;  3DUK A;  2M7O A;  7STD A;  2QIY A;  2GBX B;  4IIA A;  3NV0 A;  3CXC 2;  1CYV A;  3AMO A;  5AYR B;  1ASK A;  3DGM A;  1T5Y A;  5CLK A;  4K90 B;  4G1M B;  4X2H A;  1VQK 3;  3NHX A;  3HX8 A;  3WOD G;  1K28 A;  1IT7 A;  1AVL A;  4HM7 B;  5EQL A;  4HBR A;  1SPU A;  3CCQ 3;  2WOF A;  3GZB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...