3VSYA

High-resolution crystal structure of wild-type ksi in the apo form at neutral ph
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
125
structure length
123
Chain Sequence
LPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFYRQGLGKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Steroid Delta-isomerase
publication title Incorporation of rapid thermodynamic data in fragment-based drug discovery.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 33
structure length 123
sequence length 125
chains with identical sequence B
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2012-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3vsyA00
2BMQB 3B4PA 3UJMA 5EVHA 5IG4A 1WQLB 7STDA 3NBRA 5D83A 4HM5B 3F9SA 3DXOA 5IEOA 3NHXA 4HM0B 8CHOA 1JN5A 1ULJB 3FLJA 3RGRA 2HMJB 4WWUC 2F86B 4R9KA 1DMNA 2R4IA 3DUKA 4K1UA 1O7WB 2K54A 1NWWA 1W01A 3EF8A 3F8XA 2IMJA 3ER7A 1GY6A 3F14A 3GZRA 1JN5B 4K1VA 1ISKA 2XSHB 3B7CA 2QGUA 3D9RA 3OXAA 3EJVA 4RZMA 5IENA 1C7HA 1U5OA 1W6YA 5AIIA 3LYGA 4HJLB 1OGZA 2BMOB 5CF2A 4MJDA 1AR0A 1ZO2A 3MSOA 4HM8B 1E3RA 3JUMA 2RFRA 2JQ5A 2GEYA 1IDPA 3NXJA 4OVMA 3HK4A 4HZBB 4HKVB 3F8HA 1UUWB 3MG3A 5KP1A 1EG9B 3SOAA 5FW5A 5IG5A 2GBWB 4L8PA 4HM4B 3B4OA 4STDA 1HKXA 1VZZA 3FF0A 3CNMA 3ECFA 1OF5A 5AEUB 2HMNB 1OHPA 4XBYA 1O7NB 2RCDA 3NUVA 5CLKA 4XBXA 1JKGA 1E97A 1UUVB 1TUHA 3GZXB 3DMCA 4X2HA 2QIYA 3JUOA 5AIHA 4XM4A 2CHCA 4FCMA 4H3UA 2BNGA 1OF5B 2GXFA 3H3HA 2XR8B 4PEJA 5IEPA 1ASKA 1JKGB 4HZ9B 3VGNA 3S5CA 2CKFB 1OHOA 2RGQA 3FZWA 2XRXB 5CK6A 5CF1A 4HM6B 1TP6A 4J8TA 4KVHA 3EBYA 5G2GA 2B1XB 1JB2A 3GRDA 4HM2B 3GZBA 3OX9A 3WMDA 3Q90A 3KE7A 5BXQA 3MYTA 3HZPA 4WYKA 3EBTA 5BVBA 4R1KA 4U13A 3BB9A 2Z76A 5JPUA 1BUQA 1ULIB 3CNXA 3G8ZA 3OWSA 4R9LA 5STDA 3BLZA 4XBTA 2Z77A 3EX9A 3GZYB 1EA2A 3I0YA 4XDWA 3NV0A 3B8LA 4J9AA 4WYKB 1GYBA 1GY5A 3JUPA 2HMOB 4HM3B 1W02A 3LZAA 4LGQA 3F7XA 3MHEA 4Q53A 1SJWA 5KP4A 3NV0B 2GEXA 2HMMB 3SEDA 4ORLA 3F7SA 1ZX2A 4HM1B 3RGAA 3FGYA 5HGRA 3OV4A 4IIAA 3F40A 3EQQB 1O7GB 3G16A 5TGNA 3CU3A 2B24B 4XB5A 5AIFA 5DREA 1JB5A 1OH0A 1OGXA 3MKIA 4L8OA 3OWYA 2BMRB 3KZTA 1GS3A 2STDA 5IF6A 5D82A 2PZVA 5KP3A 3EC9A 5D81A 3STDA 2HMKB 3DZLA 2UX0A 4OUQA 1JB4A 1GY7A 2A15A 3KSPA 1DMMA 2XSOB 1O7HB 4CDLA 1NDOB 4HM7B 5AIGA 3DM8A 6STDA 4L7KA 1OCVA 3UNLA 3FF2A 4I4KA 4LEHA 3KKGA 2W2CA 1CQSA 2YFLB 1Q42A 3E99A 4N3VA 4XDVA 5AI1A 5JPPA 1A2KA 1S5AA 2Z7AA 1OPYA 3FSDA 3EN1B 3ROBA 3H51A 3OWUA 3FH1A 3VSYA 3SOYA 5DRVA 1O7PB 3A76A 3MG1A 3T8UA 1OUNA 4FCJA 3GWRA 1STDA 3MG2A 2HMLB 1Q40A 1O7MB 3EHCA 5AEWB 4X2OA 3M8CA 2F99A 1Z1SA 3K7CA 2OWPA 5IG0A 1K41A 1E3VA 2YFIB 2YFJB 3JUNA 1NU3A 3T8NA 5IG3A 1QMAA 3IPTA 2I9WA 5IERA 1W00A 3NM2A 2GBXB 4GB5A 2INXA 3CPOA 3K0ZA 3HX8A 3FKAA 3EN8A 1QJGA 3JUQA 1OHSA 5CXOA 1Q40B 3G0KA 4HVNA 1DMQA 4WP5A 4LMIA 2F98A
chains in the Genus database with same CATH superfamily
3BIRA 2BMQB 1RTUA 1RKYA 1M1XB 3B4PA 3UJMA 5EVHA 5IG4A 1YNVX 1JRQA 1WQLB 7STDA 5I97A 3NBRA 1BRGA 5D83A 4HM5B 3F9SA 4AKZA 4GL6A 3PS8A 1RGAA 4FMBA 4MEIA 1BSDA 3DXOA 5IEOA 3T0UA 1TU5A 3NHXA 3KN4A 2IY2A 1BRSA 3LT9A 2C4BA 1LOWA 2GSPA 1IV9A 4HM0B 3PGBA 5HOHA 8CHOA 1VQP3 1BNIA 1Q864 1JN5A 1CH0A 3N9HA 1ULJB 1X1YA 2F56A 5JBSA 3FG4A 3Q3FA 1G0TA 3FLJA 3DY5A 3U1WA 1MOLA 3RGRA 4K90B 3IMAB 2C11A 2UUGC 3EE1A 1AQZA 2HMJB 1D6UA 4DKIA 1PFPA 2H0IA 4WWUC 2C10A 1Y4KA 2BHMA 3GSPA 2F86B 3D79A 4R9KA 1DMNA 2KF4A 1B2XA 1WTHA 2R4IA 3DUKA 4K1UA 1STFI 3CC23 4OK0A 1IV7A 2KAAA 1O7WB 1I0XA 4J5KA 4CJNA 1VQM3 2K54A 1NWWA 1NJI4 1BAOA 8RNTA 1W01A 1YVBI 3HOHA 4FCZA 1RN1A 3EF8A 2RSXA 1BNFA 1GOYA 2OTJ3 3F8XA 4FMCA 1U8CB 3L0RA 2IMJA 4LZIA 2ZA4A 3ER7A 1GY6A 1DYUA 2AAEA 3F14A 1SPUA 1JN5B 2V1LA 3GZRA 1W2ZA 4K1VA 6RNTA 1ISKA 1LRAA 2XSHB 3K63A 3KFQC 3B7CA 3TDGA 1WMNA 3QK9A 3O8YA 1OACA 3AGOA 2QGUA 3D9RA 3OXAA 1Q7Y4 3EJVA 4RZMA 5LC7A 4EYCA 5IENA 3CXC2 1YHQ3 5M18A 1C7HA 3LOYA 3X3YA 1U5OA 1W6YA 5AIIA 3FCSB 1S723 3LYGA 4HJLB 1DE3A 1B2SA 2CK3H 1OGZA 2D1WA 2BMOB 1R4YA 1SARA 5CF2A 2AADA 4MJDA 3S27A 3OW22 1K8A4 1RCKA 1I3IA 1BUJA 1AR0A 3G4S3 3V99A 1ZO2A 3MSOA 2O3OA 4HM8B 2L4VA 3SLUA 3G713 1W5ZA 1E3RA 1MGRA 1YJW3 3JUMA 2RFRA 2JQ5A 3GAXA 2GEYA 1IDPA 1IVUA 3NXJA 4LSOA 4OVMA 1W2B2 2IUKA 4NREA 1VQO3 3X42A 4CCVA 1V58A 1FUTA 1D6ZA 3HK4A 4HZBB 1N9EA 2IA7A 4HKVB 3F8HA 4NPBA 3X41A 1RGGA 4ZM8A 1JBRA 1CYUA 1CEWI 1QAFA 1TFOA 1K9M4 1FUWA 3V92A 4FMDA 3URPA 5BU4A 1AVLA 1GSPA 3CC73 1UUWB 2W0QA 3MG3A 5FGOA 5KP1A 1EG9B 3SOAA 3HIGA 3CCQ3 1CYVA 1B2ZA 1FGMA 1BU4A 2QEX3 1YIT3 4R80A 4G1MB 5FW5A 3CCE3 3EB8A 1IVWA 3AHWA 3CCR3 1V74A 1X1UA 2E2UA 1BIRA 2GBWB 1BRIA 1RMSA 2FNQA 2WOFA 5IG5A 2WGQA 4L8PA 4HM4B 3B4OA 4STDA 2W56A 1N5HA 1HU9A 1ROVA 2XEPA 3D4AA 1HKXA 1VZZA 2R41A 3FF0A 3KIIA 1ZS7A 1TJDA 3BNEA 1R4CA 1I0VA 1TRPA 1B3SA 1J2BA 1RCLA 3CNMA 3ECFA 1OF5A 3LXUX 5AEUB 1UW1A 2HMNB 2KF3A 2O9UX 1KWIA 2CWTA 1OHPA 4XBYA 4KT3B 2P09A 3Q2PA 1JZOA 1GD4A 2SARA 1PY3A 2F5WA 3A5EA 4TX4A 1O7NB 4QWTA 5GSPA 2YX9A 1D6YA 2RCDA 1B2UA 2WOHA 3NUVA 5CLKA 2CFLA 4XBXA 1KSIA 1UCIA 1JKGA 1E97A 1RLSA 1LXEA 4N6LA 1UUVB 1TUHA 4BTWA 1UCJA 2J8XB 3X3ZA 2K3DA 3GZXB 4EW5A 3DMCA 3G6E3 1JBSA 4X2HA 1GOUA 1RGFA 1T2IA 1WNHA 3SYUA 2QIYA 3JUOA 2W56B 3CCJ3 3D5GA 3LTAA 5AIHA 3ZFZA 4XM4A 2CWVA 2CHCA 1RNTA 2CG0A 3SX1A 1YI23 4FCMA 2D42A 4H3UA 2W6JH 2BNGA 4EXRA 1FW7A 1OF5B 3PYJA 2F4YA 4KZ1A 2BIRA 1EEJA 1BNEA 2OCTA 4KFEA 3X3XA 2WGOA 2P0MA 4WFOA 1MWSA 3BNBA 1RRHA 1ROAA 4N6V0 2GXFA 3H3HA 1QVF2 4LYLB 2FGTA 2XR8B 1VQ93 5G1LA 3V98A 4PEJA 5IEPA 1RGCA 1ASKA 2Y73A 1YJN3 1JKGB 1RDSA 1UDII 2P0XA 2P38A 3PCRA 4WHAA 1JV2B 1QALA 1IVXA 2CH9A 1BRKA 4HZ9B 1M904 3VGNA 2CFDA 3S5CA 2CKFB 1OHOA 2BO9B 2CW9A 2RGQA 3FZWA 2CG1A 2XGLA 3CCU3 2XRXB 4FMAA 4N6UA 5CK6A 5CF1A 1UGIA 1GD3A 4HM6B 3QRDA 3ALAA 1DVDA 1TP6A 3BNDA 4J8TA 4N6OB 4KVHA 1BNRA 4HOHA 1K734 1LVNA 3S28A 4BTXA 3CMA3 3EBYA 5G2GA 1RNBA 2B1XB 1VQ53 1VQ63 1BGSA 1LOXA 3K9MC 1JB2A 1JNQA 3GRDA 4J5GA 4RNYA 4HM2B 3GZBA 3OX9A 1A2PA 1LOVA 3WMDA 2RBIA 1FUSA 4NHFA 4ILFA 3Q90A 1MWUA 1X1XA 4MMYB 1NB5I 1BRNL 4HAAA 3KE7A 3KSED 3IJEB 5IW9A 2CFWA 1A90A 4LMIA 2Z6BA 1TIJA 4R4KA 4RNZA 2MC8A 5BXQA 1RGLA 2MF7A 3MYTA 3HZPA 1MWRA 4WYKA 3SVAA 1LNHA 3KCHA 2XF3A 3EBTA 4I5QA 1VQ73 2XFSA 4EBGA 1LOYA 1IT7A 5BVBA 4R1KA 1VQN3 3RNTA 2UGIA 4U13A 3BB9A 2W9QA 2Z76A 2Q07A 2OQEC 2ZL8A 1HZ1A 1I2GA 1SIIA 5JPUA 2H0HA 4RNTA 2SBLA 1BUQA 3NQZA 1N9JA 1ULIB 3CNXA 3G8ZA 1G96A 3OWSA 5EQLA 4AKYA 4R9LA 4O3VA 5STDA 3BLZA 2FXTA 2OOVC 1W4NA 3WHOA 3DGOA 4XBTA 3SXXA 2CWUA 3Q1CA 3VF1A 1BANA 2Z77A 1TTOA 3EX9A 1EA2A 3GZYB 3I0YA 4XDWA 5LC6A 1DVCA 3CME3 3D3LA 3NV0A 7RNTA 3WA3A 3B8LA 4N6NB 1IK3A 4J9AA 2RNTA 4AEQA 1Q9EA 4WYKB 5A0OB 1GYBA 3D5IA 1GY5A 1C54A 3JUPA 2HMOB 1B20A 2KXGA 3FG3A 1W02A 4HM3B 3LZAA 1W7CA 2ZDJA 4O02B 3LTBA 1T2HA 2F98A 1IQYA 1IYYA 3S67A 1UI8A 2E2VA 4LGQA 1NB3I 3AMOA 4MMXB 1EKMA 3HIIA 1PU4A 1VQL3 4GSPA 1IQXA 3F7XA 1LQGC 2LYXA 4BL2A 3MHEA 1I2EA 2Y74A 4EV2A 2ML6A 2JDIH 4Q53A 3RDEA 4BIRA 1PYLA 2QA43 2OTL3 2CFGA 1RGEA 1RN7A 1UI7A 3N8BA 1SJWA 3WOEB 4BTYA 3CCL3 5KP4A 3DGYA 1JBTA 3NV0B 1RGHA 1B2MA 3J7Yd 3NQYA 2GEXA 5ELJA 3NBBA 2HMMB 1V57A 1I70A 3FG1A 3SEDA 4N6MA 4ORLA 1RRLA 1N8R4 3AGNA 1T3BA 1RJOA 1BNJA 3F7SA 3U97A 1ZX2A 3UL5A 2HOHA 4HM1B 3RGAA 3UL6A 3FGYA 1YGWA 2KRTA 5HGRA 3OV4A 2OQEA 4O8SA 1BSCA 2CIUA 4IIAA 1BSAA 2GU1A 3F40A 3AMOB 3I563 3HI7A 3NBJA 3NM7A 2K0MA 3EQQB 7GSPA 1O7GB 1QAKA 3G16A 5TGNA 3I553 1B21A 2OOVA 1Q7HA 1AVKA 2B24B 1GMQA 3CU3A 4XB5A 4IPBA 3WDGB 5AIFA 5DREA 1JB5A 1OH0A 2W03A 3PZWA 1OGXA 3X40A 3MKIA 4L8OA 3OWYA 1RHLA 2BMRB 3KZTA 1I3FA 1GS3A 2STDA 5IF6A 5D82A 5AYRB 5G1KA 2PZVA 5KP3A 2BT3A 5RNTA 3EC9A 1LNIA 1NNVA 5D81A 3UB1A 5BIRA 1WMOA 4FR9A 1N8QA 4JF8A 3CPW2 3AHSA 2KF6A 3DGMA 3STDA 2HMKB 4K61A 2UX0A 1YGEA 3DZLA 4OUQA 1JB4A 1FGQA 1GY7A 2A15A 2PNCA 2CC3A 3KSPA 1DMMA 3CD63 3WOFB 2XSOB 4BL3A 4IT7A 1O7HB 4CDLA 1NDOB 1VQ83 4HM7B 5AIGA 1G02A 1FGRA 4EV5A 3DM8A 1VQK3 2LQVA 6STDA 3MWZA 4L7KA 1SQWA 3WODG 2L1SA 1OCVA 3DH2A 3UNLA 1QVG2 3LTDA 2GU3A 3NX0A 1Q824 3FF2A 1EQKA 4EC6A 5M1AA 4I4KA 1B27A 1RN4A 4LEHA 9RNTA 3KKGA 1Q814 4KFFA 2ZHXB 3PCSA 2W2CA 1CQSA 2YFLB 1Q42A 1X1WA 3E99A 4N3VA 4XDVA 1VQ43 2KCDA 5ELUA 1DETA 1IVVA 5AI1A 3CCM3 1WMPA 1A67A 5JPPA 1A2KA 1A2VA 1BSEA 3LH4A 2H0GA 1M9GA 1S5AA 1BNSA 4HYZA 1IQ8A 2M7OA 2W9PA 1FA3A 1VQQA 1K28A 2Z7AA 1OPYA 1EUIC 2CFKA 3WA2X 1KQS2 1SIHA 1GMRA 5AYSC 3FSDA 3EN1B 3ROBA 2E2TA 1KD14 3H51A 1GOVA 3OWUA 3FH1A 2F5MA 2IYJA 1FZUA 1BNGA 3ZG5A 1F8NA 1JZDA 3VSYA 3SOYA 5DRVA 1O7PB 3A76A 3MG1A 3T8UA 1OUNA 1MGWA 3BNCA 4FCJA 3GWRA 4MMZB 4BU4A 1UCKA 3JVCA 3MPHA 1STDA 1MWTA 3MG2A 1BVIA 1L5GB 1GMPA 2HMLB 1Q40A 3PXMA 1O7MB 3CCS3 3EHCA 4HBRA 4X2OA 1BRHA 5AEWB 4JRFA 3M8CA 1RSNA 4O2HA 2F99A 1JJ22 1T5YA 1Z1SA 5M19A 1IU7A 1TFKA 3WR2A 3K7CA 2OWPA 3N54B 1UCLA 1AV4A 1I8VA 3K5TA 2W04A 2IUJA 4GHOA 5IG0A 1K41A 1E3VA 2YFIB 1YJ93 1BSBA 3ZG0A 1AY7A 2XGNA 2YFJB 2KF5A 1BOXA 1NU3A 3DGLA 3JUNA 1UGHI 3T8NA 5IG3A 1N5PA 5EEOA 2CX1A 2XFTA 6GSPA 1YIJ3 1FGTA 1QMAA 3IPTA 2I9WA 5IERA 1W00A 1W6CA 3NM2A 1YVSA 1UUGB 1FGOA 2GBXB 4GB5A 1MNLA 1ZGXA 1RGKA 2INXA 2ML5A 3CC43 3CPOA 3K0ZA 3HX8A 4KFDA 3FKAA 3LTCA 3EN8A 3LT8A 1I2FA 3DGNA 1M1K4 1QJGA 3JUQA 3LMLA 1US1A 1OHSA 4RBNA 5CXOA 3S29A 1IT8A 1Q40B 2BU4A 1HYFA 3G0KA 1KC84 1NO3A 4CPKA 3CCV3 4HVNA 1DMQA 2P05A 1LQMB 4WP5A 3BU4A 1BRJA 4N6TA 4H61A 2WO0A 2XH9A 1W6GA 1TRQA 2CX0A 1FYSA
chains in the Genus database with same CATH topology
2BMQB 1RKYA 1M1XB 3B4PA 3UJMA 5EVHA 5IG4A 1JRQA 1WQLB 7STDA 5I97A 3NBRA 5D83A 4HM5B 3F9SA 4AKZA 4GL6A 3PS8A 4FMBA 4MEIA 3DXOA 5IEOA 3T0UA 1TU5A 3NHXA 3KN4A 3LT9A 1IV9A 4HM0B 3PGBA 1VQP3 8CHOA 1Q864 1JN5A 3N9HA 1ULJB 5JBSA 3FG4A 3FLJA 3DY5A 3U1WA 1MOLA 3RGRA 4K90B 3IMAB 2C11A 3EE1A 2HMJB 1D6UA 1PFPA 4WWUC 2C10A 1Y4KA 2BHMA 2F86B 4R9KA 1DMNA 1WTHA 2R4IA 3DUKA 4K1UA 1STFI 3CC23 4OK0A 1IV7A 1O7WB 1VQM3 2K54A 1NWWA 1NJI4 1W01A 1YVBI 4FCZA 3EF8A 2RSXA 2OTJ3 3F8XA 4FMCA 1U8CB 3L0RA 2IMJA 4LZIA 3ER7A 1GY6A 1DYUA 3F14A 2V1LA 1SPUA 1JN5B 3GZRA 1W2ZA 4K1VA 1ISKA 2XSHB 3K63A 3KFQC 3B7CA 3TDGA 1WMNA 3QK9A 3O8YA 1OACA 1Q7Y4 2QGUA 3D9RA 3OXAA 3EJVA 4RZMA 5LC7A 4EYCA 5IENA 3CXC2 1YHQ3 1C7HA 3LOYA 3X3YA 1U5OA 1W6YA 5AIIA 3FCSB 1S723 3LYGA 4HJLB 2CK3H 1OGZA 2D1WA 2BMOB 5CF2A 1K8A4 3S27A 4MJDA 3OW22 1AR0A 3G4S3 3V99A 1ZO2A 3MSOA 2O3OA 4HM8B 2L4VA 3SLUA 3G713 1W5ZA 1E3RA 1YJW3 3JUMA 2RFRA 2JQ5A 3GAXA 2GEYA 1IDPA 1IVUA 3NXJA 4LSOA 4OVMA 1W2B2 2IUKA 4NREA 1VQO3 3X42A 4CCVA 3HK4A 1D6ZA 4HZBB 1N9EA 2IA7A 4HKVB 3F8HA 3X41A 4ZM8A 1CYUA 1CEWI 1QAFA 1TFOA 1K9M4 1FUWA 3V92A 4FMDA 1AVLA 3CC73 1UUWB 2W0QA 3MG3A 5FGOA 5KP1A 1EG9B 3SOAA 3HIGA 3CCQ3 1CYVA 1FGMA 2QEX3 1YIT3 4R80A 4G1MB 5FW5A 3CCE3 3EB8A 1IVWA 3CCR3 1V74A 5IG5A 2E2UA 2GBWB 2FNQA 2WOFA 2WGQA 4L8PA 4HM4B 3B4OA 4STDA 2W56A 1N5HA 1HU9A 1ROVA 2XEPA 1HKXA 1VZZA 3FF0A 3KIIA 3BNEA 1R4CA 1J2BA 3CNMA 3ECFA 1OF5A 3LXUX 5AEUB 1UW1A 2HMNB 2O9UX 1KWIA 2CWTA 1OHPA 4XBYA 2P09A 3Q2PA 1GD4A 4TX4A 1O7NB 4QWTA 2YX9A 1D6YA 2RCDA 2WOHA 3NUVA 5CLKA 2CFLA 4XBXA 1KSIA 1JKGA 1E97A 1LXEA 4N6LA 1UUVB 1TUHA 4BTWA 3X3ZA 3GZXB 3DMCA 3G6E3 4X2HA 1WNHA 2QIYA 3JUOA 2W56B 3CCJ3 3LTAA 5AIHA 4XM4A 2CWVA 2CHCA 1YI23 2CG0A 3SX1A 4FCMA 2D42A 4H3UA 2W6JH 2BNGA 4EXRA 1OF5B 3PYJA 4KZ1A 2OCTA 4KFEA 3X3XA 2WGOA 2P0MA 4WFOA 3BNBA 1RRHA 1ROAA 4N6V0 2GXFA 3H3HA 1QVF2 2FGTA 2XR8B 1VQ93 3V98A 4PEJA 5IEPA 1ASKA 2Y73A 1YJN3 1JKGB 3PCRA 2P0XA 2P38A 4WHAA 1JV2B 1QALA 1IVXA 2CH9A 4HZ9B 1M904 3VGNA 2CFDA 3S5CA 2CKFB 1OHOA 2BO9B 2CW9A 2RGQA 3FZWA 2CG1A 2XGLA 3CCU3 2XRXB 4FMAA 4N6UA 5CK6A 5CF1A 1GD3A 4HM6B 3QRDA 3ALAA 1DVDA 1TP6A 3BNDA 4J8TA 4N6OB 4KVHA 1K734 1LVNA 3S28A 4BTXA 3CMA3 3EBYA 5G2GA 2B1XB 1VQ53 1VQ63 1LOXA 3K9MC 1JB2A 1JNQA 3GRDA 4RNYA 4HM2B 3GZBA 3OX9A 3WMDA 4NHFA 3Q90A 4MMYB 3KE7A 3KSED 3IJEB 5IW9A 2CFWA 1A90A 4LMIA 2Z6BA 1TIJA 4R4KA 4RNZA 2MC8A 5BXQA 3MYTA 2MF7A 3HZPA 4WYKA 3SVAA 1LNHA 2XF3A 3EBTA 1VQ73 2XFSA 4EBGA 1IT7A 5BVBA 4R1KA 1VQN3 4U13A 3BB9A 2W9QA 2Z76A 2Q07A 2OQEC 2ZL8A 1SIIA 5JPUA 2SBLA 1BUQA 3NQZA 1N9JA 1ULIB 3CNXA 3G8ZA 1G96A 3OWSA 5EQLA 4AKYA 4R9LA 4O3VA 5STDA 3BLZA 2FXTA 2OOVC 1W4NA 3DGOA 4XBTA 3SXXA 2CWUA 3Q1CA 3VF1A 2Z77A 3EX9A 3GZYB 1EA2A 3I0YA 4XDWA 5LC6A 1NB5I 1DVCA 3CME3 3D3LA 3NV0A 3WA3A 3B8LA 4N6NB 1IK3A 4J9AA 4AEQA 4WYKB 5A0OB 1GYBA 1GY5A 3JUPA 2HMOB 2KXGA 3FG3A 1W02A 4HM3B 3LZAA 1W7CA 2ZDJA 4O02B 3LTBA 1IQYA 3S67A 1UI8A 2E2VA 4LGQA 1NB3I 3AMOA 4MMXB 1EKMA 3HIIA 1PU4A 1VQL3 1IQXA 3F7XA 2LYXA 3MHEA 2Y74A 4EV2A 2ML6A 2JDIH 4Q53A 3RDEA 2QA43 2OTL3 2CFGA 3CCL3 1RN7A 1UI7A 3N8BA 1SJWA 3WOEB 4BTYA 5KP4A 3NV0B 3J7Yd 3NQYA 2GEXA 5ELJA 3NBBA 2HMMB 3FG1A 3SEDA 4N6MA 4ORLA 1RRLA 1N8R4 1RJOA 3F7SA 3U97A 1ZX2A 3UL5A 4HM1B 3RGAA 3UL6A 3FGYA 2KRTA 5HGRA 3OV4A 2OQEA 4O8SA 2CIUA 4IIAA 2GU1A 3F40A 3AMOB 3I563 3HI7A 3NBJA 3NM7A 2K0MA 3EQQB 1O7GB 1QAKA 3G16A 5TGNA 3I553 2OOVA 3CU3A 1AVKA 2B24B 4XB5A 4IPBA 3WDGB 5AIFA 5DREA 1JB5A 1OH0A 2W03A 3PZWA 1OGXA 3X40A 3MKIA 4L8OA 3OWYA 2BMRB 3KZTA 1GS3A 2STDA 5IF6A 5D82A 5AYRB 2PZVA 5KP3A 2BT3A 3EC9A 3UB1A 5D81A 3CPW2 1WMOA 4FR9A 1N8QA 4JF8A 3DGMA 3STDA 2HMKB 4K61A 2UX0A 1YGEA 3DZLA 4OUQA 1JB4A 1FGQA 1GY7A 2A15A 2PNCA 2CC3A 3KSPA 1DMMA 3CD63 3WOFB 2XSOB 4IT7A 1O7HB 4CDLA 1NDOB 1VQ83 4HM7B 5AIGA 1FGRA 4EV5A 3DM8A 1VQK3 2LQVA 6STDA 3MWZA 4L7KA 1SQWA 3WODG 1OCVA 3UNLA 1QVG2 3LTDA 2GU3A 3NX0A 1Q824 3FF2A 1EQKA 4EC6A 4I4KA 4LEHA 3KKGA 1Q814 4KFFA 3PCSA 2W2CA 1CQSA 2YFLB 1Q42A 3E99A 4N3VA 4XDVA 1VQ43 2KCDA 5ELUA 1IVVA 5AI1A 3CCM3 1WMPA 1A67A 5JPPA 1A2KA 1A2VA 3LH4A 1M9GA 1S5AA 4HYZA 1FA3A 1IQ8A 2M7OA 2W9PA 2Z7AA 1K28A 1OPYA 2CFKA 3WA2X 1KQS2 1SIHA 5AYSC 3FSDA 3EN1B 3ROBA 2E2TA 1KD14 3H51A 3OWUA 3FH1A 1F8NA 3VSYA 3SOYA 5DRVA 1O7PB 3A76A 3MG1A 3T8UA 1OUNA 3BNCA 4FCJA 3GWRA 4MMZB 3JVCA 3MPHA 1STDA 3MG2A 1L5GB 2HMLB 1Q40A 3PXMA 1O7MB 3CCS3 3EHCA 4HBRA 4X2OA 5AEWB 4JRFA 3M8CA 4O2HA 2F99A 1JJ22 1T5YA 1Z1SA 1IU7A 1TFKA 3K7CA 2OWPA 3N54B 3K5TA 1AV4A 2IUJA 2W04A 5IG0A 1K41A 1E3VA 2YFIB 1YJ93 2YFJB 2XGNA 3DGLA 1NU3A 3JUNA 3T8NA 5IG3A 1N5PA 5EEOA 2XFTA 1YIJ3 1FGTA 1QMAA 3IPTA 2I9WA 5IERA 1W00A 1W6CA 3NM2A 1FGOA 2GBXB 4GB5A 1MNLA 2INXA 2ML5A 3CC43 3CPOA 3K0ZA 3HX8A 4KFDA 3FKAA 3LTCA 3EN8A 3LT8A 3DGNA 1M1K4 1QJGA 3JUQA 3LMLA 1US1A 1OHSA 4RBNA 5CXOA 3S29A 1IT8A 1Q40B 3G0KA 1KC84 1NO3A 3CCV3 4HVNA 1DMQA 2P05A 4WP5A 4N6TA 4H61A 2WO0A 2XH9A 1W6GA 2F98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BMQ B;  3B4P A;  3UJM A;  5EVH A;  5IG4 A;  1WQL B;  7STD A;  3NBR A;  5D83 A;  4HM5 B;  3F9S A;  3DXO A;  5IEO A;  3NHX A;  4HM0 B;  8CHO A;  1JN5 A;  1ULJ B;  3FLJ A;  3RGR A;  2HMJ B;  4WWU C;  2F86 B;  4R9K A;  1DMN A;  2R4I A;  3DUK A;  4K1U A;  1O7W B;  2K54 A;  1NWW A;  1W01 A;  3EF8 A;  3F8X A;  2IMJ A;  3ER7 A;  1GY6 A;  3F14 A;  3GZR A;  1JN5 B;  4K1V A;  1ISK A;  2XSH B;  3B7C A;  2QGU A;  3D9R A;  3OXA A;  3EJV A;  4RZM A;  5IEN A;  1C7H A;  1U5O A;  1W6Y A;  5AII A;  3LYG A;  4HJL B;  1OGZ A;  2BMO B;  5CF2 A;  4MJD A;  1AR0 A;  1ZO2 A;  3MSO A;  4HM8 B;  1E3R A;  3JUM A;  2RFR A;  2JQ5 A;  2GEY A;  1IDP A;  3NXJ A;  4OVM A;  3HK4 A;  4HZB B;  4HKV B;  3F8H A;  1UUW B;  3MG3 A;  5KP1 A;  1EG9 B;  3SOA A;  5FW5 A;  5IG5 A;  2GBW B;  4L8P A;  4HM4 B;  3B4O A;  4STD A;  1HKX A;  1VZZ A;  3FF0 A;  3CNM A;  3ECF A;  1OF5 A;  5AEU B;  2HMN B;  1OHP A;  4XBY A;  1O7N B;  2RCD A;  3NUV A;  5CLK A;  4XBX A;  1JKG A;  1E97 A;  1UUV B;  1TUH A;  3GZX B;  3DMC A;  4X2H A;  2QIY A;  3JUO A;  5AIH A;  4XM4 A;  2CHC A;  4FCM A;  4H3U A;  2BNG A;  1OF5 B;  2GXF A;  3H3H A;  2XR8 B;  4PEJ A;  5IEP A;  1ASK A;  1JKG B;  4HZ9 B;  3VGN A;  3S5C A;  2CKF B;  1OHO A;  2RGQ A;  3FZW A;  2XRX B;  5CK6 A;  5CF1 A;  4HM6 B;  1TP6 A;  4J8T A;  4KVH A;  3EBY A;  5G2G A;  2B1X B;  1JB2 A;  3GRD A;  4HM2 B;  3GZB A;  3OX9 A;  3WMD A;  3Q90 A;  3KE7 A;  5BXQ A;  3MYT A;  3HZP A;  4WYK A;  3EBT A;  5BVB A;  4R1K A;  4U13 A;  3BB9 A;  2Z76 A;  5JPU A;  1BUQ A;  1ULI B;  3CNX A;  3G8Z A;  3OWS A;  4R9L A;  5STD A;  3BLZ A;  4XBT A;  2Z77 A;  3EX9 A;  3GZY B;  1EA2 A;  3I0Y A;  4XDW A;  3NV0 A;  3B8L A;  4J9A A;  4WYK B;  1GYB A;  1GY5 A;  3JUP A;  2HMO B;  4HM3 B;  1W02 A;  3LZA A;  4LGQ A;  3F7X A;  3MHE A;  4Q53 A;  1SJW A;  5KP4 A;  3NV0 B;  2GEX A;  2HMM B;  3SED A;  4ORL A;  3F7S A;  1ZX2 A;  4HM1 B;  3RGA A;  3FGY A;  5HGR A;  3OV4 A;  4IIA A;  3F40 A;  3EQQ B;  1O7G B;  3G16 A;  5TGN A;  3CU3 A;  2B24 B;  4XB5 A;  5AIF A;  5DRE A;  1JB5 A;  1OH0 A;  1OGX A;  3MKI A;  4L8O A;  3OWY A;  2BMR B;  3KZT A;  1GS3 A;  2STD A;  5IF6 A;  5D82 A;  2PZV A;  5KP3 A;  3EC9 A;  5D81 A;  3STD A;  2HMK B;  3DZL A;  2UX0 A;  4OUQ A;  1JB4 A;  1GY7 A;  2A15 A;  3KSP A;  1DMM A;  2XSO B;  1O7H B;  4CDL A;  1NDO B;  4HM7 B;  5AIG A;  3DM8 A;  6STD A;  4L7K A;  1OCV A;  3UNL A;  3FF2 A;  4I4K A;  4LEH A;  3KKG A;  2W2C A;  1CQS A;  2YFL B;  1Q42 A;  3E99 A;  4N3V A;  4XDV A;  5AI1 A;  5JPP A;  1A2K A;  1S5A A;  2Z7A A;  1OPY A;  3FSD A;  3EN1 B;  3ROB A;  3H51 A;  3OWU A;  3FH1 A;  3VSY A;  3SOY A;  5DRV A;  1O7P B;  3A76 A;  3MG1 A;  3T8U A;  1OUN A;  4FCJ A;  3GWR A;  1STD A;  3MG2 A;  2HML B;  1Q40 A;  1O7M B;  3EHC A;  5AEW B;  4X2O A;  3M8C A;  2F99 A;  1Z1S A;  3K7C A;  2OWP A;  5IG0 A;  1K41 A;  1E3V A;  2YFI B;  2YFJ B;  3JUN A;  1NU3 A;  3T8N A;  5IG3 A;  1QMA A;  3IPT A;  2I9W A;  5IER A;  1W00 A;  3NM2 A;  2GBX B;  4GB5 A;  2INX A;  3CPO A;  3K0Z A;  3HX8 A;  3FKA A;  3EN8 A;  1QJG A;  3JUQ A;  1OHS A;  5CXO A;  1Q40 B;  3G0K A;  4HVN A;  1DMQ A;  4WP5 A;  4LMI A;  2F98 A; 
#chains in the Genus database with same CATH topology
 3BIR A;  2BMQ B;  1RTU A;  1RKY A;  1M1X B;  3B4P A;  3UJM A;  5EVH A;  5IG4 A;  1YNV X;  1JRQ A;  1WQL B;  7STD A;  5I97 A;  3NBR A;  1BRG A;  5D83 A;  4HM5 B;  3F9S A;  4AKZ A;  4GL6 A;  3PS8 A;  1RGA A;  4FMB A;  4MEI A;  1BSD A;  3DXO A;  5IEO A;  3T0U A;  1TU5 A;  3NHX A;  3KN4 A;  2IY2 A;  1BRS A;  3LT9 A;  2C4B A;  1LOW A;  2GSP A;  1IV9 A;  4HM0 B;  3PGB A;  5HOH A;  8CHO A;  1VQP 3;  1BNI A;  1Q86 4;  1JN5 A;  1CH0 A;  3N9H A;  1ULJ B;  1X1Y A;  2F56 A;  5JBS A;  3FG4 A;  3Q3F A;  1G0T A;  3FLJ A;  3DY5 A;  3U1W A;  1MOL A;  3RGR A;  4K90 B;  3IMA B;  2C11 A;  2UUG C;  3EE1 A;  1AQZ A;  2HMJ B;  1D6U A;  4DKI A;  1PFP A;  2H0I A;  4WWU C;  2C10 A;  1Y4K A;  2BHM A;  3GSP A;  2F86 B;  3D79 A;  4R9K A;  1DMN A;  2KF4 A;  1B2X A;  1WTH A;  2R4I A;  3DUK A;  4K1U A;  1STF I;  3CC2 3;  4OK0 A;  1IV7 A;  2KAA A;  1O7W B;  1I0X A;  4J5K A;  4CJN A;  1VQM 3;  2K54 A;  1NWW A;  1NJI 4;  1BAO A;  8RNT A;  1W01 A;  1YVB I;  3HOH A;  4FCZ A;  1RN1 A;  3EF8 A;  2RSX A;  1BNF A;  1GOY A;  2OTJ 3;  3F8X A;  4FMC A;  1U8C B;  3L0R A;  2IMJ A;  4LZI A;  2ZA4 A;  3ER7 A;  1GY6 A;  1DYU A;  2AAE A;  3F14 A;  1SPU A;  1JN5 B;  2V1L A;  3GZR A;  1W2Z A;  4K1V A;  6RNT A;  1ISK A;  1LRA A;  2XSH B;  3K63 A;  3KFQ C;  3B7C A;  3TDG A;  1WMN A;  3QK9 A;  3O8Y A;  1OAC A;  3AGO A;  2QGU A;  3D9R A;  3OXA A;  1Q7Y 4;  3EJV A;  4RZM A;  5LC7 A;  4EYC A;  5IEN A;  3CXC 2;  1YHQ 3;  5M18 A;  1C7H A;  3LOY A;  3X3Y A;  1U5O A;  1W6Y A;  5AII A;  3FCS B;  1S72 3;  3LYG A;  4HJL B;  1DE3 A;  1B2S A;  2CK3 H;  1OGZ A;  2D1W A;  2BMO B;  1R4Y A;  1SAR A;  5CF2 A;  2AAD A;  4MJD A;  3S27 A;  3OW2 2;  1K8A 4;  1RCK A;  1I3I A;  1BUJ A;  1AR0 A;  3G4S 3;  3V99 A;  1ZO2 A;  3MSO A;  2O3O A;  4HM8 B;  2L4V A;  3SLU A;  3G71 3;  1W5Z A;  1E3R A;  1MGR A;  1YJW 3;  3JUM A;  2RFR A;  2JQ5 A;  3GAX A;  2GEY A;  1IDP A;  1IVU A;  3NXJ A;  4LSO A;  4OVM A;  1W2B 2;  2IUK A;  4NRE A;  1VQO 3;  3X42 A;  4CCV A;  1V58 A;  1FUT A;  1D6Z A;  3HK4 A;  4HZB B;  1N9E A;  2IA7 A;  4HKV B;  3F8H A;  4NPB A;  3X41 A;  1RGG A;  4ZM8 A;  1JBR A;  1CYU A;  1CEW I;  1QAF A;  1TFO A;  1K9M 4;  1FUW A;  3V92 A;  4FMD A;  3URP A;  5BU4 A;  1AVL A;  1GSP A;  3CC7 3;  1UUW B;  2W0Q A;  3MG3 A;  5FGO A;  5KP1 A;  1EG9 B;  3SOA A;  3HIG A;  3CCQ 3;  1CYV A;  1B2Z A;  1FGM A;  1BU4 A;  2QEX 3;  1YIT 3;  4R80 A;  4G1M B;  5FW5 A;  3CCE 3;  3EB8 A;  1IVW A;  3AHW A;  3CCR 3;  1V74 A;  1X1U A;  2E2U A;  1BIR A;  2GBW B;  1BRI A;  1RMS A;  2FNQ A;  2WOF A;  5IG5 A;  2WGQ A;  4L8P A;  4HM4 B;  3B4O A;  4STD A;  2W56 A;  1N5H A;  1HU9 A;  1ROV A;  2XEP A;  3D4A A;  1HKX A;  1VZZ A;  2R41 A;  3FF0 A;  3KII A;  1ZS7 A;  1TJD A;  3BNE A;  1R4C A;  1I0V A;  1TRP A;  1B3S A;  1J2B A;  1RCL A;  3CNM A;  3ECF A;  1OF5 A;  3LXU X;  5AEU B;  1UW1 A;  2HMN B;  2KF3 A;  2O9U X;  1KWI A;  2CWT A;  1OHP A;  4XBY A;  4KT3 B;  2P09 A;  3Q2P A;  1JZO A;  1GD4 A;  2SAR A;  1PY3 A;  2F5W A;  3A5E A;  4TX4 A;  1O7N B;  4QWT A;  5GSP A;  2YX9 A;  1D6Y A;  2RCD A;  1B2U A;  2WOH A;  3NUV A;  5CLK A;  2CFL A;  4XBX A;  1KSI A;  1UCI A;  1JKG A;  1E97 A;  1RLS A;  1LXE A;  4N6L A;  1UUV B;  1TUH A;  4BTW A;  1UCJ A;  2J8X B;  3X3Z A;  2K3D A;  3GZX B;  4EW5 A;  3DMC A;  3G6E 3;  1JBS A;  4X2H A;  1GOU A;  1RGF A;  1T2I A;  1WNH A;  3SYU A;  2QIY A;  3JUO A;  2W56 B;  3CCJ 3;  3D5G A;  3LTA A;  5AIH A;  3ZFZ A;  4XM4 A;  2CWV A;  2CHC A;  1RNT A;  2CG0 A;  3SX1 A;  1YI2 3;  4FCM A;  2D42 A;  4H3U A;  2W6J H;  2BNG A;  4EXR A;  1FW7 A;  1OF5 B;  3PYJ A;  2F4Y A;  4KZ1 A;  2BIR A;  1EEJ A;  1BNE A;  2OCT A;  4KFE A;  3X3X A;  2WGO A;  2P0M A;  4WFO A;  1MWS A;  3BNB A;  1RRH A;  1ROA A;  4N6V 0;  2GXF A;  3H3H A;  1QVF 2;  4LYL B;  2FGT A;  2XR8 B;  1VQ9 3;  5G1L A;  3V98 A;  4PEJ A;  5IEP A;  1RGC A;  1ASK A;  2Y73 A;  1YJN 3;  1JKG B;  1RDS A;  1UDI I;  2P0X A;  2P38 A;  3PCR A;  4WHA A;  1JV2 B;  1QAL A;  1IVX A;  2CH9 A;  1BRK A;  4HZ9 B;  1M90 4;  3VGN A;  2CFD A;  3S5C A;  2CKF B;  1OHO A;  2BO9 B;  2CW9 A;  2RGQ A;  3FZW A;  2CG1 A;  2XGL A;  3CCU 3;  2XRX B;  4FMA A;  4N6U A;  5CK6 A;  5CF1 A;  1UGI A;  1GD3 A;  4HM6 B;  3QRD A;  3ALA A;  1DVD A;  1TP6 A;  3BND A;  4J8T A;  4N6O B;  4KVH A;  1BNR A;  4HOH A;  1K73 4;  1LVN A;  3S28 A;  4BTX A;  3CMA 3;  3EBY A;  5G2G A;  1RNB A;  2B1X B;  1VQ5 3;  1VQ6 3;  1BGS A;  1LOX A;  3K9M C;  1JB2 A;  1JNQ A;  3GRD A;  4J5G A;  4RNY A;  4HM2 B;  3GZB A;  3OX9 A;  1A2P A;  1LOV A;  3WMD A;  2RBI A;  1FUS A;  4NHF A;  4ILF A;  3Q90 A;  1MWU A;  1X1X A;  4MMY B;  1NB5 I;  1BRN L;  4HAA A;  3KE7 A;  3KSE D;  3IJE B;  5IW9 A;  2CFW A;  1A90 A;  4LMI A;  2Z6B A;  1TIJ A;  4R4K A;  4RNZ A;  2MC8 A;  5BXQ A;  1RGL A;  2MF7 A;  3MYT A;  3HZP A;  1MWR A;  4WYK A;  3SVA A;  1LNH A;  3KCH A;  2XF3 A;  3EBT A;  4I5Q A;  1VQ7 3;  2XFS A;  4EBG A;  1LOY A;  1IT7 A;  5BVB A;  4R1K A;  1VQN 3;  3RNT A;  2UGI A;  4U13 A;  3BB9 A;  2W9Q A;  2Z76 A;  2Q07 A;  2OQE C;  2ZL8 A;  1HZ1 A;  1I2G A;  1SII A;  5JPU A;  2H0H A;  4RNT A;  2SBL A;  1BUQ A;  3NQZ A;  1N9J A;  1ULI B;  3CNX A;  3G8Z A;  1G96 A;  3OWS A;  5EQL A;  4AKY A;  4R9L A;  4O3V A;  5STD A;  3BLZ A;  2FXT A;  2OOV C;  1W4N A;  3WHO A;  3DGO A;  4XBT A;  3SXX A;  2CWU A;  3Q1C A;  3VF1 A;  1BAN A;  2Z77 A;  1TTO A;  3EX9 A;  1EA2 A;  3GZY B;  3I0Y A;  4XDW A;  5LC6 A;  1DVC A;  3CME 3;  3D3L A;  3NV0 A;  7RNT A;  3WA3 A;  3B8L A;  4N6N B;  1IK3 A;  4J9A A;  2RNT A;  4AEQ A;  1Q9E A;  4WYK B;  5A0O B;  1GYB A;  3D5I A;  1GY5 A;  1C54 A;  3JUP A;  2HMO B;  1B20 A;  2KXG A;  3FG3 A;  1W02 A;  4HM3 B;  3LZA A;  1W7C A;  2ZDJ A;  4O02 B;  3LTB A;  1T2H A;  2F98 A;  1IQY A;  1IYY A;  3S67 A;  1UI8 A;  2E2V A;  4LGQ A;  1NB3 I;  3AMO A;  4MMX B;  1EKM A;  3HII A;  1PU4 A;  1VQL 3;  4GSP A;  1IQX A;  3F7X A;  1LQG C;  2LYX A;  4BL2 A;  3MHE A;  1I2E A;  2Y74 A;  4EV2 A;  2ML6 A;  2JDI H;  4Q53 A;  3RDE A;  4BIR A;  1PYL A;  2QA4 3;  2OTL 3;  2CFG A;  1RGE A;  1RN7 A;  1UI7 A;  3N8B A;  1SJW A;  3WOE B;  4BTY A;  3CCL 3;  5KP4 A;  3DGY A;  1JBT A;  3NV0 B;  1RGH A;  1B2M A;  3J7Y d;  3NQY A;  2GEX A;  5ELJ A;  3NBB A;  2HMM B;  1V57 A;  1I70 A;  3FG1 A;  3SED A;  4N6M A;  4ORL A;  1RRL A;  1N8R 4;  3AGN A;  1T3B A;  1RJO A;  1BNJ A;  3F7S A;  3U97 A;  1ZX2 A;  3UL5 A;  2HOH A;  4HM1 B;  3RGA A;  3UL6 A;  3FGY A;  1YGW A;  2KRT A;  5HGR A;  3OV4 A;  2OQE A;  4O8S A;  1BSC A;  2CIU A;  4IIA A;  1BSA A;  2GU1 A;  3F40 A;  3AMO B;  3I56 3;  3HI7 A;  3NBJ A;  3NM7 A;  2K0M A;  3EQQ B;  7GSP A;  1O7G B;  1QAK A;  3G16 A;  5TGN A;  3I55 3;  1B21 A;  2OOV A;  1Q7H A;  1AVK A;  2B24 B;  1GMQ A;  3CU3 A;  4XB5 A;  4IPB A;  3WDG B;  5AIF A;  5DRE A;  1JB5 A;  1OH0 A;  2W03 A;  3PZW A;  1OGX A;  3X40 A;  3MKI A;  4L8O A;  3OWY A;  1RHL A;  2BMR B;  3KZT A;  1I3F A;  1GS3 A;  2STD A;  5IF6 A;  5D82 A;  5AYR B;  5G1K A;  2PZV A;  5KP3 A;  2BT3 A;  5RNT A;  3EC9 A;  1LNI A;  1NNV A;  5D81 A;  3UB1 A;  5BIR A;  1WMO A;  4FR9 A;  1N8Q A;  4JF8 A;  3CPW 2;  3AHS A;  2KF6 A;  3DGM A;  3STD A;  2HMK B;  4K61 A;  2UX0 A;  1YGE A;  3DZL A;  4OUQ A;  1JB4 A;  1FGQ A;  1GY7 A;  2A15 A;  2PNC A;  2CC3 A;  3KSP A;  1DMM A;  3CD6 3;  3WOF B;  2XSO B;  4BL3 A;  4IT7 A;  1O7H B;  4CDL A;  1NDO B;  1VQ8 3;  4HM7 B;  5AIG A;  1G02 A;  1FGR A;  4EV5 A;  3DM8 A;  1VQK 3;  2LQV A;  6STD A;  3MWZ A;  4L7K A;  1SQW A;  3WOD G;  2L1S A;  1OCV A;  3DH2 A;  3UNL A;  1QVG 2;  3LTD A;  2GU3 A;  3NX0 A;  1Q82 4;  3FF2 A;  1EQK A;  4EC6 A;  5M1A A;  4I4K A;  1B27 A;  1RN4 A;  4LEH A;  9RNT A;  3KKG A;  1Q81 4;  4KFF A;  2ZHX B;  3PCS A;  2W2C A;  1CQS A;  2YFL B;  1Q42 A;  1X1W A;  3E99 A;  4N3V A;  4XDV A;  1VQ4 3;  2KCD A;  5ELU A;  1DET A;  1IVV A;  5AI1 A;  3CCM 3;  1WMP A;  1A67 A;  5JPP A;  1A2K A;  1A2V A;  1BSE A;  3LH4 A;  2H0G A;  1M9G A;  1S5A A;  1BNS A;  4HYZ A;  1IQ8 A;  2M7O A;  2W9P A;  1FA3 A;  1VQQ A;  1K28 A;  2Z7A A;  1OPY A;  1EUI C;  2CFK A;  3WA2 X;  1KQS 2;  1SIH A;  1GMR A;  5AYS C;  3FSD A;  3EN1 B;  3ROB A;  2E2T A;  1KD1 4;  3H51 A;  1GOV A;  3OWU A;  3FH1 A;  2F5M A;  2IYJ A;  1FZU A;  1BNG A;  3ZG5 A;  1F8N A;  1JZD A;  3VSY A;  3SOY A;  5DRV A;  1O7P B;  3A76 A;  3MG1 A;  3T8U A;  1OUN A;  1MGW A;  3BNC A;  4FCJ A;  3GWR A;  4MMZ B;  4BU4 A;  1UCK A;  3JVC A;  3MPH A;  1STD A;  1MWT A;  3MG2 A;  1BVI A;  1L5G B;  1GMP A;  2HML B;  1Q40 A;  3PXM A;  1O7M B;  3CCS 3;  3EHC A;  4HBR A;  4X2O A;  1BRH A;  5AEW B;  4JRF A;  3M8C A;  1RSN A;  4O2H A;  2F99 A;  1JJ2 2;  1T5Y A;  1Z1S A;  5M19 A;  1IU7 A;  1TFK A;  3WR2 A;  3K7C A;  2OWP A;  3N54 B;  1UCL A;  1AV4 A;  1I8V A;  3K5T A;  2W04 A;  2IUJ A;  4GHO A;  5IG0 A;  1K41 A;  1E3V A;  2YFI B;  1YJ9 3;  1BSB A;  3ZG0 A;  1AY7 A;  2XGN A;  2YFJ B;  2KF5 A;  1BOX A;  1NU3 A;  3DGL A;  3JUN A;  1UGH I;  3T8N A;  5IG3 A;  1N5P A;  5EEO A;  2CX1 A;  2XFT A;  6GSP A;  1YIJ 3;  1FGT A;  1QMA A;  3IPT A;  2I9W A;  5IER A;  1W00 A;  1W6C A;  3NM2 A;  1YVS A;  1UUG B;  1FGO A;  2GBX B;  4GB5 A;  1MNL A;  1ZGX A;  1RGK A;  2INX A;  2ML5 A;  3CC4 3;  3CPO A;  3K0Z A;  3HX8 A;  4KFD A;  3FKA A;  3LTC A;  3EN8 A;  3LT8 A;  1I2F A;  3DGN A;  1M1K 4;  1QJG A;  3JUQ A;  3LML A;  1US1 A;  1OHS A;  4RBN A;  5CXO A;  3S29 A;  1IT8 A;  1Q40 B;  2BU4 A;  1HYF A;  3G0K A;  1KC8 4;  1NO3 A;  4CPK A;  3CCV 3;  4HVN A;  1DMQ A;  2P05 A;  1LQM B;  4WP5 A;  3BU4 A;  1BRJ A;  4N6T A;  4H61 A;  2WO0 A;  2XH9 A;  1W6G A;  1TRQ A;  2CX0 A;  1FYS A; 
#chains in the Genus database with same CATH homology
 2BMQ B;  1RKY A;  1M1X B;  3B4P A;  3UJM A;  5EVH A;  5IG4 A;  1JRQ A;  1WQL B;  7STD A;  5I97 A;  3NBR A;  5D83 A;  4HM5 B;  3F9S A;  4AKZ A;  4GL6 A;  3PS8 A;  4FMB A;  4MEI A;  3DXO A;  5IEO A;  3T0U A;  1TU5 A;  3NHX A;  3KN4 A;  3LT9 A;  1IV9 A;  4HM0 B;  3PGB A;  1VQP 3;  8CHO A;  1Q86 4;  1JN5 A;  3N9H A;  1ULJ B;  5JBS A;  3FG4 A;  3FLJ A;  3DY5 A;  3U1W A;  1MOL A;  3RGR A;  4K90 B;  3IMA B;  2C11 A;  3EE1 A;  2HMJ B;  1D6U A;  1PFP A;  4WWU C;  2C10 A;  1Y4K A;  2BHM A;  2F86 B;  4R9K A;  1DMN A;  1WTH A;  2R4I A;  3DUK A;  4K1U A;  1STF I;  3CC2 3;  4OK0 A;  1IV7 A;  1O7W B;  1VQM 3;  2K54 A;  1NWW A;  1NJI 4;  1W01 A;  1YVB I;  4FCZ A;  3EF8 A;  2RSX A;  2OTJ 3;  3F8X A;  4FMC A;  1U8C B;  3L0R A;  2IMJ A;  4LZI A;  3ER7 A;  1GY6 A;  1DYU A;  3F14 A;  2V1L A;  1SPU A;  1JN5 B;  3GZR A;  1W2Z A;  4K1V A;  1ISK A;  2XSH B;  3K63 A;  3KFQ C;  3B7C A;  3TDG A;  1WMN A;  3QK9 A;  3O8Y A;  1OAC A;  1Q7Y 4;  2QGU A;  3D9R A;  3OXA A;  3EJV A;  4RZM A;  5LC7 A;  4EYC A;  5IEN A;  3CXC 2;  1YHQ 3;  1C7H A;  3LOY A;  3X3Y A;  1U5O A;  1W6Y A;  5AII A;  3FCS B;  1S72 3;  3LYG A;  4HJL B;  2CK3 H;  1OGZ A;  2D1W A;  2BMO B;  5CF2 A;  1K8A 4;  3S27 A;  4MJD A;  3OW2 2;  1AR0 A;  3G4S 3;  3V99 A;  1ZO2 A;  3MSO A;  2O3O A;  4HM8 B;  2L4V A;  3SLU A;  3G71 3;  1W5Z A;  1E3R A;  1YJW 3;  3JUM A;  2RFR A;  2JQ5 A;  3GAX A;  2GEY A;  1IDP A;  1IVU A;  3NXJ A;  4LSO A;  4OVM A;  1W2B 2;  2IUK A;  4NRE A;  1VQO 3;  3X42 A;  4CCV A;  3HK4 A;  1D6Z A;  4HZB B;  1N9E A;  2IA7 A;  4HKV B;  3F8H A;  3X41 A;  4ZM8 A;  1CYU A;  1CEW I;  1QAF A;  1TFO A;  1K9M 4;  1FUW A;  3V92 A;  4FMD A;  1AVL A;  3CC7 3;  1UUW B;  2W0Q A;  3MG3 A;  5FGO A;  5KP1 A;  1EG9 B;  3SOA A;  3HIG A;  3CCQ 3;  1CYV A;  1FGM A;  2QEX 3;  1YIT 3;  4R80 A;  4G1M B;  5FW5 A;  3CCE 3;  3EB8 A;  1IVW A;  3CCR 3;  1V74 A;  5IG5 A;  2E2U A;  2GBW B;  2FNQ A;  2WOF A;  2WGQ A;  4L8P A;  4HM4 B;  3B4O A;  4STD A;  2W56 A;  1N5H A;  1HU9 A;  1ROV A;  2XEP A;  1HKX A;  1VZZ A;  3FF0 A;  3KII A;  3BNE A;  1R4C A;  1J2B A;  3CNM A;  3ECF A;  1OF5 A;  3LXU X;  5AEU B;  1UW1 A;  2HMN B;  2O9U X;  1KWI A;  2CWT A;  1OHP A;  4XBY A;  2P09 A;  3Q2P A;  1GD4 A;  4TX4 A;  1O7N B;  4QWT A;  2YX9 A;  1D6Y A;  2RCD A;  2WOH A;  3NUV A;  5CLK A;  2CFL A;  4XBX A;  1KSI A;  1JKG A;  1E97 A;  1LXE A;  4N6L A;  1UUV B;  1TUH A;  4BTW A;  3X3Z A;  3GZX B;  3DMC A;  3G6E 3;  4X2H A;  1WNH A;  2QIY A;  3JUO A;  2W56 B;  3CCJ 3;  3LTA A;  5AIH A;  4XM4 A;  2CWV A;  2CHC A;  1YI2 3;  2CG0 A;  3SX1 A;  4FCM A;  2D42 A;  4H3U A;  2W6J H;  2BNG A;  4EXR A;  1OF5 B;  3PYJ A;  4KZ1 A;  2OCT A;  4KFE A;  3X3X A;  2WGO A;  2P0M A;  4WFO A;  3BNB A;  1RRH A;  1ROA A;  4N6V 0;  2GXF A;  3H3H A;  1QVF 2;  2FGT A;  2XR8 B;  1VQ9 3;  3V98 A;  4PEJ A;  5IEP A;  1ASK A;  2Y73 A;  1YJN 3;  1JKG B;  3PCR A;  2P0X A;  2P38 A;  4WHA A;  1JV2 B;  1QAL A;  1IVX A;  2CH9 A;  4HZ9 B;  1M90 4;  3VGN A;  2CFD A;  3S5C A;  2CKF B;  1OHO A;  2BO9 B;  2CW9 A;  2RGQ A;  3FZW A;  2CG1 A;  2XGL A;  3CCU 3;  2XRX B;  4FMA A;  4N6U A;  5CK6 A;  5CF1 A;  1GD3 A;  4HM6 B;  3QRD A;  3ALA A;  1DVD A;  1TP6 A;  3BND A;  4J8T A;  4N6O B;  4KVH A;  1K73 4;  1LVN A;  3S28 A;  4BTX A;  3CMA 3;  3EBY A;  5G2G A;  2B1X B;  1VQ5 3;  1VQ6 3;  1LOX A;  3K9M C;  1JB2 A;  1JNQ A;  3GRD A;  4RNY A;  4HM2 B;  3GZB A;  3OX9 A;  3WMD A;  4NHF A;  3Q90 A;  4MMY B;  3KE7 A;  3KSE D;  3IJE B;  5IW9 A;  2CFW A;  1A90 A;  4LMI A;  2Z6B A;  1TIJ A;  4R4K A;  4RNZ A;  2MC8 A;  5BXQ A;  3MYT A;  2MF7 A;  3HZP A;  4WYK A;  3SVA A;  1LNH A;  2XF3 A;  3EBT A;  1VQ7 3;  2XFS A;  4EBG A;  1IT7 A;  5BVB A;  4R1K A;  1VQN 3;  4U13 A;  3BB9 A;  2W9Q A;  2Z76 A;  2Q07 A;  2OQE C;  2ZL8 A;  1SII A;  5JPU A;  2SBL A;  1BUQ A;  3NQZ A;  1N9J A;  1ULI B;  3CNX A;  3G8Z A;  1G96 A;  3OWS A;  5EQL A;  4AKY A;  4R9L A;  4O3V A;  5STD A;  3BLZ A;  2FXT A;  2OOV C;  1W4N A;  3DGO A;  4XBT A;  3SXX A;  2CWU A;  3Q1C A;  3VF1 A;  2Z77 A;  3EX9 A;  3GZY B;  1EA2 A;  3I0Y A;  4XDW A;  5LC6 A;  1NB5 I;  1DVC A;  3CME 3;  3D3L A;  3NV0 A;  3WA3 A;  3B8L A;  4N6N B;  1IK3 A;  4J9A A;  4AEQ A;  4WYK B;  5A0O B;  1GYB A;  1GY5 A;  3JUP A;  2HMO B;  2KXG A;  3FG3 A;  1W02 A;  4HM3 B;  3LZA A;  1W7C A;  2ZDJ A;  4O02 B;  3LTB A;  1IQY A;  3S67 A;  1UI8 A;  2E2V A;  4LGQ A;  1NB3 I;  3AMO A;  4MMX B;  1EKM A;  3HII A;  1PU4 A;  1VQL 3;  1IQX A;  3F7X A;  2LYX A;  3MHE A;  2Y74 A;  4EV2 A;  2ML6 A;  2JDI H;  4Q53 A;  3RDE A;  2QA4 3;  2OTL 3;  2CFG A;  3CCL 3;  1RN7 A;  1UI7 A;  3N8B A;  1SJW A;  3WOE B;  4BTY A;  5KP4 A;  3NV0 B;  3J7Y d;  3NQY A;  2GEX A;  5ELJ A;  3NBB A;  2HMM B;  3FG1 A;  3SED A;  4N6M A;  4ORL A;  1RRL A;  1N8R 4;  1RJO A;  3F7S A;  3U97 A;  1ZX2 A;  3UL5 A;  4HM1 B;  3RGA A;  3UL6 A;  3FGY A;  2KRT A;  5HGR A;  3OV4 A;  2OQE A;  4O8S A;  2CIU A;  4IIA A;  2GU1 A;  3F40 A;  3AMO B;  3I56 3;  3HI7 A;  3NBJ A;  3NM7 A;  2K0M A;  3EQQ B;  1O7G B;  1QAK A;  3G16 A;  5TGN A;  3I55 3;  2OOV A;  3CU3 A;  1AVK A;  2B24 B;  4XB5 A;  4IPB A;  3WDG B;  5AIF A;  5DRE A;  1JB5 A;  1OH0 A;  2W03 A;  3PZW A;  1OGX A;  3X40 A;  3MKI A;  4L8O A;  3OWY A;  2BMR B;  3KZT A;  1GS3 A;  2STD A;  5IF6 A;  5D82 A;  5AYR B;  2PZV A;  5KP3 A;  2BT3 A;  3EC9 A;  3UB1 A;  5D81 A;  3CPW 2;  1WMO A;  4FR9 A;  1N8Q A;  4JF8 A;  3DGM A;  3STD A;  2HMK B;  4K61 A;  2UX0 A;  1YGE A;  3DZL A;  4OUQ A;  1JB4 A;  1FGQ A;  1GY7 A;  2A15 A;  2PNC A;  2CC3 A;  3KSP A;  1DMM A;  3CD6 3;  3WOF B;  2XSO B;  4IT7 A;  1O7H B;  4CDL A;  1NDO B;  1VQ8 3;  4HM7 B;  5AIG A;  1FGR A;  4EV5 A;  3DM8 A;  1VQK 3;  2LQV A;  6STD A;  3MWZ A;  4L7K A;  1SQW A;  3WOD G;  1OCV A;  3UNL A;  1QVG 2;  3LTD A;  2GU3 A;  3NX0 A;  1Q82 4;  3FF2 A;  1EQK A;  4EC6 A;  4I4K A;  4LEH A;  3KKG A;  1Q81 4;  4KFF A;  3PCS A;  2W2C A;  1CQS A;  2YFL B;  1Q42 A;  3E99 A;  4N3V A;  4XDV A;  1VQ4 3;  2KCD A;  5ELU A;  1IVV A;  5AI1 A;  3CCM 3;  1WMP A;  1A67 A;  5JPP A;  1A2K A;  1A2V A;  3LH4 A;  1M9G A;  1S5A A;  4HYZ A;  1FA3 A;  1IQ8 A;  2M7O A;  2W9P A;  2Z7A A;  1K28 A;  1OPY A;  2CFK A;  3WA2 X;  1KQS 2;  1SIH A;  5AYS C;  3FSD A;  3EN1 B;  3ROB A;  2E2T A;  1KD1 4;  3H51 A;  3OWU A;  3FH1 A;  1F8N A;  3VSY A;  3SOY A;  5DRV A;  1O7P B;  3A76 A;  3MG1 A;  3T8U A;  1OUN A;  3BNC A;  4FCJ A;  3GWR A;  4MMZ B;  3JVC A;  3MPH A;  1STD A;  3MG2 A;  1L5G B;  2HML B;  1Q40 A;  3PXM A;  1O7M B;  3CCS 3;  3EHC A;  4HBR A;  4X2O A;  5AEW B;  4JRF A;  3M8C A;  4O2H A;  2F99 A;  1JJ2 2;  1T5Y A;  1Z1S A;  1IU7 A;  1TFK A;  3K7C A;  2OWP A;  3N54 B;  3K5T A;  1AV4 A;  2IUJ A;  2W04 A;  5IG0 A;  1K41 A;  1E3V A;  2YFI B;  1YJ9 3;  2YFJ B;  2XGN A;  3DGL A;  1NU3 A;  3JUN A;  3T8N A;  5IG3 A;  1N5P A;  5EEO A;  2XFT A;  1YIJ 3;  1FGT A;  1QMA A;  3IPT A;  2I9W A;  5IER A;  1W00 A;  1W6C A;  3NM2 A;  1FGO A;  2GBX B;  4GB5 A;  1MNL A;  2INX A;  2ML5 A;  3CC4 3;  3CPO A;  3K0Z A;  3HX8 A;  4KFD A;  3FKA A;  3LTC A;  3EN8 A;  3LT8 A;  3DGN A;  1M1K 4;  1QJG A;  3JUQ A;  3LML A;  1US1 A;  1OHS A;  4RBN A;  5CXO A;  3S29 A;  1IT8 A;  1Q40 B;  3G0K A;  1KC8 4;  1NO3 A;  3CCV 3;  4HVN A;  1DMQ A;  2P05 A;  4WP5 A;  4N6T A;  4H61 A;  2WO0 A;  2XH9 A;  1W6G A;  2F98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...