3VSYA

High-resolution crystal structure of wild-type ksi in the apo form at neutral ph
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
125
structure length
123
Chain Sequence
LPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFYRQGLGKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Steroid Delta-isomerase
publication title Incorporation of rapid thermodynamic data in fragment-based drug discovery.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
total genus 33
structure length 123
sequence length 125
chains with identical sequence B
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2012-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3vsyA00
1O7PB 3EQQB 2A15A 1AR0A 2CHCA 3VGNA 1JN5B 4XB5A 2UX0A 1OF5B 5CK6A 4STDA 5IEOA 4K1UA 4CDLA 2K54A 3NXJA 4HJLB 1OGXA 3DM8A 4OUQA 1S5AA 5IERA 4ORLA 1GY5A 1OHOA 2OWPA 3GZXB 2YFJB 3CU3A 5JPPA 2B24B 2GXFA 3B7CA 3I0YA 4X2OA 1JB2A 4FCMA 3JUQA 3MG3A 4HKVB 5AIFA 1UUVB 3OXAA 2RGQA 2XSHB 4Q53A 1GS3A 2RFRA 4HM5B 3DUKA 2W2CA 2GBWB 3HK4A 3OWSA 5CF1A 5EVHA 3MG1A 1OUNA 5AI1A 3DZLA 1ZX2A 5BVBA 1JKGB 1BUQA 4J8TA 1OHPA 1W02A 3NM2A 4U13A 3H3HA 3A76A 2XRXB 1C7HA 1O7WB 1O7NB 2YFIB 3FLJA 5AEUB 1ZO2A 5JPUA 4OVMA 1W6YA 2HMLB 3CNMA 2BNGA 2HMKB 3NV0B 1WQLB 1JB5A 1E97A 2INXA 3F14A 4LEHA 4XDVA 2R4IA 3BLZA 2Z7AA 3FKAA 1GY7A 4HM7B 2B1XB 2F98A 3B8LA 2BMRB 3LZAA 3KSPA 8CHOA 3KKGA 3CNXA 1JKGA 5D81A 4HVNA 4HM2B 1EA2A 1EG9B 1VZZA 4LGQA 3MYTA 1OHSA 3EC9A 1JN5A 1OF5A 1A2KA 3GZBA 5D82A 4HM0B 4HM8B 2BMOB 2RCDA 3FF0A 3OV4A 3STDA 4XM4A 2Z76A 3SEDA 1K41A 5BXQA 4FCJA 1ULJB 1QJGA 5STDA 4WP5A 2GBXB 3BB9A 3ER7A 4HZBB 3MKIA 3JUNA 1HKXA 1ASKA 5DRVA 6STDA 3T8UA 1NWWA 4RZMA 1ISKA 1DMQA 3FSDA 1DMMA 1TUHA 3GZYB 5TGNA 3HZPA 5CF2A 4MJDA 3UNLA 3G0KA 3F40A 1Q40B 1U5OA 4IIAA 7STDA 3DXOA 4L7KA 2STDA 4XBXA 2GEXA 3K0ZA 5AEWB 3M8CA 3WMDA 4J9AA 1NDOB 4N3VA 3F8XA 5IEPA 5HGRA 2HMOB 5AIIA 1W00A 5IG4A 1STDA 3GZRA 3MSOA 3RGAA 3NV0A 4XBYA 5AIGA 4H3UA 1ULIB 2QIYA 3KZTA 3ECFA 5AIHA 5KP1A 2CKFB 1QMAA 1OGZA 1OH0A 3OX9A 1E3RA 5IF6A 1UUWB 3S5CA 3T8NA 3EBTA 3EN8A 3NUVA 4WYKB 3FGYA 1DMNA 1Q42A 3JUPA 2QGUA 3KE7A 2HMJB 3F8HA 3FZWA 4R9KA 3DMCA 2F99A 5IG3A 3FF2A 3EBYA 3HX8A 3EF8A 3B4PA 2HMNB 3ROBA 1OCVA 4HM6B 3K7CA 4XDWA 3EHCA 3JUOA 2PZVA 3F7XA 3JUMA 3GRDA 3EN1B 1SJWA 3MG2A 4XBTA 5IG0A 2HMMB 4WWUC 1JB4A 3LYGA 3NBRA 1O7HB 2YFLB 3Q90A 1Z1SA 4L8PA 3RGRA 5KP4A 5KP3A 4R1KA 5IG5A 4KVHA 2GEYA 2I9WA 1NU3A 3MHEA 2BMQB 5G2GA 2XR8B 1Q40A 3F7SA 3D9RA 3GWRA 4X2HA 4GB5A 3G16A 3EX9A 1TP6A 3CPOA 2XSOB 4L8OA 3FH1A 2JQ5A 3G8ZA 1CQSA 5CLKA 3H51A 3OWYA 3UJMA 1GY6A 1W01A 4I4KA 4LMIA 3SOYA 3VSYA 2Z77A 2F86B 4HM1B 3E99A 4HM3B 1OPYA 4R9LA 1GYBA 5FW5A 3B4OA 1O7MB 3SOAA 3IPTA 4HZ9B 4HM4B 5IENA 3NHXA 3F9SA 2IMJA 1O7GB 4WYKA 4K1VA 5DREA 5CXOA 4PEJA 1IDPA 1E3VA 3OWUA 5D83A 3EJVA
chains in the Genus database with same CATH superfamily
4BL3A 1UI7A 1I2EA 2CG1A 2CFDA 4HBRA 3CC43 1BUJA 1O7PB 5HOHA 3EQQB 2A15A 1M1XB 3RDEA 1RCKA 2CW9A 1AR0A 1GMQA 2OTJ3 5RNTA 2CHCA 4N6NB 5M19A 1R4YA 1S723 2J8XB 3VGNA 1JN5B 1V74A 2C11A 2H0HA 2UX0A 1BVIA 2WOHA 4XB5A 1OF5B 3DH2A 4KZ1A 1JBRA 3WODG 5CK6A 3X3YA 4N6V0 2SBLA 1LOWA 3BU4A 4EXRA 2O3OA 1RN7A 2WGOA 4STDA 4K1UA 5IEOA 3URPA 4CDLA 1GSPA 5AYSC 1VQL3 2K54A 3I553 3NXJA 3CD63 3FG1A 1OGXA 2HOHA 3PGBA 4HJLB 4LSOA 8RNTA 1GOUA 3DM8A 4OUQA 1S5AA 2KF6A 1TJDA 1RTUA 4ORLA 5IERA 2FNQA 4EYCA 2ZA4A 1GY5A 1OHOA 2OWPA 1JZDA 3AMOB 4GHOA 3V98A 3GZXB 2YFJB 3N9HA 1MOLA 3BNCA 3CU3A 1UUGB 5JPPA 1RGEA 3D4AA 1TRPA 2B24B 1J2BA 2GXFA 3B7CA 1B3SA 5M18A 1F8NA 4H61A 2BHMA 1TTOA 1TIJA 3I0YA 4X2OA 1JB2A 1RGFA 1B2MA 3KIIA 2JDIH 1YJ93 4FCMA 2CC3A 3JUQA 3MG3A 4HKVB 5AIFA 1FA3A 4N6MA 2D42A 3L0RA 1D6YA 1FGQA 1MGWA 1LOXA 1GD4A 1UUVB 3OXAA 1BRSA 2SARA 1X1WA 1FGRA 1UGIA 2Y73A 4BTYA 3WOEB 2RGQA 1EKMA 1RNTA 1BGSA 1I2FA 2XSHB 4Q53A 1NNVA 3PS8A 2QA43 1GS3A 1AV4A 2RFRA 4HM5B 3DUKA 4NHFA 4R80A 1IT7A 2W2CA 2OOVC 5BU4A 2GBWB 2BIRA 3LOYA 3G713 1W6GA 3HK4A 3LTAA 1N9JA 2BT3A 3OWSA 1DVCA 4K90B 5CF1A 5IW9A 1BIRA 5EVHA 4AEQA 3MG1A 1OUNA 5I97A 5AI1A 3DZLA 1B21A 1ZX2A 4HAAA 5BVBA 1JBSA 4EBGA 3PXMA 1HU9A 2E2VA 1T5YA 1BUQA 1RRLA 4J8TA 1G0TA 1LOYA 1OHPA 3BIRA 1DE3A 1W02A 4BTWA 4IT7A 1IVUA 4O3VA 2C4BA 2CFGA 6RNTA 1BSBA 3NM2A 3AGOA 3FG4A 4WFOA 3EJVA 3H3HA 3A76A 1KWIA 2GSPA 4NPBA 4U13A 5ELUA 1AY7A 1AVKA 5AYRB 2XRXB 1C7HA 1B2XA 2UUGC 1I8VA 3WA3A 3EB8A 4JRFA 7GSPA 1O7WB 1BSAA 1RDSA 4I5QA 1D6UA 1O7NB 2YFIB 1HZ1A 3FLJA 2FXTA 5AEUB 1ZO2A 4FCZA 3DGOA 5JPUA 1RGAA 4OVMA 1W6YA 2HMLB 3CNMA 3NX0A 2IYJA 2BNGA 2HMKB 4ILFA 1I3FA 3NV0B 3QRDA 1X1XA 3G6E3 1X1UA 1V57A 1IQ8A 1WQLB 4MMXB 3LTDA 1FGMA 4GL6A 1VQ73 1R4CA 1JB5A 1E97A 2INXA 1MWUA 3F14A 4LEHA 4XDVA 3PCRA 2R4IA 3U1WA 3WR2A 3BLZA 2F4YA 2Z7AA 5M1AA 1LQGC 4HOHA 1I0VA 3FKAA 4BIRA 4K61A 1B2ZA 2IA7A 2W03A 4EC6A 1GY7A 4G1MB 1VQP3 1YNVX 1LRAA 4HM7B 1A90A 3LMLA 3CC23 1MWTA 1US1A 1RHLA 3CCU3 2B1XB 1BRIA 1Q864 2F98A 3CCE3 1YVSA 3B8LA 1BNJA 2BMRB 1IVWA 3LZAA 3KSPA 3GSPA 1Q7Y4 8CHOA 3KKGA 3LXUX 2OQEC 3CNXA 1BNRA 1JKGA 5D81A 4HVNA 2E2TA 1GMPA 2V1LA 2ZHXB 1WMNA 1JZOA 1QALA 2OCTA 4HM2B 1JV2B 9RNTA 2KF5A 2PNCA 3N54B 1EA2A 1SPUA 1YGWA 2AAEA 1EG9B 1STFI 1VZZA 4LGQA 2F5WA 3LT9A 4HYZA 3MYTA 1OHSA 2W9QA 1JN5A 2CWTA 3EC9A 1Q824 2MF7A 3T0UA 1OF5A 2CFWA 7RNTA 1A2KA 3GZBA 5D82A 1WTHA 4HM0B 3WOFB 1TFOA 3K9MC 3LH4A 4RBNA 1QVF2 1BANA 4HM8B 1LVNA 2BMOB 2RCDA 3D3LA 1LNIA 3AGNA 3FF0A 3NBJA 3OV4A 4RNZA 1IU7A 1GOYA 4KT3B 3STDA 4ZM8A 3CMA3 2IY2A 4MMYB 5EEOA 1RGGA 1UW1A 3NBBA 1W2B2 3S28A 3DY5A 1W4NA 1W5ZA 1RJOA 1M1K4 1YJN3 1RGCA 1BSDA 4XM4A 2Z76A 3Q1CA 1AVLA 3AMOA 3SEDA 1I0XA 1K41A 5BXQA 3HIIA 3V92A 3IMAB 2OTL3 2O9UX 2L4VA 4FCJA 1ULJB 1QJGA 1K734 1YI23 3LTBA 4MEIA 1Q814 1VQO3 3VF1A 5STDA 4WP5A 4EV5A 2GBXB 3BB9A 1W6CA 3ER7A 3X3ZA 4HZBB 1CYVA 2RBIA 4BTXA 1UGHI 3CCL3 1RGKA 1FUTA 1WMPA 3MKIA 4KFDA 5FGOA 3JUNA 1HKXA 1BNGA 1W2ZA 2UGIA 1CH0A 1ASKA 2OOVA 3CXC2 3UL6A 1K28A 1QAFA 5DRVA 3T8UA 4MMZB 6STDA 1NWWA 4RZMA 1T3BA 1ISKA 1DMQA 3FSDA 1Q7HA 2ML6A 5GSPA 1DMMA 1TUHA 3EE1A 4FR9A 3GZYB 3WA2X 4IPBA 1RLSA 3SLUA 5TGNA 2IUJA 2BO9B 3BNEA 1YHQ3 2RNTA 1FGTA 1BOXA 3HZPA 5CF2A 4MJDA 3UNLA 3ZFZA 2MC8A 2BU4A 3G0KA 3CCV3 1C54A 3F40A 4OK0A 1BRGA 1Q40B 1IVVA 1U5OA 4IIAA 2XFTA 2LYXA 7STDA 3DXOA 3ALAA 1X1YA 3DGYA 1WNHA 4L7KA 2Z6BA 1B2SA 2STDA 4XBXA 3CCM3 1JNQA 1KSIA 2GEXA 2W0QA 3MWZA 3D79A 3K0ZA 1NJI4 1UDII 4N6OB 3KSED 2XGLA 2ZDJA 1NB5I 5BIRA 2XF3A 5ELJA 3CC73 1JJ22 3S67A 2D1WA 3M8CA 3WMDA 5AEWB 1IK3A 4J9AA 3CCJ3 1NDOB 4N3VA 3F8XA 5IEPA 2M7OA 5HGRA 2HMOB 2KF4A 5AIIA 1W00A 5IG4A 1STDA 2W56B 5EQLA 1BNIA 1CEWI 3GZRA 4KFFA 1KQS2 1MGRA 3MSOA 3RGAA 3CME3 3NV0A 4XBYA 5AIGA 4H3UA 1NB3I 1VQ93 1MNLA 3FCSB 1IV7A 1U8CB 1ULIB 1RNBA 3HIGA 1V58A 2QIYA 3KZTA 1T2HA 1BU4A 2CWVA 3ECFA 3DGMA 1VQ63 5AIHA 1Y4KA 5KP1A 2CKFB 2K3DA 4BU4A 1LQMB 2ML5A 1YVBI 3MPHA 1QMAA 1BRKA 1OGZA 1GD3A 1OH0A 2W9PA 1VQK3 3OX9A 1G96A 1E3RA 3X41A 1G02A 5IF6A 1UUWB 3J7Yd 3CCQ3 3S5CA 3T8NA 1KD14 3BNBA 3V99A 2E2UA 3EBTA 4FMAA 1PFPA 1SQWA 4QWTA 3HOHA 3EN8A 3NUVA 3X42A 4EV2A 4WYKB 1JBTA 5A0OB 3FGYA 2ZL8A 3SX1A 2XGNA 4BL2A 1DMNA 1M904 3LT8A 1B20A 3CCR3 1A2PA 4CJNA 3UL5A 3FG3A 1Q42A 3ZG5A 3WDGB 2GU3A 2H0IA 1VQM3 1B2UA 1FW7A 3JUPA 3D5IA 1W7CA 1TRQA 2QGUA 2RSXA 2W6JH 3KE7A 2HMJB 3X3XA 1N9EA 1VQ43 3F8HA 3KFQC 2CFLA 3FZWA 3S29A 1BNEA 1HYFA 2P0XA 1UCLA 4R9KA 4O02B 4CCVA 3DMCA 1I3IA 4RNTA 2F99A 3D5GA 4J5KA 3FF2A 5IG3A 1CYUA 3DGLA 3EBYA 2P38A 2CX1A 3EF8A 3HX8A 3B4PA 2HMNB 2CX0A 3ROBA 1OCVA 4HM6B 1FYSA 3K7CA 1JRQA 1ROAA 3K63A 4XDWA 2XEPA 4AKZA 3SXXA 6GSPA 1LNHA 1LXEA 3EHCA 3JUOA 2CG0A 2PZVA 2KXGA 3F7XA 3G4S3 3JUMA 5LC7A 3GRDA 1FGOA 2P0MA 1Q9EA 3EN1B 1EUIC 3GAXA 1SJWA 2IUKA 5JBSA 3MG2A 1K9M4 1FUWA 3OW22 3PZWA 3WHOA 4XBTA 1ZGXA 5IG0A 2HMMB 2Y74A 1EEJA 2R41A 3X40A 4WWUC 2W04A 3Q2PA 1IQYA 1JB4A 3A5EA 1M9GA 3LYGA 2C10A 1O7HB 1N5HA 3NBRA 2YFLB 4FMCA 3O8YA 1DETA 1LOVA 1IV9A 1Z1SA 3Q3FA 3Q90A 3ZG0A 4L8PA 3RGRA 5KP4A 1VQN3 1I70A 3PYJA 4FMDA 2L1SA 5KP3A 4LYLB 1OACA 4R1KA 1UCJA 5IG5A 1RN4A 1ROVA 4KVHA 3CCS3 4O8SA 1VQ53 4O2HA 3CPW2 3NQYA 2GEYA 1UCIA 3NQZA 4N6LA 2I9WA 1NU3A 3LTCA 1BRJA 1IT8A 3MHEA 2BMQB 3RNTA 4AKYA 5G2GA 2Q07A 2XR8B 1Q40A 1PU4A 3F7SA 1RGHA 2KAAA 3D9RA 1QAKA 3GWRA 4X2HA 4GB5A 2F56A 2CFKA 4JF8A 4N6UA 3G16A 1FUSA 4GSPA 3EX9A 4J5GA 1EQKA 1TP6A 4CPKA 1BRHA 1IQXA 3CPOA 1KC84 1GMRA 1BSEA 2WOFA 1TU5A 2XSOB 1DYUA 4L8OA 3SVAA 4N6TA 3FH1A 1YGEA 1RCLA 2JQ5A 1GOVA 3HI7A 1BNSA 1PY3A 2P05A 1WMOA 3G8ZA 4WHAA 2AADA 1SIIA 3AHWA 3NM7A 2GU1A 1CQSA 1VQQA 4LZIA 5CLKA 5G1KA 1RSNA 3H51A 2CK3H 3OWYA 1L5GB 3SYUA 3UJMA 1GY6A 1W01A 3I563 2W56A 1B27A 4I4KA 1BRNL 1BAOA 2XH9A 1TFKA 3TDGA 1RMSA 3UB1A 2FGTA 4LMIA 3SOYA 3JVCA 1BNFA 3BNDA 1K8A4 2H0GA 4TX4A 1IVXA 1N8QA 2WGQA 3U97A 3VSYA 2CH9A 2Z77A 3PCSA 1QVG2 1SARA 1BSCA 1N8R4 1RGLA 1YIT3 2KF3A 1UCKA 2QEX3 3IJEB 4EW5A 2F86B 3AHSA 4KFEA 2KRTA 1D6ZA 1IYYA 4HM1B 1SIHA 1RKYA 3E99A 4HM3B 3KCHA 2WO0A 1A67A 3KN4A 2YX9A 1RN1A 2OQEA 1OPYA 1PYLA 4R9LA 5G1LA 3N8BA 4DKIA 2XFSA 3DGNA 1ZS7A 2P09A 1GYBA 1N5PA 2K0MA 5FW5A 3B4OA 1O7MB 1RRHA 1A2VA 5LC6A 3SOAA 1MWSA 1AQZA 3IPTA 1YIJ3 1I2GA 4HZ9B 2KCDA 1UI8A 1FZUA 2CWUA 4HM4B 3S27A 5IENA 2LQVA 3NHXA 1NO3A 2CIUA 2IMJA 1O7GB 3F9SA 4WYKA 1DVDA 4K1VA 4R4KA 5DREA 2F5MA 5CXOA 1T2IA 3K5TA 1VQ83 1MWRA 1YJW3 4PEJA 3QK9A 4RNYA 1IDPA 1E3VA 4FMBA 3OWUA 5D83A 4NREA 1JKGB
chains in the Genus database with same CATH topology
1UI7A 2CG1A 2CFDA 4HBRA 3CC43 1O7PB 3EQQB 2A15A 1M1XB 3RDEA 2CW9A 1AR0A 2OTJ3 2CHCA 4N6NB 1S723 3VGNA 1JN5B 1V74A 2C11A 2UX0A 2WOHA 4XB5A 1OF5B 4KZ1A 3WODG 5CK6A 3X3YA 4N6V0 2SBLA 4EXRA 2O3OA 1RN7A 2WGOA 4STDA 4K1UA 5IEOA 4CDLA 1VQL3 2K54A 3I553 3NXJA 3CD63 3FG1A 1OGXA 3PGBA 4HJLB 4LSOA 3DM8A 4OUQA 1S5AA 5IERA 4ORLA 2FNQA 4EYCA 1GY5A 1OHOA 2OWPA 3AMOB 3V98A 3GZXB 2YFJB 3N9HA 1MOLA 3BNCA 3CU3A 5JPPA 2B24B 1J2BA 2GXFA 3B7CA 1F8NA 4H61A 2BHMA 1TIJA 3I0YA 4X2OA 1JB2A 3KIIA 2JDIH 1YJ93 4FCMA 2CC3A 3JUQA 3MG3A 4HKVB 5AIFA 1FA3A 4N6MA 2D42A 3L0RA 1D6YA 1FGQA 1LOXA 1GD4A 1UUVB 3OXAA 1FGRA 2Y73A 4BTYA 3WOEB 2RGQA 1EKMA 2XSHB 4Q53A 2QA43 1VQ53 3PS8A 1GS3A 1AV4A 2RFRA 4HM5B 3DUKA 4NHFA 4R80A 1IT7A 2W2CA 2OOVC 3G713 2GBWB 3LOYA 1W6GA 3HK4A 3LTAA 1N9JA 2BT3A 3OWSA 1DVCA 4K90B 5CF1A 5IW9A 5EVHA 4AEQA 3MG1A 1OUNA 5I97A 5AI1A 3DZLA 1ZX2A 5BVBA 4EBGA 3PXMA 1HU9A 2E2VA 1T5YA 1BUQA 1RRLA 4J8TA 1OHPA 1W02A 4BTWA 4IT7A 1IVUA 4O3VA 2CFGA 3NM2A 3FG4A 4WFOA 5AYSC 3EJVA 3H3HA 3A76A 1KWIA 4U13A 5ELUA 5AYRB 1AVKA 2XRXB 1C7HA 3WA3A 3EB8A 4JRFA 1O7WB 1D6UA 1O7NB 2YFIB 3FLJA 2FXTA 5AEUB 1ZO2A 4FCZA 3DGOA 5JPUA 4OVMA 1W6YA 2HMLB 3CNMA 3NX0A 2BNGA 2HMKB 3NV0B 3QRDA 3G6E3 1IQ8A 1WQLB 4MMXB 3LTDA 1FGMA 4GL6A 1VQ73 1R4CA 1JB5A 1E97A 2INXA 3F14A 4LEHA 4XDVA 3PCRA 2R4IA 3U1WA 3BLZA 2Z7AA 3FKAA 4K61A 2W03A 2IA7A 4EC6A 1VQP3 1GY7A 4G1MB 4HM7B 1A90A 3LMLA 3CC23 3CCU3 1US1A 2B1XB 1Q864 2F98A 3CCE3 3B8LA 2BMRB 1IVWA 3LZAA 3KSPA 1Q7Y4 8CHOA 3KKGA 3LXUX 2OQEC 3CNXA 1JKGA 5D81A 4HVNA 2E2TA 2V1LA 1WMNA 2OCTA 1QALA 4HM2B 1JV2B 2PNCA 3N54B 1EA2A 1SPUA 1EG9B 1STFI 1VZZA 4LGQA 3LT9A 4HYZA 3MYTA 1OHSA 2W9QA 1JN5A 2CWTA 3EC9A 1Q824 2MF7A 3T0UA 1OF5A 2CFWA 1A2KA 3GZBA 5D82A 1WTHA 4HM0B 3WOFB 1TFOA 3K9MC 3LH4A 4RBNA 1QVF2 4HM8B 1LVNA 2BMOB 2RCDA 3D3LA 3FF0A 3NBJA 3OV4A 4RNZA 1IU7A 3STDA 4ZM8A 3CMA3 4MMYB 5EEOA 1UW1A 3NBBA 1W2B2 3S28A 3DY5A 1W4NA 1W5ZA 1RJOA 1M1K4 1YJN3 4XM4A 2Z76A 3Q1CA 1AVLA 3AMOA 3SEDA 1K41A 5BXQA 3HIIA 3V92A 3IMAB 2OTL3 2O9UX 2L4VA 4FCJA 1ULJB 1QJGA 1K734 1YI23 3LTBA 4MEIA 1Q814 1VQO3 3VF1A 5STDA 4WP5A 4EV5A 2GBXB 3BB9A 1W6CA 3ER7A 3X3ZA 4HZBB 1CYVA 4BTXA 3CCL3 1KD14 5FGOA 1WMPA 3MKIA 4KFDA 3JUNA 1HKXA 1W2ZA 2OOVA 1ASKA 3CXC2 3UL6A 1K28A 1QAFA 5DRVA 3T8UA 4MMZB 6STDA 1NWWA 4RZMA 1ISKA 1DMQA 3FSDA 2ML6A 1DMMA 1TUHA 3EE1A 4FR9A 3GZYB 3WA2X 4IPBA 3SLUA 5TGNA 2IUJA 2BO9B 3BNEA 1YHQ3 1FGTA 3HZPA 5CF2A 4MJDA 3UNLA 2MC8A 3G0KA 3CCV3 3F40A 4OK0A 1Q40B 1IVVA 1U5OA 4IIAA 2XFTA 2LYXA 7STDA 3DXOA 3ALAA 1WNHA 4L7KA 2Z6BA 2STDA 4XBXA 3CCM3 1JNQA 1KSIA 2GEXA 2W0QA 3MWZA 3K0ZA 1NJI4 4N6OB 3KSED 2XGLA 2ZDJA 1NB5I 2XF3A 5ELJA 3CC73 1JJ22 3S67A 2D1WA 3M8CA 3WMDA 5AEWB 1IK3A 4J9AA 3CCJ3 1NDOB 4N3VA 3F8XA 5IEPA 2M7OA 5HGRA 2HMOB 5AIIA 1W00A 5IG4A 1STDA 2W56B 5EQLA 3GZRA 1CEWI 4KFFA 1KQS2 3MSOA 3RGAA 3CME3 3NV0A 4XBYA 5AIGA 4H3UA 1NB3I 1VQ93 1MNLA 3FCSB 1IV7A 1U8CB 1ULIB 3HIGA 2QIYA 3KZTA 2CWVA 3ECFA 3DGMA 1VQ63 5AIHA 1Y4KA 5KP1A 2CKFB 2ML5A 1YVBI 3MPHA 1QMAA 1OGZA 1GD3A 1OH0A 2W9PA 1VQK3 3OX9A 1G96A 1E3RA 3X41A 5IF6A 1UUWB 3J7Yd 3CCQ3 3S5CA 3T8NA 3BNBA 3V99A 2E2UA 3EBTA 4FMAA 1PFPA 1SQWA 4QWTA 3EN8A 3NUVA 3X42A 4EV2A 4WYKB 5A0OB 3FGYA 2ZL8A 3SX1A 2XGNA 1DMNA 1M904 3LT8A 3CCR3 3UL5A 3FG3A 1Q42A 3WDGB 2GU3A 1VQM3 3JUPA 1W7CA 2QGUA 2RSXA 2W6JH 3KE7A 3X3XA 2HMJB 1VQ43 1N9EA 3F8HA 3KFQC 2CFLA 3FZWA 3S29A 2P0XA 4R9KA 4O02B 4CCVA 3DMCA 2F99A 5IG3A 1CYUA 3FF2A 3DGLA 3EBYA 2P38A 3HX8A 3EF8A 3B4PA 2HMNB 3ROBA 1OCVA 4HM6B 3K7CA 1JRQA 1ROAA 3K63A 4XDWA 2XEPA 4AKZA 3SXXA 1LNHA 1LXEA 3EHCA 3JUOA 2CG0A 2PZVA 2KXGA 3F7XA 3G4S3 3JUMA 5LC7A 3GRDA 1FGOA 2P0MA 3EN1B 3GAXA 1SJWA 2IUKA 5JBSA 3MG2A 1K9M4 1FUWA 3OW22 3PZWA 4XBTA 5IG0A 2HMMB 2Y74A 3X40A 4WWUC 2W04A 3Q2PA 1IQYA 1JB4A 1M9GA 3LYGA 2C10A 1O7HB 1N5HA 3NBRA 2YFLB 4FMCA 3O8YA 1IV9A 1Z1SA 3Q90A 4L8PA 3RGRA 5KP4A 1VQN3 3PYJA 4FMDA 5KP3A 1OACA 4R1KA 5IG5A 1ROVA 4KVHA 3CCS3 4O8SA 4O2HA 3CPW2 3NQYA 2GEYA 4N6LA 3NQZA 2I9WA 1NU3A 3LTCA 1IT8A 4AKYA 3MHEA 2BMQB 5G2GA 2Q07A 2XR8B 1Q40A 1PU4A 3F7SA 3D9RA 3GWRA 1QAKA 4X2HA 4GB5A 2CFKA 4JF8A 4N6UA 3G16A 3EX9A 1EQKA 1TP6A 1IQXA 3CPOA 1KC84 2WOFA 1TU5A 2XSOB 1DYUA 4L8OA 3SVAA 4N6TA 3FH1A 1YGEA 2JQ5A 3HI7A 2P05A 1WMOA 3G8ZA 4WHAA 1SIIA 3NM7A 2GU1A 1CQSA 4LZIA 5CLKA 3H51A 2CK3H 3OWYA 1L5GB 3UJMA 1GY6A 1W01A 3I563 2W56A 4I4KA 2XH9A 3TDGA 1TFKA 3UB1A 2FGTA 4LMIA 3SOYA 3JVCA 3BNDA 1K8A4 4TX4A 1IVXA 1N8QA 2WGQA 3U97A 3VSYA 2CH9A 2Z77A 3PCSA 1QVG2 1N8R4 1YIT3 2QEX3 3IJEB 2F86B 4KFEA 2KRTA 1D6ZA 4HM1B 1SIHA 1RKYA 3E99A 4HM3B 2WO0A 1A67A 3KN4A 2YX9A 2OQEA 1OPYA 4R9LA 3N8BA 2XFSA 3DGNA 2P09A 1GYBA 1N5PA 2K0MA 5FW5A 3B4OA 1O7MB 1RRHA 1A2VA 5LC6A 3SOAA 3IPTA 1YIJ3 4HZ9B 2KCDA 1UI8A 2CWUA 4HM4B 3S27A 5IENA 2LQVA 3NHXA 1NO3A 2CIUA 2IMJA 1O7GB 3F9SA 4WYKA 1DVDA 4K1VA 4R4KA 5DREA 5CXOA 3K5TA 1VQ83 1YJW3 4PEJA 3QK9A 4RNYA 1IDPA 1E3VA 4FMBA 3OWUA 5D83A 4NREA 1JKGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O7P B;  3EQQ B;  2A15 A;  1AR0 A;  2CHC A;  3VGN A;  1JN5 B;  4XB5 A;  2UX0 A;  1OF5 B;  5CK6 A;  4STD A;  5IEO A;  4K1U A;  4CDL A;  2K54 A;  3NXJ A;  4HJL B;  1OGX A;  3DM8 A;  4OUQ A;  1S5A A;  5IER A;  4ORL A;  1GY5 A;  1OHO A;  2OWP A;  3GZX B;  2YFJ B;  3CU3 A;  5JPP A;  2B24 B;  2GXF A;  3B7C A;  3I0Y A;  4X2O A;  1JB2 A;  4FCM A;  3JUQ A;  3MG3 A;  4HKV B;  5AIF A;  1UUV B;  3OXA A;  2RGQ A;  2XSH B;  4Q53 A;  1GS3 A;  2RFR A;  4HM5 B;  3DUK A;  2W2C A;  2GBW B;  3HK4 A;  3OWS A;  5CF1 A;  5EVH A;  3MG1 A;  1OUN A;  5AI1 A;  3DZL A;  1ZX2 A;  5BVB A;  1JKG B;  1BUQ A;  4J8T A;  1OHP A;  1W02 A;  3NM2 A;  4U13 A;  3H3H A;  3A76 A;  2XRX B;  1C7H A;  1O7W B;  1O7N B;  2YFI B;  3FLJ A;  5AEU B;  1ZO2 A;  5JPU A;  4OVM A;  1W6Y A;  2HML B;  3CNM A;  2BNG A;  2HMK B;  3NV0 B;  1WQL B;  1JB5 A;  1E97 A;  2INX A;  3F14 A;  4LEH A;  4XDV A;  2R4I A;  3BLZ A;  2Z7A A;  3FKA A;  1GY7 A;  4HM7 B;  2B1X B;  2F98 A;  3B8L A;  2BMR B;  3LZA A;  3KSP A;  8CHO A;  3KKG A;  3CNX A;  1JKG A;  5D81 A;  4HVN A;  4HM2 B;  1EA2 A;  1EG9 B;  1VZZ A;  4LGQ A;  3MYT A;  1OHS A;  3EC9 A;  1JN5 A;  1OF5 A;  1A2K A;  3GZB A;  5D82 A;  4HM0 B;  4HM8 B;  2BMO B;  2RCD A;  3FF0 A;  3OV4 A;  3STD A;  4XM4 A;  2Z76 A;  3SED A;  1K41 A;  5BXQ A;  4FCJ A;  1ULJ B;  1QJG A;  5STD A;  4WP5 A;  2GBX B;  3BB9 A;  3ER7 A;  4HZB B;  3MKI A;  3JUN A;  1HKX A;  1ASK A;  5DRV A;  6STD A;  3T8U A;  1NWW A;  4RZM A;  1ISK A;  1DMQ A;  3FSD A;  1DMM A;  1TUH A;  3GZY B;  5TGN A;  3HZP A;  5CF2 A;  4MJD A;  3UNL A;  3G0K A;  3F40 A;  1Q40 B;  1U5O A;  4IIA A;  7STD A;  3DXO A;  4L7K A;  2STD A;  4XBX A;  2GEX A;  3K0Z A;  5AEW B;  3M8C A;  3WMD A;  4J9A A;  1NDO B;  4N3V A;  3F8X A;  5IEP A;  5HGR A;  2HMO B;  5AII A;  1W00 A;  5IG4 A;  1STD A;  3GZR A;  3MSO A;  3RGA A;  3NV0 A;  4XBY A;  5AIG A;  4H3U A;  1ULI B;  2QIY A;  3KZT A;  3ECF A;  5AIH A;  5KP1 A;  2CKF B;  1QMA A;  1OGZ A;  1OH0 A;  3OX9 A;  1E3R A;  5IF6 A;  1UUW B;  3S5C A;  3T8N A;  3EBT A;  3EN8 A;  3NUV A;  4WYK B;  3FGY A;  1DMN A;  1Q42 A;  3JUP A;  2QGU A;  3KE7 A;  2HMJ B;  3F8H A;  3FZW A;  4R9K A;  3DMC A;  2F99 A;  5IG3 A;  3FF2 A;  3EBY A;  3HX8 A;  3EF8 A;  3B4P A;  2HMN B;  3ROB A;  1OCV A;  4HM6 B;  3K7C A;  4XDW A;  3EHC A;  3JUO A;  2PZV A;  3F7X A;  3JUM A;  3GRD A;  3EN1 B;  1SJW A;  3MG2 A;  4XBT A;  5IG0 A;  2HMM B;  4WWU C;  1JB4 A;  3LYG A;  3NBR A;  1O7H B;  2YFL B;  3Q90 A;  1Z1S A;  4L8P A;  3RGR A;  5KP4 A;  5KP3 A;  4R1K A;  5IG5 A;  4KVH A;  2GEY A;  2I9W A;  1NU3 A;  3MHE A;  2BMQ B;  5G2G A;  2XR8 B;  1Q40 A;  3F7S A;  3D9R A;  3GWR A;  4X2H A;  4GB5 A;  3G16 A;  3EX9 A;  1TP6 A;  3CPO A;  2XSO B;  4L8O A;  3FH1 A;  2JQ5 A;  3G8Z A;  1CQS A;  5CLK A;  3H51 A;  3OWY A;  3UJM A;  1GY6 A;  1W01 A;  4I4K A;  4LMI A;  3SOY A;  3VSY A;  2Z77 A;  2F86 B;  4HM1 B;  3E99 A;  4HM3 B;  1OPY A;  4R9L A;  1GYB A;  5FW5 A;  3B4O A;  1O7M B;  3SOA A;  3IPT A;  4HZ9 B;  4HM4 B;  5IEN A;  3NHX A;  3F9S A;  2IMJ A;  1O7G B;  4WYK A;  4K1V A;  5DRE A;  5CXO A;  4PEJ A;  1IDP A;  1E3V A;  3OWU A;  5D83 A;  3EJV A; 
#chains in the Genus database with same CATH topology
 4BL3 A;  1UI7 A;  1I2E A;  2CG1 A;  2CFD A;  4HBR A;  3CC4 3;  1BUJ A;  1O7P B;  5HOH A;  3EQQ B;  2A15 A;  1M1X B;  3RDE A;  1RCK A;  2CW9 A;  1AR0 A;  1GMQ A;  2OTJ 3;  5RNT A;  2CHC A;  4N6N B;  5M19 A;  1R4Y A;  1S72 3;  2J8X B;  3VGN A;  1JN5 B;  1V74 A;  2C11 A;  2H0H A;  2UX0 A;  1BVI A;  2WOH A;  4XB5 A;  1OF5 B;  3DH2 A;  4KZ1 A;  1JBR A;  3WOD G;  5CK6 A;  3X3Y A;  4N6V 0;  2SBL A;  1LOW A;  3BU4 A;  4EXR A;  2O3O A;  1RN7 A;  2WGO A;  4STD A;  4K1U A;  5IEO A;  3URP A;  4CDL A;  1GSP A;  5AYS C;  1VQL 3;  2K54 A;  3I55 3;  3NXJ A;  3CD6 3;  3FG1 A;  1OGX A;  2HOH A;  3PGB A;  4HJL B;  4LSO A;  8RNT A;  1GOU A;  3DM8 A;  4OUQ A;  1S5A A;  2KF6 A;  1TJD A;  1RTU A;  4ORL A;  5IER A;  2FNQ A;  4EYC A;  2ZA4 A;  1GY5 A;  1OHO A;  2OWP A;  1JZD A;  3AMO B;  4GHO A;  3V98 A;  3GZX B;  2YFJ B;  3N9H A;  1MOL A;  3BNC A;  3CU3 A;  1UUG B;  5JPP A;  1RGE A;  3D4A A;  1TRP A;  2B24 B;  1J2B A;  2GXF A;  3B7C A;  1B3S A;  5M18 A;  1F8N A;  4H61 A;  2BHM A;  1TTO A;  1TIJ A;  3I0Y A;  4X2O A;  1JB2 A;  1RGF A;  1B2M A;  3KII A;  2JDI H;  1YJ9 3;  4FCM A;  2CC3 A;  3JUQ A;  3MG3 A;  4HKV B;  5AIF A;  1FA3 A;  4N6M A;  2D42 A;  3L0R A;  1D6Y A;  1FGQ A;  1MGW A;  1LOX A;  1GD4 A;  1UUV B;  3OXA A;  1BRS A;  2SAR A;  1X1W A;  1FGR A;  1UGI A;  2Y73 A;  4BTY A;  3WOE B;  2RGQ A;  1EKM A;  1RNT A;  1BGS A;  1I2F A;  2XSH B;  4Q53 A;  1NNV A;  3PS8 A;  2QA4 3;  1GS3 A;  1AV4 A;  2RFR A;  4HM5 B;  3DUK A;  4NHF A;  4R80 A;  1IT7 A;  2W2C A;  2OOV C;  5BU4 A;  2GBW B;  2BIR A;  3LOY A;  3G71 3;  1W6G A;  3HK4 A;  3LTA A;  1N9J A;  2BT3 A;  3OWS A;  1DVC A;  4K90 B;  5CF1 A;  5IW9 A;  1BIR A;  5EVH A;  4AEQ A;  3MG1 A;  1OUN A;  5I97 A;  5AI1 A;  3DZL A;  1B21 A;  1ZX2 A;  4HAA A;  5BVB A;  1JBS A;  4EBG A;  3PXM A;  1HU9 A;  2E2V A;  1T5Y A;  1BUQ A;  1RRL A;  4J8T A;  1G0T A;  1LOY A;  1OHP A;  3BIR A;  1DE3 A;  1W02 A;  4BTW A;  4IT7 A;  1IVU A;  4O3V A;  2C4B A;  2CFG A;  6RNT A;  1BSB A;  3NM2 A;  3AGO A;  3FG4 A;  4WFO A;  3EJV A;  3H3H A;  3A76 A;  1KWI A;  2GSP A;  4NPB A;  4U13 A;  5ELU A;  1AY7 A;  1AVK A;  5AYR B;  2XRX B;  1C7H A;  1B2X A;  2UUG C;  1I8V A;  3WA3 A;  3EB8 A;  4JRF A;  7GSP A;  1O7W B;  1BSA A;  1RDS A;  4I5Q A;  1D6U A;  1O7N B;  2YFI B;  1HZ1 A;  3FLJ A;  2FXT A;  5AEU B;  1ZO2 A;  4FCZ A;  3DGO A;  5JPU A;  1RGA A;  4OVM A;  1W6Y A;  2HML B;  3CNM A;  3NX0 A;  2IYJ A;  2BNG A;  2HMK B;  4ILF A;  1I3F A;  3NV0 B;  3QRD A;  1X1X A;  3G6E 3;  1X1U A;  1V57 A;  1IQ8 A;  1WQL B;  4MMX B;  3LTD A;  1FGM A;  4GL6 A;  1VQ7 3;  1R4C A;  1JB5 A;  1E97 A;  2INX A;  1MWU A;  3F14 A;  4LEH A;  4XDV A;  3PCR A;  2R4I A;  3U1W A;  3WR2 A;  3BLZ A;  2F4Y A;  2Z7A A;  5M1A A;  1LQG C;  4HOH A;  1I0V A;  3FKA A;  4BIR A;  4K61 A;  1B2Z A;  2IA7 A;  2W03 A;  4EC6 A;  1GY7 A;  4G1M B;  1VQP 3;  1YNV X;  1LRA A;  4HM7 B;  1A90 A;  3LML A;  3CC2 3;  1MWT A;  1US1 A;  1RHL A;  3CCU 3;  2B1X B;  1BRI A;  1Q86 4;  2F98 A;  3CCE 3;  1YVS A;  3B8L A;  1BNJ A;  2BMR B;  1IVW A;  3LZA A;  3KSP A;  3GSP A;  1Q7Y 4;  8CHO A;  3KKG A;  3LXU X;  2OQE C;  3CNX A;  1BNR A;  1JKG A;  5D81 A;  4HVN A;  2E2T A;  1GMP A;  2V1L A;  2ZHX B;  1WMN A;  1JZO A;  1QAL A;  2OCT A;  4HM2 B;  1JV2 B;  9RNT A;  2KF5 A;  2PNC A;  3N54 B;  1EA2 A;  1SPU A;  1YGW A;  2AAE A;  1EG9 B;  1STF I;  1VZZ A;  4LGQ A;  2F5W A;  3LT9 A;  4HYZ A;  3MYT A;  1OHS A;  2W9Q A;  1JN5 A;  2CWT A;  3EC9 A;  1Q82 4;  2MF7 A;  3T0U A;  1OF5 A;  2CFW A;  7RNT A;  1A2K A;  3GZB A;  5D82 A;  1WTH A;  4HM0 B;  3WOF B;  1TFO A;  3K9M C;  3LH4 A;  4RBN A;  1QVF 2;  1BAN A;  4HM8 B;  1LVN A;  2BMO B;  2RCD A;  3D3L A;  1LNI A;  3AGN A;  3FF0 A;  3NBJ A;  3OV4 A;  4RNZ A;  1IU7 A;  1GOY A;  4KT3 B;  3STD A;  4ZM8 A;  3CMA 3;  2IY2 A;  4MMY B;  5EEO A;  1RGG A;  1UW1 A;  3NBB A;  1W2B 2;  3S28 A;  3DY5 A;  1W4N A;  1W5Z A;  1RJO A;  1M1K 4;  1YJN 3;  1RGC A;  1BSD A;  4XM4 A;  2Z76 A;  3Q1C A;  1AVL A;  3AMO A;  3SED A;  1I0X A;  1K41 A;  5BXQ A;  3HII A;  3V92 A;  3IMA B;  2OTL 3;  2O9U X;  2L4V A;  4FCJ A;  1ULJ B;  1QJG A;  1K73 4;  1YI2 3;  3LTB A;  4MEI A;  1Q81 4;  1VQO 3;  3VF1 A;  5STD A;  4WP5 A;  4EV5 A;  2GBX B;  3BB9 A;  1W6C A;  3ER7 A;  3X3Z A;  4HZB B;  1CYV A;  2RBI A;  4BTX A;  1UGH I;  3CCL 3;  1RGK A;  1FUT A;  1WMP A;  3MKI A;  4KFD A;  5FGO A;  3JUN A;  1HKX A;  1BNG A;  1W2Z A;  2UGI A;  1CH0 A;  1ASK A;  2OOV A;  3CXC 2;  3UL6 A;  1K28 A;  1QAF A;  5DRV A;  3T8U A;  4MMZ B;  6STD A;  1NWW A;  4RZM A;  1T3B A;  1ISK A;  1DMQ A;  3FSD A;  1Q7H A;  2ML6 A;  5GSP A;  1DMM A;  1TUH A;  3EE1 A;  4FR9 A;  3GZY B;  3WA2 X;  4IPB A;  1RLS A;  3SLU A;  5TGN A;  2IUJ A;  2BO9 B;  3BNE A;  1YHQ 3;  2RNT A;  1FGT A;  1BOX A;  3HZP A;  5CF2 A;  4MJD A;  3UNL A;  3ZFZ A;  2MC8 A;  2BU4 A;  3G0K A;  3CCV 3;  1C54 A;  3F40 A;  4OK0 A;  1BRG A;  1Q40 B;  1IVV A;  1U5O A;  4IIA A;  2XFT A;  2LYX A;  7STD A;  3DXO A;  3ALA A;  1X1Y A;  3DGY A;  1WNH A;  4L7K A;  2Z6B A;  1B2S A;  2STD A;  4XBX A;  3CCM 3;  1JNQ A;  1KSI A;  2GEX A;  2W0Q A;  3MWZ A;  3D79 A;  3K0Z A;  1NJI 4;  1UDI I;  4N6O B;  3KSE D;  2XGL A;  2ZDJ A;  1NB5 I;  5BIR A;  2XF3 A;  5ELJ A;  3CC7 3;  1JJ2 2;  3S67 A;  2D1W A;  3M8C A;  3WMD A;  5AEW B;  1IK3 A;  4J9A A;  3CCJ 3;  1NDO B;  4N3V A;  3F8X A;  5IEP A;  2M7O A;  5HGR A;  2HMO B;  2KF4 A;  5AII A;  1W00 A;  5IG4 A;  1STD A;  2W56 B;  5EQL A;  1BNI A;  1CEW I;  3GZR A;  4KFF A;  1KQS 2;  1MGR A;  3MSO A;  3RGA A;  3CME 3;  3NV0 A;  4XBY A;  5AIG A;  4H3U A;  1NB3 I;  1VQ9 3;  1MNL A;  3FCS B;  1IV7 A;  1U8C B;  1ULI B;  1RNB A;  3HIG A;  1V58 A;  2QIY A;  3KZT A;  1T2H A;  1BU4 A;  2CWV A;  3ECF A;  3DGM A;  1VQ6 3;  5AIH A;  1Y4K A;  5KP1 A;  2CKF B;  2K3D A;  4BU4 A;  1LQM B;  2ML5 A;  1YVB I;  3MPH A;  1QMA A;  1BRK A;  1OGZ A;  1GD3 A;  1OH0 A;  2W9P A;  1VQK 3;  3OX9 A;  1G96 A;  1E3R A;  3X41 A;  1G02 A;  5IF6 A;  1UUW B;  3J7Y d;  3CCQ 3;  3S5C A;  3T8N A;  1KD1 4;  3BNB A;  3V99 A;  2E2U A;  3EBT A;  4FMA A;  1PFP A;  1SQW A;  4QWT A;  3HOH A;  3EN8 A;  3NUV A;  3X42 A;  4EV2 A;  4WYK B;  1JBT A;  5A0O B;  3FGY A;  2ZL8 A;  3SX1 A;  2XGN A;  4BL2 A;  1DMN A;  1M90 4;  3LT8 A;  1B20 A;  3CCR 3;  1A2P A;  4CJN A;  3UL5 A;  3FG3 A;  1Q42 A;  3ZG5 A;  3WDG B;  2GU3 A;  2H0I A;  1VQM 3;  1B2U A;  1FW7 A;  3JUP A;  3D5I A;  1W7C A;  1TRQ A;  2QGU A;  2RSX A;  2W6J H;  3KE7 A;  2HMJ B;  3X3X A;  1N9E A;  1VQ4 3;  3F8H A;  3KFQ C;  2CFL A;  3FZW A;  3S29 A;  1BNE A;  1HYF A;  2P0X A;  1UCL A;  4R9K A;  4O02 B;  4CCV A;  3DMC A;  1I3I A;  4RNT A;  2F99 A;  3D5G A;  4J5K A;  3FF2 A;  5IG3 A;  1CYU A;  3DGL A;  3EBY A;  2P38 A;  2CX1 A;  3EF8 A;  3HX8 A;  3B4P A;  2HMN B;  2CX0 A;  3ROB A;  1OCV A;  4HM6 B;  1FYS A;  3K7C A;  1JRQ A;  1ROA A;  3K63 A;  4XDW A;  2XEP A;  4AKZ A;  3SXX A;  6GSP A;  1LNH A;  1LXE A;  3EHC A;  3JUO A;  2CG0 A;  2PZV A;  2KXG A;  3F7X A;  3G4S 3;  3JUM A;  5LC7 A;  3GRD A;  1FGO A;  2P0M A;  1Q9E A;  3EN1 B;  1EUI C;  3GAX A;  1SJW A;  2IUK A;  5JBS A;  3MG2 A;  1K9M 4;  1FUW A;  3OW2 2;  3PZW A;  3WHO A;  4XBT A;  1ZGX A;  5IG0 A;  2HMM B;  2Y74 A;  1EEJ A;  2R41 A;  3X40 A;  4WWU C;  2W04 A;  3Q2P A;  1IQY A;  1JB4 A;  3A5E A;  1M9G A;  3LYG A;  2C10 A;  1O7H B;  1N5H A;  3NBR A;  2YFL B;  4FMC A;  3O8Y A;  1DET A;  1LOV A;  1IV9 A;  1Z1S A;  3Q3F A;  3Q90 A;  3ZG0 A;  4L8P A;  3RGR A;  5KP4 A;  1VQN 3;  1I70 A;  3PYJ A;  4FMD A;  2L1S A;  5KP3 A;  4LYL B;  1OAC A;  4R1K A;  1UCJ A;  5IG5 A;  1RN4 A;  1ROV A;  4KVH A;  3CCS 3;  4O8S A;  1VQ5 3;  4O2H A;  3CPW 2;  3NQY A;  2GEY A;  1UCI A;  3NQZ A;  4N6L A;  2I9W A;  1NU3 A;  3LTC A;  1BRJ A;  1IT8 A;  3MHE A;  2BMQ B;  3RNT A;  4AKY A;  5G2G A;  2Q07 A;  2XR8 B;  1Q40 A;  1PU4 A;  3F7S A;  1RGH A;  2KAA A;  3D9R A;  1QAK A;  3GWR A;  4X2H A;  4GB5 A;  2F56 A;  2CFK A;  4JF8 A;  4N6U A;  3G16 A;  1FUS A;  4GSP A;  3EX9 A;  4J5G A;  1EQK A;  1TP6 A;  4CPK A;  1BRH A;  1IQX A;  3CPO A;  1KC8 4;  1GMR A;  1BSE A;  2WOF A;  1TU5 A;  2XSO B;  1DYU A;  4L8O A;  3SVA A;  4N6T A;  3FH1 A;  1YGE A;  1RCL A;  2JQ5 A;  1GOV A;  3HI7 A;  1BNS A;  1PY3 A;  2P05 A;  1WMO A;  3G8Z A;  4WHA A;  2AAD A;  1SII A;  3AHW A;  3NM7 A;  2GU1 A;  1CQS A;  1VQQ A;  4LZI A;  5CLK A;  5G1K A;  1RSN A;  3H51 A;  2CK3 H;  3OWY A;  1L5G B;  3SYU A;  3UJM A;  1GY6 A;  1W01 A;  3I56 3;  2W56 A;  1B27 A;  4I4K A;  1BRN L;  1BAO A;  2XH9 A;  1TFK A;  3TDG A;  1RMS A;  3UB1 A;  2FGT A;  4LMI A;  3SOY A;  3JVC A;  1BNF A;  3BND A;  1K8A 4;  2H0G A;  4TX4 A;  1IVX A;  1N8Q A;  2WGQ A;  3U97 A;  3VSY A;  2CH9 A;  2Z77 A;  3PCS A;  1QVG 2;  1SAR A;  1BSC A;  1N8R 4;  1RGL A;  1YIT 3;  2KF3 A;  1UCK A;  2QEX 3;  3IJE B;  4EW5 A;  2F86 B;  3AHS A;  4KFE A;  2KRT A;  1D6Z A;  1IYY A;  4HM1 B;  1SIH A;  1RKY A;  3E99 A;  4HM3 B;  3KCH A;  2WO0 A;  1A67 A;  3KN4 A;  2YX9 A;  1RN1 A;  2OQE A;  1OPY A;  1PYL A;  4R9L A;  5G1L A;  3N8B A;  4DKI A;  2XFS A;  3DGN A;  1ZS7 A;  2P09 A;  1GYB A;  1N5P A;  2K0M A;  5FW5 A;  3B4O A;  1O7M B;  1RRH A;  1A2V A;  5LC6 A;  3SOA A;  1MWS A;  1AQZ A;  3IPT A;  1YIJ 3;  1I2G A;  4HZ9 B;  2KCD A;  1UI8 A;  1FZU A;  2CWU A;  4HM4 B;  3S27 A;  5IEN A;  2LQV A;  3NHX A;  1NO3 A;  2CIU A;  2IMJ A;  1O7G B;  3F9S A;  4WYK A;  1DVD A;  4K1V A;  4R4K A;  5DRE A;  2F5M A;  5CXO A;  1T2I A;  3K5T A;  1VQ8 3;  1MWR A;  1YJW 3;  4PEJ A;  3QK9 A;  4RNY A;  1IDP A;  1E3V A;  4FMB A;  3OWU A;  5D83 A;  4NRE A;  1JKG B; 
#chains in the Genus database with same CATH homology
 1UI7 A;  2CG1 A;  2CFD A;  4HBR A;  3CC4 3;  1O7P B;  3EQQ B;  2A15 A;  1M1X B;  3RDE A;  2CW9 A;  1AR0 A;  2OTJ 3;  2CHC A;  4N6N B;  1S72 3;  3VGN A;  1JN5 B;  1V74 A;  2C11 A;  2UX0 A;  2WOH A;  4XB5 A;  1OF5 B;  4KZ1 A;  3WOD G;  5CK6 A;  3X3Y A;  4N6V 0;  2SBL A;  4EXR A;  2O3O A;  1RN7 A;  2WGO A;  4STD A;  4K1U A;  5IEO A;  4CDL A;  1VQL 3;  2K54 A;  3I55 3;  3NXJ A;  3CD6 3;  3FG1 A;  1OGX A;  3PGB A;  4HJL B;  4LSO A;  3DM8 A;  4OUQ A;  1S5A A;  5IER A;  4ORL A;  2FNQ A;  4EYC A;  1GY5 A;  1OHO A;  2OWP A;  3AMO B;  3V98 A;  3GZX B;  2YFJ B;  3N9H A;  1MOL A;  3BNC A;  3CU3 A;  5JPP A;  2B24 B;  1J2B A;  2GXF A;  3B7C A;  1F8N A;  4H61 A;  2BHM A;  1TIJ A;  3I0Y A;  4X2O A;  1JB2 A;  3KII A;  2JDI H;  1YJ9 3;  4FCM A;  2CC3 A;  3JUQ A;  3MG3 A;  4HKV B;  5AIF A;  1FA3 A;  4N6M A;  2D42 A;  3L0R A;  1D6Y A;  1FGQ A;  1LOX A;  1GD4 A;  1UUV B;  3OXA A;  1FGR A;  2Y73 A;  4BTY A;  3WOE B;  2RGQ A;  1EKM A;  2XSH B;  4Q53 A;  2QA4 3;  1VQ5 3;  3PS8 A;  1GS3 A;  1AV4 A;  2RFR A;  4HM5 B;  3DUK A;  4NHF A;  4R80 A;  1IT7 A;  2W2C A;  2OOV C;  3G71 3;  2GBW B;  3LOY A;  1W6G A;  3HK4 A;  3LTA A;  1N9J A;  2BT3 A;  3OWS A;  1DVC A;  4K90 B;  5CF1 A;  5IW9 A;  5EVH A;  4AEQ A;  3MG1 A;  1OUN A;  5I97 A;  5AI1 A;  3DZL A;  1ZX2 A;  5BVB A;  4EBG A;  3PXM A;  1HU9 A;  2E2V A;  1T5Y A;  1BUQ A;  1RRL A;  4J8T A;  1OHP A;  1W02 A;  4BTW A;  4IT7 A;  1IVU A;  4O3V A;  2CFG A;  3NM2 A;  3FG4 A;  4WFO A;  5AYS C;  3EJV A;  3H3H A;  3A76 A;  1KWI A;  4U13 A;  5ELU A;  5AYR B;  1AVK A;  2XRX B;  1C7H A;  3WA3 A;  3EB8 A;  4JRF A;  1O7W B;  1D6U A;  1O7N B;  2YFI B;  3FLJ A;  2FXT A;  5AEU B;  1ZO2 A;  4FCZ A;  3DGO A;  5JPU A;  4OVM A;  1W6Y A;  2HML B;  3CNM A;  3NX0 A;  2BNG A;  2HMK B;  3NV0 B;  3QRD A;  3G6E 3;  1IQ8 A;  1WQL B;  4MMX B;  3LTD A;  1FGM A;  4GL6 A;  1VQ7 3;  1R4C A;  1JB5 A;  1E97 A;  2INX A;  3F14 A;  4LEH A;  4XDV A;  3PCR A;  2R4I A;  3U1W A;  3BLZ A;  2Z7A A;  3FKA A;  4K61 A;  2W03 A;  2IA7 A;  4EC6 A;  1VQP 3;  1GY7 A;  4G1M B;  4HM7 B;  1A90 A;  3LML A;  3CC2 3;  3CCU 3;  1US1 A;  2B1X B;  1Q86 4;  2F98 A;  3CCE 3;  3B8L A;  2BMR B;  1IVW A;  3LZA A;  3KSP A;  1Q7Y 4;  8CHO A;  3KKG A;  3LXU X;  2OQE C;  3CNX A;  1JKG A;  5D81 A;  4HVN A;  2E2T A;  2V1L A;  1WMN A;  2OCT A;  1QAL A;  4HM2 B;  1JV2 B;  2PNC A;  3N54 B;  1EA2 A;  1SPU A;  1EG9 B;  1STF I;  1VZZ A;  4LGQ A;  3LT9 A;  4HYZ A;  3MYT A;  1OHS A;  2W9Q A;  1JN5 A;  2CWT A;  3EC9 A;  1Q82 4;  2MF7 A;  3T0U A;  1OF5 A;  2CFW A;  1A2K A;  3GZB A;  5D82 A;  1WTH A;  4HM0 B;  3WOF B;  1TFO A;  3K9M C;  3LH4 A;  4RBN A;  1QVF 2;  4HM8 B;  1LVN A;  2BMO B;  2RCD A;  3D3L A;  3FF0 A;  3NBJ A;  3OV4 A;  4RNZ A;  1IU7 A;  3STD A;  4ZM8 A;  3CMA 3;  4MMY B;  5EEO A;  1UW1 A;  3NBB A;  1W2B 2;  3S28 A;  3DY5 A;  1W4N A;  1W5Z A;  1RJO A;  1M1K 4;  1YJN 3;  4XM4 A;  2Z76 A;  3Q1C A;  1AVL A;  3AMO A;  3SED A;  1K41 A;  5BXQ A;  3HII A;  3V92 A;  3IMA B;  2OTL 3;  2O9U X;  2L4V A;  4FCJ A;  1ULJ B;  1QJG A;  1K73 4;  1YI2 3;  3LTB A;  4MEI A;  1Q81 4;  1VQO 3;  3VF1 A;  5STD A;  4WP5 A;  4EV5 A;  2GBX B;  3BB9 A;  1W6C A;  3ER7 A;  3X3Z A;  4HZB B;  1CYV A;  4BTX A;  3CCL 3;  1KD1 4;  5FGO A;  1WMP A;  3MKI A;  4KFD A;  3JUN A;  1HKX A;  1W2Z A;  2OOV A;  1ASK A;  3CXC 2;  3UL6 A;  1K28 A;  1QAF A;  5DRV A;  3T8U A;  4MMZ B;  6STD A;  1NWW A;  4RZM A;  1ISK A;  1DMQ A;  3FSD A;  2ML6 A;  1DMM A;  1TUH A;  3EE1 A;  4FR9 A;  3GZY B;  3WA2 X;  4IPB A;  3SLU A;  5TGN A;  2IUJ A;  2BO9 B;  3BNE A;  1YHQ 3;  1FGT A;  3HZP A;  5CF2 A;  4MJD A;  3UNL A;  2MC8 A;  3G0K A;  3CCV 3;  3F40 A;  4OK0 A;  1Q40 B;  1IVV A;  1U5O A;  4IIA A;  2XFT A;  2LYX A;  7STD A;  3DXO A;  3ALA A;  1WNH A;  4L7K A;  2Z6B A;  2STD A;  4XBX A;  3CCM 3;  1JNQ A;  1KSI A;  2GEX A;  2W0Q A;  3MWZ A;  3K0Z A;  1NJI 4;  4N6O B;  3KSE D;  2XGL A;  2ZDJ A;  1NB5 I;  2XF3 A;  5ELJ A;  3CC7 3;  1JJ2 2;  3S67 A;  2D1W A;  3M8C A;  3WMD A;  5AEW B;  1IK3 A;  4J9A A;  3CCJ 3;  1NDO B;  4N3V A;  3F8X A;  5IEP A;  2M7O A;  5HGR A;  2HMO B;  5AII A;  1W00 A;  5IG4 A;  1STD A;  2W56 B;  5EQL A;  3GZR A;  1CEW I;  4KFF A;  1KQS 2;  3MSO A;  3RGA A;  3CME 3;  3NV0 A;  4XBY A;  5AIG A;  4H3U A;  1NB3 I;  1VQ9 3;  1MNL A;  3FCS B;  1IV7 A;  1U8C B;  1ULI B;  3HIG A;  2QIY A;  3KZT A;  2CWV A;  3ECF A;  3DGM A;  1VQ6 3;  5AIH A;  1Y4K A;  5KP1 A;  2CKF B;  2ML5 A;  1YVB I;  3MPH A;  1QMA A;  1OGZ A;  1GD3 A;  1OH0 A;  2W9P A;  1VQK 3;  3OX9 A;  1G96 A;  1E3R A;  3X41 A;  5IF6 A;  1UUW B;  3J7Y d;  3CCQ 3;  3S5C A;  3T8N A;  3BNB A;  3V99 A;  2E2U A;  3EBT A;  4FMA A;  1PFP A;  1SQW A;  4QWT A;  3EN8 A;  3NUV A;  3X42 A;  4EV2 A;  4WYK B;  5A0O B;  3FGY A;  2ZL8 A;  3SX1 A;  2XGN A;  1DMN A;  1M90 4;  3LT8 A;  3CCR 3;  3UL5 A;  3FG3 A;  1Q42 A;  3WDG B;  2GU3 A;  1VQM 3;  3JUP A;  1W7C A;  2QGU A;  2RSX A;  2W6J H;  3KE7 A;  3X3X A;  2HMJ B;  1VQ4 3;  1N9E A;  3F8H A;  3KFQ C;  2CFL A;  3FZW A;  3S29 A;  2P0X A;  4R9K A;  4O02 B;  4CCV A;  3DMC A;  2F99 A;  5IG3 A;  1CYU A;  3FF2 A;  3DGL A;  3EBY A;  2P38 A;  3HX8 A;  3EF8 A;  3B4P A;  2HMN B;  3ROB A;  1OCV A;  4HM6 B;  3K7C A;  1JRQ A;  1ROA A;  3K63 A;  4XDW A;  2XEP A;  4AKZ A;  3SXX A;  1LNH A;  1LXE A;  3EHC A;  3JUO A;  2CG0 A;  2PZV A;  2KXG A;  3F7X A;  3G4S 3;  3JUM A;  5LC7 A;  3GRD A;  1FGO A;  2P0M A;  3EN1 B;  3GAX A;  1SJW A;  2IUK A;  5JBS A;  3MG2 A;  1K9M 4;  1FUW A;  3OW2 2;  3PZW A;  4XBT A;  5IG0 A;  2HMM B;  2Y74 A;  3X40 A;  4WWU C;  2W04 A;  3Q2P A;  1IQY A;  1JB4 A;  1M9G A;  3LYG A;  2C10 A;  1O7H B;  1N5H A;  3NBR A;  2YFL B;  4FMC A;  3O8Y A;  1IV9 A;  1Z1S A;  3Q90 A;  4L8P A;  3RGR A;  5KP4 A;  1VQN 3;  3PYJ A;  4FMD A;  5KP3 A;  1OAC A;  4R1K A;  5IG5 A;  1ROV A;  4KVH A;  3CCS 3;  4O8S A;  4O2H A;  3CPW 2;  3NQY A;  2GEY A;  4N6L A;  3NQZ A;  2I9W A;  1NU3 A;  3LTC A;  1IT8 A;  4AKY A;  3MHE A;  2BMQ B;  5G2G A;  2Q07 A;  2XR8 B;  1Q40 A;  1PU4 A;  3F7S A;  3D9R A;  3GWR A;  1QAK A;  4X2H A;  4GB5 A;  2CFK A;  4JF8 A;  4N6U A;  3G16 A;  3EX9 A;  1EQK A;  1TP6 A;  1IQX A;  3CPO A;  1KC8 4;  2WOF A;  1TU5 A;  2XSO B;  1DYU A;  4L8O A;  3SVA A;  4N6T A;  3FH1 A;  1YGE A;  2JQ5 A;  3HI7 A;  2P05 A;  1WMO A;  3G8Z A;  4WHA A;  1SII A;  3NM7 A;  2GU1 A;  1CQS A;  4LZI A;  5CLK A;  3H51 A;  2CK3 H;  3OWY A;  1L5G B;  3UJM A;  1GY6 A;  1W01 A;  3I56 3;  2W56 A;  4I4K A;  2XH9 A;  3TDG A;  1TFK A;  3UB1 A;  2FGT A;  4LMI A;  3SOY A;  3JVC A;  3BND A;  1K8A 4;  4TX4 A;  1IVX A;  1N8Q A;  2WGQ A;  3U97 A;  3VSY A;  2CH9 A;  2Z77 A;  3PCS A;  1QVG 2;  1N8R 4;  1YIT 3;  2QEX 3;  3IJE B;  2F86 B;  4KFE A;  2KRT A;  1D6Z A;  4HM1 B;  1SIH A;  1RKY A;  3E99 A;  4HM3 B;  2WO0 A;  1A67 A;  3KN4 A;  2YX9 A;  2OQE A;  1OPY A;  4R9L A;  3N8B A;  2XFS A;  3DGN A;  2P09 A;  1GYB A;  1N5P A;  2K0M A;  5FW5 A;  3B4O A;  1O7M B;  1RRH A;  1A2V A;  5LC6 A;  3SOA A;  3IPT A;  1YIJ 3;  4HZ9 B;  2KCD A;  1UI8 A;  2CWU A;  4HM4 B;  3S27 A;  5IEN A;  2LQV A;  3NHX A;  1NO3 A;  2CIU A;  2IMJ A;  1O7G B;  3F9S A;  4WYK A;  1DVD A;  4K1V A;  4R4K A;  5DRE A;  5CXO A;  3K5T A;  1VQ8 3;  1YJW 3;  4PEJ A;  3QK9 A;  4RNY A;  1IDP A;  1E3V A;  4FMB A;  3OWU A;  5D83 A;  4NRE A;  1JKG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...