3VSYA

High-resolution crystal structure of wild-type ksi in the apo form at neutral ph
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
125
structure length
123
Chain Sequence
LPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFYRQGLGKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Incorporation of rapid thermodynamic data in fragment-based drug discovery.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
molecule keywords Steroid Delta-isomerase
total genus 33
structure length 123
sequence length 125
chains with identical sequence B
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2012-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3vsyA00
1U5OA 2BMRB 4HM0B 1ASKA 5AIHA 3MKIA 1GY7A 5IENA 4R9LA 3T8UA 5D83A 1Q40B 2BMQB 4R9KA 4WP5A 2BMOB 3EBYA 3RGAA 4HKVB 3SEDA 3F7XA 5IG0A 5IEPA 2HMJB 4XBTA 1W6YA 1OGXA 1E97A 3E99A 3LYGA 3DZLA 8CHOA 5KP1A 5BXQA 3KE7A 1OHPA 2CHCA 3S5CA 2Z7AA 3ROBA 1QJGA 1ISKA 1ULIB 2BNGA 4I4KA 5CXOA 4CDLA 2UX0A 3ECFA 3NXJA 2GBXB 3OX9A 1JB4A 3K7CA 4XBYA 5D81A 2YFLB 3FF2A 2W2CA 2Z76A 1HKXA 2F99A 1OF5B 3B7CA 3DUKA 3GZBA 3OWUA 2XSOB 4LMIA 3F8XA 4U13A 2RGQA 4WWUC 3MG3A 2INXA 3EX9A 3STDA 4HM7B 1BUQA 1NWWA 2GEYA 4IIAA 2A15A 3FF0A 3BB9A 3FZWA 1OGZA 5JPUA 2OWPA 1GY6A 1W00A 2R4IA 2Z77A 5CK6A 3FKAA 5JPPA 1OH0A 2HMLB 2XRXB 3FLJA 3MHEA 4PEJA 5DREA 1GYBA 5HGRA 4L8OA 1Z1SA 5IERA 3HX8A 3MG2A 4L8PA 4HM5B 1K41A 4HM4B 1AR0A 5G2GA 1DMQA 1ZX2A 2HMOB 2I9WA 3F9SA 1O7GB 5AIIA 5STDA 3NBRA 1E3VA 1O7NB 1Q42A 2XSHB 3ER7A 1STDA 4WYKA 1OHOA 1JKGB 3A76A 1JB5A 3DM8A 5IG3A 3JUPA 1JN5B 4HM3B 3F14A 3EN1B 1O7MB 5IEOA 5IG4A 3FSDA 4HJLB 5IG5A 4RZMA 4R1KA 1NU3A 4J8TA 1GS3A 2XR8B 2F98A 1UUVB 3B4PA 3EN8A 4GB5A 4HM1B 1OCVA 2RCDA 3KKGA 3OWSA 4XB5A 1DMMA 3FH1A 4OUQA 2IMJA 1GY5A 3BLZA 3OWYA 1EG9B 1ULJB 3DXOA 3FGYA 4LEHA 5AI1A 2GXFA 4OVMA 2HMMB 5D82A 1O7HB 2B1XB 3GZXB 4KVHA 2YFJB 5DRVA 5EVHA 2B24B 5FW5A 1W02A 3SOAA 1C7HA 5AEUB 1OHSA 1TUHA 4K1VA 3CNXA 4FCJA 3G8ZA 3F7SA 1W01A 4H3UA 5AIGA 2HMNB 1O7PB 3VGNA 3D9RA 3EF8A 2F86B 4XDVA 3SOYA 1QMAA 3MSOA 3EC9A 3GWRA 3KZTA 4ORLA 4XDWA 1DMNA 3H3HA 3CPOA 1A2KA 3T8NA 2RFRA 3NV0B 3UJMA 2STDA 3IPTA 5KP3A 3LZAA 1O7WB 2CKFB 4FCMA 1Q40A 4HZ9B 4L7KA 4Q53A 4X2OA 3HZPA 1OPYA 3KSPA 5AIFA 1VZZA 1SJWA 3NM2A 2GBWB 1S5AA 2GEXA 3CU3A 5TGNA 5AEWB 4HZBB 6STDA 3MG1A 4HVNA 7STDA 3OV4A 3JUMA 3GRDA 1WQLB 3OXAA 3K0ZA 3CNMA 4K1UA 4X2HA 3MYTA 3NHXA 1ZO2A 1E3RA 3GZRA 1CQSA 1EA2A 3HK4A 3I0YA 3JUNA 3NUVA 3F40A 2HMKB 3Q90A 4HM2B 4HM8B 4WYKB 4XBXA 5IF6A 2YFIB 1TP6A 1IDPA 3EJVA 4HM6B 3H51A 4XM4A 3JUOA 2QIYA 3B8LA 3VSYA 1JKGA 5CLKA 3WMDA 3M8CA 5KP4A 2JQ5A 3G16A 5BVBA 1OUNA 4STDA 1NDOB 2K54A 4J9AA 5CF2A 3EHCA 3EQQB 4MJDA 3EBTA 3NV0A 3GZYB 1UUWB 3DMCA 1OF5A 4LGQA 4N3VA 3F8HA 1JN5A 3JUQA 5CF1A 3G0KA 3RGRA 1JB2A 3B4OA 2PZVA 3UNLA 2QGUA
chains in the Genus database with same CATH superfamily
2YX9A 1GSPA 4RBNA 1QAFA 5AIHA 1NB3I 1S723 2IUKA 1MWTA 4R9LA 2ZHXB 3FG3A 4JF8A 2GSPA 4R9KA 4WP5A 4MMXB 1D6YA 3U1WA 4BTWA 1BSCA 3E99A 3U97A 1VQ63 2CC3A 2P0XA 1RGGA 2MC8A 4OK0A 1VQ93 3ROBA 1QJGA 1UW1A 5EQLA 2BNGA 3MPHA 2K0MA 1M904 3NXJA 2W03A 4H61A 1MOLA 1B21A 1BRSA 3PXMA 3O8YA 1X1YA 5JBSA 3PYJA 2Z76A 1BNGA 4LMIA 4BTXA 4CDLA 4U13A 1YNVX 2XSOB 1R4YA 4WFOA 1PU4A 3CCV3 2GEYA 1B3SA 1AQZA 3CCM3 3KN4A 1OGZA 3NQYA 1LOYA 1GY6A 3CD63 1W00A 4MMYB 3PCSA 5LC6A 5CK6A 2P05A 5BIRA 1NB5I 1BUJA 1Q9EA 1LOXA 1YIJ3 4J5KA 5DREA 2WO0A 4N6NB 4L8OA 4EV5A 2XGLA 5IERA 3UL6A 9RNTA 4JRFA 1RGEA 1JRQA 4CPKA 1K8A4 1DVCA 4LSOA 2WOFA 4FMAA 2XFSA 2XSHB 4AKZA 1KQS2 4WYKA 1OHOA 3AHSA 1Q864 1I0VA 4HM3B 2R41A 1UI7A 2OQEA 4HJLB 4RZMA 2H0GA 1FZUA 1RHLA 1FUTA 1OCVA 1VQ83 1T3BA 1I3IA 4XB5A 1NJI4 1DMMA 3V99A 3VF1A 1GD4A 3BLZA 3OWYA 1EG9B 2BU4A 2OOVC 5D82A 2B1XB 1MNLA 2WOHA 2YFJB 5DRVA 1B2XA 1GMPA 1C7HA 1SPUA 4BL2A 4FCJA 2CX1A 3F7SA 3Q2PA 2KF5A 3QRDA 4CCVA 3VGNA 1MGRA 3TDGA 4BTYA 3SOYA 1RGAA 1QMAA 1CYVA 3AGNA 3EC9A 4XDWA 1UUGB 4NHFA 4KZ1A 3CPOA 1YI23 4N6OB 2RFRA 3SXXA 3NV0B 2STDA 1FYSA 1O7WB 4K61A 4FCMA 3OW22 4Q53A 1AVLA 3HZPA 4J5GA 1VZZA 3NM2A 5GSPA 1S5AA 4HVNA 3URPA 3G713 4FMCA 3WODG 1BOXA 2CG1A 1WTHA 3RDEA 2CW9A 3GZRA 3S28A 1CQSA 1PYLA 3HK4A 3Q90A 1VQN3 3F40A 2CX0A 3WOFB 3CXC2 2W6JH 1G96A 3MWZA 3LOYA 1VQ43 3D5IA 3K5TA 1Y4KA 1IDPA 1BGSA 4HM6B 1JZDA 1TFOA 2Z6BA 1T5YA 3JUOA 5CLKA 3VSYA 3M8CA 2JQ5A 3G16A 4J9AA 2K54A 2CWUA 2SARA 5M18A 2P38A 3NV0A 2FXTA 3K9MC 3DMCA 2K3DA 4N3VA 3JUQA 1L5GB 2KCDA 2OTJ3 1WNHA 3D79A 3B7CA 5G2GA 2QGUA 1X1XA 5BXQA 1IYYA 1IVVA 1OACA 2BMRB 2KAAA 3DGOA 1RN4A 3MKIA 4CJNA 1GY7A 1N5HA 1B2SA 2OOVA 1BNIA 1RNBA 1BVIA 3DGLA 1ROAA 2BMQB 5IEPA 8RNTA 4FCZA 1B27A 1U8CB 4LZIA 4R4KA 5IG0A 3SEDA 4XBTA 3LYGA 5KP1A 4N6V0 2ZA4A 1J2BA 2CH9A 1AV4A 2CHCA 3AHWA 2Z7AA 4IT7A 1MWSA 1R4CA 3AMOA 2UX0A 1RGCA 2GBXB 3WHOA 1RRLA 3K7CA 1UDII 2YFLB 3FF2A 3DUKA 1HKXA 1UCKA 2F99A 5G1LA 5AYRB 1Q824 3OWUA 5IG5A 4WWUC 3MG3A 1MWUA 2INXA 3N8BA 2ZL8A 4GL6A 4HM7B 2IY2A 1NWWA 2ML6A 3A5EA 2Q07A 2W9QA 1I2GA 4NPBA 1DVDA 4N6TA 1TFKA 5HGRA 3FLJA 4PEJA 2F4YA 3BNEA 1GYBA 2WGOA 4WHAA 1I70A 1G02A 4L8PA 1KD14 3X3ZA 1ZX2A 1BU4A 1BSAA 3X3YA 1M1K4 3LTBA 3WA3A 3LXUX 1BSBA 3SYUA 1STDA 2H0HA 4IPBA 3UL5A 1C54A 1JKGB 3A76A 3NBJA 4TX4A 1YJN3 3JUPA 3ZG5A 1O7MB 3FSDA 4R1KA 3LT9A 1BRKA 4J8TA 3EN8A 1MGWA 1QVF2 3G4S3 4MMZB 1LRAA 2UUGC 3FH1A 1GOYA 1GMQA 1GY5A 5G1KA 5AI1A 3CC23 1YHQ3 1N5PA 2HMMB 3BNCA 4FMDA 2CIUA 1PFPA 3PS8A 6RNTA 5EVHA 1W02A 1KSIA 3RNTA 1OHSA 1TUHA 3BNBA 3G8ZA 4ILFA 3CC43 1W01A 1A2VA 1IV9A 2W56A 1IT8A 2KF6A 4AEQA 1FW7A 2F86B 1LOVA 1IU7A 4O2HA 1STFI 1GOVA 1RGLA 3GWRA 3KZTA 6GSPA 3D3LA 3K63A 1CEWI 3LTCA 2CKFB 4X2OA 4L7KA 3FG4A 1OPYA 2Y74A 2RSXA 3KSPA 1W7CA 2XEPA 1SJWA 4GHOA 5LC7A 2GBWB 4EV2A 1I8VA 2GEXA 1FUSA 2P09A 3L0RA 3PGBA 3Q3FA 5TGNA 3SX1A 6STDA 3NX0A 1UCIA 1WQLB 2AAEA 3I563 1FA3A 3K0ZA 3NHXA 1A67A 1W6CA 1I3FA 3N54B 4XBXA 2HMKB 5IF6A 1W2ZA 1W5ZA 2SBLA 2W56B 3H51A 3B8LA 2V1LA 1JKGA 1KWIA 2GU3A 1IQYA 1D6ZA 3LH4A 2BT3A 1HU9A 1BSDA 4FR9A 3ZG0A 3G0KA 3RGRA 3UB1A 3CC73 3WDGB 2PZVA 3KSED 1T2HA 1U5OA 4MEIA 1DETA 4HM0B 1BNSA 2W04A 5ELUA 3KCHA 3I553 1BRJA 1YIT3 2HOHA 4AKYA 3T8UA 1US1A 1WMNA 5D83A 1JNQA 2BMOB 1BNRA 1FGOA 3LMLA 4HKVB 2HMJB 1UGIA 1RRHA 2J8XB 2O9UX 1V57A 2OCTA 1W6YA 3N9HA 1E97A 5HOHA 8CHOA 1K28A 4RNTA 1CYUA 1I2EA 1OHPA 3DGMA 3GSPA 3S5CA 1ISKA 3HI7A 1GOUA 3ECFA 2MF7A 3HIGA 1JBTA 2XFTA 2F5MA 4N6LA 4RNYA 1ZGXA 4XBYA 5M1AA 4LEHA 1LVNA 1BAOA 1OF5B 3GZBA 2QA43 1I2FA 3EB8A 3STDA 1YGWA 3F8XA 4EBGA 4K90B 4NREA 2OTL3 2D42A 4O3VA 4IIAA 4KFDA 3BB9A 1CH0A 5AYSC 5JPUA 2BHMA 2R4IA 2FGTA 2Z77A 3V92A 1BSEA 3FCSB 2XF3A 3D5GA 2HMLB 3MHEA 3CMA3 3Q1CA 4EYCA 1IV7A 1X1WA 2JDIH 4HM4B 5FGOA 3LT8A 1SIHA 2E2UA 2CFLA 2CWVA 2HMOB 2C10A 2I9WA 5ELJA 1O7GB 1UCLA 3ZFZA 1WMPA 5STDA 1PY3A 1V74A 3DGYA 3CCJ3 1K9M4 1O7NB 1Q42A 1BRGA 4BIRA 1BRHA 2CFDA 1W4NA 5IG3A 1A90A 1NO3A 3IMAB 3DM8A 2IA7A 3NQZA 1JN5B 3X3XA 3F14A 3EN1B 5IG4A 7RNTA 2C11A 1HYFA 2ZDJA 1N9JA 1GS3A 1M1XB 1EUIC 1UUVB 4GB5A 3WOEB 3X42A 5I97A 1LQGC 2ML5A 1F8NA 3JVCA 1MWRA 3J7Yd 2IMJA 3V98A 3FGYA 2BO9B 2CFWA 4KT3B 3HIIA 4QWTA 4KVHA 2QEX3 2D1WA 1LNIA 1NNVA 2B24B 2Y73A 1YGEA 1AVKA 4R80A 5FW5A 3SOAA 1N9EA 1B2MA 1IQ8A 3CNXA 1TTOA 4N6UA 3CPW2 1RJOA 1WMOA 1DYUA 1O7PB 1GD3A 2H0IA 2HMNB 3D9RA 4HAAA 1QVG2 4XDVA 1IK3A 1JJ22 3MSOA 1VQP3 4ORLA 1DMNA 2CG0A 1SQWA 1X1UA 1A2KA 3H3HA 3LTAA 3T8NA 4BL3A 3UJMA 3IPTA 5EEOA 5M19A 1W2B2 1N8R4 5RNTA 1Q40A 4FMBA 1DE3A 5AIFA 3IJEB 2KRTA 2CFGA 1A2PA 2PNCA 5AEWB 3CU3A 1EQKA 4HZBB 3MG1A 1N8QA 1KC84 4GSPA 5IW9A 2KF4A 3CNMA 4X2HA 3MYTA 3I0YA 1EA2A 2OQEC 3JUNA 1VQK3 1Q7Y4 4HM2B 1BNJA 1IQXA 1TP6A 3EJVA 2KF3A 3S27A 3D4AA 4BU4A 3CCS3 5KP4A 1UGHI 1IVUA 2IUJA 3DY5A 3EBTA 4EC6A 3GZYB 3X41A 4LGQA 3KFQC 1RLSA 7GSPA 1JN5A 5CF1A 3QK9A 4HBRA 3B4OA 3PCRA 1K734 4RNZA 1BNEA 2C4BA 2XH9A 1ASKA 4I5QA 1RN7A 3S67A 1VQO3 5IENA 1TJDA 1HZ1A 3CCE3 1Q40B 1FGTA 3GAXA 5BU4A 1JZOA 3EBYA 3RGAA 1JBRA 3F7XA 3X40A 1ZS7A 2RBIA 1OGXA 1QALA 1UCJA 2CFKA 2L4VA 3DZLA 1YVBI 2M7OA 3KE7A 2F5WA 3BU4A 2AADA 1ULIB 4I4KA 5CXOA 1IVWA 1BRNL 3EE1A 3ALAA 1RGFA 1JB4A 1IT7A 3BNDA 2KXGA 5D81A 3FG1A 3OX9A 2W2CA 2W0QA 1AY7A 2CWTA 1BANA 3PZWA 1BUQA 2RGQA 2CK3H 3EX9A 4KFEA 4KFFA 1SARA 2A15A 3FF0A 3FZWA 3WA2X 2OWPA 3G6E3 4N6MA 1VQ53 3FKAA 5JPPA 1OH0A 1VQQA 2XRXB 1YJW3 1RGKA 1BRIA 1Z1SA 3WR2A 1VQL3 3HX8A 3MG2A 4HM5B 1B2ZA 1K41A 1AR0A 1W6GA 1DMQA 1LOWA 1G0TA 3F9SA 1GMRA 5AIIA 2IYJA 3CME3 3NBRA 1RTUA 1E3VA 1I0XA 1RN1A 3ER7A 3T0UA 3CCL3 1BNFA 4G1MB 1JB5A 1RCLA 2LYXA 3NM7A 1TIJA 2F56A 5IEOA 1V58A 1B20A 1NU3A 4HOHA 2XR8B 3B4PA 2F98A 3SVAA 4HM1B 2RCDA 1Q7HA 3KKGA 3OWSA 1YVSA 2GU1A 2W9PA 1JV2B 2P0MA 2L1SA 1FGRA 3AMOB 1VQ73 3KIIA 4OUQA 4EW5A 1ULJB 3DXOA 2GXFA 4OVMA 4EXRA 1O7HB 3GZXB 3NBBA 1B2UA 4HYZA 5AEUB 4K1VA 3CCU3 3DGNA 2WGQA 1FUWA 1RMSA 4H3UA 3BIRA 1EEJA 3EF8A 3DH2A 2E2VA 1RSNA 1LQMB 1VQM3 1FGQA 1M9GA 1JBSA 1RNTA 2FNQA 3AGOA 3LZAA 4O02B 1ROVA 4HZ9B 5KP3A 1TRPA 5A0OB 3HOHA 3CCQ3 1LNHA 7STDA 2UGIA 2BIRA 2XGNA 3JUMA 3OV4A 1YJ93 3GRDA 3OXAA 3UNLA 1RGHA 4K1UA 5AIGA 1ZO2A 1E3RA 1RDSA 3NUVA 1T2IA 1SIIA 4HM8B 2RNTA 4WYKB 3SLUA 4ZM8A 1LXEA 4O8SA 2YFIB 1D6UA 2E2TA 1UI8A 4XM4A 2QIYA 4DKIA 1TU5A 3WMDA 3CCR3 1FGMA 5BVBA 2LQVA 1EKMA 1OUNA 1NDOB 3LTDA 4LYLB 1BIRA 3EHCA 3EQQB 4STDA 5CF2A 1Q814 1UUWB 1OF5A 1QAKA 1RCKA 3F8HA 3S29A 1RKYA 1JB2A 4MJDA 2O3OA 1IVXA 1TRQA
chains in the Genus database with same CATH topology
2YX9A 4RBNA 1QAFA 5AIHA 1NB3I 1S723 2IUKA 4R9LA 3FG3A 4JF8A 4R9KA 4WP5A 4MMXB 1D6YA 3U1WA 4BTWA 3E99A 3U97A 1VQ63 2CC3A 2P0XA 1VQ93 2MC8A 4OK0A 3ROBA 1QJGA 1UW1A 5EQLA 2BNGA 3MPHA 2K0MA 1M904 3NXJA 2W03A 4H61A 1MOLA 3PXMA 3O8YA 5JBSA 3PYJA 2Z76A 4LMIA 4BTXA 4CDLA 4U13A 2XSOB 4WFOA 1PU4A 3CCV3 2GEYA 3CCM3 3KN4A 1OGZA 3NQYA 1GY6A 3CD63 1W00A 4MMYB 3PCSA 5LC6A 5CK6A 2P05A 1NB5I 1LOXA 1YIJ3 5DREA 2WO0A 4N6NB 4L8OA 4EV5A 2XGLA 5IERA 3UL6A 4JRFA 1JRQA 1K8A4 1DVCA 4LSOA 2WOFA 4FMAA 2XFSA 2XSHB 4AKZA 1KQS2 4WYKA 1OHOA 1Q864 4HM3B 1UI7A 2OQEA 4HJLB 4RZMA 1OCVA 1VQ83 4XB5A 1NJI4 1DMMA 3V99A 3VF1A 1GD4A 3BLZA 3OWYA 1EG9B 2OOVC 5D82A 2B1XB 1MNLA 2WOHA 2YFJB 5DRVA 1C7HA 1SPUA 4FCJA 3F7SA 3Q2PA 3QRDA 4CCVA 3VGNA 3TDGA 4BTYA 3SOYA 1QMAA 1CYVA 4XDWA 3EC9A 4NHFA 4KZ1A 3CPOA 1YI23 4N6OB 2RFRA 3SXXA 3NV0B 2STDA 1O7WB 4K61A 4FCMA 3OW22 4Q53A 1AVLA 3HZPA 1VZZA 3NM2A 1S5AA 4HVNA 3G713 4FMCA 3WODG 2CG1A 1WTHA 3RDEA 2CW9A 3GZRA 3S28A 1CQSA 3Q90A 3HK4A 1VQN3 3F40A 3WOFB 3CXC2 2W6JH 1G96A 3MWZA 3LOYA 1VQ43 3K5TA 1Y4KA 1IDPA 4HM6B 3JUOA 1TFOA 2Z6BA 1T5YA 3VSYA 5CLKA 3M8CA 2JQ5A 3G16A 4J9AA 2K54A 2CWUA 2P38A 3NV0A 2FXTA 3K9MC 3DMCA 4N3VA 3JUQA 1L5GB 2KCDA 2OTJ3 1WNHA 3B7CA 5G2GA 2QGUA 5BXQA 1IVVA 1OACA 2BMRB 3DGOA 3MKIA 1GY7A 1N5HA 2OOVA 3DGLA 1ROAA 2BMQB 5IEPA 4FCZA 1U8CB 4LZIA 4R4KA 5IG0A 3SEDA 4XBTA 3LYGA 5KP1A 4N6V0 1J2BA 2CH9A 1AV4A 2CHCA 4IT7A 2Z7AA 1R4CA 3AMOA 2UX0A 2GBXB 1RRLA 3K7CA 2YFLB 3FF2A 5AYRB 3DUKA 1HKXA 2F99A 1Q824 3OWUA 5IG5A 4WWUC 3MG3A 2INXA 3N8BA 4GL6A 2ZL8A 4HM7B 1NWWA 2ML6A 2Q07A 2W9QA 1DVDA 4N6TA 1TFKA 5HGRA 3FLJA 4PEJA 3BNEA 1GYBA 2WGOA 4WHAA 4L8PA 1KD14 3X3ZA 1ZX2A 3X3YA 1M1K4 3LTBA 3WA3A 3LXUX 1STDA 4IPBA 3UL5A 1JKGB 3A76A 3NBJA 4TX4A 1YJN3 3JUPA 1O7MB 3FSDA 4R1KA 3LT9A 4J8TA 3EN8A 1QVF2 3G4S3 4MMZB 3FH1A 1GY5A 5AI1A 3CC23 1YHQ3 1N5PA 2HMMB 3BNCA 4FMDA 2CIUA 1PFPA 3PS8A 5EVHA 1W02A 1KSIA 1OHSA 1TUHA 3BNBA 3G8ZA 3CC43 1W01A 1A2VA 1IV9A 2W56A 1IT8A 4AEQA 2F86B 1IU7A 4O2HA 1STFI 3GWRA 3KZTA 3D3LA 3K63A 1CEWI 3LTCA 2CKFB 4X2OA 4L7KA 3FG4A 1OPYA 2Y74A 2RSXA 3KSPA 1W7CA 2XEPA 1SJWA 5LC7A 4EV2A 2GBWB 2P09A 2GEXA 5TGNA 3L0RA 3PGBA 3SX1A 6STDA 3NX0A 3I563 1WQLB 1FA3A 3K0ZA 3NHXA 1A67A 1W6CA 3N54B 4XBXA 2HMKB 5IF6A 1W2ZA 1W5ZA 2SBLA 2W56B 3H51A 3B8LA 2V1LA 1JKGA 1KWIA 2GU3A 1IQYA 1D6ZA 3LH4A 2BT3A 1HU9A 4FR9A 3CC73 3G0KA 3RGRA 3UB1A 3WDGB 2PZVA 3KSED 1U5OA 4MEIA 4HM0B 2W04A 5ELUA 3I553 1YIT3 4AKYA 3T8UA 1US1A 1WMNA 5D83A 1JNQA 2BMOB 1FGOA 3LMLA 4HKVB 2HMJB 2O9UX 1RRHA 3N9HA 2OCTA 1W6YA 1E97A 8CHOA 1K28A 1CYUA 1OHPA 3DGMA 3S5CA 1ISKA 3HI7A 3ECFA 2MF7A 3HIGA 2XFTA 4N6LA 4RNYA 4XBYA 4LEHA 1LVNA 3GZBA 1OF5B 2QA43 3EB8A 3STDA 3F8XA 4EBGA 2OTL3 4K90B 4NREA 2D42A 4O3VA 4IIAA 4KFDA 3BB9A 5JPUA 5AYSC 2BHMA 2R4IA 2FGTA 2Z77A 3V92A 3FCSB 2XF3A 2HMLB 3MHEA 3CMA3 3Q1CA 4EYCA 1IV7A 2JDIH 4HM4B 5FGOA 3LT8A 1SIHA 2E2UA 2CFLA 2CWVA 2HMOB 2C10A 2I9WA 5ELJA 1O7GB 1K9M4 1WMPA 5STDA 3CCJ3 1V74A 1O7NB 1Q42A 2CFDA 1W4NA 5IG3A 1A90A 1NO3A 3IMAB 3DM8A 2IA7A 3NQZA 1JN5B 3X3XA 3F14A 3EN1B 5IG4A 2C11A 2ZDJA 1N9JA 1GS3A 1M1XB 4GB5A 1UUVB 3WOEB 3X42A 5I97A 2ML5A 1F8NA 3JVCA 3J7Yd 2IMJA 3V98A 3FGYA 2BO9B 2CFWA 3HIIA 4QWTA 4KVHA 2QEX3 2D1WA 5FW5A 3SOAA 2B24B 2Y73A 1YGEA 1AVKA 4R80A 1N9EA 1IQ8A 3CNXA 3CPW2 4N6UA 1RJOA 1WMOA 1DYUA 1O7PB 1GD3A 2HMNB 3D9RA 1QVG2 4XDVA 1IK3A 1JJ22 3MSOA 1VQP3 4ORLA 1DMNA 2CG0A 1SQWA 3H3HA 1A2KA 3T8NA 3LTAA 1W2B2 3UJMA 3IPTA 5EEOA 1N8R4 1Q40A 4FMBA 5AIFA 3IJEB 2KRTA 2CFGA 2PNCA 5AEWB 3CU3A 1EQKA 4HZBB 3MG1A 1N8QA 1KC84 5IW9A 3CNMA 4X2HA 3MYTA 3I0YA 1EA2A 2OQEC 3JUNA 1VQK3 1Q7Y4 4HM2B 1IQXA 1TP6A 3EJVA 3S27A 3CCS3 5KP4A 1IVUA 2IUJA 3DY5A 3EBTA 4EC6A 3GZYB 3X41A 4LGQA 3KFQC 1JN5A 5CF1A 3QK9A 4HBRA 3B4OA 3PCRA 1K734 4RNZA 2XH9A 1ASKA 1RN7A 3S67A 1VQO3 5IENA 3CCE3 1Q40B 1FGTA 3GAXA 3EBYA 3RGAA 3F7XA 3X40A 1OGXA 1QALA 3DZLA 2CFKA 2L4VA 1YVBI 2M7OA 3KE7A 1ULIB 4I4KA 5CXOA 1IVWA 3EE1A 3ALAA 3BNDA 1JB4A 1IT7A 2KXGA 5D81A 3FG1A 3OX9A 2W2CA 2W0QA 2CWTA 3PZWA 1BUQA 2RGQA 2CK3H 3EX9A 4KFEA 4KFFA 2A15A 3FF0A 3FZWA 3WA2X 2OWPA 3G6E3 4N6MA 1VQ53 3FKAA 5JPPA 1OH0A 1YJW3 2XRXB 1Z1SA 1VQL3 3HX8A 3MG2A 4HM5B 1K41A 1W6GA 1AR0A 1DMQA 3F9SA 5AIIA 3CME3 3NBRA 1E3VA 3T0UA 3ER7A 3CCL3 4G1MB 1JB5A 2LYXA 3NM7A 1TIJA 5IEOA 1NU3A 3SVAA 2XR8B 3B4PA 2F98A 4HM1B 2RCDA 3KKGA 3OWSA 2GU1A 2W9PA 3AMOB 1JV2B 2P0MA 1VQ73 1FGRA 3KIIA 4OUQA 1ULJB 3DXOA 2GXFA 4OVMA 4EXRA 1O7HB 3GZXB 3NBBA 4HYZA 5AEUB 4K1VA 3CCU3 3DGNA 2WGQA 1FUWA 4H3UA 3EF8A 2E2VA 1VQM3 1FGQA 1M9GA 4O02B 2FNQA 3LZAA 5KP3A 1ROVA 4HZ9B 5A0OB 3CCQ3 1LNHA 7STDA 2XGNA 3JUMA 3OV4A 1YJ93 3GRDA 3OXAA 3UNLA 4K1UA 5AIGA 1ZO2A 1E3RA 3NUVA 1SIIA 4HM8B 4WYKB 3SLUA 4ZM8A 1LXEA 4O8SA 2YFIB 1D6UA 2E2TA 1UI8A 4XM4A 2QIYA 1TU5A 3WMDA 3CCR3 1FGMA 5BVBA 2LQVA 1EKMA 1OUNA 1NDOB 3LTDA 4STDA 5CF2A 3EHCA 3EQQB 1Q814 1UUWB 1OF5A 1QAKA 3F8HA 3S29A 1RKYA 1JB2A 4MJDA 2O3OA 1IVXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U5O A;  2BMR B;  4HM0 B;  1ASK A;  5AIH A;  3MKI A;  1GY7 A;  5IEN A;  4R9L A;  3T8U A;  5D83 A;  1Q40 B;  2BMQ B;  4R9K A;  4WP5 A;  2BMO B;  3EBY A;  3RGA A;  4HKV B;  3SED A;  3F7X A;  5IG0 A;  5IEP A;  2HMJ B;  4XBT A;  1W6Y A;  1OGX A;  1E97 A;  3E99 A;  3LYG A;  3DZL A;  8CHO A;  5KP1 A;  5BXQ A;  3KE7 A;  1OHP A;  2CHC A;  3S5C A;  2Z7A A;  3ROB A;  1QJG A;  1ISK A;  1ULI B;  2BNG A;  4I4K A;  5CXO A;  4CDL A;  2UX0 A;  3ECF A;  3NXJ A;  2GBX B;  3OX9 A;  1JB4 A;  3K7C A;  4XBY A;  5D81 A;  2YFL B;  3FF2 A;  2W2C A;  2Z76 A;  1HKX A;  2F99 A;  1OF5 B;  3B7C A;  3DUK A;  3GZB A;  3OWU A;  2XSO B;  4LMI A;  3F8X A;  4U13 A;  2RGQ A;  4WWU C;  3MG3 A;  2INX A;  3EX9 A;  3STD A;  4HM7 B;  1BUQ A;  1NWW A;  2GEY A;  4IIA A;  2A15 A;  3FF0 A;  3BB9 A;  3FZW A;  1OGZ A;  5JPU A;  2OWP A;  1GY6 A;  1W00 A;  2R4I A;  2Z77 A;  5CK6 A;  3FKA A;  5JPP A;  1OH0 A;  2HML B;  2XRX B;  3FLJ A;  3MHE A;  4PEJ A;  5DRE A;  1GYB A;  5HGR A;  4L8O A;  1Z1S A;  5IER A;  3HX8 A;  3MG2 A;  4L8P A;  4HM5 B;  1K41 A;  4HM4 B;  1AR0 A;  5G2G A;  1DMQ A;  1ZX2 A;  2HMO B;  2I9W A;  3F9S A;  1O7G B;  5AII A;  5STD A;  3NBR A;  1E3V A;  1O7N B;  1Q42 A;  2XSH B;  3ER7 A;  1STD A;  4WYK A;  1OHO A;  1JKG B;  3A76 A;  1JB5 A;  3DM8 A;  5IG3 A;  3JUP A;  1JN5 B;  4HM3 B;  3F14 A;  3EN1 B;  1O7M B;  5IEO A;  5IG4 A;  3FSD A;  4HJL B;  5IG5 A;  4RZM A;  4R1K A;  1NU3 A;  4J8T A;  1GS3 A;  2XR8 B;  2F98 A;  1UUV B;  3B4P A;  3EN8 A;  4GB5 A;  4HM1 B;  1OCV A;  2RCD A;  3KKG A;  3OWS A;  4XB5 A;  1DMM A;  3FH1 A;  4OUQ A;  2IMJ A;  1GY5 A;  3BLZ A;  3OWY A;  1EG9 B;  1ULJ B;  3DXO A;  3FGY A;  4LEH A;  5AI1 A;  2GXF A;  4OVM A;  2HMM B;  5D82 A;  1O7H B;  2B1X B;  3GZX B;  4KVH A;  2YFJ B;  5DRV A;  5EVH A;  2B24 B;  5FW5 A;  1W02 A;  3SOA A;  1C7H A;  5AEU B;  1OHS A;  1TUH A;  4K1V A;  3CNX A;  4FCJ A;  3G8Z A;  3F7S A;  1W01 A;  4H3U A;  5AIG A;  2HMN B;  1O7P B;  3VGN A;  3D9R A;  3EF8 A;  2F86 B;  4XDV A;  3SOY A;  1QMA A;  3MSO A;  3EC9 A;  3GWR A;  3KZT A;  4ORL A;  4XDW A;  1DMN A;  3H3H A;  3CPO A;  1A2K A;  3T8N A;  2RFR A;  3NV0 B;  3UJM A;  2STD A;  3IPT A;  5KP3 A;  3LZA A;  1O7W B;  2CKF B;  4FCM A;  1Q40 A;  4HZ9 B;  4L7K A;  4Q53 A;  4X2O A;  3HZP A;  1OPY A;  3KSP A;  5AIF A;  1VZZ A;  1SJW A;  3NM2 A;  2GBW B;  1S5A A;  2GEX A;  3CU3 A;  5TGN A;  5AEW B;  4HZB B;  6STD A;  3MG1 A;  4HVN A;  7STD A;  3OV4 A;  3JUM A;  3GRD A;  1WQL B;  3OXA A;  3K0Z A;  3CNM A;  4K1U A;  4X2H A;  3MYT A;  3NHX A;  1ZO2 A;  1E3R A;  3GZR A;  1CQS A;  1EA2 A;  3HK4 A;  3I0Y A;  3JUN A;  3NUV A;  3F40 A;  2HMK B;  3Q90 A;  4HM2 B;  4HM8 B;  4WYK B;  4XBX A;  5IF6 A;  2YFI B;  1TP6 A;  1IDP A;  3EJV A;  4HM6 B;  3H51 A;  4XM4 A;  3JUO A;  2QIY A;  3B8L A;  3VSY A;  1JKG A;  5CLK A;  3WMD A;  3M8C A;  5KP4 A;  2JQ5 A;  3G16 A;  5BVB A;  1OUN A;  4STD A;  1NDO B;  2K54 A;  4J9A A;  5CF2 A;  3EHC A;  3EQQ B;  4MJD A;  3EBT A;  3NV0 A;  3GZY B;  1UUW B;  3DMC A;  1OF5 A;  4LGQ A;  4N3V A;  3F8H A;  1JN5 A;  3JUQ A;  5CF1 A;  3G0K A;  3RGR A;  1JB2 A;  3B4O A;  2PZV A;  3UNL A;  2QGU A; 
#chains in the Genus database with same CATH topology
 2YX9 A;  1GSP A;  4RBN A;  1QAF A;  5AIH A;  1NB3 I;  1S72 3;  2IUK A;  1MWT A;  4R9L A;  2ZHX B;  3FG3 A;  4JF8 A;  2GSP A;  4R9K A;  4WP5 A;  4MMX B;  1D6Y A;  3U1W A;  4BTW A;  1BSC A;  3E99 A;  3U97 A;  1VQ6 3;  2CC3 A;  2P0X A;  1RGG A;  2MC8 A;  4OK0 A;  1VQ9 3;  3ROB A;  1QJG A;  1UW1 A;  5EQL A;  2BNG A;  3MPH A;  2K0M A;  1M90 4;  3NXJ A;  2W03 A;  4H61 A;  1MOL A;  1B21 A;  1BRS A;  3PXM A;  3O8Y A;  1X1Y A;  5JBS A;  3PYJ A;  2Z76 A;  1BNG A;  4LMI A;  4BTX A;  4CDL A;  4U13 A;  1YNV X;  2XSO B;  1R4Y A;  4WFO A;  1PU4 A;  3CCV 3;  2GEY A;  1B3S A;  1AQZ A;  3CCM 3;  3KN4 A;  1OGZ A;  3NQY A;  1LOY A;  1GY6 A;  3CD6 3;  1W00 A;  4MMY B;  3PCS A;  5LC6 A;  5CK6 A;  2P05 A;  5BIR A;  1NB5 I;  1BUJ A;  1Q9E A;  1LOX A;  1YIJ 3;  4J5K A;  5DRE A;  2WO0 A;  4N6N B;  4L8O A;  4EV5 A;  2XGL A;  5IER A;  3UL6 A;  9RNT A;  4JRF A;  1RGE A;  1JRQ A;  4CPK A;  1K8A 4;  1DVC A;  4LSO A;  2WOF A;  4FMA A;  2XFS A;  2XSH B;  4AKZ A;  1KQS 2;  4WYK A;  1OHO A;  3AHS A;  1Q86 4;  1I0V A;  4HM3 B;  2R41 A;  1UI7 A;  2OQE A;  4HJL B;  4RZM A;  2H0G A;  1FZU A;  1RHL A;  1FUT A;  1OCV A;  1VQ8 3;  1T3B A;  1I3I A;  4XB5 A;  1NJI 4;  1DMM A;  3V99 A;  3VF1 A;  1GD4 A;  3BLZ A;  3OWY A;  1EG9 B;  2BU4 A;  2OOV C;  5D82 A;  2B1X B;  1MNL A;  2WOH A;  2YFJ B;  5DRV A;  1B2X A;  1GMP A;  1C7H A;  1SPU A;  4BL2 A;  4FCJ A;  2CX1 A;  3F7S A;  3Q2P A;  2KF5 A;  3QRD A;  4CCV A;  3VGN A;  1MGR A;  3TDG A;  4BTY A;  3SOY A;  1RGA A;  1QMA A;  1CYV A;  3AGN A;  3EC9 A;  4XDW A;  1UUG B;  4NHF A;  4KZ1 A;  3CPO A;  1YI2 3;  4N6O B;  2RFR A;  3SXX A;  3NV0 B;  2STD A;  1FYS A;  1O7W B;  4K61 A;  4FCM A;  3OW2 2;  4Q53 A;  1AVL A;  3HZP A;  4J5G A;  1VZZ A;  3NM2 A;  5GSP A;  1S5A A;  4HVN A;  3URP A;  3G71 3;  4FMC A;  3WOD G;  1BOX A;  2CG1 A;  1WTH A;  3RDE A;  2CW9 A;  3GZR A;  3S28 A;  1CQS A;  1PYL A;  3HK4 A;  3Q90 A;  1VQN 3;  3F40 A;  2CX0 A;  3WOF B;  3CXC 2;  2W6J H;  1G96 A;  3MWZ A;  3LOY A;  1VQ4 3;  3D5I A;  3K5T A;  1Y4K A;  1IDP A;  1BGS A;  4HM6 B;  1JZD A;  1TFO A;  2Z6B A;  1T5Y A;  3JUO A;  5CLK A;  3VSY A;  3M8C A;  2JQ5 A;  3G16 A;  4J9A A;  2K54 A;  2CWU A;  2SAR A;  5M18 A;  2P38 A;  3NV0 A;  2FXT A;  3K9M C;  3DMC A;  2K3D A;  4N3V A;  3JUQ A;  1L5G B;  2KCD A;  2OTJ 3;  1WNH A;  3D79 A;  3B7C A;  5G2G A;  2QGU A;  1X1X A;  5BXQ A;  1IYY A;  1IVV A;  1OAC A;  2BMR B;  2KAA A;  3DGO A;  1RN4 A;  3MKI A;  4CJN A;  1GY7 A;  1N5H A;  1B2S A;  2OOV A;  1BNI A;  1RNB A;  1BVI A;  3DGL A;  1ROA A;  2BMQ B;  5IEP A;  8RNT A;  4FCZ A;  1B27 A;  1U8C B;  4LZI A;  4R4K A;  5IG0 A;  3SED A;  4XBT A;  3LYG A;  5KP1 A;  4N6V 0;  2ZA4 A;  1J2B A;  2CH9 A;  1AV4 A;  2CHC A;  3AHW A;  2Z7A A;  4IT7 A;  1MWS A;  1R4C A;  3AMO A;  2UX0 A;  1RGC A;  2GBX B;  3WHO A;  1RRL A;  3K7C A;  1UDI I;  2YFL B;  3FF2 A;  3DUK A;  1HKX A;  1UCK A;  2F99 A;  5G1L A;  5AYR B;  1Q82 4;  3OWU A;  5IG5 A;  4WWU C;  3MG3 A;  1MWU A;  2INX A;  3N8B A;  2ZL8 A;  4GL6 A;  4HM7 B;  2IY2 A;  1NWW A;  2ML6 A;  3A5E A;  2Q07 A;  2W9Q A;  1I2G A;  4NPB A;  1DVD A;  4N6T A;  1TFK A;  5HGR A;  3FLJ A;  4PEJ A;  2F4Y A;  3BNE A;  1GYB A;  2WGO A;  4WHA A;  1I70 A;  1G02 A;  4L8P A;  1KD1 4;  3X3Z A;  1ZX2 A;  1BU4 A;  1BSA A;  3X3Y A;  1M1K 4;  3LTB A;  3WA3 A;  3LXU X;  1BSB A;  3SYU A;  1STD A;  2H0H A;  4IPB A;  3UL5 A;  1C54 A;  1JKG B;  3A76 A;  3NBJ A;  4TX4 A;  1YJN 3;  3JUP A;  3ZG5 A;  1O7M B;  3FSD A;  4R1K A;  3LT9 A;  1BRK A;  4J8T A;  3EN8 A;  1MGW A;  1QVF 2;  3G4S 3;  4MMZ B;  1LRA A;  2UUG C;  3FH1 A;  1GOY A;  1GMQ A;  1GY5 A;  5G1K A;  5AI1 A;  3CC2 3;  1YHQ 3;  1N5P A;  2HMM B;  3BNC A;  4FMD A;  2CIU A;  1PFP A;  3PS8 A;  6RNT A;  5EVH A;  1W02 A;  1KSI A;  3RNT A;  1OHS A;  1TUH A;  3BNB A;  3G8Z A;  4ILF A;  3CC4 3;  1W01 A;  1A2V A;  1IV9 A;  2W56 A;  1IT8 A;  2KF6 A;  4AEQ A;  1FW7 A;  2F86 B;  1LOV A;  1IU7 A;  4O2H A;  1STF I;  1GOV A;  1RGL A;  3GWR A;  3KZT A;  6GSP A;  3D3L A;  3K63 A;  1CEW I;  3LTC A;  2CKF B;  4X2O A;  4L7K A;  3FG4 A;  1OPY A;  2Y74 A;  2RSX A;  3KSP A;  1W7C A;  2XEP A;  1SJW A;  4GHO A;  5LC7 A;  2GBW B;  4EV2 A;  1I8V A;  2GEX A;  1FUS A;  2P09 A;  3L0R A;  3PGB A;  3Q3F A;  5TGN A;  3SX1 A;  6STD A;  3NX0 A;  1UCI A;  1WQL B;  2AAE A;  3I56 3;  1FA3 A;  3K0Z A;  3NHX A;  1A67 A;  1W6C A;  1I3F A;  3N54 B;  4XBX A;  2HMK B;  5IF6 A;  1W2Z A;  1W5Z A;  2SBL A;  2W56 B;  3H51 A;  3B8L A;  2V1L A;  1JKG A;  1KWI A;  2GU3 A;  1IQY A;  1D6Z A;  3LH4 A;  2BT3 A;  1HU9 A;  1BSD A;  4FR9 A;  3ZG0 A;  3G0K A;  3RGR A;  3UB1 A;  3CC7 3;  3WDG B;  2PZV A;  3KSE D;  1T2H A;  1U5O A;  4MEI A;  1DET A;  4HM0 B;  1BNS A;  2W04 A;  5ELU A;  3KCH A;  3I55 3;  1BRJ A;  1YIT 3;  2HOH A;  4AKY A;  3T8U A;  1US1 A;  1WMN A;  5D83 A;  1JNQ A;  2BMO B;  1BNR A;  1FGO A;  3LML A;  4HKV B;  2HMJ B;  1UGI A;  1RRH A;  2J8X B;  2O9U X;  1V57 A;  2OCT A;  1W6Y A;  3N9H A;  1E97 A;  5HOH A;  8CHO A;  1K28 A;  4RNT A;  1CYU A;  1I2E A;  1OHP A;  3DGM A;  3GSP A;  3S5C A;  1ISK A;  3HI7 A;  1GOU A;  3ECF A;  2MF7 A;  3HIG A;  1JBT A;  2XFT A;  2F5M A;  4N6L A;  4RNY A;  1ZGX A;  4XBY A;  5M1A A;  4LEH A;  1LVN A;  1BAO A;  1OF5 B;  3GZB A;  2QA4 3;  1I2F A;  3EB8 A;  3STD A;  1YGW A;  3F8X A;  4EBG A;  4K90 B;  4NRE A;  2OTL 3;  2D42 A;  4O3V A;  4IIA A;  4KFD A;  3BB9 A;  1CH0 A;  5AYS C;  5JPU A;  2BHM A;  2R4I A;  2FGT A;  2Z77 A;  3V92 A;  1BSE A;  3FCS B;  2XF3 A;  3D5G A;  2HML B;  3MHE A;  3CMA 3;  3Q1C A;  4EYC A;  1IV7 A;  1X1W A;  2JDI H;  4HM4 B;  5FGO A;  3LT8 A;  1SIH A;  2E2U A;  2CFL A;  2CWV A;  2HMO B;  2C10 A;  2I9W A;  5ELJ A;  1O7G B;  1UCL A;  3ZFZ A;  1WMP A;  5STD A;  1PY3 A;  1V74 A;  3DGY A;  3CCJ 3;  1K9M 4;  1O7N B;  1Q42 A;  1BRG A;  4BIR A;  1BRH A;  2CFD A;  1W4N A;  5IG3 A;  1A90 A;  1NO3 A;  3IMA B;  3DM8 A;  2IA7 A;  3NQZ A;  1JN5 B;  3X3X A;  3F14 A;  3EN1 B;  5IG4 A;  7RNT A;  2C11 A;  1HYF A;  2ZDJ A;  1N9J A;  1GS3 A;  1M1X B;  1EUI C;  1UUV B;  4GB5 A;  3WOE B;  3X42 A;  5I97 A;  1LQG C;  2ML5 A;  1F8N A;  3JVC A;  1MWR A;  3J7Y d;  2IMJ A;  3V98 A;  3FGY A;  2BO9 B;  2CFW A;  4KT3 B;  3HII A;  4QWT A;  4KVH A;  2QEX 3;  2D1W A;  1LNI A;  1NNV A;  2B24 B;  2Y73 A;  1YGE A;  1AVK A;  4R80 A;  5FW5 A;  3SOA A;  1N9E A;  1B2M A;  1IQ8 A;  3CNX A;  1TTO A;  4N6U A;  3CPW 2;  1RJO A;  1WMO A;  1DYU A;  1O7P B;  1GD3 A;  2H0I A;  2HMN B;  3D9R A;  4HAA A;  1QVG 2;  4XDV A;  1IK3 A;  1JJ2 2;  3MSO A;  1VQP 3;  4ORL A;  1DMN A;  2CG0 A;  1SQW A;  1X1U A;  1A2K A;  3H3H A;  3LTA A;  3T8N A;  4BL3 A;  3UJM A;  3IPT A;  5EEO A;  5M19 A;  1W2B 2;  1N8R 4;  5RNT A;  1Q40 A;  4FMB A;  1DE3 A;  5AIF A;  3IJE B;  2KRT A;  2CFG A;  1A2P A;  2PNC A;  5AEW B;  3CU3 A;  1EQK A;  4HZB B;  3MG1 A;  1N8Q A;  1KC8 4;  4GSP A;  5IW9 A;  2KF4 A;  3CNM A;  4X2H A;  3MYT A;  3I0Y A;  1EA2 A;  2OQE C;  3JUN A;  1VQK 3;  1Q7Y 4;  4HM2 B;  1BNJ A;  1IQX A;  1TP6 A;  3EJV A;  2KF3 A;  3S27 A;  3D4A A;  4BU4 A;  3CCS 3;  5KP4 A;  1UGH I;  1IVU A;  2IUJ A;  3DY5 A;  3EBT A;  4EC6 A;  3GZY B;  3X41 A;  4LGQ A;  3KFQ C;  1RLS A;  7GSP A;  1JN5 A;  5CF1 A;  3QK9 A;  4HBR A;  3B4O A;  3PCR A;  1K73 4;  4RNZ A;  1BNE A;  2C4B A;  2XH9 A;  1ASK A;  4I5Q A;  1RN7 A;  3S67 A;  1VQO 3;  5IEN A;  1TJD A;  1HZ1 A;  3CCE 3;  1Q40 B;  1FGT A;  3GAX A;  5BU4 A;  1JZO A;  3EBY A;  3RGA A;  1JBR A;  3F7X A;  3X40 A;  1ZS7 A;  2RBI A;  1OGX A;  1QAL A;  1UCJ A;  2CFK A;  2L4V A;  3DZL A;  1YVB I;  2M7O A;  3KE7 A;  2F5W A;  3BU4 A;  2AAD A;  1ULI B;  4I4K A;  5CXO A;  1IVW A;  1BRN L;  3EE1 A;  3ALA A;  1RGF A;  1JB4 A;  1IT7 A;  3BND A;  2KXG A;  5D81 A;  3FG1 A;  3OX9 A;  2W2C A;  2W0Q A;  1AY7 A;  2CWT A;  1BAN A;  3PZW A;  1BUQ A;  2RGQ A;  2CK3 H;  3EX9 A;  4KFE A;  4KFF A;  1SAR A;  2A15 A;  3FF0 A;  3FZW A;  3WA2 X;  2OWP A;  3G6E 3;  4N6M A;  1VQ5 3;  3FKA A;  5JPP A;  1OH0 A;  1VQQ A;  2XRX B;  1YJW 3;  1RGK A;  1BRI A;  1Z1S A;  3WR2 A;  1VQL 3;  3HX8 A;  3MG2 A;  4HM5 B;  1B2Z A;  1K41 A;  1AR0 A;  1W6G A;  1DMQ A;  1LOW A;  1G0T A;  3F9S A;  1GMR A;  5AII A;  2IYJ A;  3CME 3;  3NBR A;  1RTU A;  1E3V A;  1I0X A;  1RN1 A;  3ER7 A;  3T0U A;  3CCL 3;  1BNF A;  4G1M B;  1JB5 A;  1RCL A;  2LYX A;  3NM7 A;  1TIJ A;  2F56 A;  5IEO A;  1V58 A;  1B20 A;  1NU3 A;  4HOH A;  2XR8 B;  3B4P A;  2F98 A;  3SVA A;  4HM1 B;  2RCD A;  1Q7H A;  3KKG A;  3OWS A;  1YVS A;  2GU1 A;  2W9P A;  1JV2 B;  2P0M A;  2L1S A;  1FGR A;  3AMO B;  1VQ7 3;  3KII A;  4OUQ A;  4EW5 A;  1ULJ B;  3DXO A;  2GXF A;  4OVM A;  4EXR A;  1O7H B;  3GZX B;  3NBB A;  1B2U A;  4HYZ A;  5AEU B;  4K1V A;  3CCU 3;  3DGN A;  2WGQ A;  1FUW A;  1RMS A;  4H3U A;  3BIR A;  1EEJ A;  3EF8 A;  3DH2 A;  2E2V A;  1RSN A;  1LQM B;  1VQM 3;  1FGQ A;  1M9G A;  1JBS A;  1RNT A;  2FNQ A;  3AGO A;  3LZA A;  4O02 B;  1ROV A;  4HZ9 B;  5KP3 A;  1TRP A;  5A0O B;  3HOH A;  3CCQ 3;  1LNH A;  7STD A;  2UGI A;  2BIR A;  2XGN A;  3JUM A;  3OV4 A;  1YJ9 3;  3GRD A;  3OXA A;  3UNL A;  1RGH A;  4K1U A;  5AIG A;  1ZO2 A;  1E3R A;  1RDS A;  3NUV A;  1T2I A;  1SII A;  4HM8 B;  2RNT A;  4WYK B;  3SLU A;  4ZM8 A;  1LXE A;  4O8S A;  2YFI B;  1D6U A;  2E2T A;  1UI8 A;  4XM4 A;  2QIY A;  4DKI A;  1TU5 A;  3WMD A;  3CCR 3;  1FGM A;  5BVB A;  2LQV A;  1EKM A;  1OUN A;  1NDO B;  3LTD A;  4LYL B;  1BIR A;  3EHC A;  3EQQ B;  4STD A;  5CF2 A;  1Q81 4;  1UUW B;  1OF5 A;  1QAK A;  1RCK A;  3F8H A;  3S29 A;  1RKY A;  1JB2 A;  4MJD A;  2O3O A;  1IVX A;  1TRQ A; 
#chains in the Genus database with same CATH homology
 2YX9 A;  4RBN A;  1QAF A;  5AIH A;  1NB3 I;  1S72 3;  2IUK A;  4R9L A;  3FG3 A;  4JF8 A;  4R9K A;  4WP5 A;  4MMX B;  1D6Y A;  3U1W A;  4BTW A;  3E99 A;  3U97 A;  1VQ6 3;  2CC3 A;  2P0X A;  1VQ9 3;  2MC8 A;  4OK0 A;  3ROB A;  1QJG A;  1UW1 A;  5EQL A;  2BNG A;  3MPH A;  2K0M A;  1M90 4;  3NXJ A;  2W03 A;  4H61 A;  1MOL A;  3PXM A;  3O8Y A;  5JBS A;  3PYJ A;  2Z76 A;  4LMI A;  4BTX A;  4CDL A;  4U13 A;  2XSO B;  4WFO A;  1PU4 A;  3CCV 3;  2GEY A;  3CCM 3;  3KN4 A;  1OGZ A;  3NQY A;  1GY6 A;  3CD6 3;  1W00 A;  4MMY B;  3PCS A;  5LC6 A;  5CK6 A;  2P05 A;  1NB5 I;  1LOX A;  1YIJ 3;  5DRE A;  2WO0 A;  4N6N B;  4L8O A;  4EV5 A;  2XGL A;  5IER A;  3UL6 A;  4JRF A;  1JRQ A;  1K8A 4;  1DVC A;  4LSO A;  2WOF A;  4FMA A;  2XFS A;  2XSH B;  4AKZ A;  1KQS 2;  4WYK A;  1OHO A;  1Q86 4;  4HM3 B;  1UI7 A;  2OQE A;  4HJL B;  4RZM A;  1OCV A;  1VQ8 3;  4XB5 A;  1NJI 4;  1DMM A;  3V99 A;  3VF1 A;  1GD4 A;  3BLZ A;  3OWY A;  1EG9 B;  2OOV C;  5D82 A;  2B1X B;  1MNL A;  2WOH A;  2YFJ B;  5DRV A;  1C7H A;  1SPU A;  4FCJ A;  3F7S A;  3Q2P A;  3QRD A;  4CCV A;  3VGN A;  3TDG A;  4BTY A;  3SOY A;  1QMA A;  1CYV A;  4XDW A;  3EC9 A;  4NHF A;  4KZ1 A;  3CPO A;  1YI2 3;  4N6O B;  2RFR A;  3SXX A;  3NV0 B;  2STD A;  1O7W B;  4K61 A;  4FCM A;  3OW2 2;  4Q53 A;  1AVL A;  3HZP A;  1VZZ A;  3NM2 A;  1S5A A;  4HVN A;  3G71 3;  4FMC A;  3WOD G;  2CG1 A;  1WTH A;  3RDE A;  2CW9 A;  3GZR A;  3S28 A;  1CQS A;  3Q90 A;  3HK4 A;  1VQN 3;  3F40 A;  3WOF B;  3CXC 2;  2W6J H;  1G96 A;  3MWZ A;  3LOY A;  1VQ4 3;  3K5T A;  1Y4K A;  1IDP A;  4HM6 B;  3JUO A;  1TFO A;  2Z6B A;  1T5Y A;  3VSY A;  5CLK A;  3M8C A;  2JQ5 A;  3G16 A;  4J9A A;  2K54 A;  2CWU A;  2P38 A;  3NV0 A;  2FXT A;  3K9M C;  3DMC A;  4N3V A;  3JUQ A;  1L5G B;  2KCD A;  2OTJ 3;  1WNH A;  3B7C A;  5G2G A;  2QGU A;  5BXQ A;  1IVV A;  1OAC A;  2BMR B;  3DGO A;  3MKI A;  1GY7 A;  1N5H A;  2OOV A;  3DGL A;  1ROA A;  2BMQ B;  5IEP A;  4FCZ A;  1U8C B;  4LZI A;  4R4K A;  5IG0 A;  3SED A;  4XBT A;  3LYG A;  5KP1 A;  4N6V 0;  1J2B A;  2CH9 A;  1AV4 A;  2CHC A;  4IT7 A;  2Z7A A;  1R4C A;  3AMO A;  2UX0 A;  2GBX B;  1RRL A;  3K7C A;  2YFL B;  3FF2 A;  5AYR B;  3DUK A;  1HKX A;  2F99 A;  1Q82 4;  3OWU A;  5IG5 A;  4WWU C;  3MG3 A;  2INX A;  3N8B A;  4GL6 A;  2ZL8 A;  4HM7 B;  1NWW A;  2ML6 A;  2Q07 A;  2W9Q A;  1DVD A;  4N6T A;  1TFK A;  5HGR A;  3FLJ A;  4PEJ A;  3BNE A;  1GYB A;  2WGO A;  4WHA A;  4L8P A;  1KD1 4;  3X3Z A;  1ZX2 A;  3X3Y A;  1M1K 4;  3LTB A;  3WA3 A;  3LXU X;  1STD A;  4IPB A;  3UL5 A;  1JKG B;  3A76 A;  3NBJ A;  4TX4 A;  1YJN 3;  3JUP A;  1O7M B;  3FSD A;  4R1K A;  3LT9 A;  4J8T A;  3EN8 A;  1QVF 2;  3G4S 3;  4MMZ B;  3FH1 A;  1GY5 A;  5AI1 A;  3CC2 3;  1YHQ 3;  1N5P A;  2HMM B;  3BNC A;  4FMD A;  2CIU A;  1PFP A;  3PS8 A;  5EVH A;  1W02 A;  1KSI A;  1OHS A;  1TUH A;  3BNB A;  3G8Z A;  3CC4 3;  1W01 A;  1A2V A;  1IV9 A;  2W56 A;  1IT8 A;  4AEQ A;  2F86 B;  1IU7 A;  4O2H A;  1STF I;  3GWR A;  3KZT A;  3D3L A;  3K63 A;  1CEW I;  3LTC A;  2CKF B;  4X2O A;  4L7K A;  3FG4 A;  1OPY A;  2Y74 A;  2RSX A;  3KSP A;  1W7C A;  2XEP A;  1SJW A;  5LC7 A;  4EV2 A;  2GBW B;  2P09 A;  2GEX A;  5TGN A;  3L0R A;  3PGB A;  3SX1 A;  6STD A;  3NX0 A;  3I56 3;  1WQL B;  1FA3 A;  3K0Z A;  3NHX A;  1A67 A;  1W6C A;  3N54 B;  4XBX A;  2HMK B;  5IF6 A;  1W2Z A;  1W5Z A;  2SBL A;  2W56 B;  3H51 A;  3B8L A;  2V1L A;  1JKG A;  1KWI A;  2GU3 A;  1IQY A;  1D6Z A;  3LH4 A;  2BT3 A;  1HU9 A;  4FR9 A;  3CC7 3;  3G0K A;  3RGR A;  3UB1 A;  3WDG B;  2PZV A;  3KSE D;  1U5O A;  4MEI A;  4HM0 B;  2W04 A;  5ELU A;  3I55 3;  1YIT 3;  4AKY A;  3T8U A;  1US1 A;  1WMN A;  5D83 A;  1JNQ A;  2BMO B;  1FGO A;  3LML A;  4HKV B;  2HMJ B;  2O9U X;  1RRH A;  3N9H A;  2OCT A;  1W6Y A;  1E97 A;  8CHO A;  1K28 A;  1CYU A;  1OHP A;  3DGM A;  3S5C A;  1ISK A;  3HI7 A;  3ECF A;  2MF7 A;  3HIG A;  2XFT A;  4N6L A;  4RNY A;  4XBY A;  4LEH A;  1LVN A;  3GZB A;  1OF5 B;  2QA4 3;  3EB8 A;  3STD A;  3F8X A;  4EBG A;  2OTL 3;  4K90 B;  4NRE A;  2D42 A;  4O3V A;  4IIA A;  4KFD A;  3BB9 A;  5JPU A;  5AYS C;  2BHM A;  2R4I A;  2FGT A;  2Z77 A;  3V92 A;  3FCS B;  2XF3 A;  2HML B;  3MHE A;  3CMA 3;  3Q1C A;  4EYC A;  1IV7 A;  2JDI H;  4HM4 B;  5FGO A;  3LT8 A;  1SIH A;  2E2U A;  2CFL A;  2CWV A;  2HMO B;  2C10 A;  2I9W A;  5ELJ A;  1O7G B;  1K9M 4;  1WMP A;  5STD A;  3CCJ 3;  1V74 A;  1O7N B;  1Q42 A;  2CFD A;  1W4N A;  5IG3 A;  1A90 A;  1NO3 A;  3IMA B;  3DM8 A;  2IA7 A;  3NQZ A;  1JN5 B;  3X3X A;  3F14 A;  3EN1 B;  5IG4 A;  2C11 A;  2ZDJ A;  1N9J A;  1GS3 A;  1M1X B;  4GB5 A;  1UUV B;  3WOE B;  3X42 A;  5I97 A;  2ML5 A;  1F8N A;  3JVC A;  3J7Y d;  2IMJ A;  3V98 A;  3FGY A;  2BO9 B;  2CFW A;  3HII A;  4QWT A;  4KVH A;  2QEX 3;  2D1W A;  5FW5 A;  3SOA A;  2B24 B;  2Y73 A;  1YGE A;  1AVK A;  4R80 A;  1N9E A;  1IQ8 A;  3CNX A;  3CPW 2;  4N6U A;  1RJO A;  1WMO A;  1DYU A;  1O7P B;  1GD3 A;  2HMN B;  3D9R A;  1QVG 2;  4XDV A;  1IK3 A;  1JJ2 2;  3MSO A;  1VQP 3;  4ORL A;  1DMN A;  2CG0 A;  1SQW A;  3H3H A;  1A2K A;  3T8N A;  3LTA A;  1W2B 2;  3UJM A;  3IPT A;  5EEO A;  1N8R 4;  1Q40 A;  4FMB A;  5AIF A;  3IJE B;  2KRT A;  2CFG A;  2PNC A;  5AEW B;  3CU3 A;  1EQK A;  4HZB B;  3MG1 A;  1N8Q A;  1KC8 4;  5IW9 A;  3CNM A;  4X2H A;  3MYT A;  3I0Y A;  1EA2 A;  2OQE C;  3JUN A;  1VQK 3;  1Q7Y 4;  4HM2 B;  1IQX A;  1TP6 A;  3EJV A;  3S27 A;  3CCS 3;  5KP4 A;  1IVU A;  2IUJ A;  3DY5 A;  3EBT A;  4EC6 A;  3GZY B;  3X41 A;  4LGQ A;  3KFQ C;  1JN5 A;  5CF1 A;  3QK9 A;  4HBR A;  3B4O A;  3PCR A;  1K73 4;  4RNZ A;  2XH9 A;  1ASK A;  1RN7 A;  3S67 A;  1VQO 3;  5IEN A;  3CCE 3;  1Q40 B;  1FGT A;  3GAX A;  3EBY A;  3RGA A;  3F7X A;  3X40 A;  1OGX A;  1QAL A;  3DZL A;  2CFK A;  2L4V A;  1YVB I;  2M7O A;  3KE7 A;  1ULI B;  4I4K A;  5CXO A;  1IVW A;  3EE1 A;  3ALA A;  3BND A;  1JB4 A;  1IT7 A;  2KXG A;  5D81 A;  3FG1 A;  3OX9 A;  2W2C A;  2W0Q A;  2CWT A;  3PZW A;  1BUQ A;  2RGQ A;  2CK3 H;  3EX9 A;  4KFE A;  4KFF A;  2A15 A;  3FF0 A;  3FZW A;  3WA2 X;  2OWP A;  3G6E 3;  4N6M A;  1VQ5 3;  3FKA A;  5JPP A;  1OH0 A;  1YJW 3;  2XRX B;  1Z1S A;  1VQL 3;  3HX8 A;  3MG2 A;  4HM5 B;  1K41 A;  1W6G A;  1AR0 A;  1DMQ A;  3F9S A;  5AII A;  3CME 3;  3NBR A;  1E3V A;  3T0U A;  3ER7 A;  3CCL 3;  4G1M B;  1JB5 A;  2LYX A;  3NM7 A;  1TIJ A;  5IEO A;  1NU3 A;  3SVA A;  2XR8 B;  3B4P A;  2F98 A;  4HM1 B;  2RCD A;  3KKG A;  3OWS A;  2GU1 A;  2W9P A;  3AMO B;  1JV2 B;  2P0M A;  1VQ7 3;  1FGR A;  3KII A;  4OUQ A;  1ULJ B;  3DXO A;  2GXF A;  4OVM A;  4EXR A;  1O7H B;  3GZX B;  3NBB A;  4HYZ A;  5AEU B;  4K1V A;  3CCU 3;  3DGN A;  2WGQ A;  1FUW A;  4H3U A;  3EF8 A;  2E2V A;  1VQM 3;  1FGQ A;  1M9G A;  4O02 B;  2FNQ A;  3LZA A;  5KP3 A;  1ROV A;  4HZ9 B;  5A0O B;  3CCQ 3;  1LNH A;  7STD A;  2XGN A;  3JUM A;  3OV4 A;  1YJ9 3;  3GRD A;  3OXA A;  3UNL A;  4K1U A;  5AIG A;  1ZO2 A;  1E3R A;  3NUV A;  1SII A;  4HM8 B;  4WYK B;  3SLU A;  4ZM8 A;  1LXE A;  4O8S A;  2YFI B;  1D6U A;  2E2T A;  1UI8 A;  4XM4 A;  2QIY A;  1TU5 A;  3WMD A;  3CCR 3;  1FGM A;  5BVB A;  2LQV A;  1EKM A;  1OUN A;  1NDO B;  3LTD A;  4STD A;  5CF2 A;  3EHC A;  3EQQ B;  1Q81 4;  1UUW B;  1OF5 A;  1QAK A;  3F8H A;  3S29 A;  1RKY A;  1JB2 A;  4MJD A;  2O3O A;  1IVX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...